3FCSA

Structure of complete ectodomain of integrin aiibb3
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
Knots found
sequence length
959
structure length
913
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAASWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin, alpha 2b
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 199
structure length 913
sequence length 959
chains with identical sequence C
other databases KnotProt 2.0: Artifct S +31
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3fcsA02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3fcsA03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3fcsA04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcsA01
1M1XB 1U8CA 5E6UA 5E6SB 4Z7QB 2VDOA 4MMZA 3K72A 2VDQB 5FFOA 4WJKB 3ZDYA 4MMXA 3T3MB 3K6SB 3ZE0B 2VC2B 4Z7NA 4WK2A 2VDKB 4Z7OA 3VI3B 3IJEA 2VDMB 4WK0B 3ZDXB 4UM9A 2VDPB 4UM9D 2VDLB 5FFGA 3V4PB 3FCUA 2VDRB 3ZE2B 4MMYB 3ZDZB 5ES4B 3V4VA 1TYEB 1L5GB 2VDNA 5HDBA 3FCSA 1JV2A 5E6SA 3VI4B 3NIFA 2VDQA 4WJKA 3T3MA 3K6SA 3ZE0A 4IRZA 2VC2A 3ZE1B 2VDKA 3NIGB 1JV2B 4WK0A 4WK4A 2VDPA 2P26A 2VDLA 3V4PA 4UM8B 4Z7OB 4NENB 3IJEB 4G1MB 2VDRA 3ZE2A 5E6RB 1TYEA 4G1EB 1L5GA 3K71A 1M1XA 4O02B 3T3PB 4Z7QA 3NIDB 4NEHB 1U8CB 5E6UB 3VI4A 2VDOB 4MMZB 3K72B 3VI3A 2VDMA 3ZDYB 4MMXB 3ZDXA 4Z7NB 4WK2B 3ZE1A 3NIFB 4JX0A 3NIGA 4MMYA 3ZDZA 4UM9B 3FCUB 4UM8A 4NENA 4G1MA 4WK4B 5E6RA 3V4VB 4G1EA 4O02A 3T3PA 2VDNB 5HDBB 3NIDA 3FCSB 3K71B
chains in the Genus database with same CATH superfamily
1VPOH 3N9GL 3CX5J 1E9PB 2IGTA 3O4LD 2BVYA 1OWRM 4Q2ZA 4TNWF 4NC0B 2ESVA 3DMMD 1AO7D 1A9EA 2P3YA 5LDSA 1U8HB 4IRSC 1JPGA 2NR6C 3BFWA 1WBZB 2J20A 5E9DA 2KKQA 3DYPA 3VFUA 1VHPA 5AALA 1IGJA 1KBBA 2FIRT 3AAZB 3OB0K 1C5CH 3P9LB 4M1DH 1AH1A 1HXKA 5D7LE 1QRNB 3D4CA 3CSYA 1JHLH 1QRKA 2DD8H 2DOCA 1X5YA 2I24N 2LFGA 3BN9C 5SWSD 4H2AA 1Z9PA 4MMYB 4MWFA 4S1QL 5E8OB 4JHWH 4CGUB 4Y4FC 4DSYA 5BW7C 3O9WA 2FJUB 2M8XA 2I9LA 3RUGA 3J8F7 4O2CB 4YS4A 4X0NA 4NNXB 1TG8A 3ZYZA 4HK3J 3V0HA 2VDMH 3BVXA 3SY0A 3QCVL 2E59A 1E7UA 4GAFB 4LBAA 1N7MH 3O4LE 4PGZA 3ZBMA 3FQXB 3RGVB 3MQIA 5MEOB 5L4FA 3TGXA 1D6VH 1CI5A 5KTEH 1VKXB 4HJEA 1D5IH 2EIKB 4ABWA 1WFJA 2JLLA 3FYIB 3GD1I 3QJUB 1RJZA 4J4PC 5DMGD 1I7ZA 4MD5B 5FXYA 3C6LC 3E1ZA 4FG2A 3B2DC 1DEEA 2UZXA 1NCBL 5J13C 4UT6L 1A3LL 3SFZA 1H3PL 4N9GA 2NNRA 5I1HL 3X14A 3CN0A 1DEDA 3GMRA 5CKGA 1WD9A 1K6QH 4BFIB 2L7JA 4HK0A 2R83A 4JVPA 3RDJA 1XIWD 3HE6C 1RUPL 4KK9D 2DQTH 3DPBA 4WO4A 1QVOA 4AH2A 5LNGA 4P05A 1IC5L 1JK8A 5EALA 2XY2A 3VFOA 3K4ZA 1BQLH 3VXPB 4NBZB 1WA1X 3TIEA 3TA3D 1E4WL 4Z7VE 3MLXL 4CU8A 3PQYD 5ERWB 4F57L 2DI9A 2E27H 2EC8A 1CWVA 3BDXA 1CR9L 4AJWA 1GCFA 3ARWA 3HTLX 4E41D 1NM4A 2VITB 5KJ4A 3MLTB 3AMKA 3UTQA 1SGKA 5DO2C 4K71B 2WUBH 1HS6A 1TO4A 5F9WC 1NCWH 2WCSA 4JCMA 2ZG1A 2W92A 4KFMA 2WLNA 3OR6B 1MI5E 2P44B 1E9OA 1GTFA 4U3SA 3RHWF 3AH8B 3QQ9C 4OGQC 1FIGL 5CS7A 4JGUA 1Z1WA 4PJ8A 3BKMH 5JPNA 2IJ0C 1OCCB 4NNYA 3K7UA 4XVSH 4GKZA 3V0WH 4NQDA 1SEQH 1OM9A 2XWRA 1QI3A 1UT9A 4L8SC 4F1SA 5AB0A 3PQYE 3LN5B 1TZIA 3T4YA 4CMMA 3HAEG 4YL4A 2I0RA 3S98A 4JHVA 3QS3A 4J1UA 4XE5B 4LHJB 3KYNA 4XVJL 1WFMA 4ALAH 4I5BB 3MZGB 4CSSA 4RGNE 1MLBA 1N2RB 3MUY1 5AVRB 3LSOA 3L3OB 3FRPB 2B1HH 4U49A 5A2BA 1Y7VA 3ILPA 1YEHH 4PTUA 4LCYA 4YLBA 3V6OA 4HSCX 4Y0GA 3GSWB 4HT1H 2NUTB 4AYSA 3LJ3A 3NSYA 4B5ZA 5L9DH 5CP3H 1LO3H 1NWOA 2EIZA 3LN4B 3N91A 3NFNA 4U1HB 1S9XA 3U46A 3AFCA 4LSQL 1UGNA 3BAWA 4HDJA 4FHKA 4UOZA 4XYHA 5JO5B 3ULAB 1FZOA 3MNMA 1BLNB 2I0TA 4LOFA 1YYLL 4IS6B 2E6QA 3SE4A 5JZ7C 2F53E 4EMZA 3EXLA 3BZFA 2DYPB 1O5DT 2I26N 4HA1A 3BDYH 4C54A 3ILDA 4XRCA 4HWEH 3VH0A 5M94B 2P26A 5TD4A 3BPNC 1USZA 4NJAL 2DQDL 3GLEA 4NO3A 2XIIA 2AP2A 1UZ8A 4K8RL 3WUWB 3LEXB 3QDJA 3HE7B 4GW4B 4ABVA 3OSVA 4AQ1C 2NNAA 3QJOA 3FFCE 1M1XA 2CR3A 4G8EB 4KKBD 4UDUB 3BG0A 3GSXA 3K8KA 1AJ7H 4U33A 4HLZG 3I7KA 3NCJH 2R2BA 4L1QD 4W1TA 4H0LC 1I8LC 3FU5A 3ZVVA 3JTSA 4KKCD 5DA4A 4IBQA 2BW5A 3ECWA 3L7EB 1IQDB 2ZKYA 2NY0D 3C5ZC 4AW7A 4M3HA 2PKDA 3MRHA 4DAGH 2DY2A 5DO8A 4PJDF 4WK2B 2BOBA 1FVCA 4LKXB 5DQ9B 5INCA 3RL2A 4NHUA 2ZSWA 4MAZA 1T6BX 4JM4H 1I1AB 3WE6B 5GMKn 3OAZH 2YXFA 3D52A 4QYAA 3EGDB 1FZMA 4PP2B 3P4NA 3MHZA 4WFGE 3UROR 1IC7L 5IQ7L 1LHZA 3U4EA 1NBYA 4MQXD 2IWKA 2JJTC 5FYJH 3FF8A 4I48B 5CLXA 4HJ0D 2YWZA 2VN6A 5C86A 4XNAA 2KL6A 4KQ3H 4U6YA 1OPGH 3EYQC 3TEUA 3WI9A 4G8GB 4HPYL 4KK8D 3NIDF 4ABUA 5H4ZA 2JI2A 4J3OD 2APSA 1GGUA 3FUDA 1IT9L 2Q9OA 3E6FB 3H7BA 2Z3FA 4OFYA 1MCOH 4LCVA 3KLAA 4PJGE 4TTDD 3X1NA 4GQ2P 1VFOA 4WK0B 2XG5B 1CGWA 1M4KA 3G6DH 5FS5A 2K4AA 3JVFC 2KMWA 3SDAA 2NY2D 2OMWB 1O7SA 4YDZA 1TCRA 3ABKB 4D0BB 3SCMA 3FPYA 3INUH 4LDOB 1CN4A 2CM6A 3KYMB 2PCPA 4JM2B 2F8VA 1IGYA 1FVEB 4LCCA 4UQAA 1H2WA 2VN3A 2OL3L 4RRPG 2OZ4H 2D7QA 4OFQA 2ADGA 4QHNB 3VXSD 4J0WA 1QSFD 2ED9A 2JWYA 1AQKL 1JL8A 4ADJA 4AGLA 3TURA 1BM3L 5B3JF 2VLRE 3RNKB 5LG6A 5ANHA 2WTOA 5DFVD 2WZ5A 1UJ3B 4D0DA 4PRNB 2YD7A 4UINH 4V33A 1B90A 5K9OA 3ULVF 3FXIC 3RKDD 4PLKD 4XMPL 1NFDA 5FW7A 1XF5B 3QFJA 2XQBH 4IEFA 3SOBH 2WINA 5D1XD 5DJ0A 3S8WA 4AK1A 1S4IA 3CMOH 4NM4L 1RURL 4TPRL 1IAOA 2Y7QB 4DVRL 