3FCSA

Structure of complete ectodomain of integrin aiibb3
Total Genus 199
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
199
Knots found
sequence length
959
structure length
913
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAASWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin, alpha 2b
total genus 199
structure length 913
sequence length 959
chains with identical sequence C
other databases KnotProt 2.0: Artifct S +31
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3fcsA02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3fcsA03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3fcsA04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3fcsA01
4O02A 3FCSA 5FFGA 4MMXB 4UM9A 1TYEA 1U8CA 4G1EA 4WK2B 3NIDA 3ZE2B 2VDPB 3ZDYA 3VI4B 3ZDXA 5E6RB 4MMZB 1JV2A 3IJEA 3VI3A 3NIFB 2VDKA 2VDQB 4Z7QA 4NEHB 2VDNA 2VDQA 3NIFA 3VI3B 1L5GA 3IJEB 3K72A 4UM8A 4MMZA 5E6RA 2VDPA 3ZE2A 2VDMB 4G1EB 2VDOA 2VC2B 1TYEB 3ZE0B 3ZE1A 4UM9B 4MMXA 3FCSB 3FCUB 3ZDZA 2VDRA 4NENA 3V4VB 1M1XB 4WK4A 3V4PB 4G1MA 3T3MB 3T3PB 2VDLB 5E6SA 4WJKA 4Z7NA 5HDBA 4MMYA 4WK0B 4Z7OB 3T3MA 4G1MB 4WK4B 3V4VA 3NIGB 2VDRB 3K71B 3FCUA 3K6SB 5ES4B 2P26A 3ZE1B 3ZE0A 5E6UB 2VC2A 2VDOB 2VDMA 5E6UA 4UM8B 3K72B 3K6SA 4JX0A 1L5GB 3K71A 3NIGA 2VDNB 4Z7QB 4IRZA 2VDKB 4WK0A 4Z7OA 4MMYB 1JV2B 5HDBB 4WJKB 5E6SB 4Z7NB 2VDLA 3T3PA 3ZDXB 3VI4A 3ZDYB 3V4PA 3NIDB 4WK2A 1M1XA 1U8CB 4NENB 4UM9D 3ZDZB 5FFOA 4O02B
chains in the Genus database with same CATH superfamily
2ITCB 1NMAH 3WIHH 2WLIB 4L2YA 2WZPA 3CLEH 2LOEA 2MNUA 2B16A 5IHUH 2VW4A 4P2OB 5LGYA 4Z5RB 4CVXA 1FNEA 2XNAA 3BGFC 5D6CA 2OZ4L 4UQ2A 3Q2WA 4R5TA 3V2AR 4PTUB 3MUGA 4GRWB 3VQLA 4JM2B 2H47A 1MOEA 5CFAA 3QO0B 3KXFE 5SV3A 3D3VD 2GIYA 2YSSB 5TE4H 2WNKA 2W0KA 1KXQE 5HYJE 4K5NA 5HHPB 2NX5B 4HKBB 1RZ7L 4JPQA 5IQNA 