3FCSA

Structure of complete ectodomain of integrin aiibb3
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
Knots found
sequence length
959
structure length
913
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAASWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
molecule keywords Integrin, alpha 2b
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 199
structure length 913
sequence length 959
chains with identical sequence C
other databases KnotProt 2.0: Artifct S +31
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3fcsA02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3fcsA03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3fcsA04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcsA01
4Z7OB 2VDRB 2VDNB 1TYEB 3NIFA 2VC2A 3VI3A 4UM9D 5FFGA 4IRZA 5E6SB 4WK4B 4O02A 3NIGA 4UM9A 3ZE1A 5E6RA 4G1EA 3ZDZA 5FFOA 5E6UA 3T3MA 4O02B 3NIGB 2VDPA 5E6RB 4G1EB 4NENA 3ZDZB 2P26A 3FCSA 3FCUB 3K6SA 3T3MB 2VDQA 4Z7QA 4NENB 4UM8A 1L5GA 3FCSB 3ZDYA 3K6SB 3NIFB 3V4PA 4MMYA 2VDQB 4Z7QB 2VC2B 3VI3B 3T3PA 4UM8B 2VDOA 1L5GB 1JV2A 3NIDA 4MMYB 2VDLA 4UM9B 3ZE1B 2VDOB 1JV2B 3ZE0A 5E6UB 3K71A 4WK2A 2VDLB 5HDBA 2VDPB 4Z7NA 5ES4B 4WJKA 4JX0A 3K71B 4G1MA 3V4VA 5HDBB 4MMZA 4MMXA 3K72A 3ZE2A 4Z7NB 2VDKA 4NEHB 4WJKB 3ZDXA 4Z7OA 2VDNA 1TYEA 3ZDYB 4G1MB 3V4VB 4MMZB 3V4PB 3K72B 3T3PB 3ZE2B 3VI4A 2VDKB 3ZDXB 5E6SA 4WK4A 1M1XA 1U8CA 3NIDB 3VI4B 1M1XB 1U8CB 3ZE0B 4WK2B 2VDMA 3IJEA 3FCUA 4WK0A 2VDRA 2VDMB 4MMXB 3IJEB 4WK0B
chains in the Genus database with same CATH superfamily
1KJ2B 3MHZA 2HFEA 3ZKSD 4EI5B 1T7ZA 1DJGA 4FFWD 5D6DC 4WW2B 4X5LA 1SQ9A 4S1QL 2CLZB 2G0LA 5SWZA 2EKSB 4HKBA 3OB0H 5IB2A 3WY1A 3MRMB 4K2UH 4OAWA 4PW4A 3LJ3A 5DFVC 5GZND 1D2OA 2FX9H 5FV1L 4ODVL 4F9PA 4E5ZB 4K3HA 3VWKC 1KB9J 3Q5YA 5EBLA 4WDIB 3BP7A 1YEFL 2OYLA 1F6LL 2BDNL 2LHAA 3TN0D 1MCWW 2D4FA 2VWEE 2NX5A 4MKTA 3VRLF 4UTAH 2NR6C 2VIRB 4MMZC 5T5FH 3X14B 4ZUUA 4R7DA 3PWPD 2IH9A 3AS0A 3FCSA 1YG9A 3HMWL 1CC3A 1B4LA 5EUOE 3QUHA 4CY1A 4XP6L 5AVSB 5KSAD 2TAAA 2J8UA 5AL8A 4UAOB 4H8QA 1U8PA 2OP4H 4UU9A 2CM6A 4G56B 3GZQA 1TQUA 1PFOA 2UXTA 3NIFE 3JPXA 4G6KH 5CZXC 3N44F 1ND0A 4QOKB 4I18A 4YXHL 5F1IB 4JL1A 4YSOA 4Y4HB 3ML8A 2JQAA 5INDB 1KGIA 2NY7L 2P9SC 4DZ8A 2CUHA 1UTCA 4BKLB 5TDOA 4JGMA 2DYRB 2AJYL 2XICA 3EO0A 4HPOH 4EI5C 5KYXB 1YHPA 1UA3A 2OMTB 3TA3B 3VWKA 5CD5C 3RDTD 4X6DA 1B0IA 4QRUA 3GLAA 1VZIA 2ZXQA 3U2IA 4HFUH 1OE2A 4QHPA 5JOFA 5SXMA 4WSGA 1J05A 3OXSB 1TCMA 2ZZUT 4FFVD 3RGVB 1QNZL 4MMZA 3JB9L 1IFHL 1LEIB 4OZHF 4Q2ZB 4ERSL 5ACLA 4RGND 4Z7QE 1ZSHA 3L5IA 2CR6A 3EGSB 2NSMA 2EJ1A 2IAND 1YUHA 3GLDA 3BSZL 1YQ2A 3KDMA 3L5WA 1B88A 2WLIB 4ODWA 1AS8A 2HN7B 2EDFA 5FA5B 3CHXA 1LD9B 4NNYA 3U1QA 1CD0A 2JB6A 5GSAA 1U42A 4RISH 3QXDA 5L8KB 4HJJL 1EV2E 3FT9A 2R2CA 2ZUTA 2BVQB 5KVDL 3L4TA 4W1TA 2WXNA 4LLAA 5E4OA 4UAOC 1N0LA 1J48A 4K9EH 4RX4A 1ZCRA 5BUPA 1WP6A 4QKXB 4A11A 1B6UA 3F00A 3ULVL 4JFDB 5I1KH 5AVZB 4E9SA 2Y1VA 1KJ2A 4EI5A 4I0KA 1WBXB 4TQPA 3S4SB 4I0CC 3TA4D 2DAVA 1W80A 1HAWA 4WW2A 1FFOB 2Z92A 2CLZA 2EKSA 4GQRA 4E41E 3MRMA 1KYUA 3MLWL 2Y6TE 4Y9GA 5E4IA 4ANVA 2AK4D 3W39A 4OLXH 4AJYV 1CBVL 4E5ZA 3Q06A 2DIEA 5E2WL 2JTYA 2KZBA 4U0RC 4Q6YA 4PBXA 4PG2A 4QIRA 2IAMC 3WCYA 2D31A 1LVEA 5KVFE 3CDYA 2XQYA 2AK1H 3EYUH 4L3GD 3B1TA 4ESGA 3KGSA 1U8QA 4AOFA 3F84A 4X6EB 4NKMA 1Q72L 4AL8C 4EPSA 3ZTJH 2DMGA 5AYUH 4C55A 2HRPL 4JY5L 2DQDL 2XXCB 4HEPG 1QKZH 5D4QA 3LEXB 3IDJB 4R7LA 3TYGH 2EEAA 1AKJD 4IKNA 4ZNEA 4G55A 4OF5A 3CZUB 3X2QB 3QCTH 5F1IA 4B0MM 1NDTA 1O7DE 4P9MH 4Y4HA 4AOWA 3AACA 4PJEE 2VKWA 1CE1L 1U93B 4BKLA 2P3YA 3SY0A 1VGEL 5KYXA 4JFEB 5D4IA 3BAEL 2OMTA 3DHPA 3ISWA 1F2QA 3TA3A 1KDJA 1ZRUA 3UYPB 2HB0A 3RWGB 4AW7A 2F8IA 1F42A 3RGVA 3RQ3A 2B5IB 3S36X 2NQCA 1E4KC 3SKJH 1LEIA 2JELL 4MDRA 1PPIA 4F7TB 4Q2ZA 5AFU3 5FHAL 4BINA 2QZPA 2R8SH 3ISYA 1QI5A 3PABB 3PAVA 2FYVA 1X5IA 2WKOF 2MCG1 5FIEA 1GGYA 1TZGH 4PJXE 2WLIA 4ELMB 3L7FB 5JQIB 3WHE0 4Z7OA 4ZTPH 3VAEA 4U6YB 4C4KO 3U7AA 2APVA 1AYOA 2C9RA 2P9UC 1KJVA 4TVPH 4Y9CA 4GMSH 2BVQA 1FNSH 1I75A 4EBQH 2J5WA 1H9VA 1AR2A 3S5ZA 1N3NB 1X5XA 2Z0UA 4Y1AD 3DM0A 4JFDA 3MBWB 1CG9A 5BO1H 2AQNA 3TF7C 5D2NB 4QHUB 3TIEB 3S4SA 3HVNA 1UT1A 3CFKB 3EOTH 3OAUL 4Z3HA 3FN0H 4Q14A 1IAIL 2VLRB 4YSCA 4Q52A 1E4KA 2IBZY 1UWFA 1E9PA 1KEML 3O3DB 3PWPE 1SM3H 3V0VB 5ESQA 2ED6A 3BP4B 5DD1H 3HZVB 1ZEAL 4OQTA 1C7SA 2P9NC 5EM2A 2R0KH 3OHMB 2H26B 3FU3A 4ZBJA 1NICA 3Q8BA 1AC0A 2R4SL 1E67A 3GJFK 5GS0H 4X5RA 1KYDA 3QJTB 4X6EA 4Y19D 2DLEA 4GP5B 4PRPB 4GRWE 1MAMH 3QEGL 3EHBC 5DDHB 3UTTD 1XGPA 4HJUA 5DGRA 3CPLA 3KLAB 4H8WH 3ZW3A 4WWNA 1TITA 2UZYB 1BAGA 2WW8A 3T71A 1JNHB 5IZ7A 1ZD6A 4OD3L 1I8MB 2D7OA 3FU7B 1OP4A 3QIUC 1F41A 2YSTA 1JTPA 4IKJA 4ZZKA 3IWUA 2DYSB 3AITA 1XIWC 2QSTA 1DJXA 2BC4A 2E5EA 3TH3T 3PRZA 1U93A 4CY2A 5I6XB 5E2TH 4LQFL 4RMVA 3R7RA 5I28A 3DV6B 3E0CA 3VG0L 4JFEA 5C9ZB 4NHUB 1KB5B 4MA1C 3EFOB 5IBLD 4OGZA 4Z7UB 1G7HB 2Y5TB 4F33B 1QRKA 3RWGA 3QIWC 3DIVA 1SFHA 1NUDA 5I26A 4DP0X 3BLPX 3RWFB 1NFKA 3NPSC 2V9RA 3CX5K 3TIDA 4F7TA 1HHHB 3TX4A 4O9HL 4PJDB 1WWCA 2NMSA 3PABA 4OCYL 1QEXA 4OCRL 3KMDA 1Q9OB 3GQFA 