1SEBB 3LXAA 1KGIA 2DM2A 3MNWA 1N6DA 4Z3IA 2X4NB 5E9NA 4UBDC 1F90L 2CO4A 3G6JE 4FZ8L 3OAUH 1DJHA 1ZWIA 3CIQA 4M02A 1XH3A 1YY9C 4PRDB 4XOCA 1VGKA 1BGXH 2L7UA 5CN2A 1GG2B 3WD5L 1VACB 3MRIB 3LDBC 4YBQD 3WFDH 3FF7A 5CUSH 2KQNA 2WVVA 3GS7A 1LP9A 2EICA 4Q2ZB 1CJYA 3KHOA 3LH9A 2XZCL 4PLJD 3RBSA 1OALA 2CM5A 2AI0L 3VFUB 3HI1A 4KKQA 1EEUA 1GZQB 4X9IA 1IGJB 1L7TH 3FK3A 2O61A 5L4IA 1CICD 3Q05A 3CSYB 4LAJH 4RFNB 4BP8A 5PAZA 4H13C 4MWFB 3VE0A 3QHZH 1Z5LA 4H8VA 4Y5YC 3O9WB 3RUGB 2I9LB 1DUYA 1HH6B 3DOSA 3HUJF 1B9YA 4BZ1A 5I9QC 2GC4C 3MUNA 1MCEA 1T5XA 5L88L 3K4AA 4WI9A 2LE9A 4JPSA 5CJ5A 1RZQA 1D7DA 3SY0B 3EYVA 3L6FA 4M9OA 1BJ1H 5AKTA 2MFNA 4GMTL 3QUYC 4KHTH 4O2FA 4O1QD 3SDCC 4Z3GA 5K9KA 1CLZH 1SJHA 1T1YA 4WNQA 1RJZB 3GRGA 1I7ZB 2FJSA 3M7FB 1XEDA 3IDNA 3D4ZA 3BG1A 1JI2A 5E1IA 1RUMH 4I77L 1DEEB 1YUKB 3V4LA 2UZXB 2VWEC 1T3FA 3NA9H 1FFPB 3NIFE 3GMRB 3SGDH 3D51A 1A02N 2F5BL 5DD5H 1MZYA 4M3KB 4HK0B 1DP0A 1QRND 4LPXA 2R4RL 3CVHA 3QQ4B 3GJEA 4HKXA 5KS9E 1WAAF 3EOYG 1B4RA 4DFIA 4P9HL 4ZMNA 5TJWK 3BX7C 5FKPA 3DPBB 1QVOB 4HJJH 4AH2B 2BCKA 5KUKA 4CVUA 1DQQA 4PJ7E 5TPWH 1JK8B 3SIKA 2E46A 1TQCC 1KMGA 3VFOB 1OZTG 3C8DA 3TIEB 5D2LE 3U1QA 3DIDA 4QOKD 3GT6A 2CLVA 3MRMA 2Q10A 4XVTH 4L23A 3K6SA 1NCCL 3RGVD 1I9RL 2Y6SD 8FABB 1IEBA 1AGCA 3KVDD 3CFCH 3AU0A 5IB3A 4C83A 1NCGA 3GRWL 4Q97A 4TM9A 3TWCL 1UD6A 3I6GB 4MS8C 5C0RL 3OAZK 5IT2L 1DSFL 2DLTA 2WB1A 3WO3B 3BUPA 1OAKL 4I0KA 4KJPD 5CZVL 4KFMB 1PSKL 1E4XL 4MMZC 3QIUD 4HG4J 1E9OB 1KCLA 1QRNE 2F58H 3MLSL 2ROYA 4NWUL 4U3SB 2D3JA 1B2WH 2X3BA 2DKSA 4U6VH 2LAAA 5D72H 1XZ0A 3DI2B 3IBOA 5C92A 1FORL 4JZJA 1HI6A 1I85C 2PWHA 4PVNA 4JFXA 1C8QA 4PJ8B 5JPNB 2PO6D 3MV01 5ISZA 4HIIA 1R19A 4GKZB 3W57A 1BHGA 3PV6B 4YL9A 3WYRA 2GAZA 3WMQA 2K8MA 3JPXA 2HTLC 1FG2B 4J1UB 1A6VH 3KYNB 4PH8A 2PW2A 4H8PA 2VT0A 2APFA 4R2GC 2H2SC 3KPQA 4ANKA 4U1LA 1KCSH 1MLBB 5CILH 3GXUB 1U41A 2IEPA 3LEVL 3AS3A 2WANA 1B4LA 5K69A 4BQCA 3FN3A 4KAQH 1UJTA 1FNSH 3ILPB 4IKKA 4RMRA 3U7WH 2YFNA 4PTUB 2WTPA 4LCYB 5CD5D 3TPUA 1GP2B 1INEL 2V5YA 1BVNP 4OD2A 2EIZB 2IC2A 1S9XB 1QTYT 4OGYL 2E7CA 1IVLA 3NABH 2VL5A 4IOFC 2BIQA 4LVHC 1CGXA 1TTRA 4XWGH 2HVJA 3O3EA 4UTAA 4XB8A 5FFOA 3VYNA 3PXSD 1FZOB 2FT8A 3IXAA 1PU0A 4KK5C 2O93L 2EDWA 3BZFB 1QLEH 5HYFA 5AZEL 4B3EA 4XRCB 2PN5A 5DJAA 3PP4H 5E0QA 4P3WA 3RWEA 2YC1A 3ZQ9A 1TIUA 4ODSL 1IX2A 1CGVA 1UZ8B 3D39E 4A09A 4UNTA 1MREH 3DTUB 3O0RL 3QDJB 4NUMA 4Z7WA 2NNAB 4ZUVB 1CDBA 4F8TA 3CE1A 1WUZA 2IDFA 4KFZC 5A3ID 1E8MA 2FZ3A 3L4YA 2EYSB 2OMTB 1TCMA 2D2OA 3MRQB 4LXFA 5JHDB 2R2BB 4RETB 2OM5A 2V37A 3ULUE 3L1EA 1Z32X 1KJVA 4QPEA 3JTSB 3WIFA 4PJ9A 3UTZA 4ADGA 5BUAA 4YWGH 4KZCA 3MRHB 4PCTA 5EMLB 3FUJA 3QA3A 1URIA 1FVCB 5INCB 3RL2B 4NHUB 4DKFL 2ZSWB 3R7RA 3F5WA 2NZ9C 1YYMH 4M1GH 2VDPA 3L4VA 2KYIA 4DNLA 4WCYH 4BCXA 5A7BA 1NEPA 4K5PA 2C7UB 2KC0A 5F7EH 2R2EA 3EUUA 4GW5B 5BZXA 5GISH 5BS0A 3U4EB 2F1BA 1HSAA 1NBYB 1G9MH 3CZUB 3OG6B 3I7NA 3RFGA 3CDCA 4M48H 4KRNA 1E7VA 2NZ1A 35C8L 4XMZA 5C0AA 1MIML 4BM7A 4A7GF 1DANU 2B1OA 5EA0L 4L0ZA 1HC1A 1XL6A 1Z9SA 4U6YB 3RWFA 4M6NL 2UWEA 1EO8H 4DH2A 3MC0A 1TFPA 3C60D 4X6CA 2B20A 4YZWA 1HHKA 1UM6L 2WQXA 2YGQA 1UB5B 4J3XA 1WT5C 1A66A 3OWRA 3KLAB 4ZAKB 4ZUTA 4FXKC 3CGTA 4ELKA 5K9JL 3CMGA 3HPJA 4K3EH 4N25A 2C9RA 2ZSVA 2NW3A 2D4DA 4GT7A 4OLVH 2H3XC 2OBGA 1TCRB 2DMBA 2PW1A 2X1PA 4G1MA 4KK6D 4PRAA 5I8EA 1MCSA 4WI4A 4RWYH 2VZOA 2QVKA 4KOBA 1IGYB 3JVGA 4NLAA 4LCCB 1BAFL 1I1AD 5AG8A 1AE6L 3NCXA 4J7RA 2BCMA 5C0JB 1MRCH 4IDJH 4FE9A 2ITFA 2EIEA 4NZRL 1T03H 1SHYB 4BELD 2FX8L 5IJVA 1FFRA 4LRIA 2CE9A 1X7QA 4G6JL 3UTPE 3MRKA 5DVMA 1MNNA 3F8UB 1TQWA 3JXAA 3GIVA 2P8MB 4D0DB 1J87A 3HN8A 3I2NA 3GHBL 1U8KB 4JK0D 2VDNH 5ID0A 3QFJB 5EUOF 1Z6JT 1OL0A 4G8GD 4IEFB 5DJ0B 4LPCA 3D4GA 5C9JA 1IAOB 1IBYA 3CFDA 2WLJA 4IBWA 5I16B 3MNWB 2LLLA 5JW4R 2ZYIA 5EO9A 6CGTA 1ZHKA 1B2YA 2CK2A 2HLFD 3J27A 4AW4A 5BO1H 4KQ0A 2R51A 3F3FA 3AQXA 2Y06L 3QQDB 4XMKL 1VGKB 2YARA 2V2TA 4Z8LA 5FYKE 4RIRA 4GQQA 4RISH 3RGBA 1L0XA 1F8TL 4JFDD 4PRIE 1ZE3H 2A9BA 3SGJC 4N14A 1TF4A 1D2PA 1W80A 2WVVB 1UWXK 5EAMA 3B2XA 1QX1A 1BWWA 3LMJL 3ARFA 1E9QA 5MHSE 4QRPA 3WMSA 2WKLA 2AGXA 3MXVH 4B9JA 3W9EA 1ML0A 4TVSa 3HI1B 2PR4L 5I30L 2O61B 4GG8A 3ZXAC 1GAFH 2LFEA 4LGNA 1IKNA 2FEJA 4O02H 1X5MA 5T3XD 1VERA 1ETJA 1UZ6F 5AVUB 1BREA 2YK1L 4P3CL 4PV9A 1S9YB 3TV3H 3VE0B 5EZLA 2ZUQB 1DUYB 1G1CA 3DOSB 5DK2A 5EOCJ 4L4VE 3UZQA 3J81g 5E99L 1LE9A 2P9NC 5H17A 1FFQA 4DKAA 1UEMA 1CE1H 1RLWA 4WWNA 4EXKA 4KJYA 1RIUL 3QEGH 5CZRA 4MCMA 1P4BL 3EYVB 3L6FB 3TN0B 4AL8H 1TJHH 2PF6A 1J9RA 4ODWA 4Y4FA 2EZ0C 5IHZA 3VFVA 1N6UA 3CD4A 4IRJC 2W59A 5K9KB 5E4OA 3UJTL 5HGGS 1SJHB 1T1YB 1TKWA 3LQAH 4WNQB 5E23A 3B5TA 1V3MA 2FSEB 4QGTA 3IDNB 3GMNA 3EADA 3SD5A 5LBVA 1FGVH 2ESVD 3OZLA 2E8YA 4WEUD 1T3FB 4N28A 4BFGA 2VQ1A 2AVFA 2OQJA 4C56A 5E9DD 3B9EA 3S3DB 5DHXB 4AGQA 2HN7A 3EJPA 5AZ2H 3BH4A 3FRUA 1V8HA 3IN0A 3SYQA 4HKXB 2QVIA 1YECL 3CVHB 3GJEB 2Q8AH 2J73A 3HKZA 4Y19D 1NFIA 2YA1A 2IFFH 1QATA 4KTDH 1TLMA 2BCKB 3IUQA 3O9WD 1DQQB 3SDXF 3MV11 4F33B 4Y16D 2BH0A 4XI5C 1H2XA 2CJUH 2CLVB 1VFBA 3GKZA 4HQQH 4B9YA 1HKLH 3IPEA 3K6SB 4BFJA 4DP0X 2FWUA 3JWOC 