2XZAH 4HK3J 1XTLA 4TL5A 1ZMYA 4GQBB 4RISH 5C0CE 1BZ9A 3TBCA 2WZAA 5L2KA 2OL3A 2LU7A 1CYXA 4EZJA 3P11H 5I15L 3NCYS 1EAOA 2NLJA 1N0LB 1S9YA 3EZ8A 1A02N 1JNHA 3T0WA 1I31A 4QTIH 3LPPA 4PJAF 1DBJH 3VFPB 4X98A 5CWSA 3WLBA 4N2IA 3O0RL 1J9SA 4WWKB 4BH7B 2I0RA 5C2UB 2PP7A 4LEOB 2HVJB 4LSVL 2BH0A 1OALA 1JPSL 4F8TA 2V3FA 3R0NA 4LCYA 5ID0A 1D9KC 1OY3B 3QS3A 4GBXC 4ZFOA 2XG5B 3PWLB 4MHHI 3L3HB 1XF4A 4AXWB 3AS0A 3NESA 4N2NA 3GIVA 3D4GA 5LGHH 3MAWA 3TNMA 3OLIA 4Y19E 3EJZD 5HDOA 3DARA 1NUDA 1AC6A 1KJMB 2VUYA 1MCCA 1UOLA 4FRWA 4PUBL 4CNIB 3VYNA 3G6JE 3NJGA 3P4OA 5JORA 4FHKA 3V7AE 3D0AA 2WLMA 5CXBB 4EEEA 4KRPB 4B96A 1KG0A 4JPSA 3FFCE 3GSUB 4OGYL 3L3KB 4OF8A 3S35H 5CR1A 4HIXH 3UJIH 2NUPB 4UNUA 1T03L 1B0GA 1NJ9A 3HOGA 3MXVL 3O4HA 4K7PL 2WP3O 1LP9F 4BV1A 5C2WB 5D7IA 3LQZA 4YLQT 2MCG1 5CEZH 1GJUA 3D33A 2VN7A 2ZUUA 2H6OA 1DJSA 1IGJA 4OGXL 4PHXA 1LTXA 5FHBL 4DOHB 4EN3A 3G6DL 1B0WA 3TS8A 4IW4C 2TSBA 3HUJE 4HPOL 5KAQF 2YAHA 1T0OA 4K3JL 4S0TD 4L3FA 3MUJA 5TE4L 1QTPA 4LMQI 3AVEA 3CFEB 2DWXA 3I2CH 2Q8BH 5DFWH 1AHWB 1EJOL 2WQ8A 3LEXA 2YXWA 4Y5YA 2YBRB 3GJFH 4Y4HA 1A3QA 3V7DB 1WFIA 3KBPA 3W9DA 4UIMA 1F86A 2VLRB 3WIIL 5MEPB 3G7TA 4DNWA 2HMID 3DJ9A 5E94B 2EH8L 1LE5B 2QLVB 3WE1A 4IRSB 1TENA 5H1MA 2G2RB 2J21A 1J8KA 1K5WA 4P5KA 2VLKD 1B9XA 1AGEA 5TQ2L 4YSAA 3STBA 3VRJB 5I6XC 2FX7L 3AB0B 2BNRA 4A7VA 2I9TA 4Y4KA 3NH7H 5C07B 2ZUXA 1BM7A 1YA5A 3OF7A 2C3GA 2ZIDA 3ECQA 1T7VA 2MQ0A 4MXQD 3JWDH 1XR9A 4NXKA 1AO7E 2G4EA 3OAZK 1FV1A 3CCHB 3V0JA 2P8LB 3HI6H 1IAKA 1U92B 1OHQA 3QJFB 2ZWLT 3V5WB 3P9LB 2RQEA 4YJZL 3DDFA 1OEZW 4ILDA 5E1GA 5E94A 1LE5A 2WINB 4LSQH 1CFTB 5CN1A 2AJSH 2QMJA 3NCXA 4G6MH 3U1SH 4NZUH 3W9DB 4PJHF 4X6DF 1FORL 2VDRA 4Y4HB 3ZRFC 1U36A 3QZNA 5INDA 2VUOA 1I7ZB 1P4BH 5EZOH 4R2GD 2W95A 1JGLH 3B8YA 2EUZA 5AVXB 1EEZB 3CFEA 1NCBL 4HZ1A 4FNTA 1N3NB 2V9RA 