3L2LA 3ZE0A 1WV7T 4AJ0A 5DJ2A 4AEHH 1C5DA 1I53A 4XNMB 5I8CB 4ELMA 2F61A 1HU8A 1QW8A 3WJMB 3L7FA 1LGVA 1A7PL 2JCCB 4HD5A 1S5IH 4A7GF 2ATKB 1OHQA 4JFQA 4U6YA 1UOOA 3NCJH 1IAIM 1EVUA 4QRRB 4XN8A 4IM8A 3WKMH 5C7XL 1YEKL 2W81C 2QBWA 4WJKB 1V55B 2BH0A 2X2IA 3EJUA 1DBJH 2N0KA 1NZRA 3N42B 1N3NA 1XIWA 4ZT1A 1AO7B 2IPTH 3QULB 4G7VH 4HXAH 3MBWA 4AI7A 2KUTA 3VXMB 3S88H 2AK4E 5D2NA 4QHUA 1KWGA 3TIEA 5EUKB 3UKUC 2ZIDA 3SHSA 3CFKA 4AGQA 3VE0B 3KYMB 5TPWL 3IJ7A 2VLRA 1MW0A 5E5MB 5DRXA 3S34H 2XA8L 1FCGA 3C6LC 2ZSVB 4JANB 1HQRA 3O3DA 3V0VA 2XYIA 4JZNA 3BP4A 3VD7A 4MA8H 3CZKA 3LZFL 1IKOP 1JVKA 4YZWA 5HDOA 3O4GA 2HYEA 4OI8A 4NPKA 4HJ0D 3WJLC 1MRCL 1ORQA 2H26A 4BUQA 2XY2A 3IIWA 2BFVL 2F1EA 2F1AA 3DIFB 3IS0X 3QDGE 3S9DB 2EDJA 4O3UB 2BX5A 5I9QC 3BZ5A 2VC2A 2XWBB 4FG2A 4N0YH 5IB3B 4PRPA 2ROXA 3BUTA 2AV1B 3WIFA 5DDHA 4NO2B 4DJMA 5F3HB 3RRMC 1CT8B 1KJ2H 5E8NB 1P6FA 1E3XA 4BWTA 5H14A 2UZYA 3R7QA 5KDOB 1JNHA 4BFIB 4ZFZB 1E8NA 4JUTA 4WJG3 2KLTA 2ZX9A 3FU7A 3S48A 3FQ2A 1E8XA 3RVWC 2YKLH 2OYMA 1LO4H 5I18L 1D5MB 2X4SB 25C8L 3V7AG 4CSZA 5J1AB 1YFQA 3F62A 2Y25A 5J7CC 4K3EH 1I3GH 3IXTA 2BHZA 4N0CC 1RZGB 4DGIH 4NHUA 2ADIB 1KB5A 2A9DA 3GBMH 3EFOA 1FL5B 3S3BB 5LG6A 3BWUF 4FEMA 3WNOA 1WAAE 4Z7UA 2VERA 3W2DH 4XTRD 3APFA 4NBYB 1BD2D 1Y0LB 1SHWA 2X5PA 3RWFA 1QBAA 2NT0A 2NYKA 5EU6D 1JVOA 3C8HA 4LMQI 4PHXA 3O2DA 1F3DJ 4X99A 1IC5L 2VDLL 4PJDA 4QTIH 5DS2A 1Q9OA 3CVIH 2DQJH 4GMTL 3UACA 2HRGA 4CN4A 4XNMA 4Z7VF 5DMKA 1WF5A 5CR1A 1ADQL 3IGAB 5I8CA 1N10A 3WJMA 3RP1A 5CFAA 1IGJB 2JCCA 3CU1A 5F97E 2J57A 4N1HB 4JFYB 2ZONA 5E9DD 3QFJA 4LEEA 4JRYB 4WJKA 1IC4L 3SMRA 4AV5A 2X42A 4AYFB 3ULVF 2X9XA 3FFOA 3VGEA 1JZ3A 1AO7A 1MNUL 3IEAA 4HJEA 4ZMPA 4GFTB 4B9PA 4LF3A 2XSKA 5EUKA 5C0BD 3ZE2B 3TXAA 2H3KA 3KYAA 4F2FA 3VE0A 3SDAB 3KYMA 5DHYB 4TNWF 1F11A 5KS9F 5F8QC 5E5MA 4AL8H 3T0EC 1PY4A 3CWGA 4K71B 4KAQL 5EZIH 4JANA 2YD4A 3HG1B 4V11A 4KZDL 2HJKB 3RN1D 4I7ZC 4PG9B 4IDLA 2BNUB 2P8PB 1HHKA 3F6JA 3ZO0A 1PQZB 1VKXA 1OL0A 4JJHA 3A24A 4KY2A 5HHNB 1MHHB 5DU7A 5BZWA 3DIFA 3MKKA 1EHAA 1WGOA 3CMOL 2YMUA 1K8DA 4RSVA 2XWBA 2A83A 5ICUA 3F5WA 3VXRA 2EP6A 2BSED 5F3HA 1W9XA 3S8FB 4YL9A 1HWWA 5DA0B 4JM4L 3SSGA 3SCMB 3PP3K 4HCIA 4ZFZA 4BFIA 5IFAL 5JW5B 2Y5EA 5PCYA 1ZT1B 3O3BB 3US0A 3UBXG 1S7TA 1U6AL 2NCMA 4BFKA 1N26A 1QSEA 4ONGL 1D5MA 2X4SA 4P23D 4DUXA 5F1KC 2EVJA 5J1AA 2YEVB 5M5UA 5IQ7H 2YR3A 4WY7L 4OJAA 1NAML 4OQTH 4ZXBB 1RZGA 5IJDC 5C71A 1XGYL 3BZFB 1FPTH 4FKKA 5HI3D 2DQTL 3I75B 4DTGH 3SDAC 2OPCA 4EOWL 1FA4A 5FYJD 2L8AA 4NJ9H 4APQD 1Y0LA 5FGSA 1VPOL 3CAFA 2JKSA 4K23L 5T1LB 5L0QB 1UASA 2G4EA 2VXQL 4UIKH 1ILUA 1CF1A 4OLZH 5SX5K 5CCKH 3K2UL 4B95C 4HP5A 2IGFL 2ZCLL 5LHDA 3BSGA 1NM9A 2DRUA 4YFDB 2P7TB 4G6FB 4MKMA 1N18A 4XPFH 5HPMB 4I1PA 4TVUA 1U8LB 4BM7A 4W81A 2FWSA 1E90A 2Z8WC 3I7OA 5GGTA 2ZPKL 1ESOA 4HIXL 5DGQA 3ARFB 4RMBA 2J1XA 5FO8B 4HGWB 4HJIA 3T6WA 4HWUA 1YQVH 5I5IA 3SCMC 2CBPA 2HX8A 1OGAE 4K07A 4NUMA 3ZX1A 3K6NA 4OGXL 5FS5A 1BQKA 4AE1A 3ZE2A 2XT1B 1J1OL 2LLNA 4IGBB 3MLUL 5IGOA 3L4VA 3SDAA 4XMUA 3ZDYB 4CVZA 3H7LA 1G7MB 4ZPTB 1ZA6B 3SZKC 4ZXBC 4KMLB 5DHMC 3RKDC 1YAZA 3FC8A 5F7UA 5IHUL 3HG1A 4PGZA 4J84A 4I0PC 4PG9A 4M62L 2E7MA 3WY3A 2Z2NA 1EO8L 2P8PA 3EI2B 1PQZA 2CQVA 1JK9B 4F7KA 5HHNA 2UV3A 2FECL 2EDEA 5CSZB 2F7QA 3WG7B 2VMDA 4DNUA 3ARPA 1A25A 4ISVB 4ODHH 2PW2B 1KZQA 3ET9F 5HXMA 1CD8A 4Y4KD 3CJJA 3ILPB 4BFJA 4Y7MA 3MRJB 1JDAA 3ZTJG 4RRPM 1WC7B 5EORH 4QCIB 5AW1B 1RUPL 1KZYA 1SVZA 1DBKH 4NRXB 4YLQT 5C0IB 1CR9H 2VN7A 2WQRA 3SCMA 5JW5A 1F1AA 2PR9A 4DT2A 1ZT1A 4KTDL 3O3BA 3QHTC 1QASA 3ARFC 2D7TL 3HE6D 5I73B 2H5UA 4Y16C 2ISDA 1M05B 1TQCC 2ATAA 2EDHA 3UPCA 2F7RA 4NKOB 5DFAA 5IMOB 1U8NA 5EU6E 4KVCH 4ZXBA 4HUCA 1N4XL 4DHLA 3BZFA 3Q2VA 3STBA 4PS4L 5IVXF 3WFBL 1LE5B 4KQ3L 5KVMC 4XNUH 3CFQA 3HPLB 3U48A 2VC2H 5AUMB 3LH2H 1ZJBA 2WYHA 5T1LA 4PJHB 1USQA 2H9LA 2P5WB 1TJIL 3GUFA 4UOW0 3UPRB 2N59A 4J2QA 1RP8A 5E9DE 1GTFA 2EVGA 3NZHL 2W80C 4XMXA 1M3JA 4N87A 2P7TA 3ZDXF 3AY2A 5HPMA 1QBLH 2WZPA 2EC8A 1JBJA 3RZCB 2R59A 4F2MB 5GS3A 2VM4A 1CS6A 5DJCB 3H9SD 5C0BE 3QJHB 3ARFA 1UWEH 5DVNA 3D51A 1I1FB 3BDYH 5FO8A 3IRPX 4HGWA 1KB5H 1Z9MA 2BCKA 3BUBA 3R0NA 3FT4B 4QT5B 1Q9KB 3LRMA 3MQIA 1PD0A 4Y5XB 1BREA 2FYYA 4FTVE 5FFLA 2NY3B 2YRPA 4OZ4B 2FX8H 3O2DH 4MK0B 4IGBA 1ZLEA 3I50L 5I1EH 5AVUB 1IFRA 2W9DH 4YSAA 1G7MA 4JPWL 4ZPTA 1ZA6A 1AQKL 3O3AB 2I60L 1NCAH 4UQ9A 4G6JL 3QUYB 3S36L 1NC4D 3TNNA 3VNYA 1E30A 1DCLA 1NCCL 4N86A 4TUKL 4EI0A 4GS7B 1J1PH 2CN3A 2LVCA 3QORB 3UEZA 3EI2A 1G6RL 1L6ZA 4RMQA 1QQDB 1UWYA 1I7RA 4H25B 5GQBA 5FQDA 4NQXB 4BK4A 1I8IB 1TJGL 5CSZA 4RFOH 1L3WA 4U05A 3RVXC 4JFZL 3ILPA 2GG1A 3MRJA 3ZL1A 1U4CA 4L1BA 3OR7B 5C6TH 3VGGA 4WFHD 4GQ2P 1UB6B 4NP9A 4OZUA 1WC7A 4JR9L 5A7EA 1YEIH 2YA0A 4ALAL 1GZPA 1E6OL 2M1KA 3P77B 3IMSA 3POHA 4G8GE 4WK2B 1NBZA 5JNYB 4P4RB 3KZ8A 1Q0XH 3E2HC 3FCUA 3B34A 4D9RE 2OK0H 4F15C 5EZPA 4MB5A 4XP1L 3SDDD 1KCWA 1GR7A 1K6QH 1RFDH 3OKOB 1LO5B 1BM3L 2GSIB 3IJEB 2ZKWA 3G5XB 3QIBB 4KX8A 1VFAB 4MXWL 2A9MH 5FYJE 3I02B 3D3VB 4GO8A 3OMAB 4NKOA 4LEOB 4XCFH 4DAGL 1VIWA 4UTCA 2UXFA 1L9QA 2K1MA 2XN1A 1T5KA 3UO1L 2DZEA 5SWSB 1FGNH 4L9LC 1WUZA 