3RIFK 1IEBB 4U1SA 1AGCB 3ZGIA 4J27A 5IB3B 5DLML 2N3JA 2CNXA 2YIHA 5ACZA 2C7FA 4PWKA 4Y1AE 2EP6A 3RVVC 4PJBF 2DDQL 5D1ZC 5GGQH 4PJ5A 4Y4HD 3EFOB 4WTZA 4IKNA 3TFKC 3KE0A 5ES4B 4TNEA 5E0FA 4M5YL 2GCYA 4UTBA 4J39A 2NDFA 2HLEB 1HI6B 2X3CA 4J81A 4FEMA 2DYRB 1U6AL 4HS8H 3HZKB 2NY1C 4UZGA 3ZE2E 5ISZB 5M5VA 4HIIB 3K27A 3CAFA 1CLYL 1LMIA 4WO4D 1NGZA 4MDRA 5MEPA 1TETH 2CDEA 3VQ2C 4LDCA 4JFEA 2TSBA 3DSFH 3ZQXA 3DVNB 5IJ7E 2PW2B 4LAQL 1B0WA 3KPQB 3Q8AA 4U1LB 3PHOA 1SOSA 4YXHH 1UQSA 3KS0H 5FO9A 3U0PB 1B4JL 5A2KH 3BW9A 1OAYH 1P5VA 4AUYA 3HR6A 3AVEA 1TUPA 2J57A 1IBDA 3TPUB 1HU8A 3RLMD 2ENQA 5CEYA 4NEHB 4EN3C 3LAFA 5DZOA 1N5YH 1J1PH 3TO4C 4AVHA 4X6FA 4F24A 4UQ2A 1ILUA 3RVWD 4WSGA 2VL5B 1RUKH 3K2KA 1TXKA 2G3ZA 4PJHF 2D7PA 4QRSA 4ETYA 2HVJB 4PJ8D 3E3QC 3IXAB 5LWYL 1AQDA 4NQDD 1F58L 1I9IL 5FW8A 4N86A 3IGFA 4FX5A 5DJAB 2WKGA 3D05A 3X12A 2JELL 2YC1B 4NRZA 1GXRA 1QWUA 2AJSH 3QZMA 1YZZA 4FMVA 2GJ6A 3WN5A 4A09B 1JGIA 1W91A 4OJDH 5CEZD 4LF3B 2JJSC 3PAYA 2FZ3B 2O5YL 1D5RA 3N43B 4JLRA 4CRPA 1L9RA 1LQSR 3KL3A 4LSPH 3UTTA 1QR1A 2C4XA 2Q3ZA 3WIFB 2V9UA 1OCOB 3UTZB 1H3GA 1GMEA 1FE8H 4TQIA 2BIHA 2B16A 2CO3A 2QSCL 3QA3B 3D8MA 4LIQE 1NSNH 3VI3B 1I8LA 1XR8B 1N18A 2XV3A 2VDPB 3BIKA 3F5WB 1ETZA 2XWDA 1AZVA 1U33A 5HGAA 1THCA 1IEAB 3GJFA 3ULEC 1WFUA 4KXBA 4P9MH 2A0LC 2R2EB 5BS0B 4A2EA 3L48A 3PVUB 1K5NA 1UUNA 4X2UA 2W65A 1HSAB 1BSIA 4KKAD 3W11C 2AEQL 4GAGL 4U31A 3X1BA 2FB4L 2HP4A 4YVUA 2G9AA 4MCZA 4UILL 1AR2A 3QDJD 1J5OH 1P7KA 5C0AB 1ZIAA 4AVJA 1MHPL 5D93C 4PVBA 1Z9SB 2C5DC 2EVHA 4G6ML 5EOCL 3HFML 1BCIA 3EYFA 1FAIH 2XCMC 4X6CB 3VB8A 1S78C 2XHNA 1N67A 4WTWA 1HHKB 4OIIH 5KVGH 3VG9B 4FZEL 4MJ5A 4WO0A 4ZUTB 3BE1H 5C2BH 2MH4A 4ELKB 5I8KH 5FM8A 2BHZA 3HPJB 2NW3B 4L1LA 4QO1A 4Z7OB 5IB5A 3MU3A 2PW1B 4G1MB 4PRAB 5T3XL 4IOIA 3H53A 5I8EB 3VO0A 3W2DH 4K2UL 2P5PA 2W0KA 4A0BA 2VXQL 1KGCE 3NCWA 3WFBL 3ILEA 2OULB 5E2WL 4ZFFA 4L8CA 5TGBA 2FD6L 4MXQC 4AMYA 4HIHA 2NTSP 1AMXA 5GPRA 1MF2L 4LCUA 3UBGA 5JOFA 5IJVB 3O2WL 1Q90A 1X7QB 5A43C 4ABQA 1QD0A 3IMSA 3ARGD 1ZLSL 1BQRA 2L0DA 5JHDE 3RVUD 3GIVB 2C9PA 4NZTH 4S1QH 2VN5A 2VR6A 2W1NA 5BQDA 5HI5D 4D0KA 5IQMA 5DZLA 3MBWA 5ID0B 1VFMA 1H6EA 2YJQA 5GRWA 1HHGA 4ZYKA 2Y25A 4NP9A 5A2LH 4N0YH 4DJMA 3QCVH 1REIA 3GINA 5C9JB 4KKRA 2VR8A 3CFDB 4P46C 4OFYD 4N2LA 1U3YA 1OP4A 4X83A 5ECJE 3BHBA 5EO9B 2NXYC 4ODVL 1F56A 1ZHKB 2DMGA 3GSUA 3OKLB 2R0WL 1NCDL 4NT6A 3RB7A 3SDAD 4ZMOA 3QEQA 3IPFA 3NPSB 2V2TB 4LL9A 3SCMD 4RIRB 4MAUL 2EVGA 3B9VA 5H8DA 3EO9L 1HIMH 3OXSA 1TITA 4HH9B 1NCBH 2YPVL 3I6LD 1A3LH 1ZPUA 4PQXA 1H3PH 4UT6H 4BZ2L 3T6QC 3ARFB 4NN7C 4AY0A 1E9QB 4KZEL 4HWBL 3DJ9A 1BD2A 4QRPB 3RE0A 2DQFA 2BP8A 5EFIA 4KDTC 1J8HA 4DPBX 1CZ8H 3CU1A 4Z7NA 1AYRA 1RUPH 2CO0C 1SHXA 3PUCA 5ITBL 4BV1A 4Z6AT 1XD0A 1RPUA 2W9DL 1FA4A 4PV9B 4RQQB 3QFJD 1U3ZA 5EZLB 4IRSB 4W6WB 3QUXC 2GI0A 4Y7MA 5DK2B 1JERA 1E4WH 4YSOA 3UZQB 4EI5A 1GOFA 1LE9B 2DRUA 1E40A 3VSVA 4JXMA 1BOYA 1NAKH 4F57H 5I1KL 4A66A 1CR9H 2NYZA 5KG9A 5AB2A 4NPYA 5GGVY 1SOQA 1W0YT 3RJOA 4A7VA 3D69B 1EJFA 2R0LL 1LK2A 1MVYA 3E7JA 4G3YH 2HXAA 1HL8A 4ODWB 4Y4FB 4U1GC 4HMEA 5IHZB 3VFVB 1ECZA 1TR7A 4FFZA 1TKWB 2GC4A 2F7IA 3HHSB 3MV9E 1ITCA 3GMNB 5I76A 3QAZC 2CDGB 2C9XA 3NMEA 1PZAA 3IRPX 1FIGH 4JG5A 3ETTA 4GXUN 2VQ1B 5HYJA 4C56B 2JH2A 3HUJA 4QNPE 3QFJE 2ALWA 5IQ9A 2HN7B 2L4OA 4TUKH 1J9CT 1UH3A 5IHLB 3C6LB 4NWTH 5LCVA 3UMTA 3AM8C 2V33A 2LT9A 4GLRH 5J13B 2MCPH 5J6GA 2AH1A 3O2DA 2X42A 5C0NC 1CLVA 5HHOA 5L7XL 2O6DA 1W0WA 2FVNA 4XVJH 3VCLA 1I1YA 4L37A 4L3HD 4PYGA 3CNKA 4J2QA 4YEEA 3NTCH 3WTTA 4PJIF 4Z7QF 3ZTJH 5SX4I 3HE6B 3RSEC 4KRLB 4MLIA 4E2OA 4U1SB 2YR3A 3A22A 2XWZA 4FCHA 1ODUA 3MRPB 4B5EA 5ACZB 3DIFA 3LS4L 5CXCA 1ZHBB 3HB3B 2A73A 2X10A 3IULA 4PJ5B 4CBZA 2A6IA 2BM3A 3T6XA 4DKTA 3T2QA 2NY6D 4LSQH 4TLSA 5E6RA 1JHKH 3T09A 2GCYB 3PS6A 4J3UA 2HJ4A 2K45A 2WBJC 3BI9X 3MKGA 3GM0A 5A2FA 4GJTB 1PIGA 1JK9A 5HGHA 2XT1B 3AITA 1YYLH 4X5XA 3VVWA 5L8JB 1O7DE 1QBML 4HGKC 5KVEL 4QXGL 3SPIA 3M46A 1XD1A 5CGYD 3SE6A 4MMZA 2J6EL 1KB3A 1LYQA 4NJAH 4Y4KA 4JT5C 1NGZB 5MEPB 3TOPA 3KMDA 2WLIA 2CDEB 2CK0H 3F58L 3J7HA 1DJYA 1I85A 4JFEB 1MFBL 4ZOCA 3EI4A 2UVFA 4RA0C 4KKLD 1RZGA 4Y5VA 3CPLA 1ZAGA 3ARRA 3PHOB 3STBA 4L8SB 2F74A 1UQSB 4EDWL 1G5GA 1K8IA 5BPPA 5C2VB 5FO9B 4PW4A 1P2CB 4WW1A 3T3ME 3BW9B 1P5VB 3SGKC 4HXBL 2NOYA 2B15A 4Y8DC 2AJ3A 5CEYB 4D2NA 2WVTA 2X4RA 1LWRA 4ZODA 3K5SA 2G2NA 5DD0H 3IKCA 2OP4H 2YGVA 1KB5B 1PD6A 4DUWA 3IAPA 5HDQL 4QRSB 1CUOA 4HBCL 1CL7I 3A21A 1E8ZA 4QLWA 1C9LA 1PLCA 4PG2C 3D25A 5ISZD 1P53A 1WISA 5E6IA 1QSEA 3FB8A 1AQDB 1JWSA 3WENA 2GKIA 8CGTA 3GHEL 4ERQA 2OIZA 4PPTA 5B1JC 1KV3A 4GIAA 5E6YA 4XN8A 3X12B 4B41A 4FQXC 4NRZB 2I5YL 2OYPA 1VZ2A 3LV3A 4WW2C 2C26A 2GJ6B 3QARA 4CKVX 3SKJH 2D3LA 1VLXA 3U0TA 4JJOA 4AIOA 2YKLH 3FMGL 4UQBA 2CBOA 3D85A 3MLVH 2AABL 2BS8A 4JZOA 3OMAB 3ZLQC 4LQ1A 3CX2A 4JLRB 4I18C 3BPNB 1EGJH 3HVNA 5I74C 4KDVA 2GBVA 2EDNA 3UTTB 4LE8A 4ENEC 2JKTM 5CZKA 5FR3A 2W0PA 3PF2A 5DVLA 4ENZA 1A4AA 4JN1H 1ONQA 3WNIA 4CJ0A 4YHNA 2RIKA 1P84J 2ZICA 1WIOA 3AREC 5GJSL 3FH7A 4FA8A 4MA7L 5ELIA 1X5ZA 3D12B 3B1TA 4FNSA 3KJ4C 5AWNL 5TFSL 5GGVL 3BIKB 3CUPA 