3QAZB 2GKIA 4EWRA 5F1SA 1M57B 4CC4A 3FB6B 3RUGA 4G9FE 3PNWA 2XTJE 1NMCC 4ENED 1SHWA 1ZV2A 5I0YA 3UAAA 3GPSA 1HJCA 5E4OA 5GIRB 1OK0A 1FWXA 2VERN 3HG1E 5IB5B 2IJ0C 3MV01 3UPRA 4NQCD 3VM7A 3ZQWA 4OZGF 4P5TD 2NUPA 5F21B 4J5VA 2L4OA 2PTUA 1EUTA 3L3KA 3STLA 4ODSL 1I75A 3BUQA 5EU4A 4FX5A 1MFEH 3MNVA 4MNGB 5I8EB 4AYFB 4CKQA 5LGJB 1IVTA 4GW5B 1MVFA 3KPTA 1MCOL 3IGKA 5CXBA 1PG7W 3NJJA 3P4OB 4Y1AE 5JORB 2ORBH 3DV6B 1IL1B 1XH3B 2QQLH 4ZFFB 3TNMB 2HFFB 3AT0A 3EYVB 1S5HA 1KFAL 2OXGB 3CK0L 4PSXB 3BT0A 3OF6A 5FK9B 2O6DA 4FDWA 1VLXA 1IGIL 1CFNB 1ND0B 2FWOA 1N0XL 4HPYL 5FO2A 1YJDC 3HC2A 1II4E 4LF3B 1UD5A 1ZEAH 3DIVA 2CU9A 3DVGB 1DJWA 1HSAA 4OKVA 2A9DA 2I5YH 1R5WA 3C5ZA 1IRAY 1CLZL 4PRBA 1C9LA 1E6JH 3BWZA 1C8QA 4G80B 1KZYA 4AGLA 3CZKA 5CWSB 3VFPA 3BW9B 1I3RA 5H35B 1XDTT 5E56A 4YBLB 5IMOB 2XN9E 1N0LA 2ESVB 4FN0A 5AW6B 3BKYH 1SY6L 2ERJC 5SWZA 3ZDXA 2OL3B 5B1CA 2XIIA 4Q58C 5L2KB 1BZ9B 1AZBA 4PJXF 1LK3L 1Z9OA 1SY6A 2W81C 2DY2A 4PJAE 4PNKB 1JFQH 4LPXA 3VFUA 4QO1B 3F00A 4UQIM 5DQ9B 1X5GA 4PJ8A 5JMRA 2YSSA 4DK6A 4O9HL 4A55A 1KB5L 4MD5B 3DX8B 3GSWA 3ZN6A 4BUJC 4CU6A 2GW5A 4AE0A 2M8XA 1ZK5A 3I85A 4PTUA 3RUGF 4UQ2B 4ALAC 5C92A 4MA7H 4KXCA 4LHJB 4LLYB 2BWQA 2OCJA 1O9VA 4UDTB 2DQIH 1J5CA 1KGCE 3ZJAA 1PGUA 1SRDA 1NM9A 1YN6A 3MKGA 4N86A 3VD9A 2I24N 3VI3E 3I75B 5I71C 4E9SA 2IUVA 3W57A 1U8JA 3NIFE 2WBJB 2Q3ZA 2AZUA 4WTWA 3JT2A 1FZOB 2Z4QA 1RZJL 3JWNG 5HE1B 3KYNA 3ARBB 1KB5H 4Z7NA 5FLXg 3MRBA 4L1TA 4HDIB 1EFXD 1F41A 5D1ZA 1RUMH 2XPZA 3FU8A 2O5ZH 3GSQA 3HCVA 5F1OB 3NIGB 3WEBA 3QNXB 1FNGB 2BWDA 2R56H 3KXFA 5C0GB 5KSUB 2HT2D 1REIA 4K9EC 1ML0A 4J8GA 3IJ7A 1DVFA 5FKTA 1ET5A 3TTYA 1QUNA 1U8IA 2OTUB 1I7UA 5ALCL 3GTTA 2QKIB 1CLOL 3H3BC 1T21A 5K9JH 4W9LC 4HZAA 3HS9A 3SMRA 4R2GC 1A8JH 3D09A 2ADFH 1A7PH 4MQTB 3UTZB 1JD9A 1KBWA 5I5IA 1YYMH 4RWYL 2EIZB 3LQAL 4XX1E 5HHVL 