3HPLA 4TOYH 1BAFH 3H42L 3MJ7B 4NDMB 5AUMA 5LBGA 1Z0MA 3SYAA 1M7IB 4BSWA 2NYZA 3QUYC 2JKNA 1MJJB 3WNNA 4PJHA 2P5WA 5C08D 5T1MB 2WTPA 3VDBA 2H47C 2NDFA 1W0YT 3A5VA 3QORC 1NFDF 4BCDA 5FGCB 3ARED 1FSKB 2ILLA 4HUWB 4DSYA 3RFZC 1ZVSB 5BCAA 1JZIA 3CBJB 5AVYB 3RZCA 4F2MA 2IWFA 2E27H 3RHWK 2WOBA 1FZKB 4OLWL 3QJHA 4P2OB 4LSRL 1I1FA 4FA6A 5E03A 1RV6X 3FT4A 4QT5A 5T33L 1Q9KA 3ZKND 2VMEA 1FAIL 3AT9A 1FUNA 5D72L 4AIXA 1YRKA 4PB9L 1X7SA 5G4NA 4EZJA 4OZ4A 3I9PA 1E5TA 1QHOA 3Q0HA 4MZRA 4X6CB 3BZDA 4L9LA 2QLYA 3MLYH 5L2JB 4FDWA 1OAQL 3V8CA 4PLKD 1F4WL 2R29A 4A7UA 3JWDC 3O3AA 3QUYA 3DLQR 3MJWA 1RIHL 2A9NL 3K74B 4YQXH 3V6FB 5BXFB 2H47A 5H1MA 3LQAL 3QORA 3UG4A 1IGIH 1QSVA 3V95A 1YECH 1QQDA 1XHHA 3QG7L 4OCWL 5JHLA 1GOGA 1VZ2A 3K2KA 2A99A 4NQXA 4DQOH 1I8IA 4G8FB 1YMHB 5D7HA 5GGTH 2TRYA 5CXCB 1C5CH 1Q38A 5I5RA 3CN1A 2AXWA 2YPLD 4JRFA 4R97B 5AB0A 3ARRA 3VYNA 1H2XA 4NSXA 4OLUH 3FRXA 1A4CA 1ZS2A 4KROC 4OJFL 2X4TA 2XWDA 2SEBA 5T1DH 3PYCA 4Z0BH 1YNKH 3TO2B 3DGGB 5LCVA 1HX0A 2HFGL 5JNYA 4NZRL 4P4RA 1PGUA 3PWNB 5FM5M 3N0DA 2W0KA 2FLBT 4QRPD 4PRAB 1U8CB 1KCLA 1X5KA 3RWCB 4HC1L 4KFZC 2N56A 2F6AA 4E54B 5DQDH 3OKOA 1LO5A 2UY7B 2GSIA 3IJEA 5I6KA 3IFNH 3SD2A 3G5XA 1WBYB 3Q6GH 1HILA 3QIBA 1FO0B 4RWYH 1GCFA 4LEOA 1W0WB 3MPCA 2NY5C 4PCYA 1J8SA 5EUOB 1RI8A 1J0IA 4J3XA 1M4KA 1IX2A 1NGYB 5HGAA 2XQYG 4KKNA 2AABL 2VDRB 5KW9H 3V55A 3QPKA 5SWSA 4JGUA 1BZ7A 3C60C 5IESH 3N2JA 2E6QA 3MJ7A 3B9EA 1I4FB 2OTUB 1M7IA 5CKGA 4RMSA 2YUWA 5FWRA 2WNXA 1MJJA 1UD5A 4KK9D 5CEYB 1PIFA 2JTDA 3BG0A 5T1MA 3T6ZA 5CJOH 5AKVA 3I84A 1J5HA 3H9SE 3KH4A 3FU9A 3FYIB 3FUKA 3S5LA 2AQSA 4X9BA 1TUPA 4H5IA 4HUWA 1ZVSA 1TQBC 4XPAH 3NT0A 2OSYA 2QVFB 3LKNA 5EDSA 4HIJA 4M29A 1FZKA 3L9RB 1KBPA 5T3ZL 5EFIB 3HEIB 1TF4A 1TTRA 3BD3A 1SJMA 2FJFB 3BO8A 3HBGA 5ALCL 2YD6A 4PY8J 1H5BC 3LKPB 1YEEL 3C08H 4Z7QB 1G6VK 3FFCA 4Q7DA 2Q2LA 3NEXA 1SUJA 3GSQA 1P6AB 4P5KB 3UKRC 3IDXL 3ZGHA 4EN2A 1TVHB 3BKCL 5FYLH 3VCLB 5L2JA 3KBFA 3C60A 5CF3A 1GH7A 3KXFA 5SWQB 3HB3B 4BSVB 1G0YR 3OJDB 4B9JA 4NYLB 3FF7A 1UOPA 2DM4A 5CGYC 1KNOB 1XD1A 3V6FA 1U3HB 5DWUH 1XXFC 2AQ3A 5CIPB 1B3JA 4AQ8A 3MBEB 3DHJA 4F93B 4GQ1A 3KH3A 5HY9B 4G8FA 5GRVK 1YMHA 2VZOA 1FZMB 5I15L 3RAJL 5CXCA 1R0AL 4N2OA 1QYGL 2J88L 3U79A 4LCYB 4JAMB 3RI5K 1B2YA 2VM9A 2Z31D 1CE6B 1MCEA 2YGVA 3TO2A 3S4SG 2GJPA 2HMIC 5I1HL 3T3PE 1NOLA 1H5BA 4QHMB 1AAJA 3PWNA 2CU9A 2ETWA 4PRAA 4Y2DC 1U8CA 3RWCA 5C6PB 3V7MA 4E54A 1HHJA 1IE5A 5FGRA 4RGMB 4W9FC 4A55A 3OC5A 2WXHA 4NM8H 4AT6A 2UY7A 2XHNA 4JVPA 3GBLA 3JV4B 3FONB 1FO0A 3F3HA 3D33A 4XI5C 5J3HD 4V2BA 1LQBC 5EUOA 5E1AA 3HA0A 5C08E 3VH8A 4HPHA 5C92A 2LU7A 2VDRA 3IFLL 5JOPD 3SKOB 4AEFA 3HB3C 2EDKA 3SQOL 1I4FA 4W70A 4ES0A 4BP8A 1Z9LA 2G99A 2YFNA 2UVEA 4YSTA 3UAJC 3NIFA 5CEYA 4KRPC 4F57L 2UWEE 2AJVL 1BDYA 2H9GA 3ARWA 2CKBB 1EAJA 1ZXKA 4J6IA 5FFGA 5C0EB 2CR3A 2YD5A 4YDIH 5AVTB 5D7LD 4PJEB 5I2IB 3MLSH 3OZLA 1NL0L 3EFDH 1HL4A 2KL6A 4JRXA 4WF7A 3FFDB 4KV5F 3NEOA 3O2VL 4Y2DA 1UZ6E 4MXQC 3BSHA 3I9GH 3BZ4A 2JJTC 4LNRB 5EFIA 1BIHA 1I1YB 2FJFA 1HINH 2VW4A 3ARTA 3LKPA 2B08A 3DHUA 4Z7QA 1I1AD 2Z7WA 3ARGC 4PRHD 4ODXA 3P02A 1GW6A 1UJTA 4OBSA 4FABL 3VFMB 4RGMC 2ZUSA 5I8KL 4PJXB 5JHDD 2BY0A 4JE4B 3VCLA 1F45A 5TFSL 2C26A 5SWQA 2DWDB 3U2JA 1NSNH 4BSVA 2BHYA 3OJDA 2VQ4A 3CZGA 4NYLA 4O5LH 2IFFL 3UTQA 1KNOA 2IBGA 2ZXGA 4POYA 3O6LL 2YRLA 2NY4C 2MMXA 3GUTB 1T0NB 2ZP8A 3MREB 4PSRA 1FZMA 4NI3A 1OAZL 3L4MD 2DL9A 3FQYA 2PTTB 3CD4A 2CO2A 5IQNA 4MJ2A 2V3FA 1T66D 4L4VE 4QRPE 5L6YH 3D4ZA 4LLMB 3WUWB 4Y89A 4LCYA 1OPGH 3EJPA 4UTBA 1PSKL 3TN0B 1CE6A 4E41A 1PCSA 3HUJA 4L2YA 5FLUA 2FBRA 4QHMA 2X0UA 3FTUA 1L7TH 3PWPB 1GPOL 2B7DT 4Z8LA 3ARGA 5E56A 3K6IA 2R29H 4Y9FA 5CP3A 5KSAB 5CUSH 1DVFD 2V6HA 2IMNA 4KDTC 3JV4A 4PU2A 3DPBB 1WITA 2CALA 5EWIL 2W65B 4KKCC 1RCYA 3IK2A 3ULUH 1K2DB 3IGFA 3SB3A 1S8DB 1J87A 5D1QE 1KJ3L 1CZ8L 5D9SB 4GRWB 4I5BA 5C86A 3VW3H 3TGXA 3BVNB 4JUSA 4GW4B 3TV3H 4XAWH 3T0VA 2VLKA 2W94A 3FO0L 3JTBA 4UMGA 4UYQA 2MQ3A 1MRFH 4AJVA 1J9TA 3N6YA 5LCVH 1Y6KR 3P3YA 3RDTB 4B9ZA 1MCDA 1K8KC 5JDJA 3VSUA 2HRHA 4OM1H 2Y4SA 5GGRB 2FHFA 3P0YL 3E1ZA 3DUHA 4OFPA 4A2DA 5DYOB 5B39B 1BQLH 1M2OA 4BZ1L 4EEEA 4LNRA 3JWDH 1OD7A 3MJGX 1I1YA 1HJBC 1FE8H 2A74B 3C75A 3B1UA 4KDTA 5IBUG 1BYNA 2ARWA 3H7BA 1CLOL 2O26U 4NQSA 2IDFA 1G0XA 1VENA 2KH2B 2H6PA 4AMKL 3ZRFC 2J56A 3PV7A 4Z7NF 4LLDB 4PJXA 1AGEA 2XN9D 4DEWA 3D34A 3DTDA 2FBJL 3VG9B 4M6ML 4KJQC 4N14A 3KYNB 2KZWA 3L4OD 2X4NB 1LTXA 3AQYA 2J57G 3KGTA 1PU0A 5D2LE 2G3NA 5IQOA 2H3NB 1SEQL 2VW6A 3FQXB 4UM8B 4PY8I 1JDCA 1WO2A 3MVSA 5M5VA 3VGBA 1QG3A 1T0NA 3Q6FB 3EYOB 3D52A 3LN9A 4XWGL 1OAKL 3MREA 3KR3L 3MXVH 4IYKA 1NCUA 4PR5B 2QR0A 3H4HA 2PTTA 5IEHB 5EIIG 2AK4B 4QXWA 3ZE1E 4LLMA 1BVZA 5AKRA 1JL8A 4PVNA 4MD0A 2V7HB 2NY5H 3QUGA 4IRJB 5DVMA 1EJOL 3ZKQD 4DCQB 2ZCKH 3RVVC 1Q9LB 3HC2A 5JO5B 4DIXA 5I0ZA 1CTMA 3S2AA 4K5NA 3PWPA 4HPYH 4ONOA 4WEBH 3N41B 4Z8FH 1X5MA 2V5RA 3GZOA 4L4JA 2UY6B 5KSAA 4WRLA 5HDLA 1INQA 5JOPE 2YAEA 5I6MA 3I85A 2GK0B 1YEDB 3DPBA 5EEZA 1FLTX 1JD7A 3NFPB 4WJ5A 4E36A 1MVUA 1RPQA 3QDGB 4Z7IA 4AG4L 2K9FB 1K2DA 4F8TA 2GIMA 1S8DA 1AKJB 3G6AB 4YC2B 2DWYA 3WD5H 