3FNKA 3BSZA 1SMAA 3WE1A 5HGAB 2N7BA 4NJ9L 1WD8A 3C5ZB 3FFDB 1EXHA 4YGVA 1IFGA 5T3ZE 1LEGA 1MDAA 3D0VA 4AQ8C 1BM3H 1YNLL 1OSZA 3ECQA 2QADB 1K5NB 2W65B 1I3VA 3QIBC 5DD3H 3K1KC 2VOTA 4LDEB 4OZGA 4N8VG 3WIIL 5HI4C 1F11B 4MCZB 2GVYA 4J6RH 3WJMA 1LDPL 1PFCA 2WXKA 1BZOA 1JF1A 1P7KB 2Z6FA 5ETUA 4AM0Q 3GUTA 4A39A 5FEBA 5CFHA 5KSVA 3JZGA 1L0PA 2YQ2A 1P4UA 1TPXC 1F18A 4TSBL 3IKOA 1V10A 4DHLA 2XQYA 4MJ5B 2C3VB 1SXSA 3B7YA 1F90H 5KSAC 1TU2A 1S9WB 4FZ8H 4PJ9D 1JP5A 4TQEL 3MKKA 5KVDE 3MJ8A 5JA9A 3DYMA 3QHFH 1WCBB 5FO7A 5IBLC 3BZ4B 3WD5H 1CXEA 4QO1B 4HIJB 5IB5B 3VG0L 4IOIB 2Y5EA 3OM3B 2ZKXA 5IB4A 1J9QA 4NRYA 2H2PD 2IPTL 1WT5A 2YEQA 4S11A 3S34L 2XZCH 4UDTA 4OGXL 5JHAA 4FXKA 4H26A 3F7VB 2JK5B 3TASA 4HIHB 3WFZA 4A7GA 5BS0D 4LCUB 4HMDA 5JOFB 2VR7A 1T7ZA 5EORH 5E6SA 3CV5A 2Z7WA 4Y2NA 1BZDA 1W72L 3H3BC 3MUUA 4PIBA 3FUEA 5HBBA 3UBXG 2WWOA 3QH3B 4QCIA 5C0AD 4XBEL 1NINA 2AGJL 3EOBA 3ZTJG 1U21A 3MBWB 1WZ1L 5CHNB 1EHNA 3QXWA 1KJMA 1PMYA 1HHGB 1ZGLP 4ZYKB 3MMEA 1EFQA 5A16A 5BOPA 1IEHA 4AYFA 4W4OA 3OJVC 1IRAY 1M42A 3VI3E 3O6KL 3D3VE 3BHBB 3GF8A 5AL0A 3VRLE 3GSUB 1VYHC 4NT6B 3KVQA 2F7RA 2EILB 4TSAL 3RRMC 2IH3B 3T0EC 3L16A 3UKUC 1RZKC 3LB6D 2ADFH 1BG1A 2CGRL 4PV8A 1MSPA 3MLYL 4I77H 4B27A 1ZIBA 3BQUA 4LSVH 3OXSB 4UT9L 3RB5A 3RPIA 3F62A 4KV5F 2XU9A 3C75A 1CYWA 3KCWA 4EIZC 1XB6A 3Q3GA 1KZQA 3CPUA 5ICZA 1BD2B 2DQFB 3BSHA 1C12B 2BP8B 3MREA 1J8HB 2BOCA 2EC9T 2LTQC 4QWWD 4U6XB 1F0LA 1T1WA 5EUOA 4Z7NB 4PS4L 4DCQA 3FAWA 3LDBB 5DMIL 2R4RH 1TTGA 4AEEA 4AQEA 2P45B 4ISVA 5H35A 1U3HC 3UIYA 2YGPA 2P46B 3OG4B 4FERA 7TAAA 2FHFA 4IBUA 1E5TA 4LMQE 3IJ9A 3S3PA 1VDGA 3CIKB 1AGBB 3RY4A 3HG3A 3VQLA 4C58B 4X6BA 2LU5A 4Z7OE 2EO9A 5FO8B 4AXWB 4KH9A 4PRPA 3R8QA 5KG9B 4P57B 4QGYA 3FKUS 4NPYB 2ZUVA 5E56A 5JR1L 1GZPA 1WJ3A 4G9FA 3CX5K 4WDIA 2R7EA 1QFUL 3U9UA 4RGMC 1G4RA 3RFHA 4BCDA 2VDOA 3EI2A 1T7WA 5IT2H 1DSFH 1FGNH 5I9QB 3WXWL 2AEPL 5MEQA 5CZVH 2B08A 4W9HC 3UTSA 1E4XH 3DX6A 3MLSH 4NWUH 2UZYB 5I76B 2K9FB 4N2EA 3AACA 3NRPA 1J8RA 3W38A 1F45A 5F21B 1FORH 3QUYB 3B2UC 4IRJA 4U3HA 4CMHC 5HYJB 3HUJB 2GB2A 1BFSA 5IQ9B 3ZZSA 3PAZA 1GPOL 3T5WA 3N40P 4J77A 3OKMA 1CFQA 5FAAA 1NR0A 2H8PA 1ZK5A 4J0XA 4N3TA 3NJMA 4RCAA 1HYSC 4A7JA 3LPFA 5HHOB 3DUSB 1RZJC 3P30L 5BUPA 4NB7A 3MCYA 4L37B 5EUKB 2YXVA 2XUWA 1NDMA 5DJ8A 4AIZA 2V17L 2X2YA 4W70A 1NIAA 3LKSA 5KBPA 1HSBA 5T1JA 3U0WL 2ZOKA 4A11A 1UOLA 3CSFA 1AS6A 1PZ3A 4Y4FD 3ZL2A 3I3BA 2AXFB 1R9FA 3OC8A 1MPAL 4QRPE 4DEPB 1TQCB 1Z3RA 5CXCB 5F93C 3GSNH 1INEH 4EXPX 1JNNH 2A73B 2ALAA 3RTQC 1FVDA 3SN6B 4ZTOH 1ANUA 5EO1A 4OGYH 2A6IB 4Q8BA 2MKLC 4Q9RL 4U4BA 1X5GA 3DWLC 4JKWA 2P9PC 2CRYA 4LG9A 2CDFB 4MNHA 5E6RB 3FTSA 2OJ1A 3QDHA 4MAYC 1ET5A 1F2QA 1OSEA 1YCSA 3I7LA 1WFTA 2X88A 1AY1L 1JK9B 4C56D 5HGHB 4F37F 3HG1B 2BRQA 2Z34A 1A7QL 2YA0A 1C7SA 4LASL 1HCZA 1DQVA 5JXAH 2OI9C 3ES6A 2ZCHL 1AFVL 5FQDA 4MMZB 3UL4A 4Y4KB 1B9KA 5EBMA 3IKKA 2VDMA 2WLIB 1MWOA 1UA6L 3CDGA 3O0RH 3FFOA 1VE6A 3RIAK 1A6TA 1UZGA 3NCCB 3S48A 4BH7A 5E2TL 3EI4B 1N10A 4PJBA 4TMPA 4KX7A 3KXFE 2OVRB 4HZ1A 3CPLB 4BL0A 4MJ6A 1FBIL 4UTAL 2EBSA 1DDHA 1UWEL 4KJWC 1FNEB 2C9UA 3VWKC 1K8IB 4OQTA 2YAEA 5DZ9A 2FX9H 4KRPD 1SXNA 3W5MA 4WW1B 2GY5A 3I9IA 1PI6A 4DO4A 5B39A 3HB3D 3MRGA 2DQGL 3QFGA 4PJ5D 4C4KO 2C9VA 3OZKA 4A6YH 3I6SA 2AJ3B 3FUMA 1G84A 1OY3B 3O45A 4N8UA 2B4EA 2X4RB 2XV6B 2A77L 5EAPA 3IKCB 1JAEA 4XC1L 4BGDA 2NT0A 1RUQH 4R26L 3ZW3A 4YDVA 5DO2D 2TSAA 4HGWA 1WAEA 3LIZL 3WO4C 3H3PL 4JRWA 3F6JA 3FO1A 3BYYA 4ODUB 4DN3L 3LRMA 2F15A 3D25B 2MTPA 4EN3A 4LNRA 5E6IB 1DUZA 3FB8B 1JWSB 2DH2A 3MXWL 3ELAT 3PDOA 3TO4A 4XWOD 4YQXL 2GBUA 1H5BA 2EIMB 4LVHB 1DBBH 4S0HA 2PM9A 2EKSA 4JFED 4OGZA 3MV7A 4AC4A 1G9HA 5ALCH 4M6NH 2ED6A 4L3GD 3U0TB 4F9PC 4ZQTA 3F00A 3GB7A 3N44F 3D85B 3U2IA 4HGMA 4JZOB 5D4HA 2F7PA 3ZL4H 2QQLL 1UM6H 1S6NA 3P3YA 5DEGA 4E54A 4D9LL 1DVSA 3FH5A 4IDLA 1JNJA 2Z31D 1I3GL 1SM3L 3BAEL 4M8RA 1SXZA 3UZVA 2XYBA 4DGIH 5FGCB 2OTPA 2ZPKH 3OKYA 3EH2A 3LNEA 2YD3A 4MQTB 4TVPD 2HKHH 3FO2B 2HWZH 1KGYE 1R3JB 1ADQL 1RIHH 1PW3A 4NSXA 3SVWD 2BWIA 1BAFH 1AE6H 2H32H 1NOLA 1MELA 4GPVA 4M9PA 1EAOA 1W15A 3CUPB 5K33A 3TP4A 4MGXA 2KZWA 4NZRH 4FG4A 2ETWA 4JFEE 1G5AA 1AC6A 1TZAA 5DVPA 4YGVB 2HKAA 4M8VA 1A3RH 2EDJA 3D0VB 2H9LA 1OSZB 4Z7UA 1OM3H 1CC3A 1NKGA 4ICWA 1HK6A 2KLTA 2DB8A 3KW8A 2Z9TA 2GJ6D 1COBA 2EINB 3JTTA 1JF1B 4RDBA 5ETUB 4HPOL 4U0QB 5KSVB 2X2JA 1MXDA 1NIFA 2GIXA 3L1OH 5BOZG 5ID1A 2YOAA 3IT8D 2ATKA 4LNVA 3EOTL 4LRNL 4X6DA 5CP3A 1XL4A 4ZW7A 3UTTD 2FBJH 4JFSA 3UO1H 4J84A 1RFDL 1H8NA 4OLZL 4Y1TA 3MJ8B 4YDKL 3I7PA 1FPTH 3QIWC 1KELL 2J7LA 3JWNC 4YHIA 3SKOA 5FO7B 2K4WA 5ALBL 3V7AE 4LEXL 1O9VA 5I19H 1ODAA 3ZDXF 1LWJA 4UT7L 3CZKA 2AGYA 1S7QA 2V5MA 5IB4B 1DLHB 2G4GA 4NRYB 5JDSA 2QXVA 3CU7A 4G1EA 2YQBA 1XF4A 4FXKB 4H26B 2H3NA 1XF2A 1XXDC 4PJXA 2ED7A 3KNBB 3I9AA 1OKEA 2PR4H 2QADD 2YD4A 2UY6A 4YZFF 5E6SB 5IJCC 2UUDH 5FW6A 1G1YA 1J48A 3B4NA 4N20A 4QCIB 3RZWA 1RK0A 4D7BA 1MFMA 3EOBB 3IGAA 4PD4J 1NFAA 2K78A 4PBWD 1KJMB 4LFHG 1JWMA 4MHHG 3MMEB 2GFBB 5A16B 4M29A 2BDNL 1JHTA 3OPZL 1EA9C 5DHVH 1Z0NA 1LK3H 1UWFA 1OGAB 4GQPH 3RY5A 3H8NA 5EU6A 4PUBL 2CNZA 4XCCL 3GO1L 