5BOPA 2OMVB 4NUQA 3ZTCC 4OLXH 4PI2A 2OMZA 3S3CB 1FYTB 3OXSB 1F90L 4LXFA 3K5RA 3PF2A 2VXQH 1DL7H 5J4MA 4XBEL 5DS2A 5C0RL 2VDMH 3SB3A 2VXUL 3ME0A 2NY4D 3QEUA 4Q4EA 2X4UB 4DPBX 3IDMB 5E4EC 5CKGA 4PJAB 2FYVA 1U8CB 5BUPA 2FBJL 3TWYA 3UPCA 2WSPA 2Z1KA 4PJ5B 1KEGL 1QX1A 3LPOA 3WTSA 4AIZA 3GLEA 4BP8A 4LESA 2GYSA 4KFZC 4JFFE 2CBQA 1U8OA 7FABH 1A4KB 5J06A 4K5LA 1Q47A 5D71H 4MMXB 3MRKA 32C2B 1JNLL 1KGWA 1IKNC 1PPIA 4RQQB 3SE6A 4OCXH 1SHYB 1M3IA 3SDXA 4NQCE 4ZX3A 4I13B 1VFAB 4YHOH 1JOFA 1H5BB 4MAYB 1MAKA 2MMXA 1DO5A 2AJVH 1E6OL 4PJCB 1D6VL 5H14A 1EAPB 2H3KA 5C09B 3FTVA 5I8KL 2OM5A 3MRPA 4Z7VB 1DLHA 1OAUH 3VXUB 1Q38A 4X6DA 1ETA1 2ENSA 3U4AA 1BFOA 2HWZL 1WH0A 3QZOA 2DQIL 2PXYA 3MV8E 1MRFL 1ZHBA 1F8TL 4QXTB 3QG7L 4PB0L 3PRZA 3WIFA 4QHKJ 4Z3TA 3FQWA 3CVCA 5D1XB 4P2QE 4YSTA 2W9EH 1MZYA 1ZRUA 4Y8AA 3VX0A 5CBAB 4NWTH 4MVBD 5EM2A 1FE8L 1T4KA 3EFOA 3HPLA 4BUHA 3QIUA 2JKXA 4M6NL 4NQED 3UTQB 4YHMH 3RZCA 4TTDC 1GYUA 4KOBA 5DUMH 3OKYA 3W37A 4QHNA 4HVBA 4TF4A 2PYFB 2WTRB 2IH8A 3F7PC 5T5NF 1XBDA 5IQ7H 3SBWA 1R19A 1A65A 1WQVT 2FQFA 2KHAA 5DEJA 5F9JB 2WN2A 2FGZA 1PQZB 4RAUA 5HHOB 3UTTA 3FFDB 5DEGB 2Z92A 4K07A 1KMGA 4NRXA 3QHZH 4TNWK 1CD9B 5HSFA 1LO2H 4KK9C 4NQEE 2F7RA 1XGQA 1SY6H 4ERYA 2P5WB 3QQ3B 3JWDC 1QNZL 4PV9A 1J05B 3DPBA 4PTTB 2O6CA 4LDOB 2I3SA 5E6YA 2ZT9C 2NNAB 2DM2A 5AW9B 2WUCL 1SF3A 1KN4H 1QASA 2YGVA 2VTFA 1EBPA 2VAJA 1TJMA 1V27A 2R69L 3LKNB 1G7JA 4D9QE 5I1KL 3CLWA 4KHXL 4CI8A 4QY8B 5GGVY 1UT2A 5HE2B 1JV2B 2WNXA 3OR6B 1KGUA 4XHQA 3UCQA 3WO4B 5F6IB 3PPSA 3TURA 3ZY7A 1IGTA 4R7VA 4DQOH 1NDMA 3CFCL 3V6OE 2DLGA 5C07E 5EIQA 2HH0L 1MCKA 4UTBH 1WZ1L 2VDQL 1B88A 4PIRF 3MGOA 1P4UA 4O02B 3U6XS 1C5BL 4RA3A 3TV3H 2KI6A 4JGUA 1JDDA 4NZ8A 1QPXA 2F53A 3IDIB 4X6DE 5D93B 3ZE1F 3ULVF 4JCMA 2XL2A 1I1YA 1Z9NA 3ROLB 4QWWD 5IP4A 2EDOA 4LAQH 1BREA 1DEEA 1IC5L 4X9GA 