4KKZA 5JIDA 5KSVA 2DWEB 5CILL 3QRLA 2Z8VC 3FKUS 3BVNA 1SOSA 1BLIA 2CGZA 5CJBA 5D7LE 4XB3A 1T1XB 2Y7NA 3QCVL 2E74C 3U0WH 5DVKA 2C7FA 4D0DA 5EU5B 2YFOA 5IEKB 1PZSA 5CEZD 3RDTA 3QUXD 1WA1X 1TLKA 5EU4A 1BX2B 1CVRA 1WRFA 2VXUH 3O81A 5AAPA 4PJGE 3L3IB 1LO0H 3RWEB 5GGRA 2ITFA 1IIIA 1YNLH 2R4RH 5HD8D 4TLUA 1N68A 3VMNA 1TJHH 1UKQA 1RH8A 1FO0H 1NMCC 4X4ZA 1CDBA 1RIUL 3HIZA 3GWJA 3EXJA 4PGBB 2OSXA 3MXWH 4IRJC 5JHDE 1CK0H 1YEWA 2R7EB 1MIEL 3PV6B 1EHLH 2VDRH 3RL2B 4G3YH 1G9MH 4M7KH 1KTRL 1OTTC 3CHPA 4YDZA 4FMKA 4WI8A 5DD3H 2L7EA 4WHTB 3IT8D 4ZN4A 4LLDA 2NXZC 5B8CB 4UZSA 4AVJA 1K85A 4L8SB 5I6NA 4I3RH 3PNWB 5TQ2L 2EIEA 1B4RA 1FYHB 1SMDA 3EJSA 3KYNA 4ZUSA 4UQ3B 5AOMA 2X4NA 1PD1A 1RZFH 5JIHA 1FIGL 2H3NA 4UM8A 1VFMA 2YRZA 4KJWD 1U36A 3A4AA 3OPZL 3Q6FA 3EYOA 4DNWA 5FO7A 2AMGA 2IAAC 4D9QD 1EDQA 1U8HB 3HZKB 5CM1A 4LIQE 5IEHA 3QEHB 4NWUL 2AK4A 4JDTL 2AJSL 4N90E 3IULA 3FTWA 4P8QA 4HF5H 1HI6A 3GEFA 3RG1C 2P24B 3UC0H 1R3HB 5GMKn 3DSFL 4M5ZH 2V7HA 3MTRA 1IVTA 4IRJA 3WNMA 1YPZF 5T5NG 4DCQA 5JOEA 4BCCA 5D7EA 3MCKB 5JO5A 1FIEA 3FTGB 4IIZA 4XBEH 5C2VB 1UC6A 4Y19B 3LN4B 2JSFA 1WWBX 2VYRE 4K3JL 3UTTB 3BRDA 2R1XB 1AI1H 4DETA 3IUNA 2GK0A 1TTCA 1YEDA 3IAPA 1RZKL 3BCDA 2BCMA 4R4BA 3QDGA 4P5MB 4H88L 4G72B 5E5UB 3X1EA 1FBIL 2G2RA 4PYGA 1AKJA 3G6AA 3SPHA 2OK6A 1DQDH 1J0HA 2Y23A 4JPVH 1DVZA 2BIPA 3CFCH 3DETC 1Z9OA 4L8SC 4OBRA 5CBAB 3HHMA 3MLRL 2A4EA 4S10A 2HPOA 4CMHB 1T1ZB 4UTBH 2IAAA 4HG4J 1IBBA 1ITBB 2OMXB 3B37A 2F1BA 4X8JB 4MD5A 4XP5H 5EU5A 3MLXL 1NGQL 3DIDA 1BX2A 3V0GA 4AJWA 3SDCC 4PP1C 5DLMH 2EYRA 3RWEA 3TJPA 4JHPC 3LXBA 1ZANH 2CH8A 4P04A 4QUOA 3T0AA 4GSQA 1HE7A 4OSUH 4N28A 5BQDA 1SMOA 3NJMA 1U0QA 1WAAA 4PGBA 1Z9SB 4TPRL 5A2BA 2XN9E 2WO4A 1BOGB 1AD0A 3ASNB 2B5NA 3RL2A 2HRLA 3OMZA 3ZDYF 4U1HB 1BMWA 1UXWB 3KPOA 1P5UC 5FAAA 1OGSA 1DBBL 1YDPB 3JT2A 5CLWA 2IF7A 5D71H 1QFMA 1XCTB 4WHTA 1ZDSA 4YBQD 1B9ZA 4FKHA 2JQZA 4XRCB 3ZL4H 5B8CA 2XKSA 3REWB 1QFOA 3PLYA 3QC5X 3VH0A 4L8SA 4JQXC 2FX9L 1NC2D 4ZQTA 4OLVL 4GKSA 4MVBC 4MNQE 4PJ6A 4MJ6B 3AL9A 3EJRA 3NEEA 3MNVA 3L81A 2OQJB 3F6LA 4HW6A 4J8BA 1FL3B 2MEJB 1TSHA 2RHEA 3C5SB 4RA3A 4FQJH 2R27A 1RUKL 1LEGB 4AGMA 4WWPA 2E7CA 2Y1AA 3ZZSA 1OGAB 2CDGB 4J3VA 4XMPL 3QEHA 3C75H 2J5LB 4L23A 3Q3GB 2ZXAA 1HS6A 4D9SA 2P24A 1R3HA 3I6SA 5IMMB 3WGUB 3C09C 3NAAL 4OFYD 4Z76B 5D5MB 3FPYA 2XG5B 3LH9A 1O0VA 3MRGB 4EIUA 3GYRA 4X4YB 4JCMA 1K5NA 2J56H 4G6KL 1EWHA 5CCJA 1P5UA 1IGCH 1JTOA 3FTGA 3OPUA 2GSGB 4MB3A 4HBQA 2BHUA 1RMFH 5DJXB 3LN4A 1F02I 1RU9L 2R1XA 1BVKB 4W9HC 3TOPA 4UINH 2IADB 3S6CA 4E2OA 2VDPB 4D9LH 5AOKA 6CGTA 3U83A 4P5MA 1IBZA 1BBDH 3ZSTA 2BNQD 3LNFA 3SD5A 3SDXE 3PSCB 3B8YA 2VE6A 2J6WA 3OZ9L 5CBAA 2CKBL 1NKOA 1X5FA 2OL3L 3TL5A 4XNYL 1EMTH 1T1ZA 4UNTA 4B60A 2X3BA 1I1RA 3KLDA 3CN3A 5AG8A 1BPOA 4X8JA 3CSPA 4MXVE 5DZNA 3O9WC 2XIDA 1KUMA 3M17A 4JE0A 4GT7A 5BOJA 5F44A 1BD2B 4IU3B 4J3WA 4BA8A 5EU6B 2VO8A 1RULL 1Q8MA 2VUKA 4ZG1A 5HYSB 1A9EA 3HR5B 4F3FB 3CN0A 3B7SA 5FCUL 1G5AA 4K9EL 2X12A 3IUQA 1BECA 1Z9SA 3MV7E 4NP4H 5HI5D 4FERA 1BOGA 5B7FA 4JHAL 1D6EA 2L3BA 1Y18A 2VR4A 2W0PA 3BUYA 4U1HA 1UXWA 3LH8A 3HG5A 2NOYA 1A6UH 5E9DB 2WXQA 4GM9A 4QY8B 4MRCA 4U7SA 2I0RA 4M7LH 2JE8A 3P4MB 4JO1L 4XVUC 3FU5A 1MFCL 4NZUH 5L9DH 1CLYH 4WWKC 4JHBA 4KZCA 3CBKB 1D7FA 2FO8A 4D9QE 2BERA 2EH7L 3L9EA 3NCWA 4MJ6A 4UQEA 4DPBX 3OKTA 1VFBB 3BLBA 3ZJAA 5E24E 2FUQA 4BZ2H 2JF1A 3HBZA 2ATPB 2AV7B 5C0BB 1ZIAA 3C5SA 4BFNA 1RLBA 2PO6B 3NJLA 1LEGA 3EYUL 4HJ1A 1DL7L 1OGAA 3U46B 2FSEB 2CDGA 1FFNB 1S3KH 3FB6B 2HT4D 4EUPA 1GXRA 1KCUH 3FMGH 3JTSA 4U1EI 1GTNA 2FEDC 2CJ3A 3RILA 3Q3GA 3DGCR 5AYUL 4NC2B 4JS7A 3IDNB 4WGVB 3W56A 1E8MA 1PZ5B 3CZSA 1QKZL 2XG5A 5EZJA 2I24N 2XTLA 3VACA 4X4YA 3EYQC 5T3XE 2IQ9H 4LAQL 3N1QC 1F2XK 3QJUB 1TKWB 2GSGA 4FZ8H 2KKQA 4YBLC 5DJXA 2FB4L 5I0VA 1FG2B 4DP8X 2XQ0A 4CC1A 1BVKA 5DK2A 3LD8B 1ZGLM 4N2DA 3DJ9A 3LRHA 4WWKA 4BWWA 3ZK0A 5EC2B 2R56H 4H8HA 1PEWA 4M5YH 2FR4A 1T1YB 1BZ8A 4A2EA 5I71B 1AQ8A 4LP5A 3M46A 1A0RB 3N40P 4TQ8A 3Q2NA 2WSPA 3EYSH 4X7FC 1UM4L 1SLWA 5BRQA 3AM8C 4P23B 3GSUA 5C0DB 1MFBH 4TS6A 3KVQA 3K71B 2VL5B 4KMTH 4MQSB 3W11D 1FNFA 2BVPB 3U4EB 3AWFA 1BXVA 3X17A 3NA9H 4PVBA 1K3ZA 5AW8B 4U1LB 1O9ZA 3L2NA 2PO6C 3W57A 4LPCA 3L5XL 5FM5O 2IUVA 4IU3A 4ZMNA 1RD6A 3WFEH 5EU6A 1MCOH 4EDXB 1CDIA 3FGBA 5I74C 3HR5A 2R2BB 4F3FA 3TEZA 1GYAA 5MENE 4PRID 1AVAA 1B3IA 4C59B 2LFGA 1S9KC 3M1OA 3ORJA 4TUUA 3O45B 4L3EE 3PWLB 4X6CF 5DS1A 3WGVB 2KPNA 3HNTH 5AOZA 1FFTB 4JJOA 3E8UL 4IBTA 32C2B 8PAZA 3KVPA 3IF1B 5LGKA 3GXIA 5E9DA 2CNYA 3EOTL 4QY8A 5HJ3A 2DQ6A 3FN0L 5TGBB 3FDWA 1ZOXA 3LD8C 2YRBA 5GS2D 1AZVA 3MUUA 4HIEA 1D3CA 1U2CA 4NUPA 4KNSA 3S5LG 2X4UB 4IKIA 5I71C 4YHZH 2QQKH 1ES0A 2DIJA 4NQVB 4PMEA 1MF2H 4TF4A 4AK2A 2ATPA 2ZE0A 1WQVT 1XL4A 1ZE3H 2R0KL 4YUEL 5C0BA 3RTQD 3TNMA 4ESKA 4CN1A 3FUNA 2PO6A 4XNZC 1KCRH 3F3PA 2BW5A 3U46A 2FSEA 1FFNA 4E9XA 3FB6A 4FTVA 4E5XB 5L4FA 3OWEA 1J0JA 2XU7A 5DRNB 2DYPD 4N2AA 4O02B 4UZGA 1V5JA 3CFSB 4H8WL 4S0SD 3IDNA 4PLNC 1PZ5A 3DO3A 3T4YB 3BESR 1JPTH 3EO9H 1TPXB 4FHBD 3ZYIA 5A2CA 4OFVA 5GISH 2ALAA 1TKWA 1OB0A 1NBCA 1S9YB 2BNQE 3IKCA 1H9DA 3VFUB 3QR2A 1UH3A 2ICEC 