2H6KA 1M2OA 2BKLA 2X12A 3KWVA 2OK0L 4PV8B 5JXEC 4GGAA 3G08A 3BQUB 3V0GA 3RPIB 3OLGA 5DWPA 4HEPG 3Q3GB 3MJ6A 1KGXA 1MFCL 2QSVA 3B37A 5ICZB 1BPOA 2ZXCA 3ARBC 3MREB 3PLYA 1CF8L 2BOCB 5EUOB 1T1WB 4YBHA 2HYMA 1TOXA 2ZKHH 4BH8A 1YECH 5T5FH 5J11C 3P73A 3IU3A 4PJDE 5IF0B 3S37L 5F3FA 4HMCA 1F02I 4AQEB 1AVAA 1SXAA 4ISVB 5DJXB 3SQBA 3CH1B 5SXMA 4ZSOE 3FCBA 4HCIA 3O2VL 4PJEF 1S7RA 2IOMA 1EJ8A 3O3UN 4LSTH 2O30A 4KTEH 1UT2A 1E5CA 2JKJA 1YN6B 4R5TA 2R69A 4PRPB 1DQIA 1C8PA 2E8ZA 4FAND 5LN8A 5BJTA 5DLMH 1BF5A 2CN3A 1OK0A 2DM7A 4G9FB 4WDIB 2R7EB 1DVUA 1QFWH 2MRYA 4KVCH 3U9UB 2BY1A 1GR7A 3QEQD 2VDOB 3P0VH 2JI3A 2V7NA 3OAWA 4GQBB 3EI2B 4YHMH 2WOBA 4FMKA 1JVLA 2H9PA 5HJGA 2PTUA 4G8AC 5MEQB 5TQ2L 4ZPVA 4KVNL 1GC1L 3PWPA 2IV8A 3DX6B 4M5YH 2EYTB 3NIDE 3NVNA 1WITA 4R6UA 4EBQL 5CSZA 1BD2D 3H4FA 2C1OA 2N01B 4UIMA 3IFNL 1QTPA 1J8HD 2G0KA 4IRJB 3APCA 3O4OB 4LOUC 3LPOA 5IIEA 2UZPA 2Y72A 4K3JB 2JKIS 4YSAA 3IUMA 1UH4A 3ALXA 1PZUB 1CFQB 4RMBA 4OY9A 2NY5C 5ESAA 4QI3A 3SBQA 5C09D 4PREA 3QJRB 4I4WA 2IUQA 3HKFA 2IH8A 1T89A 3Q48A 4FI8A 4MB4A 4WI6A 5TQ0H 4EI5D 4CI8A 1FIEA 4P4KA 5DD1L 4LAQH 4EQ3A 1NDMB 3FO0H 5DJ8B 5DMKA 3LKSB 3VDAA 4ELMF 1HSBB 1P7HL 1QA9A 3AM8A 4LLVB 4A11B 4G43B 3I02A 1B6UA 2HT4D 2H6UA 3T4AC 1JZ5A 1BD2E 1E2WA 2OJZH 3ULVE 3ETBF 1RJYA 4P23C 1M1SA 3ZYOA 4JY4A 1JFQL 3V9EA 2EACA 3UFIA 5AW2B 3X1EA 5EO1B 3EI3A 1CQKA 1KY7A 3KDMA 1BZ9B 3U83A 2HX8A 4NSKA 4IMLA 4JY6A 5IROC 1SPDA 1MH5A 3IDGA 2Z7UA 3VUAA 5FF6A 2AAVA 5L0QC 5LWYH 1XGUA 1F58H 1U9KA 3ES6B 4PJIA 4FXTA 2JMRA 2YAPA 43CAA 4ETQA 3ILQC 2JELH 4QIRA 4NZ8A 5EBMB 1E5UI 3C87A 2WBJA 4NQCA 4KXDA 4UU9A 5MENE 1SF5A 4JHZA 1QWHA 3L08A 5IK3B 3CDGB 3N06B 3UC0H 2OMYB 1W8OA 1A6TB 1FSKC 4FFVD 4BH7B 3UO8B 5FYLE 4PJBB 3BD4A 5KYXA 5KSBA 2NY1B 3Q2WA 4MJ6B 1DDHB 2P42B 3AG3B 4BFNA 4A08A 3GPSA 1V3KA 1KENL 5DR5L 4HG4K 3MGOA 2IADB 5B39B 4DZ8A 3QDAA 3MRGB 4FQIH 3QQ3A 5HYJE 3HUJE 3PWLB 3O45B 4WGKA 1ZLUH 3A4DA 1NCIA 3VFSA 5CO1A 1J0KA 3I2CH 3ZTNL 3OGCA 1JPTL 1QFHA 2VWEE 2UUDK 4OLXL 4YDVB 4HGWB 5HHOE 5IVXF 3SGKA 3LX9A 1MN4A 4JFUA 5DCCA 1DBKH 3OV6A 4EEEA 4QJ5B 5HHVL 1TZGH 4EN3B 3MV8A 2VLKA 4LNRB 2EDHA 4XNXL 2NQ3A 4B95C 4HKBB 1AKJA 3PDOB 4TNVF 3TO4B 4Y4KD 1OP5H 3QXDA 5IREA 4H1LA 2WM0A 2J5WA 4YXLH 1Q72L 4WHCA 4H5JA 3MACH 2PM9B 4U2YA 3RZCD 1NGQL 3VACA 3MV7B 2GSGA 2W95A 1IQWL 2NT1A 1KBPA 3GXDA 5IVZB 32C2B 4Z95L 2VXTL 5I0VA 4PG2A 3HFMH 4OSUH 1JTTA 4NCDA 1U2YA 1H3TA 4IKLA 4E54B 1WZAA 2X4OA 4L9DA 4UUJA 5DEGB 1MQ8A 3TBCA 1WAAE 4KI5F 4FP8L 1NPJA 1MJ8L 3UZVB 3HG1E 4K8RC 3B43A 5C1MB 3VI4F 3RY6A 3IXTA 3QYCA 2D3VA 4IHBA 3OKYB 3D6GA 4CZYA 1EQWA 4IBSA 4I18A 4RX4A 1YPZA 1K72A 3ABMB 2VZSA 1N8ZA 2MPAL 4H44C 4KI5C 5CN3A 1P6FA 4FD0A 4JR9L 3WNNA 2J21A 4N8CH 5IBUB 1MF2H 5E6ID 2DQHH 5FDYA 1QSED 4TNGA 3SZKC 3WEBA 3BH9A 1R3IH 3KM2A 4PCYA 4Z7UB 2VTFA 3QI9D 1F41A 4JCWA 3AREA 3HJ0A 4NM8H 3N3EA 1WVZA 3TNMA 4BJLA 3WN6A 3JYCA 2OZNA 4UANA 4P06A 2LR4A 5E8PA 5E1AA 2NX5A 5I1EL 4WNSA 1KFAL 3ZHNA 4KK5D 4IGBC 1ZA3A 3D85D 3VFTA 2A7BA 5H94A 5HGDA 3GMLA 4YXKL 5ID1B 5HTSA 2ATKB 1FNAA 3BAXA 4C8XA 1N70A 2FLRT 4X6DB 5HYSA 4MQ7B 3QE5A 4BYHA 3N0EA 1X5HA 5TH2A 4JREC 2R0WH 1NCDH 1XO8A 2O6CA 1IBGH 4ERZA 1ZV2A 1E4JA 3LZFL 4YHIB 1QFSA 4NYLA 3PXTD 4EJ1C 4WWKC 2HJBA 3TLRA 2F19H 1KGUA 1WTGT 5I2IA 4GUPA 5M5RA 1TMQA 1FHGA 2YPVH 3C5SA 4J3TA 4OLYL 4BZ2H 1B0RA 2ISDA 5EU4A 2IH1A 2X7LA 3DMMC 1AGEA 3NYKA 4HWBH 3CHQA 4G1EB 5HDOA 5TK2A 5KSAA 1XF4B 4KZEH 3W56A 5DHEA 1DE4A 2H3NB 2WUCH 1NPUA 3PFUA 4BBWA 1XF2B 3ARPA 2JV6A 4R0LA 3MJ9L 2QGBA 3EQ7A 4ZN4A 5ITBH 5HGBA 4YHPA 3B2PA 1INQB 3CZGA 4R4FL 2PP8A 2X3AA 1LWHA 1MFEH 1RK0B 4W4NA 5I1IL 5EEYA 3BC9A 3IGAB 2VSKB 2ZWYA 4CSZA 1PBYA 2V5RA 3JAMg 1V05A 5I1KH 1ZSDA 2C4FU 1JGDA 3QNFA 4RWHA 3VH8A 4JQIH 5JHLL 4PSRA 4PU2A 1PG7W 1XB8A 2GABA 4F1ZA 4OCSL 1XBRA 2R0LH 4JHPC 4JQVA 4EOWL 3MA9H 2NNXA 3Q2NA 1PVHA 2X9YA 5KYWA 5EU6B 4RMTA 1K4DA 3FQWB 3VXUE 1EEZA 3BLKA 1OAUL 4X8JA 4P2YA 3CN2A 3UYRL 1A4BA 2NPLX 3G08B 3QSKB 3K71B 15C8H 3L4CA 4FHJA 4K73A 5E6UA 1X5KA 3QORC 5D7KD 3DX9A 3SE3A 2NXYB 3QZNA 4ZXBA 2GQHA 4HVBA 1PF3A 1BQKA 2GTWA 2FL5B 1YEJL 4O9DA 1SJEA 1XSJA 4NO0A 2FR4A 4I9WD 1URZA 5AAMC 1XIWC 2F54A 4BH8B 5F7HA 3O4JA 3P73B 3IU3B 4KK9C 5EOQL 3L2MA 3UBHA 3SQBB 4NN7B 5FFGA 3F05A 1EHLL 2YD5A 1S7RB 5JPMA 1A6ZA 1V5JA 1RZ7L 2ERJC 4G7QB 4RH4A 3CFUA 1R5WA 4HEME 3HBZA 3CC1A 2HKFH 1FNHA 2ATAA 4GB9A 4AZ8B 5D7SL 1ZLUK 3LD8B 3OKOB 4ONGL 3ZE2B 3QULA 5BJTB 5TDPA 1HILA 3MLUL 2QQQA 2V7NB 2XPZA 5C0FA 3GMPA 3H3KA 5DRZA 1I53A 4MBOA 1AZUA 5DZPA 4UNUA 1YMMB 3O2DL 1QBBA 4ZPVB 4K7FA 3BQUD 3PWPB 1PJWA 4J3WA 3CXDH 3VYPA 4GSUA 5AKSA 5LXGL 4FTVE 4AGOA 5CSZB 3WAJA 5I0YA 5G4MA 1OP5K 3SWSD 1JMXB 3HBPA 4UIMB 3MVSA 4AZUA 4NHCH 4U1GB 5CCJA 4MJJA 2JKRM 4E9LA 4E5XG 5HVGB 2Z2OA 1ASOA 4XNZB 2VDRA 4H2CA 5IIEB 5KVEH 4QXGH 1N6QL 1EO5A 5B4WA 4ANVA 4KUZL 1TYEA 4FXLA 1ZTMA 3AC0A 4MJ4A 5ESAB 4L29A 4YAQA 1GZHC 3NCYP 4ZUWA 5D71L 3F58H 4Z3TA 4I4WB 4AE1A 1OGAE 5I1LA 5J3HD 2H6NA 1XCTA 3BT2L 4QL1A 1DSYA 3MJWA 1SMOA 3W39A 3UEQA 4DERA 1YEEL 4G7YH 4PRPD 2EYRA 3UVLA 3BPLB 5B1CA 5IGXL 4PJCA 1QA9B 1EJOL 4G9FD 1U8IA 4U1MA 4WUUA 4P9HC 2CR6A 