4JQIH 4JO3L 3S37L 1UWGH 5E6RB 3S88L 2FB4L 3O6FA 2ICEA 4PJDF 4ZUWB 1A7OL 1W72H 3BVUA 5JNYB 3SE4A 3GWJA 3O2VL 4X2UA 4ZI8A 5B3JF 1B6UA 1A1MB 2AQQA 3S2CA 3ZX1A 5B7FA 4JFDD 3AY2A 1NBCA 1JL8A 1R0AL 2YA0A 1KN2H 2NTFA 1TJXA 1K6QH 4MSWA 4FQPA 3AM8A 3ZLQC 3KLHD 1S8DA 1ZE3C 3DK2A 5A3ID 3MBWA 4Q52A 1IAMA 4A2MA 4WGWB 4PRPD 3R06B 5EN2A 2AGJL 4HIIB 3UPAA 1NIFA 5CLZA 3W0WD 3US1A 1MNUH 3UH8A 3B9AA 2FYYB 4L3EE 2PXYC 1YUHA 2R1XA 5IBUB 4NO3A 3SYAA 4PBVC 4ALAL 3DOHA 3LY6A 4HWEH 3NVXA 3S3BB 3VMPA 3QUXD 5EU3A 5F3FA 2Y25A 4HEPA 1NFDB 4NQVA 1C7SA 1UXSA 2KLSA 5EOQL 3ZKNC 4YL9A 3SPVA 4HUXA 4MDIA 3LH2H 3I7LA 4XVSH 1X4YA 1RUPL 2W0FA 4N2DA 1UKSA 3U7WH 4A11A 4OT1L 4TMPA 3JVGC 3VRIB 3Q9PA 3IS1X 4AOFA 4N3TA 4C83A 4ZW3A 5I1CH 3D39B 4KITB 2OJ1A 3GS7A 4OLYH 5FO9A 4F8PA 1HINH 3HG1D 2R4RL 4A39A 4OZGB 4GY4A 5E23A 5I1IH 4HAGA 1GJIA 2NY6C 5IHUL 2R69A 4M3HA 5SWZD 1D5RA 2ZSVB 4LVHB 4JLRB 5DA0B 1YPZA 3EUUA 3GTNA 4KO5A 3CSYA 4HW6A 4G8GB 2WLZA 2RH0A 5J1TC 3VDAA 3N5AA 1MCRA 1T1ZB 3QUGA 1JHLH 1XHMA 3FQRA 1V54B 4NO5B 4AL8H 3ZO0A 3EFDH 4HBCH 4KZEL 5IBTH 2L04A 3ZE0F 2G5RA 1XR8B 4DZBB 4R90L 3ZDYF 5KZCD 1SJXA 4KDTC 1UFGA 2A1WL 3EKCA 1P6AB 1Q8MA 4LCUB 3ZR5A 5EC2A 4LASH 1TZHA 3LNHA 5IB2A 3NDYE 4FQJL 2Y1AA 1BYPA 1FJ1B 4QRUA 4J86A 5JPNB 4UI2A 1OB1A 4J27A 5HI4D 2MIZA 1N8OE 2JELH 4J79A 4HEMA 1AD9B 5CCGE 4YX2L 2ZUSA 1KZQA 5CAYB 4CMHC 1U8HB 2CHXA 1ZS8A 3QUMA 1MJ7H 1JBJA 3MNZA 1ZOXA 3BGMA 1FAIH 4FEIA 1F3JB 4NCDA 1QW8A 3ET9F 2UWEA 1QSVA 4I3GA 3QR2A 1M7IA 2D9QB 4IBZA 2E86A 4Z7QA 1T0NB 3UG5A 1BVLB 4X99B 2ZX7A 1HN1A 3CHRA 4P57A 4IU3B 2B3IA 3AACA 1LO5A 4W70A 5HGAA 5TE7L 3U4EA 4F5CA 4P05A 4X6CB 5GRJH 3GSRA 3QHYB 1ZLSH 4ANUA 3VCLB 3JV0A 3L5XL 2JV6A 1NBQA 2YFNA 4CY1A 2XJLA 1U3JA 4WI4A 1DE4B 3UG4A 1CK0L 2NY7H 2ZP0T 4KDWA 4NZDA 1JGLL 5AW2B 3VXMB 3U1QA 3VGFA 4FXKB 1RU9H 3H42L 4UINH 5AOJA 2QQLL 