3RY4A 3WE1A 1FG2A 2IO5A 5KSBF 1MNNA 2BSEA 2YO3A 3GXNA 3VGDA 1OZUA 4XGZA 4TRPH 5E8EA 4OZGE 4Z3GA 5E23A 5EC2A 4JKMA 5A16A 2UUDK 1T1YA 4C56D 5I1GL 1MI5E 1V54B 2J20A 4ZNCD 2OA9A 5FLVA 5CSBA 2OJZL 3HE6B 2CA3A 4QXVA 2ZUQB 4F2EA 1T20B 4P23A 4G8GA 3MUNA 3K71A 2AQ5A 2VL5A 5FLXg 4RLDA 2BVPA 2VZUA 5CGTA 3U4EA 5I23A 4IBVA 3X1BA 3NCYS 3KBPA 2H7WA 5AMSA 1AHKA 2KI6A 4XWOC 4U1LA 4FFYA 4LSSH 5FOBB 2OTWB 3HE7D 3MN8A 4P5SA 4P5TC 4LVNC 5IQMA 5FCSH 1MLCA 5E9AA 4XB7A 3NCJL 4EDXA 1GRWA 2VUYA 5DJ0B 3WKML 2FLMA 3X1FA 4D0CB 4MA3B 2MOVA 5E70A 1VESA 1B2WH 1CI3M 2A7BA 2ICEA 3O45A 3PWLA 3VH8G 2FUTA 2IPTL 5ESAA 3RIAK 1TPXC 4HXAL 1XGTB 4H5JA 3ZTNL 2LU4A 5KN5A 1ZTXE 3QI9C 3TASA 5TD4A 3SQBB 32C2A 3VQ2C 3IF1A 1OAUH 2DD8L 3EUDA 1H2YA 1L9TA 3VRLE 1KLGA 3H9SB 4L8CA 1MCQA 1PVHA 2LQRA 4ODSH 4XHQA 5TGBA 2Y22A 4O51B 1L9OA 5DJ8A 1BV8A 1HCVA 4N2CA 2F9BT 1NEZB 1WZLA 2X4UA 1G9NL 4IU2B 2EXSA 2PW1B 5C09D 4S2SA 4YO0B 4NQVA 3SPJA 1JHTB 1EO5A 1CWVA 4P2RD 4Z95H 3B2UC 1JGIA 5F7MC 2ZUQC 1IAMA 1UGNA 3NACH 4W6WB 1EZLA 2ERJC 2XWTB 2D2CC 3AW5A 3QUZD 4ZUVA 4E9YA 5EF2A 4GIOA 4DGVL 4WNJA 4N22A 4N2FA 2M26A 3MLVL 1AQDA 4E5XA 1NC4B 4NFDA 2OM5A 3S2CA 1R19A 3ZGIA 3UP6A 2XZQH 2K4AA 3CSTA 4O02A 4AGLA 4B50A 2NY6D 1KCSL 4G6AD 4NQCE 5HGDB 4KJPD 1WCQA 2HG5B 4NGHH 3T4YA 3PU7A 4UAHA 2WWNA 4BGDA 1IQDB 1M7UA 2NTSP 3U7YH 5HVHC 5LVEA 2H6OA 2QV2A 3SPVB 5LNEA 1NCTA 3VFUA 4LPUA 1A0QL 5H2BB 5C97A 5J89A 4C47A 1HESA 4XPTH 4PW9A 2AXJA 4ZODA 4OZHE 5EBGA 1CGTA 1J5OH 2WLLB 1CO1A 1MHCA 3P11L 4DGIL 5ECGA 3CFDB 5CYKB 5FW7A 2QSQA 4X42A 5IGXH 5KEZA 3ECUA 3SDDB 2XWEA 5KBMA 1N6FA 3FB8B 3HE6A 4MFHA 4LSPL 4EUPH 1T20A 4PJEF 1SDYA 4GB9A 2GSMB 4LSTH 4QF1B 2AMUA 3TVMD 4A2HA 3UPAA 3GS0A 5DR5L 5I1IH 4XCEB 2DQMA 1N8ZB 3KPQB 5HHPB 3JVGC 1AJ7H 2CRIA 2ZOUA 5FOBA 3VFVB 2OTWA 3R06B 3OAZK 4POZD 4LSQL 3MZLA 1CIUA 3GSRB 2WP3T 5DJ0A 2EIMB 4D0CA 4FG4A 4W9GC 3MMYA 5C08B 4HV8B 2CWRA 5FM8A 1TOXA 2P80A 4MA3A 3NH7L 1CFVH 2WP3O 1MQKH 2YEZB 4AQOA 1H3PL 1U8IB 2G3XA 3B8SA 1PI6A 4K8RC 3AREB 4B9IA 3SYQA 2D7QA 1J0KA 4ADIA 2OZ4A 1XGQA 2FRGP 1HKLH 1V7NH 5JIMA 2PYEE 2ADYA 3SQBA 3H2PA 1R33A 2UWEB 3EJJX 4N5EC 1B0GB 2EDDA 4J8RA 1WJ3A 3H9SA 3G6DL 4O51A 1N5YH 2XQBL 1KV3A 2F8XC 4AL8L 4YSSA 3ATBA 1ZVYA 1FVDB 3VGFA 3VD1A 1T5XB 4D0BB 4R83A 1L7IL 4IU2A 2PW1A 4YO0A 3PS6A 4GI6A 3KYOB 1ZT7B 3QJQB 5BV7C 3LPWA 4GSRA 1S7WA 3QPQD 1BZOA 4ZS6D 2YD3A 2CLVB 2OMUB 3U9PH 1F86A 5ID1B 2C3VA 1C5BH 2Y9RT 5LBVA 4J7RA 5F0MB 4G42A 1QFSA 1HH9B 4AKQA 1TNMA 3ES6B 4GRMB 4A7TA 2FATH 2XV2A 1QA9B 3U1SH 1NWOA 4LLWB 4RMRA 1S6NA 2G9KA 3JWOL 4FZEL 5JYMA 2HG5A 4NZDA 2YAHA 1UA6L 3L16A 1OALA 4QLRA 3JZHA 4PBYA 4S11A 3M6DA 2AW2A 3WXWL 3SPVA 4C56E 5H2BA 3EBIA 3RA7H 3FRPA 4MS8C 5FPIA 4E9QA 1NIBA 3H9HA 2E9BA 3LNHA 4Q9QL 1A6VL 3ILQC 1IT9H 1DVYA 2XNAA 3UYRH 5JR1L 4MA7L 3CFDA 3GHEH 4M61B 4QRPB 3BAYA 5G4MA 3EKCA 3L3KB 3SDDA 1P7QD 3FB8A 4NJ9L 3CXDH 3X3FL 1IARB 4B7IA 5ID0B 3UMTA 2B9BA 4JZJC 4DWHA 2E8YA 1ASPA 2VLLB 4LRNH 4MQXC 1RUMH 3D50A 3T3PA 4QF1A 5DZVA 4QHNB 1MJUH 4WTQA 2AH1A 3NQKA 1UATA 1V3MA 4Z1PA 3BVUA 3DTUB 2HJFA 4N8PA 4NAMA 1N8ZA 2Z8RA 1J88A 2HT2C 3KPQA 4U1GB 4XCEA 5DD5H 2BJMH 1P4IH 3VFVA 3R06A 4JPIA 2JIXD 3V0WH 1E5CA 1G7IB 1JNNH 3JTTA 6FABL 3OV6A 3GO1H 2K7QA 4YX2L 3SGJC 4N6QA 1SHSA 3KWXA 2AJUH 2DM7A 3CLEH 3GSXB 1RJYB 3SE8L 2KHAA 4UDTA 1RJZB 2FTAA 4N8UA 3J2PA 5D1QB 5C08A 1HL5A 5F0LB 3ULVD 4KXCA 2WLYA 3V4UH 1IC1A 3O11B 2BS9A 4UQIM 2NY2C 2YEZA 1JOFA 1U8IA 2R9HD 5JIPA 3AREA 4WO0A 4IBQA 1A22B 2ENJA 3E0GA 4YS4A 5GZOC 2DEXX 3K4AA 1S9XB 1NCBH 2UWEA 2B2XL 1JF1B 2GW5A 1B0GA 5C09E 3LEYH 1SF5A 3DDFA 4P2RE 4U6XB 5DCCA 4GY4A 2N1TE 4HEME 1L6XA 4Y7OC 4NXKA 2JQMA 4O1QD 1FVDA 4CC9A 3V0JA 4FFYH 3ABLB 2WXFA 1T5XA 2E4FA 4D0BA 1F90H 3WE6B 4DKEL 5FYJH 1GGUA 4YSPA 4JY6B 2NXYD 2PCFB 3KYOA 2X1PA 5F7KC 1ZT7A 1DQQB 1NINA 4LASH 3SGEI 1FWXA 3HRZC 1G0DA 4YL4A 4YR6A 1SMAA 1HYSD 2OMUA 3MOBL 5ID1A 1JGUL 4OW6A 5I5MA 3SGJA 3SO3B 4OCSH 2HCZX 5ANHA 2VTFA 1E4XH 1UXMA 3BIKB 2GHWB 2OV0A 1IAKB 4X4XB 1HH9A 4OB5H 3ES6A 1X5YA 4GRMA 1XAKA 2XACC 3BX7C 1DUYB 3EDJA 4O2CB 3BUIA 5ANME 5DZOA 1JYXA 3KLHD 5DYFA 4TN9A 2HWZH 2Y36L 2CUAA 3GFCA 1SJEB 5GSRB 4D94A 4F37K 1L9SA 5GZOA 1CTNA 5D1QC 1CICC 4DK6A 5ABZA 2FLRT 5D2LB 1E9QB 4JEGB 3ZWLB 4OD1H 3NOIA 4JFFD 1F3RB 2B77A 2VQTA 2XZCH 5T1JA 2Z31B 3ARDD 4ZQKB 2XWZA 2L7JA 3D0VB 4ABVA 1U58B 3GTVA 4L4VA 1SNRA 4QRPA 5EU3B 3L3KA 1T04B 2FWUA 3IFOA 3DWTA 4J4PC 2Q3ZA 5DUPL 1MUJB 5ID0A 4LOFA 3NABL 4TQIA 1QLRA 3LH2L 3V8OA 1IFGA 5FOJA 2XWCA 2VLLA 3C5ZB 4O02H 4I79A 1UFUA 4OFDA 3DMMD 2B0SL 3Q2WA 4BCYA 1ZHKB 4HLJA 2FEEI 2K8QA 1NCIA 3KLKA 1G7IA 4KHXH 3T08A 4PAZA 5I76A 1QBLL 3WY2A 3SO3C 3BW9B 4ORGB 4X5WA 2VR5A 3FTYA 3GSXA 3K2MC 3DRTA 3N1PC 4KJYA 4FA7B 1RJZA 1XV8A 3P4OB 4BZYA 5D1QA 1VA9A 5KTEL 3V52L 3TCTA 2XPYA 3IPBA 1TJXA 3BDYL 1NGPH 1GAFL 2ICCA 4WGWB 3U6RA 2AJ3B 3CHSA 3R18A 3BH9B 5D7LB 1DQTA 4K7PH 4H8UA 1MVYA 1UJ3C 1WIPA 2ED8A 43CAB 1S9XA 3SJVD 1XB8A 2ZQKA 2Y7SA 3X3GH 4U6XA 2OULB 4J73A 4LVHC 4CY5A 1KXTB 3L13A 1BEYL 1NPNA 4PJGB 1M6UA 1K9TA 3OF6D 1VCAA 3CZLA 5H8DA 1Z7JA 2V5MA 2DOCA 3L3GB 1J1PL 2AI0L 4IMKC 4PRHB 1ZLVK 5DK0A 3RKPA 3T2NH 1JF6A 4CU6A 