3NDZE 1RJYB 4DNVA 1M7DA 5EUOE 3UTSD 3H2QA 3MUZ1 3SGEI 3EI3B 3FONB 4PVLA 3KDMB 3KR3L 5IUSA 1H8OA 4JY6B 3WDIA 5K1JA 1MH5B 1J0JA 2EZ0D 3IDGB 5BRPA 4QXUL 4IRJD 4JPVL 4O02A 3Q7JA 4GKLA 5FF6B 3RWGB 4B9IA 3WS3A 5I17A 1ADWA 1Q94A 3A6CH 1MG2C 4UV4L 3TH4T 1C1EL 1OT4A 2Q76A 3GHEH 3HNVL 4IMKA 5IJKC 4PJIB 3IU4H 4Z7QB 1O9WA 1HL9A 4HSAC 4PRPE 43CAB 2Z7YA 3OLDA 2WBJB 4NQCB 4UU9B 1JXJA 4Y2DC 5E5RB 1A14H 5IKCA 5D70L 5DS1A 5G4OA 2CHZA 4KKBC 4OTXL 3FMGH 4K0OA 3QFDA 2AABH 5AYTA 4FI7A 4JDEA 5KSBB 5KYXB 3UJJL 3LXUX 4GI8A 4OCXL 2BXYA 4TUUA 4KKCC 2IOOA 1Z9MA 3VXTA 3HZYB 4KQ4H 7CGTA 4A08B 2NY0C 3MGOB 1UZ6E 1CGSL 4AUJA 3ALPA 4DZ8B 3VDCA 3QQ3B 4XI5D 3SGDI 4OV5A 1BVNT 3SJLD 1U8OA 1N26A 2KZ1B 3WFCL 3D0AA 5GJSH 1UXMA 4MA7H 4APQA 5AWNH 5J6SA 3OGCB 3DSMA 1P1ZA 5GGVH 4YDNA 3QJFA 4NQQA 1ZOXA 1BYNA 3DNKA 4NJ9H 2VLLA 5EMMB 3RVVD 5HYEA 2CBMA 3GK8L 3KEDA 4Q74A 4YBLC 3D2UB 4L1TA 3MV8B 2VLKB 3TFKD 4FQLH 4OCWL 3QPQC 5IMOA 1ZANL 2G3MA 4J3OF 4V11A 4CC4A 1AKJB 3KD4A 3QXDB 3C8KA 4H1LB 4HJ0C 4IIQA 4XAKD 4ZS6D 5C0IA 1KCUL 2BK8A 5TE4L 5FYKL 4J8RA 5KVFL 2ARWA 5HDWA 2GSGB 3U48A 4EUPH 2AV7A 5JHBA 2VDLL 5I1JL 4ZOZA 1MHCA 4E68A 1NBVL 3QWRA 4KK8C 4LLYA 3SQOL 4TSBH 4J3OC 1L6ZA 3VFNA 3MRNA 1N4XL 4UUJB 1KTCA 3U9PL 4ZOAA 2QBWA 3HW7A 4BP9A 4RDQF 2Q6WA 3V52H 2VMFA 3WFEL 1QPKA 3QQNA 1FV1A 2W9EH 6FABL 2NY2C 4UI9R 3SDXE 3IMWA 3WKPA 5DXWA 3VG0H 3IXTB 2EC9U 2VMJA 4CVZA 4KMTH 5E08L 2AGLA 1V7NL 4F7EB 4I18B 4TLUA 2IPTH 3Q6GL 5I74B 3IBEA 4OGXH 3WLBB 3SLED 4Z18A 2CPCA 1FWXA 4HJUA 1J1OL 1CTMA 1P0SE 2YPLA 4PB0L 3FTXA 4EN3D 2IPKA 2LU4A 1R3LA 2MMXA 1VESA 3BH9B 2COQA 3TO4D 1IVTA 1W72H 4M00A 2F8IA 3OMNB 2DI7A 3ZMRA 3AREB 4NDMB 5DFVC 4MD0A 2ID5A 3TNMB 3CC5A 3WIHL 4LMQI 4Y5RD 5C6PB 2AF2A 5AAPA 3MV7D 5E4IA 3I3DA 5E8PB 3RKDC 5E1AB 5D1QC 2CRIA 1KFGA 2NX5B 3MZLA 4LGRB 1HWGB 1MHEA 4HV8A 2CCLA 4KO6A 3VFTB 1S7WA 5D1XC 1QPPA 4QXVA 5H94B 5GRUH 2BVUA 3JZNA 1J86A 4X98A 3TEYA 3J2PA 4Z9KB 3PVWB 1ZTXE 5HYSB 4KKPA 4OUOA 3S37X 1ASQA 3O6KH 3QK0A 1IAKB 4KGJA 1ET8A 3GBNL 4MZ3A 3T65A 4HLEA 1VZGA 5JQIB 2A2QT 5AW8B 2Y9RT 25C8L 5IB2A 4WKZB 4NYLB 4KZ0A 4UM9A 5DI8A 3FCTA 3CHPA 1TPXB 4GW1A 4WUKH 4YBQC 3RX5A 2PTVA 5I2IB 1WE5A 3MLYH 4GUPB 1ZHLB 3SY6A 4UT9H 1NEZG 2BVTA 2YN3A 2KUTA 2FE0A 5I1GL 1B0RB 1YMHA 4HHGA 5HE3B 1AGEB 2P7TA 1JGEA 3S5YA 5KSAB 4PVMA 3BRFA 2EVJA 5J7CC 1DE4B 4NGHL 1A7NL 1WWWX 1EO7A 3E3QE 1MHHA 4PS4H 5IMLA 4R0LB 3AXLA 5DMIH 1VZ3A 4HHAB 2BVPA 1CICC 3IJSA 1KEGH 1WA2X 5CSGA 5HGBB 2ZXEB 4BE6A 4WHTA 2RA1A 4YHPB 5I5JA 1PTZA 4G5ZL 5B1BB 3H0TB 5KAQG 4HYTB 3FT3A 4PJHE 1ULVA 1C5BL 2A0LD 3QCTL 1IKFH 1O6TA 4UOW1 1PBYB 1E90A 4F3FB 2OK4A 3UKRC 2VRKA 3NEOA 3UGEA 1ZSDB 4JHUA 3VMPA 5FKAA 1JGDB 3VH8B 3W11D 3FT4A 3ODTA 3V4PA 2EECA 4P2QB 4Y2LA 4MRCA 1RP9A 3TNNB 3BIAX 5DJ2A 2LU3A 3MLWL 5I5MA 3CFQA 2B9BA 3FQTA 4BSWA 3JRPA 3ZHKA 1HE8A 1JUFA 2JXMB 3WXWH 4URTB 3RL1A 1EEZB 3FU3A 4B97A 4NN5C 2Y24A 4N0UE 4WI8A 1J7VR 4HBQA 2J1XA 1OK8A 2X2HA 3P4MA 3FS9A 1X9UA 1A6WH 5E6UB 3RI5K 4NIYE 3TT3L 1NBZA 3DX9B 3OAYH 1C16A 4R7NA 5AVWB 4ZXBB 3V5KA 5KN5A 3T0EB 5FV2A 2BWDA 4NO0B 3VRJB 5AVVB 1GPOH 4X7SL 3TO2A 1RERA 2Q3AA 2UXVA 1WSST 5JXEA 3QYMA 5IC7A 4W93A 1XSKA 1RZPA 1MCCA 1HX0A 4N26A 1VAHA 3N1MC 4BWUA 1IM9D 1PS3A 3V4VB 2VL4A 2B5IC 3ROLA 5JPMB 2O5NA 1A6ZB 2LTQB 4QRFA 4EZJA 4HS3B 1R5WB 4MXVF 5T1KA 2D7TL 4GNKB 3B83A 3U0WH 4JO4L 2PYEA 4QXWA 2WZ6A 5FHAL 2X4UA 1U3HB 4YVDA 3QULB 4FKKA 5EU6D 1MPAH 5TDPB 1HILB 1CFSA 4JUSA 4FA7B 1ZEAL 2YMUA 1UM4L 2XIDA 5C0FB 5CINL 4M7KL 5DRZB 1ZLVH 1JZIA 2XN1A 3BP4A 2ICEA 3GD1C 4KJPC 5EZOL 1G7PA 3LH8A 4AEIL 4K7FB 5LAXA 4AT6A 4LQFL 2HAZA 3QIUC 4OD3L 3V7DB 4FJZA 2UY7A 2DIBA 2XACC 5JLZA 1OAZH 1KSRA 3CCHA 3SHFA 1AY1H 4Z8FH 2HFGH 3BUTA 4XC3L 4NUPA 1FO0H 1GJIA 2ZE0A 1A7QH 5J1AA 4HFUH 3U1SL 4DN4H 2PO6C 2VDRB 4N2GA 4OZUA 2UX7A 2ZCHH 1AFVH 2BSEA 4N2AA 3S5LG 1S7VA 3N04A 4YH6A 3O4HA 4EUPG 2XX0A 3A0OA 5GRXG 1TYEB 4JFQA 4HUVA 1CCZA 5DWUH 4WI0A 4L29B 2C3HA 4YAQB 4JFOA 1UA6H 3OZ9L 4HCRH 2V8LA 4OZFG 5FLXg 1SY6L 4CMHB 1XCTB 2W0LA 5E2TH 4LIQL 1A25A 1JNLL 3CFKA 4W9ZA 4X4KA 2F8XC 3W39B 2XWXA 1NAMH 3AWFA 3MCG1 1RK1B 1JHLL 1R3KA 2EYRB 3AMLA 2W5PA 3OKEA 3PUUA 1R17A 3QYNA 3VU2A 3L2NA 1U8IB 2XN9D 4U1MB 4PSXB 1CPUA 4WUUB 5CD5C 4UT6A 1T2QL 1D5XA 4L9LC 4ODBD 1M7DB 1E50A 3PWPD 2IANE 2VDML 3R4DA 2A77H 1FN4A 5FPIA 4R26H 1N7ML 2MIZA 3VGAC 1OP3H 2WN2A 2Y1VA 3SKMB 3C9CA 3DBSA 4WIQA 1D6VL 5FGBC 5KTEL 3LIZH 1A9VA 4O02B 1A6AA 2DQEH 3KYAA 4DN3H 3WS3B 3QZLA 4P23A 1OHZA 4ZNEE 2HCZX 3DV6A 1Q94B 3NJKA 4GEIA 5DJZA 1IZJA 3RTQB 3DRTA 5I17B 5HSFA 3MXWH 2Q76B 1NDTA 3MUJA 1AD9A 2BRRL 2X9XA 1MJUH 4NP4L 3P2DA 4XXCC 1DJXA 3HBQA 1OSYA 3NZSA 1AR1B 3MX0B 4AIEA 2IQ9H 4QHKI 2QPUA 4P4KD 5IKCB 2JJWA 2AK4A 4W9GC 1Q1PA 2ZZUT 3E80A 3Q1SL 4OU3A 3HN3A 3NSCA 3QFDB 4XB3A 2ZUTA 2X6UA 3L3OC 4JDEB 3T6VA 3VD5A 5A3IC 2QQLH 1CK0H 1YMME 4JO2H 2DQTL 5IVOA 3B6SA 1AS7A 5C0ND 3PG2A 5BRZA 1SM3H 3VXTB 5JA8B 3PXWD 1P5UA 2C1PB 2AFNA 4RZCA 4WK4B 1BPLB 1JIBA 3I75A 2VYRE 1BQLL 1PD0A 4FS0A 1A5FL 2EXTA 3P2TA 4GAYB 2AK1H 4MXWH 3WKQA 2FJHA 4OV5B 3BLBA 5AVYB 2HXCA 2E27L 4I0PC 5DHYA 3DO4A 4AITA 4APQB 2WPGA 3NZ8B 2OCCB 1P1ZB 1CXFA 1JVOA 