5LJYH 4JREB 4FOMA 1VZHA 1WLHA 2LTQB 1DQQA 1A6WL 1IBGL 1ZV5A 5JHDB 1DFXA 1UVQB 3G5VB 3C5ZC 4WNQB 4LLUB 3IDYC 5D7IE 4JN1L 3NSJA 5JPMB 3BIKA 3HN5A 3ZDZF 1IAKA 3ZHDA 5EO9A 1WZ1L 2Y6SD 4XCYA 4X7SL 3S98A 2X2JA 2OZ4H 3K3QA 4O2CA 3DI2B 1XDTT 4B9GA 4NOFA 2K70A 4IBZA 5GSRA 3UH8A 1QW9A 2DTMH 2X9WA 4A7SA 3EBHA 1P7HL 4MMXB 3PL6C 2F5BL 4ZOZA 1UJ3A 4ETYA 2C7UA 1EA9C 4L4TD 1OAXL 5D2LA 5HYJD 2Z2OA 3SGEH 1RFDL 4U1KB 3BAXA 2Y2TA 4O4YL 5KANI 2AXFB 4UNVA 4PXWA 4PD4J 4M43H 4HU8A 1CDCA 1HT6A 1XCWA 4A2FA 1JZ8A 4PSXB 5E9NA 3D0VA 4KK6D 1U58A 5GRUL 2DH2A 1CXIA 1J8RA 3ZE1A 4R0LB 4IMKA 4Z7VE 2UVFA 1DDTA 4NLAA 5HI4C 3H53A 1NUGA 4A09B 1DVFB 3VFRB 4I77L 3C5ZA 4XN2A 5KVDE 2R0ZH 4PGEB 5AB1A 2GT9A 5KVEL 2EDMA 4IBUA 5HSFA 3HI1B 4K8RH 1ZHKA 2LTQC 3ULVE 2I0TA 1RP9A 1JD9A 2XWRA 4PJAF 2CIKB 3P73B 5C0NC 1A47A 5CJQL 1QTPA 3BW9A 4X6BA 2J12B 4Y4FD 2E27L 3IIYA 4A0BA 1BG9A 3PL6A 2C3GA 3P4OA 4IIQC 4PTTB 4OTXH 1HSAB 1P84J 1CLCA 4ZFOB 3EH1A 2JI1A 1UKTA 2AJ3A 3ZT7A 5D7LA 4XOBA 4WFEE 1HNFA 1PNCA 4DGYH 5AD0A 2D0GA 4PGCA 1I8KB 5HHOE 5CGBA 5MI0B 4KRMB 5BV7H 4TXVB 2RGSA 2QGEA 2PWEA 2XWJB 5J06A 3AUWB 1T2JA 5F89B 5IMKB 2X2HA 3MLYL 1OP5K 1ECZA 1KXTA 3MKSB 3BE1H 4PJGA 2IG2H 1IZJA 1MEXH 1ODAA 1QUNB 2RB8A 2QZQA 3FU6A 3EBGA 1NQBA 3B5HA 2NY0D 3L3GA 1IGIL 3BP5B 1FQ9C 4NUGH 2H3XC 3RFRA 3II3A 2XN9B 1UVQA 3G5VA 1JZJA 4NQTA 5D5MF 1C5CL 3PXHA 4FXGC 4OIIH 3ARBC 5AOJA 5MERB 4ZO8A 5JPMA 5JORB 5E1GA 1XD0A 2H2PD 2ENYA 4IIQA 4PWFA 4Q56A 4H20H 4NCC1 3N9GH 2EEXA 3KJ6H 3PWJB 2PWGA 3L3OB 4FQQA 5GJSH 1QLFA 4DZBB 4HUXB 4MNQB 2V2WB 1IEAA 5IB1A 2VJ8A 3PNRB 4PS8A 5DQDL 2Z7YA 3MOAH 4G8EB 2DQGL 3B2PA 2OFQA 2X87A 4MCZB 4OF6A 4U1KA 3ZKXC 3UTZB 1NAKH 1WD8A 2AXFA 2J73A 5I0YA 2M83A 5H37A 1K5WA 2MCPL 2P44B 4LQ1A 3U36B 5MI0C 2A6DB 2ZF8A 2B4CC 3L4ZA 3MUY1 3R1GL 1MCFA 2LV4A 4TMPA 4UQ2B 4OUUA 4BBWA 4ZD3L 3CLFH 2P9IC 3REVB 5CWSB 5KW9L 3CIKB 4L3AA 4TLTA 5EN3A 3IE4A 4JCLA 1R5IB 5TF2A 4Z9KB 2H3XA 4EUPG 2FD6L 1DVFA 2ZXEB 2VR9A 4NHCH 4DKFL 3VFRA 1HWHB 4J3OC 1KYOK 1TETH 4FXGA 4PGEA 2YMTA 3TZVD 3HI1A 4IK7A 4Q6KA 5DD0H 1I31A 4OGAC 4Z0XB 2CIKA 3P73A 4QAWA 3TEXA 3WLBA 1YR2A 4CKVX 3G08A 3VYOA 4BRJA 5IIEB 4XPAL 1GP2B 2APSA 3GBNH 4UV4L 1IE4A 2EO7A 4PTTA 1HSAA 1X44A 3ABMB 3BQUD 3MA9H 5CHNB 3UJIH 3QFGA 3Q8EA 4ZFOA 1LO3H 3MR9B 4BCBA 3L3OC 2CBQA 2WYIA 1UB5B 4J6RH 4PRDB 1RK1B 1OP3K 2QGDA 4AGPA 2B1OA 1I8KA 3C8DA 1J8HD 3ODTA 4YE4H 2EYTB 2XWJA 4NQED 5F89A 1KENH 5IMKA 4C4BA 4YHOH 1RERA 4AMZA 12E8H 2OR9L 3IMVA 3V0FA 1QUNA 35C8L 3IDUA 2PABA 5GXIA 4PS7A 3EJCA 4HLZH 3QO1A 2CO6A 1BW8A 5K39A 1NMAL 4Z3TA 1B4JH 3BP5A 4OUOA 3U6XS 4BFRA 1T0MB 4TTDD 2QR5A 2VITA 4MJJA 1A7NL 3DXAE 5J0BA 3PXSD 1CFTB 5IBTH 1R47A 3E6HA 1OD9A 1YY9D 5EO1A 4JSNC 5KAQG 2NW3B 1ETB1 4JHWL 3E38A 5HYJE 3DDGA 4GAAA 3L3OA 2CK0H 3UABA 1ZVHA 3WMSA 2JJSC 4M8VA 3K0YA 4HUXA 4NNXA 3UJJH 4AQZA 1LMKA 4MNQA 4DZBA 1FHGA 4YXKL 2WXGA 1EEZB 5IVXE 3OKKA 5F7EL 4NM8L 4K3GA 1V7MH 3CH1A 4QXTB 4MCZA 3UAAA 3FM0A 3SE9H 3UTZA 5HDBE 4TL5A 2CNXA 4GAYA 2Q5BA 4ZAKD 3DNKA 3FT3A 4I48A 2D9CA 3MRNB 3U36A 2A6DA 4LESA 1IO4C 2F19L 3S37H 3IMBA 1U3YA 2DDQH 2ORBL 1IIKA 1KBGH 3SOBH 2VOTA 3BIAX 1R5IA 4F5CE 2H6KA 3WNPA 3ZDXE 2YPVL 2JKJA 2PXYC 3QRGH 3WS6A 4ATWA 1DQML 1CD9B 4YHMH 4WI0B 4Z78A 2YD7A 5DK3A 3WO3B 1A9VA 2IH3B 3PHOB 3O6KH 3EH5B 3L3JA 1OAYH 4NUJB 4Z0XA 4YFEA 2OVQB 2WGNB 4XBMA 4P5RA 2VXTH 3DX8B 3EFDL 5FC9A 5IIEA 3QYMA 2JJSA 3BYTA 1EHNA 2EE2A 3OTTA 5J1TC 4X80L 1LO2L 2HKHL 2WCPA 4H2CA 3I9GL 4RBPH 3LKSB 1OLLA 5CHNA 3SDXA 1MW1A 4OZIB 1TZOA 1BF5A 5I1CL 4LOUD 2YAFA 1FORL 2W60A 2WWMD 3MR9A 3PWUA 3U4BL 2X3AA 3LKQB 2XFXB 3DROA 3T6QC 4UBDD 3TM6A 2VN4A 1Z5YD 1PLAA 2ZOKB 2AAVA 4QAMB 4YDLC 5GGSY 5BOZG 3TT1H 4JM2D 3WEOA 1O7VA 3B2VH 3F85A 1CFSB 5I1JH 5SV3A 1D5RA 2GEQA 1E4WH 5F0PB 2EXWC 2CJUH 3IVKB 2PXYA 3NFSH 4EQ3A 1QPXA 2PP7A 4HWZA 4UILL 4BQBA 3FUMA 3ETSA 3L08A 2CGRL 2DB8A 3FOLB 3C99A 1VSCA 3MRBB 1UOVA 5MENB 3WEXA 2YZ8A 1T0MA 1AMXA 3MV7A 1YUKB 1GA2A 4PJ7F 2J7LA 5GSVB 1XCQA 2Q6WB 5LQBL 3T2OA 3PVUB 4X63B 3V5WB 4FQHB 1HAUA 4OGQC 5DUML 3BPOB 3FT2B 1OCZB 2NW3A 2VDKL 5CMAB 2A4CA 5AB9A 4I3GA 1OPGL 2VL4A 2MTAA 3MCYA 1W72B 3D25B 3ETBJ 4TYUA 4OQ1A 3U30B 2H2SD 4Q6IB 5EEWA 2EIJB 3QWRD 4TULL 3MGTB 1WAEA 3KYKL 3MYZA 2JH2A 2OKMA 3SN6N 3D07A 1I85C 4AQ1B 1EEZA 1OK0A 4O2FB 4MASA 4CZYA 5GGUB 2APWA 4W9EC 2CE9A 1SBSH 1BQSA 4L0PB 4ZSOE 1JHLL 2PP8A 4B9YA 3MRNA 4D6VA 1P2CB 5CEXB 1BQUA 1QSZA 4TLKA 4GPVA 3LNEA 2VJXA 1NFDE 3HNSH 3MV8D 1N6QH 4AYSA 4A63A 2EUVA 3GDBA 3VW3L 4PJ5D 4E5XG 2D3LA 4P46D 1VDGA 4NN5B 3ATEA 4WI0A 1MRFL 3RRQA 1T22B 2BNQB 5A2IH 5JXED 4LKXB 4XXDB 2RJMA 4DP4X 1KULA 3PXTD 1WEJH 1THCA 2XKNA 2WUCL 4NUJA 5J12C 3LXCA 4KK8C 5A40E 2O5XH 3DX8A 4N2GA 2WXIA 4IRSD 4OZGB 1L3NA 1DQLL 3MUHL 1KWKA 3IJYA 3DC0A 1HOCB 4QHLB 3RVUD 1MWOA 2ALWA 5H37H 3O8XD 1SOXA 1KCVL 2Y2YA 3A6CH 3DYPA 4FQPA 3DX7A 4MLIA 5HHVH 1O6GA 3LKQA 2P49B 3TBCA 5EZOH 2PR4H 1D9KD 4AQ1C 3HKZA 1RUQL 2Z0BA 4QAMA 2DBLL 3FH7A 4KTGA 3S35H 4F58L 4EZLA 1BFSA 3OKEB 3RNKB 4AX3A 1CFSA 3IVKA 1DJIA 3MTXA 3OB0K 2I27N 3OLDA 4D8PB 4P48A 1N70A 4ZMAT 3ERXA 1L0PA 2BIHA 4HETA 1JWUB 4DVBA 5JUEL 1J1XL 5IF0A 2E7LC 1DUZB 4QOKE 5MENA 3UZQB 1U21A 5EOCL 4YDVA 5E08L 4XNXL 3KW8A 5GPRA 1SBBA 2FQGA 4JZOB 4NN5C 4L3EA 4FQHA 2V9UA 1L9NA 3NJFA 4W9KC 3MXVL 5E51A 4F7MB 5C0RL 3NSFA 3U0PA 3FT2A 2JFCA 1XWVA 4XXWC 2F15A 1JRHI 5CMAA 5ERWA 4GG6F 1PEVA 1J11A 2OI9B 1TNNA 1S2EA 4CGTA 3T0WA 1OV8A 3RWIB 1UCBH 1GZHA 1W72A 4KI1A 2B4CH 4Q6IA 4YHYB 4ZPVA 4R96B 5C2WB 4FGMA 2DQEH 2DQHL 3AXLA 5KOMC 4AQ1A 4Z8FL 3S3CB 4ELKB 1F6AA 3NZ8A 3JUZA 4KKAC 5GGUA 4NN6B 4LHUB 2J4WL 4J23A 4OFYA 5B1AB 2W0LA 1YJDL 1F1DA 1CFBA 4I1NB 4IJ3C 1P2CA 1GC1L 5CEXA 5IFHH 3WD5L 4NKIL 2A1WL 4LVOB 2XBTA 1KTBA 5I6PA 2D0HA 2ZJSH 3O41B 5KJRH 3D69B 3NSCA 3W37A 1CMOA 1GSKA 2DM2A 3WDJA 3U7WL 4QQEA 1T22A 4PJBA 3LPGA 2BNQA 4LKXA 4XXDA 5B3SB 2EIZA 3AWEA 2A77H 5K9QG 1IQWH 2FJUB 4QXUL 4ZS7H 3OAZH 1GJIA 1OF2B 1ETA1 1TYEB 4LCWD 4OZHB 4RZKA 3G5WA 1DBAH 3LB6D 5EALA 4OZGA 3BRGC 3FRPG 2Z91B 3CSFA 3PF2A 4QHLA 1HOCA 1MI5A 1S7SA 1RURL 4FYSA 3MXWL 2BY1A 4CNIB 1CK0L 2YJQA 5DRZB 3HZYA 5D70H 3BWSA 2ICWJ 2DLGA 4U2ZA 5AZEH 5C0FB 2O9KA 1K72A 1KIUB 2P52A 4K7FA 1N0XH 5DZJA 3NFNA 3O4IA 4IOIB 3OKEA 1GYUA 2O30A 3RNKA 4XO9A 4BXSV 1OK8A 3MO1B 1JNLH 2GJRA 5DI8B 2ICWB 2FVNA 4H0HB 1WTGT 2OW6A 1Z9NA 3CFNA 1ZMYA 4FA4D 4ANKA 3BD4A 2YBAA 3KPPB 2Y1ZA 1A14H 3P3TA 3H56A 3GMMB 4WU7B 4LVOC 3IDIB 1DUZA 4XMVA 3V5KB 1AP2B 3Q13A 3WFZA 5IB5A 3K6SB 4G82A 2H14A 3F7RA 2X1WL 5I19H 1AR1C 2EECA 3SYPA 4G43B 1JXKA 3QARA 4JZOA 3MACH 4F7MA 5ENWB 4S1DD 1EO7A 1B0WA 4JFXB 3BAWA 3W81A 3WHXB 4BJLA 2PYEB 4M4RB 3CQQA 1SY6L 2X28A 4ODTL 1PZDA 2KBGA 4G7RB 5I5JA 1DFBH 5DSCA 2WD0A 3RWIA 1UOWA 5E6UB 3RTQB 2VJ0A 5CP7A 2B1HL 3AS2A 5F6IC 2WK2A 2WTOA 1ZK5A 4R96A 2DF3A 3WTUA 3RDJA 3ROOB 3MV11 4ONHB 3WTWA 2AGLA 2ZWLT 4XBEL 4ELKA 1CL7I 2DYPB 1Q1PA 4LHUA 4G5ZH 2ODIA 3FZUD 2HT3D 4PJ5E 3NRFA 1N2RB 3UEQA 1SRDA 2FAUA 2HAZA 1JRHH 4WUUD 4L1LA 5TQ0H 3S5YA 3EI1B 1GGBH 4JFVA 4MWFA 5C3TA 1G43A 1JOIA 1RJCA 3LNGA 4PRDA 5CKAA 3ENEA 3O41A 4HS6A 4ADJA 4NQCA 2IUPA 1OM3L 1EAQA 3D69A 1M1XB 2MTAH 4KV5E 5ADPL 1KEGL 3ECVA 1G5GA 4HWBA 4PUBL 4C56B 4P49A 1WVZA 1X7TA 1I7TB 1IKFL 3FBQA 3VXSD 4BK5A 4CN6A 1MFEH 1NCWL 2RD0A 3WTTA 2X2UA 1OF2A 2E75C 1OTSD 4HZLA 4OZHA 1DVUA 2A38A 2GBUA 2PETA 4X5XB 4C8XA 5CEZL 5T3ZD 3A0OA 2Z91A 4OSUL 2J21A 4JG1L 2ZAIA 5DT1H 2HXCA 3L4CA 3BT2H 5J56B 3NTCH 1DJHA 4M56A 4CNIA 3HCVB 4MQTB 5HDQL 4D2NA 3CE1A 3C6SB 5C0FA 4K3ID 3I7NA 3F12B 4GBXD 1JZFA 1LP9E 1Z3RA 1A6ZB 3B2MA 3O0RH 5EDXA 2NNCA 1E8WA 1TEYA 1T89C 1W8OA 5T3XH 4NRYB 3CFIC 1R3IH 3WKQA 1U33A 3MO1A 3OL2A 4PHZA 4WENB 1P9MC 5DI8A 1YEJH 3I8EA 2ICWA 4MYWB 4C4UA 4GW1B 3F83A 1A8ZA 3QW9A 4HLZG 2HVBA 3KPPA 3CK0L 3GMMA 2VN5A 3OM3B 3K6SA 1AP2A 3FPXA 1BFOB 3W0WA 1EAOA 4NZJA 2WVTA 2NZ9C 4JL2A 3GMLB 2AVFA 4L8BA 1A7RH 4FQJL 2ZKHH 4FN0A 4ABQA 4EI6B 5I16B 2DIBA 3O4OC 3O6FC 1DHKA 5BRZD 5IJBC 5K9JH 4G9FD 4DF9A 3RSEC 3WHXA 4LXFA 2VDQB 4KPHH 2PYEA 3WFDH 2VN3A 4Q8BA 4NAQA 3VU1A 4BFBD 5C09B 5F9OH 2Z34A 3ZXAC 4P2RB 1P6WA 4U2YA 3GGWB 4L1TA 4PN6A 3K81A 2N4IA 4AKPA 1I3RB 3GIZL 3L4XA 4PSPA 4J78A 3ROOA 2X4OA 3K6OA 4D3CL 1XB6A 1K8IB 1UEMA 5TK4A 5BUGA 3V9FA 4GUPB 3ZRCC 2NY6B 4N2LA 4LL4A 4UINL 1P9MA 4AIZB 4D9LL 4BCZA 4EIZC 5IVNA 4ONFL 2E9GA 4QRRE 5DFTA 3ASWA 3F8UB 3VI3E 3UXFA 1QAWA 3O4HA 3OD3A 2CA4A 4LSUH 5D1XD 4GSDH 2GCYB 2FHBA 5ANMB 1EANA 2G3ZA 2YBRB 1YYLH 3MCLL 4AC4A 1M1XA 4LCWE 2AHIA 3X1GA 1AD9A 1W72H 3VXME 1NEPA 4HFWB 1T5WB 3C2AL 3D39D 5DMGC 3AXIA 1CL7H 5GGVL 4C56A 3QDJD 3L7EB 3QXAB 2OMVA 1YMMD 3KEHA 4HISA 1I7TA 3GSNB 1KELL 3I6LE 4IOFD 2HA1A 2JKWA 3LIUA 1PZ3A 1ROWA 1SHXA 4DN3L 2JMRA 4AITA 2DL2A 1F4XL 4X5XA 4XVSH 3NCCB 2H8PB 2WKOA 4UT6L 1TQWA 3RX5A 1LWJA 3TVMB 3GREA 4Z7NE 4YH6A 3Q1EA 1QPPA 3APCA 4LPVA 4OZFA 5GRXG 2XZGA 1OKEA 3AGWA 3HCVA 1E4HA 3FSZA 4LAJH 5DVLA 3C6SA 1PCXA 4YSDA 3S8GB 1HHGB 3RZWA 1TTFA 3AMKA 1A6ZA 3BKYL 5DMJB 1JNJA 3CVHL 1A6UL 4L29A 5IJVA 1SGKA 2NW2B 1RIVH 4M7LL 2R51A 4PJ9D 1AY1H 4NRYA 4FAND 3UX9B 1W0VB 3SPGA 1CLYL 3NCBB 1ADWA 3P4FA 5AVVB 3BWZA 3EOAB 4GW1A 3RIFK 3FQWB 3QR0A 2QADC 1JGLL 4RAVB 4YHIB 1MVFA 3AG2B 1ZLVH 4BZ2L 1N64L 4G71B 1BFOA 3LSOA 2ICWI 2YQ3A 5ISZD 3GMLA 4BQCA 3M1BA 4I2XB 1E7UA 2X09A 2C3WA 1G1YA 4N26A 2WXRA 4EI6A 5I16A 4R5VA 1A64A 1VHPA 3HOGA 5FKTA 4G7YH 5FKPA 1S3KL 2VDQA 4LRIC 2EUZA 4OV5B 3TEYA 1AGDA 1KCUL 5EZLA 2QTVA 2LAGB 4IKLA 1Y1UA 2HTLC 5C09A 3LZPA 3G5ZB 4P2RA 2I85A 4HEMA 1XH0A 5I8OH 3QHFH 4EN3D 4JO2H 5C07A 2IQ9L 1HL9A 1I3RA 5JDSB 2Z7ZA 4X7CC 3UO8B 4P2QD 5EAMA 5L4MA 4JFPA 4Y9BA 4JNXA 2HESX 3FO1A 1K8IA 5E8PB 5JZ7C 1GL4B 2G5RA 2B9AA 4QTHB 3FN9A 3MODH 4CKQA 4K7PX 1SXCA 2ITCB 5JA9A 3D2TA 1DSWA 5H94B 5D7IB 5JXAH 1X4XA 4B5EA 1SN0A 1KLUB 4U7AA 4HKZB 4XAKD 4FCHA 5CN2A 5IREA 2A6IB 4Q97A 5EO0B 3MRHB 1GXEA 3KPSE 2OAAA 5ANMA 1XSOA 3LKOB 1KB9K 3UZEC 1MFBL 2YBRA 4QNPF 4NEHB 3V7DB 2J72A 2CHZA 2G9HB 2WN3A 3P3UA 3EI3B 2D3VA 5T3ZE 3C9NB 4LRIA 5AAWA 2CHNA 3MI6A 3TT3H 1T5WA 4BH7A 3K72B 4OGYH 3QXAA 1L6PA 3GSNA 4Y2OA 3TLRA 1WTLA 3T4AC 1P7QB 2YLHA 2YD9A 4B0MB 3MRDA 5IT2L 1DVXA 5BS0D 3RY5A 1NBVL 2K0RA 2AAAA 4URKA 4DKTA 5GRJH 2H8PA 2YJLA 3LEVL 3H2WA 3BWAB 5H37G 1UWGH 3LN5B 2WGXA 4Z7VB 2XXMB 4OKVA 4BUHA 2WOYA 2YNNA 4BL0A 4YFLF 4A7GA 3GM8A 1VJSA 2BRRH 2WVSA 1XGUA 4M6NH 