3QJFB 1UD4A 2CKNA 2WUBL 4PB9L 3CJJA 4XPFH 4XPGL 1NCWL 3GM8A 1S7TA 2ICWA 3WU1A 1U2CA 4K4KA 2A1WH 2HVBA 3NCEB 1I4FA 2EO1A 1CXIA 1YYCA 3QJVB 5IMOB 2ZOTA 3R06A 2A6JB 5J12B 2OVQB 2YBAA 4NQCD 1DSWA 5C0IB 5D7JA 2B5MA 4J8RB 2OSWA 3SQRA 2AV7B 2F1AA 2HT2C 1Q9WA 4XHJD 2MJWA 3NQIA 1TQUA 3S5ZA 3VA2C 1MHCB 3C60C 4YHOH 1SEQL 5ITFA 3IK2A 4H8WH 3VFNB 2O6PA 3MRNB 4YDMA 2F68X 3DJSA 2I60H 3V4VL 4XBGA 3M8OH 1NJ9A 1RU9L 1RFDH 2ED8A 3I9PA 4AV0A 1NCJA 4OLZH 5BCAA 5HYQA 2Q6WB 4YDKH 3H55A 1A8ZA 1KELH 1TFHA 2V8MA 3OAYK 3OKNA 3QUZC 1FV1B 2DIJA 4JFWA 4XCEA 4YC2C 1ACYL 3K6FA 4JG9A 4KK6C 4X4XB 4UT7H 1T83C 1WBXA 1GYCA 4CVZB 1JF6A 1JXKA 2B1HL 3DX2A 4PJIE 5FOBA 1PX4A 2WBKA 4NNPH 4OJFL 4Z7QE 1I1AC 4L1DA 3EH4B 4OJCA 2HESX 1ZCRA 5ECGA 3NFPA 1BX2B 4F8OA 2YPLB 3V6ZA 3HZVA 1AYOA 2IPKB 1LO3L 2VLKD 3MV8D 4XMTA 1R3LB 2FO4A 3AJ7A 3N44B 1E6JH 4M7LH 3MROA 4L5FH 3UAAA 5I0DA 5F6HI 4XZ4A 4GAJH 3CC5B 4UI2A 4YR6A 2FT6A 3ROOA 4HOMA 4R7DA 1L9OA 1GYVA 3L3HA 3VD1A 5HHQB 1O5PA 4WVRA 2YD1A 1MHEB 4HV8B 1D9KD 1F6FB 3VI4A 3BDYL 4HWEL 4X5QA 4X98B 1ZLVK 5HVWA 4IM8A 1KV7A 2FNBA 4XMWA 1CFVL 2HLFC 3T65B 4OZ4A 2HG5A 1P84K 4XPAH 1E3XA 3MBEA 4NQEA 3BWSA 4UAHA 2APVA 2EUXA 1Z0MA 3MZKA 5ICXA 2AEIT 5DI8B 4UM9B 3FCTB 1AJ7L 2R59A 4MNGE 1I8IA 4GW1B 3REWA 2OK0H 1K8DA 3NCJL 4P0DA 4FABL 4RX4D 2FT7A 2HMID 4ENED 4UTCA 2WO3B 1MFCH 2P7TB 1JGEB 3DIVA 3EJZD 1E0OB 1I7TB 3ARTA 2PPEA 1CF8H 2J88L 4TV3A 2X89A 3QUGA 1HN1A 2WK2A 4WWKA 5IMLB 1HAWA 5JQHC 3AXLB 3MYJB 4F92B 3CLEH 2BVPB 3IJSB 1DR9A 3QUHA 4NN6C 3S37H 2VZUA 3LQMA 3WEXB 4WHTB 4HUUB 1S5IH 4JM4L 1I8KA 3OW8A 3O2VH 4Y8AA 3HBGA 2NX5D 2X40A 1EDQA 2ZKWA 1UKSA 2JB5H 3WL9A 3KPOA 5CR8A 4AQOA 2Y1AA 4Y2OA 5LG1A 5FYJL 3BD5A 4P07A 5FKAB 3ZDXB 4X8GA 2RJMA 4X4MA 3V4PB 1F5WA 3V95A 2FEDD 1U92A 3DJRA 1BMZA 1MCRA 1OP3K 3BMWA 5HJBA 3Q44A 3FQTB 4KQ3L 4Z77A 3ORVD 2OL3A 3APFA 2YRPA 5L2KA 1JUFB 2G75A 4NBXB 5TQ2H 4KVNH 1GC1H 3RL1B 4XX1G 2KERA 1OEZW 3VFWB 1VB9A 5EBWB 3RX9A 3GEFA 3H9YA 4FFYL 3K26A 3P4MB 1MCOL 2WXGA 5CJQL 3RUGF 3BMVA 4OCMC 2E7HA 3G6DL 1HH9A 1C16B 1H8LA 2ICCA 4R7NB 5DTFA 3V5KB 1RQ5A 3IUJA 5BV7H 5KN5B 1NGPL 3N55A 2ZAHA 5SX4H 3OC5A 3TO2B 3UMNA 1EBPA 1MKFA 1J12A 2I69A 2X0WA 1KOAA 4HIXL 3ZKMD 1IGIH 4I3RL 4ZX4A 3TEZA 3STZA 5JWZA 2OZ4L 3QORA 4TF4A 5AJAA 2Q7QA 3ROLB 3H9HA 4O2EA 4D0CB 4Y16C 3DOHA 4PBXA 3V9FA 5AAMA 1JDAA 4Q89A 2PYEB 2ZIDA 5J11B 1D5ZA 4YPJA 1XGYL 4CL7A 2X4UB 2HT3D 4UYPA 4WI7A 1KBGL 2JQZA 4OLEA 4ATTA 1XGQA 1MFUA 2XQBL 3K2IA 5DUJA 5EN3A 2BJMH 4DW2L 1JFQH 3SOBL 4Y4HC 1Z7JA 4K15A 3U9WA 3WKYA 2Q2EB 4O3UB 1O0VA 3CMOL 1FFNB 4JFVA 5LAXB 4AT6B 1P6AB 2P80A 1II4E 2UY7B 4X9BA 5JLZB 1AANA 4ZXBD 5C0CE 3CCHB 2WIIA 4BK4A 3OAUL 3KYKL 1DJSA 2QVTA 1U8JB 2DQUH 4PJEB 1R5IA 3IGLA 3T8VA 4F7TB 2J1YA 3L95A 3QDMB 4I13B 4NO0D 4EPSA 2IMNA 5IT9g 2EE0A 2YQ3A 3WFDL 2F54D 5CUSL 3B9DA 2H47A 1S7VB 3GBLA 2YA2A 3JZYA 3CZFA 4EDXB 4WO4C 1PZSA 3E2HB 4JFQB 2WGNB 4G8IA 4WI0B 4P2QE 3LKOA 3TJHD 1F6LL 5I0ZA 3WV0A 1YQVL 1IARB 3DX3A 3NPZB 1RIVL 4W9CC 4WSKA 3MRRA 3T8MA 4N68A 1L7TL 1LXMA 2VIRA 2HX9A 2DJUA 5JIPA 2DJSA 5DJ6A 4GRLA 2ZYRA 4E36A 5BXFA 5FUOL 3TESA 1M71A 4PJFF 1Q9KA 1QYGL 4XPTH 1J1XH 3PWNA 1EEQA 5DR5H 3V5HA 3VD7A 5C2UB 1BEXA 2WLMA 5EIIB 1CL7H 1D5XB 3T0EE 2IF7A 3CBRA 1B88A 1QZNA 4ZO8A 1KXQE 5GGSB 4O00A 1ZPLA 2WWNA 1XX9C 1FN4B 5TF0A 1PJ9A 4KOCA 1A21A 3FQNA 4BQBA 2NSMA 3LHAA 1A6AB 1NGWB 4HKZA 4M8QA 5BMFL 4P23B 5DF0A 1OLLA 1X4ZA 5HDRA 1I75A 3DV6B 5DJZB 3LQZA 2QPDB 3DRTB 1JYNA 3FCSA 3CZJA 5HXMA 1RUML 2BFVH 1AD9B 1TENA 4G2AA 3RAJH 1QEWA 3ZTCC 5L2JA 3F85A 3MO1A 2IURA 3DXAB 1NGQH 4KV5E 1JXDA 5KOMC 1G0XA 1A7BA 3WGUB 1F4XL 5IQNA 3UAEA 1X9QA 3ZUCA 4OWRA 3DJZA 3PWVA 5E4EC 3GRWA 5DD5L 3ZYIA 5AMSA 1KTKE 3BGMB 1IMHC 3V6FA 2OMXA 3BJ91 1HYSD 4G8FA 2B4CH 2D8KA 2VQUA 3DWTA 4Q58C 4Y2DA 4FP8H 5C8JB 2DM4A 1MJ8H 1P5UB 4JRXB 3V6OC 5D7IA 2HUHA 2FJFA 2R56H 2QKSA 4N0RA 1FSKB 1J8SA 3EH3B 1VSCA 2FJHB 4N2OA 4BQ8A 1GGIH 2X28A 2NDGA 1WICA 4XVTL 5LLIC 2B39A 5DHYB 5FWRA 4GLRI 2V4LA 2E7DA 5E1GA 1F4YL 1PD1A 1RMFH 3TTSA 1ZJBA 1J11A 1X6NA 1S7TB 2ICWB 3UBXI 5T1DL 1Z66A 3SOTA 5MP6L 1I4FB 5EU3B 2AH0A 1KLUA 1YEDB 4WJG3 2F58L 1JTOA 4KKAC 1UHVA 3R06B 5B38G 1XEUA 4OI8A 1B2WL 4U6VL 1AR1D 5D72L 4TNFA 1K3IA 3NAAH 5FLUA 1KFAH 4WUUE 3QJHA 4UQ3A 2OCJA 1HL4A 1Q9WB 4RMWA 2HU7A 3EGSA 1PPIA 5ITFB 4DKEH 1IE5A 4OV6F 5IESH 2E5EA 2NSXA 2CCVA 4XBGB 3WUZA 1NJ9B 3IS1X 1KCWA 4FKEA 2P9UC 2XWBA 5LGKA 1JDDA 1X5LA 1A6VL 4J8QA 1R4XA 3NJIA 3OKNB 1N64L 4XCEB 1FFOA 5JOPD 3EGXA 1KCSL 3P9WB 5CILL 3WFHA 1WBXB 4BUHA 3H9SA 4KJWD 1SQMA 4APQD 3BZEB 5C9KA 5FOBB 1RCYA 3I7OA 2EEBA 2G2RA 1JF5A 4KAQL 1WFIA 2ENJA 4QHKJ 1SDAB 3BGAA 5E1QA 1LO0L 2WXJA 2LQRA 3SBPA 3NFPB 4OAWA 4UQ9A 3MJ9H 3HZVB 3V6ZB 1CBVH 1R3HB 3BSGA 5BNXD 2FO4B 4U0RC 3UEZA 2Q0ZX 3ARGC 3MROB 4TQ8A 2Y4SA 3NOIA 3I9GL 1DVFC 3RVUC 4X7CC 1ACZA 4YR6B 4XWGL 2GNQA 5A6LA 1OW0C 3T0WA 5HI5C 3IMBA 3ROOB 3X3FL 5A6IA 5EEVA 3E6HA 1DJWA 3N1QC 3US9A 1QSFA 1XF3A 3QWRD 4PC0A 1PNDA 1FDLH 4WHDA 5A2IH 1QLEL 3VI4B 5EZIL 3M7OA 4AM0A 5JHLH 3O41B 4A6YA 2W60A 3PP4L 4OCSH 4AIXA 3A67L 4JO8A 4EOWH 1OF2A 4OZ4B 2HG5B 3A24A 3MRJA 5D1QA 3DHJA 3LIUA 3SDAC 3CZSA 3MBEB 