1DVQA 3BKJL 2EAEA 1HHGA 4B7LA 4FXTA 4U6HB 4PJIF 3EJYC 4DK5A 1DE4A 4OJEH 5DQJA 1QI3A 2NW2A 3RUGB 4FQ2L 1PLCA 3RJQB 1GHFL 1NLBH 1W0VA 2ADJB 4HWBH 4WO4D 4ZMVA 3CTTA 3F65A 2ENSA 3UZEA 1OTUD 4M1DH 3VA2C 3EOAA 5BRZE 3UR4A 1DLFL 2CR0A 3FQWA 4PLJC 2DLFH 4AM0A 4RAVA 2OVRB 2FDBP 1C1EH 3CFBB 2RA1A 3BZEB 3CFEB 1YPZE 4FXKC 1KCRL 5D7SL 2Q7QA 3FRUA 4FFZL 3H6JA 4DVRH 4JFWA 4OV5A 4DP6X 5HHOB 3BWUC 4NCDA 3V0IA 3WOVA 5FUCC 3S3DB 2XUWA 4F7EB 2OTPA 2LABA 5FYKL 2DTSA 2ID5A 4M6OH 4R4ND 4XCCL 1RVFH 5E8OB 5FK9B 5AW6B 2NXYB 3WIHL 1CFNB 4M1GH 3BVXA 4G5AA 4V1DE 1BF8A 2CO0C 2CBMA 1B90A 3Q05A 5JDSA 4OM0H 2FCBA 4QRTB 2WQWA 4PI2A 1QFUL 1Z5HA 1LL1A 3PQYE 5CLYA 2WWKO 3BAJA 2OYKA 1NCDL 5DQ9B 3CC5B 4KXZI 4QTHA 4M8QB 3OX8B 3BI9X 4GXFA 4FCAA 2ITCA 1OT2A 5D7JD 4U3HA 2VXSH 4HQQH 5H94A 4GH7B 1O9WA 1KLUA 1FH5L 1XGRB 1MCJA 4GG8B 1G7QB 2GTZB 4KQ0A 1A3RL 5D4JA 1BJMA 3D39E 2A6IA 5EO0A 1VADB 2GITB 4NJAH 3JBG7 2JNZA 3MRHA 4DP2X 3IGLA 3AU1B 2GNQA 1AZNA 1GGIL 5E7FA 4M7ZB 1GOHA 3RTLA 2V0AA 1MG3C 2G9HA 4AEIH 4OJYA 3EI3A 2ZUYA 3ARDB 3INUH 1S5HB 3C9NA 1FFPA 1KXHA 2EADA 4OLYL 3BFOA 3K72A 4Z5RA 3QO0B 1BGXL 2BNRD 2R2HA 5E0FA 3UFIA 3N0PB 4M7JL 4MAYD 5D1ZC 5FDYA 2ZAGA 4FI8A 1SUHA 1BXUA 4GRLD 4X8XA 3ZDYE 4GM8A 1BZQK 3B9AA 1IEBB 4XCNB 4DP5X 3QH3B 3PJSB 3BSZA 2F58L 3E1F1 1R5MA 4YHLL 2ZWZA 1XF3A 3BWAA 3LN5A 2CJTA 2KDYA 4JB9H 4EVNA 1ASOA 3DV4B 4Z7VA 3J81g 4WHYH 5EMMB 3AFLA 1L9PA 3UG3A 5CBEB 1R9FA 4L3HD 3BEVB 2L7UA 2YGOA 4LU5H 4LCIH 4O58H 4R7XA 4XN7A 3JZ7A 3BKMH 3GMNB 3TWYA 4CVZB 4FQIH 2XTJD 3X12A 1EEUA 2YGNA 2ZP0T 2RAMA 1MG3A 1F8TL 4J8QA 4R90H 2P4AB 4WNSA 4XP4L 5J6GB 3CFBA 3BZEA 3CFEA 3ZHLA 5KS9A 1KLFA 5GRVL 4R7AB 3LDBC 4FC3E 4OZFH 3OKDB 5IK3A 1AMYA 1JN6B 2PTVA 5HHOA 4P2QE 1JVLA 1PF3A 1TQSA 4F7EA 4ZFGH 5E8OA 5FK9A 4FHKA 43C9B 1OO2A 1CFNA 2I5YL 2M2DA 3KBHE 1FYTD 4HH8A 4TSCL 5L2KD 4NGHL 3M7FB 1ORSB 3BGMB 1MRDH 4QRTA 1H2WA 3HKFA 1XH3B 2XX0A 2NSQA 2QSCH 2Q7YB 1A1OB 3CXHJ 4KO7A 3CIQA 2DWTA 4OT1L 5DQ9A 3QI0A 3CC5A 4M8QA 3OX8A 2F08A 4M8RA 4IKKA 4XPTL 4PWKA 3IDGB 1D7DA 3ROLA 3DXAB 4HKXB 4RSYA 1VB9A 3P9LA 2RALA 4GG8A 4RWHA 1G7QA 2O5ZL 1UD3A 4X50A 4R5XA 4RMTA 3CFMA 1FRGH 2VDQH 2GITA 5HYJB 3AU1A 5E95B 4D7BA 2XL3A 1KFAH 3BMWA 5BS0E 4UNIA 1S5HA 1FGVL 3B6SB 2IURA 5IVXB 3FQNB 4FQXB 4GI9A 3QO0A 3V4VL 4JO3L 4YSQA 4KXZH 1O6FA 4PTUB 5IGQA 4OZIF 3N06B 5HDBB 1V8HA 1QFWL 2A73B 2CDFB 4XNBA 3B4NA 4IDJL 4HOMA 3D2UA 2DQCH 1JJUB 1N6VA 2P5ED 2WNGA 3PJSA 3P9WB 3QH3A 3H54A 5D7KD 2VDNA 3DX9A 5M5SA 5HHME 3K7UA 4QRSB 1BVLB 5E94B 3HR6A 3OLIA 3DV4A 1CFVL 5E99L 1CPUA 1MQKL 3OSKA 4L1DA 2WBJD 4YAQA 1X5GA 3ZDXB 3JZGA 4XR8C 3L95B 3Q1SH 4XNAA 4HWEH 5TJWK 1IGML 2NZIA 4WEUD 4KK5D 3BEVA 1P7KA 4G7QB 5BJTB 4RVBA 4JSXC 4JO5A 2R23B 5LDSA 3PE7A 1BM7A 4Z77B 3GMNA 3WFCH 1WFTA 5GS1C 3MKGA 2MSPA 4NKDB 3D9AH 2V17L 1N5YL 4U1MB 1DJWA 1IC7H 3B9KB 3P30L 3T3MF 2V5TA 3EDKA 1C16B 5F7NC 3S37X 3VGAB 4CSSA 4WI9A 4KHTH 4CMMB 3K8MA 4RH4A 1KTLA 4YSRA 4OCMC 4K5MA 4YDNA 4XN9A 3W9DB 5F9WB 1D6VH 2JKIS 3KL3A 3T0XA 7FABH 5J6GA 2BM3A 3QNYB 4NZTH 3PGFH 3EJZC 2O5YH 2QT6A 3D3VE 4Q0XH 4UM9D 4X7TA 5EF1A 4NRZB 1KY6A 3OKDA 1FL6B 3OF6A 4MQ7A 4PM1A 5DJ6B 5F7DA 4FQXC 1AQMA 4JRLA 2NY0B 1XVSA 3HFML 1AZRA 4NO3B 3WIIL 4JGNA 2EDBA 3PDOB 2WBKA 4FG6D 3TC9A 43C9A 4RE5A 2WXLA 1UH4A 1S78D 1KACB 2GB2A 5E2UH 4IMLB 1AKPA 1ORSA 3BGMA 1WYJA 3WE6A 4I85A 4FLQA 2O61B 1XH3A 2Q7YA 2ITDB 3P0VL 3OKWA 1D5XA 1QWNA 1X5LA 4R2GD 1X5ZA 2H0FA 4Y5VC 5GS1A 1OCRB 4NQDD 4S1QH 1KIRA 5FGCE 3IDGA 5I0DA 1ZSDB 3DXAA 4HKXA 3U0TB 3UYRL 5E4EB 3QHZH 5DVOA 3HG0A 1CN4A 1QFWM 1I7UB 1MIML 2NNFA 3GD1C 3FYEB 2NY1D 4K5LA 2VDOL 2VLMD 1S9VB 2BDNH 2BNRE 3IUJA 4MTMA 4LCVA 4G83A 4TNVF 2D9QB 2CJSA 1XQ4A 3B9KC 2CSPA 1OSEA 4JSPC 4LRNL 3STLB 1AIZA 4F9PC 2FO4B 4XOAA 4WFFD 3B6SA 3HMWH 3GJEB 3UIYA 5A2FA 5IVXA 3FQNA 1WA2X 3KJ4B 4FQXA 5F9AC 5F9WC 4PTUA 1Q94B 4IA9A 5HYFA 4X6CE 4JGJA 5HDBA 2VDLB 2CDFA 2A73A 1QPKA 1SF3A 4TUJB 4ZSOB 3QQNA 2AJUL 3CLEL 4PV9B 3S8WA 3RHWF 3BJ91 3O4LA 3GRWL 1XSKA 4E9VA 4QRSA 1BVLA 4JO8A 4CY3A 5E94A 1NFDB 1H2ZA 4F5CA 2C3HA 3X11A 3GSOB 2PCYA 5TF1H 4YXHH 3DX3A 3ZDXA 3GMQB 2XTJE 3L95A 1CGSL 4U33A 2NY7H 2ED7A 5EHFA 4NS0A 4ZJ9A 3T2QA 4OD2B 5BJTA 1M1SA 2VAJA 2AJYH 2R39A 4N6RB 2R23A 3TCLB 3T0DA 2NNAB 2DN7A 4I18C 2JI3A 1XF5B 4Z77A 4MLSA 3BQUB 2JXMA 3LPOA 1QRND 2O6FA 4NKDA 4YPJA 3ZKMC 4U1MA 3VD2A 3B9KA 2MQCA 5K1NA 5E4EC 2CDEB 3RFHA 1QNZH 3NGBB 4M9OA 4LARH 4KRNA 1IFHH 2VDML 1N19A 5I17B 3DURB 4KC3B 1SVCP 5EU7E 4ERSH 4CMMA 3QRBA 2AQTA 2HFFB 1MDTA 2ZYIA 4ZMTA 3GXTA 1J8HB 3BH8A 3W9DA 4NQEB 7PAZA 3BSZH 1CYWA 3QNYA 4HCFA 5LGHH 1CI5A 3QEQD 2GY5A 4X3EA 4XO4A 4OCSL 4FD0A 2RQEA 4NRZA 1E4XL 1FL6A 4YMPA 3FU8A 3QFDB 3V7AE 3DUUB 3S3JA 3WN5C 4WI2A 5KVDH 4R26H 5F7LB 2WLJA 4LT7A 5KSBE 3TFKD 5JW4Q 5J11B 1JXGA 3MZGB 3V6OE 3WNJA 3JSSA 4IMLA 3S96A 3DJSA 3IJCA 1PLGL 3ULVH 4RIRB 1WWWX 3VWJD 2DKSA 2O61A 3ZZ1A 3V0AC 5EOQH 3LQMA 5L88H 1XL6A 2ITDA 4J79A 1AFVL 4LFHG 3BPCB 3VO0A 3KNBB 3VSVA 2WO2B 4OD1L 5F72S 1WA0X 3GPSA 3GINA 1LILA 2XZCL 2AXGB 2AZAA 3MX0A 1A21A 1SLVA 4P3DB 1ZS8A 1ZSDA 3IJ9A 4PIBA 3U0TA 3MLWH 4J82A 2J71A 4YK4B 3VB8A 1QD0A 1SN5A 5B1CA 3FB7A 4WW2C 3ZIMA