4NQEB 2R29H 3PAUA 3SCMC 4IGBB 5A7EA 3REWB 4ZMWA 1I8IB 1ZS2A 2YUWA 5F7MC 5JIMA 4F8PA 4LSSH 4LCCC 5HQGA 4X5RA 1OAQH 2GSIB 4OF7A 1NFDF 4YGAB 4BD4A 4DVBA 1UKTA 4JREB 3D18B 3WMPA 4HUWA 1A22B 1YA5A 2P8LA 2YPLD 5EDXA 1OB1A 1YEJH 4YWGL 5KSUA 5BZWA 2X1WL 4WWKB 4Y19B 2X09A 5GS0L 1UFUA 1A1MA 6PAZA 4JPWH 2EDYA 3QVAA 1HEJC 5EOQH 4TOYH 3VFPA 4FQPA 5F96H 3HG5A 4A67A 4MX7A 1I8KB 3DMMB 2VXVH 2XKSA 1NH6A 1UACH 4PGJA 1U8MA 3FQRA 1KNOA 5DZJA 3WL9B 1RZ7H 3KPOB 3N1GC 2GSMB 5EO0A 4I1PA 4YDJA 3CLWA 5GISL 1YEGH 4Y2OB 4M7LT 4N2KA 3FU6A 1LP9F 5AW5B 2X4TA 3R4RA 5D7SH 3UCQA 4HWNA 2WB7A 3E38A 3HC0A 5CU5A 4XP6H 2CWRA 3AG1B 2PPCA 3MOAL 4BKLA 1U92B 3PGCA 3PL6A 4L0PB 5IJ8E 2Z1KA 3GXIA 2H32A 4Z77B 2D3NA 3LKRA 2OL3B 5L2KB 3BJLA 1NKOA 1O9ZA 2YPLE 1EO8L 2G75B 1OZUA 3BWUF 4G80A 4B3VA 4BE5A 1WS7A 5F6HJ 4KTGA 4FOMA 5IEKA 3KPTA 3ASWA 4YFLF 3VGBA 2ITDA 2H3KA 3F01A 3VSTA 3T71A 5DTFB 2DLEA 3TJEL 2PCXA 4OLVL 4JKNA 3ULUH 2CHNA 2I0SA 3E9TA 5ANME 2JTYA 3BWUC 4QDGA 4PD4K 3FQYA 1NL0H 3M45A 4RWYL 1UA7A 2E7BA 3KLKA 3P11L 4U7MA 1F1DA 1J0YA 2YUZA 3KPRA 3KLLA 4GO9A 1IAII 1QABA 2PYFA 3L3JB 3MUHL 3QORB 5D71H 4NXSA 3HRPA 1MRCL 2ZUQC 4IDJL 4J23A 5F9DC 5DS2A 4BQ6A 5FO2A 3H9HB 4O2EB 3ZKXB 1HZLA 3IIWA 4LHUA 3WXVH 4ZG1A 5F3HA 1KT2A 3ABGA 2BP0A 5IGXH 3II1A 3MRFA 4NFDA 3W5NA 1D5ZB 5I8OH 4QRAA 4S2SB 4L8DA 1ZD6A 1E65A 2VDNL 3DDFA 1XGQB 2ERJB 3JWNE 2WXFA 2Y6TE 3OMIB 1P22A 4AOWA 4EI0A 2NY6C 2WVUA 4G70B 3EJQA 2GHWB 1ZDSA 5L6YH 4GQRA 4MK0B 5F7BA 4CILA 1ORSA 2F9BT 3ZDYF 2WIIB 1DBAH 2GC7C 4XBMA 5BO1L 4BSVA 2XWTA 1GA2A 1R5IB 3MCKA 3L95B 4RISL 3V10A 1ID2A 2D73A 2J1WA 4OIAA 4UV4H 5C7XL 3CK0L 5DT1H 1EANA 1ZSHA 5JXED 5CGYC 1QHOA 5JOEA 3PGDA 1MZZA 4GO8A 3ZDXE 5CIPA 3GMMA 2RH0A 4G8IB 2G9KA 3LKOB 5D70H 4PGBA 5DHVA 4FG6C 4KNQA 3MRRB 4OJAA 4ANXA 4OCRH 3NACH 4KKLC 5T1KD 4YHLL 5F1KC 2NRDA 5LAPA 2PYED 1GAFL 5DJ6B 2OTUA 4GRLB 5TDHB 1I8AA 3BUYA 4OCXH 3RKPA 2NTFA 5EU5B 4YZFE 1M71B 5BXFB 1Q9KB 1BQHG 2H5UA 4F7CA 1Z9NA 4FTDA 3PWNB 5GQBA 3V5HB 4XVUD 3TV3L 3KWUA 1CGSH 2G3XA 3PHQB 4NI3A 2JQAA 3OGOE 5J5EA 5D1ZI 4EF3A 1DQMH 2Z7ZA 1CE1L 6PCYA 1O6FA 3SDDA 3QG6A 4DGUA 4JKMA 5I18H 4AL8L 1TJHL 3MOBL 3RWIA 1D2OA 3FQNB 4JZJC 3B9KC 3F6LA 4ZO7A 1HOEA 2N7SA 2H4EA 2XFGB 5IWLA 3GK8H 4HKZB 3LQAL 4L9LA 1KPVA 4NKQB 2AHIA 4Z23A 3LQZB 1I9JL 2BSED 5LBSH 1ZANH 3FCSB 1SHWA 1KB5L 1FGVL 5L2JB 1PCSA 3MO1B 2EDTA 4X80H 5FYKH 3FSWA 5EIVA 3PNRB 2VLME 5E94A 5I1JH 4ERYA 3LKNA 3PWVB 2FO1A 5AZ2L 1NBVH 2YAOA 3SQOH 2C3WA 1KIQA 3JTBA 1N4XH 3QAQA 1LNUA 1MJJA 4E0RA 4K9JA 1UH2A 3OX8A 2OMXB 3EYSH 2IFFL 2YJLA 4I89A 4G8FB 4KTDL 3V6FB 4FA4D 3LOWA 4Y2DB 5LUMA 3P0YH 3WFEH 4PY8I 4UMGA 5D7IB 3KL0A 1M6OB 4PJEE 4NKDA 6FABH 4WFFD 4ZMPA 4FQ1L 2AQPA 3QDME 2CJUL 3WNKA 3L8QA 5E08H 2K6ZA 5AFU3 4J12A 3U6RA 5KZCD 4BCYA 1CGUA 5C07A 1RI8A 4OJYA 1EHKB 2WN3A 2LGNA 2QVFB 4FWWA 5I0WA 1W9XA 5E5LA 4Z7WF 3RN1D 1SLXA 1J1OH 2A4CA 1XCQA 4P23D 3NP3A 5D6CA 4WV1C 5EBGA 2EE3A 3DV4B 4LVEA 1HHHA 2BLFA 4PB0H 4ZOBA 2FO8A 5GS1C 4ACTA 1JYXA 1TQVA 1SZNA 1KLUB 3BQVA 4LP4A 4V1DA 3ZO9A 2FHBA 4I0PA 5GRZA 3UXFA 3WIHH 1N6EA 1EHXA 4MHHI 5A6MA 2NNCA 3NZHL 2AK4D 3QJHB 4UQ3B 2FWLB 2HJKA 2VERN 1SVZA 2GUOB 5F7KC 2AC0A 3EGSB 1MCLA 5M61A 3VXMA 4FJ6A 2L7QA 5I6LA 2FDBP 5BRZD 1B0GA 3H2WA 4ZK8A 1QUNA 4PJ9C 1WO2A 25C8H 2XWBB 3DSFL 3C09C 3WTYA 4JVWA 3WELA 1EIBA 4K5NA 1FFOB 1BOGB 3RQ3A 4BFOA 3EGXB 4L48A 5K19A 3WFHB 4ORZC 4YXHL 4G7VL 2PXYA 3H9SB 5I1GH 5A2CA 3DX0A 4ELME 2H2PC 2G2RB 3RTLA 3RX8A 1EEYA 4MKMA 3WY3A 2A6DA 3DXAE 5TE6L 4NGHH 4LK4A 1Q9LA 4ZD3L 1HEHC 2UWEF 4OAWB 2OR8A 3QUZA 4X6CF 4QRBA 4AJYV 1AQMA 4RAUA 3QZWA 1R34A 1BFVH 2JB6A 4G5ZH 1TTFA 4Y5XC 4FKHA 5D7JD 3FJTA 2X0VA 1FH2A 4WFHD 4JRXE 1D6EA 1C5BH 3D48R 4GRWF 4WENB 2AITA 1QSFB 1XF3B 1MW3A 5F1OB 4HISA 2HX7A 2YAFA 4N6RA 5K1NA 4AM0B 1XFPA 1NIDA 2NNFA 1HHIA 2W60B 3K2UH 4C4BA 4UQCA 3SB3A 2AJSL 1OF2B 1NEUA 3MLWH 1MNUH 1YJDC 4IK7A 4L4TA 4N2IA 1XKSA 5B3NA 3TBYA 2Z2PA 5D1QB 1JZDC 3OKDA 5GSVA 4HCFA 4H0HB 2W18A 3S8FB 5D1XB 3CFBA 4HAGA 5F8QC 1OTTD 4PWJA 3JVGC 5IQOA 2IDSA 2IQAA 4NAMA 1R46A 1KEML 4OW6A 4BUJC 3TT3H 1KTDA 2F7OA 4DVBB 2XOTA 4E5XA 4BK5A 4ZPTA 2P8LB 5F8RC 1OB1B 4K8RD 1FE8L 4QWWC 5KSUB 5J4MA 5BZWB 5IEHB 2XVLA 1XIPA 5A2AA 1A1MB 2IGLA 4GMSL 5L4MA 1NSNL 4X0KA 2VLJA 3BRGC 3VFPB 1AHMA 3ULVL 1SUJA 2PPFA 4MX7B 4DP4X 2CMRH 1RAMA 1U8MB 5T5NF 2AV1A 1KNOB 4X9YA 1P9MC 4C55A 2P5WA 5IVXE 4P9ML 5EO0B 4YDJB 5DC4B 3WUWG 3S36X 2D7TH 4JO4H 3T2OA 1QG3A 1CICB 2X4TB 2AJVL 3VTAA 3GZPA 1IJNA 1F86A 3BUIA 3KJ6L 2VXQA 2JCCF 1J5OL 3MBED 4NQED 4RSYA 1RY7B 3PGCB 3PL6B 1ZEAH 2DWDA 1UM4H 3F7RA 4GS7C 3ESUF 4XNQB 3LTVA 3RDTA 4ELDA 4QHPA 4G80B 4CSTA 5EZOH 2BXZA 2XG4A 5F88A 2Q3XA 5IEKB 4OIIL 5KVGL 2ITDB 2XDHA 4MDJA 5AOIA 2CA3A 5C2BL 5C6TH 3BPCA 3L5IA 3H9ZA 4K9EC 5FYLL 4KI5E 2X89D 1L9SA 4AMXA 4WWKD 1T7XA 5FWQA 1PQZB 4JD2C 2QKIC 3W2DL 1AHWC 4U1NA 4HAFA 1IKNC 4NN5B 3VI4E 4ODHH 2WQAA 1W2KT 2QPSA 4W9LC 2QZ5A 5TE7H 5CZXC 1I8MA 2DQ6A 3DROB 3KPRB 2PYFB 3OZ9H 3NCBB 4YSTA 1A4JA 1SY6H 2J43A 2Y7OA 4LIQH 1JNLH 4NQEE 3H6JA 4LHUB 4KX8A 5F3HB 4B7IA 1KT2B 2CZNA 3APMA 1V3JA 4LLUA 3MRFB 4NZTL 3FQ4A 2VW6A 1MCJA 5ESQA 1QFOA 5EBLA 2KBGA