3QDGB 4XEIC 1CQYA 3ZMNA 4XC1L 3O8XD 3EH5B 2H1XA 5ICXA 3X11B 4U0QB 1J12A 4F24A 3OZ9L 1U21A 2HKHH 1NCDL 1JYVA 2X4RB 2PO6B 3GNMH 1SJEA 4A6YB 5FAAA 4J8BA 1RZPA 4Y7OC 3ZHNA 1SMOA 3NSCA 1NZRA 1XH1A 4K7PY 3T0EE 3SQOL 3BVTA 2P49B 1CLYL 4Y1AA 5JXEC 1XCTA 1NC4D 2HKAA 1RZ8B 3CXDL 1LO3H 4WFFE 2Q6WB 1KN4L 4HX1A 2F54A 3FQXA 3VWJA 4BFIA 2H14A 5H94B 1IQWL 4B9KC 1TVBA 1IIIA 4G6AD 3C75H 3CDZA 3CFDA 3FS9A 5FUZL 3DMMD 4IRZH 5IFJA 2R27A 2X4QB 3GSNA 3MZTA 3CFJB 1KJVB 1QR1B 3PWPE 2YA2A 1MJ7L 2H9MA 4PYGA 1FAIL 1JZJA 3V6FA 1HS6A 1ZHNB 2Y06L 4X5WB 4HAFA 3WIHA 4Z7IA 5JHLL 4I1PA 4A7JA 1UQSA 2EYRB 4K3HA 1TYRA 3JWDL 1VGEH 1JF1A 4BFEA 4E54A 2AC0A 1AE6H 3L1FA 3U6RB 2Q10A 1PY0A 2A38A 4H8WC 2P9KC 1G4MA 3FU7B 4I77H 1QPKA 4PFEA 2QHLA 3CXDH 1D9KB 3H4FA 1ETZA 2BHUA 3EI4B 1F4YL 2NW2B 5KUMA 3IJSB 2AV1A 4LHUA 4J3OC 4X5PA 4S1DD 2ARJA 2ALWA 1BV8A 4NQSB 4F80A 3CFBA 3P30H 2YMTA 1B2YA 3ETTA 4ANVA 3MTXA 2FSEA 5GSVA 5IB4A 1T22A 3EZJB 3BSZL 2CZNA 2L8AA 2R0KH 3G6JA 3BVXA 1BCIA 3VX1A 1QA9B 3OZKA 4PCKA 4XBMA 1J8HD 3VVWA 1GKOA 1CLCA 4WI2A 4E9VA 1IJ9A 1P9MA 2H3XC 3GFUA 1I8IA 4YFLF 3VE0A 3FSOA 4F7MB 1KTRL 2P46B 3U4KA 4BK4A 2O5XH 3RVWC 5KYUB 1J8SA 3FUDA 3ILQD 1LNUB 1RK1B 2VWEE 3VMOA 3WNOA 1TPXC 3CSPA 2CBTA 5AVRB 3ZDXF 4ZOAA 6CGTA 1ITBB 1G9MC 1RUQH 2DYPD 1FG9C 4GI6A 5GGTL 2PN5A 4AJYV 1L3WA 5DHDA 1W0VA 1DBKL 2VR9A 3P3RA 4FNRA 5B21A 4X5XB 3FUHA 5AZEL 3K0WA 4LNVA 4ZPTB 2DI7A 4Z0XA 3V4VL 1QFOA 2R23B 3RWGA 2HX7A 5D7SH 2EP6A 2Z34A 1H6FA 3A67H 3U9PL 3CGTA 4U1MA 3TT3L 1T6WA 1UGKA 4X4YB 1F02I 2JJTA 4LCWA 5EOCL 3O2DA 4HWZB 3VXNA 5F6HJ 3RX5A 2Y7LA 5BZDA 4YPGB 1IEBA 3I74A 2VDML 2WLKA 4JY4B 5E8PA 5E5MA 1XSIA 4L37A 1U2VC 1AFVL 3FT4A 4Y5RD 5LAXA 4PW3A 3RWHA 1G5AA 3UGUA 1UC6A 1CQKA 2N0KA 2E7HA 4JFED 4YSDA 1FPTL 2XL3A 3CQFA 4HWNA 1WFTA 1UM5L 2LLGA 1XHHA 4G8GE 2HP4A 2BFVH 1HCZA 2W5PA 1LILA 2FNBA 5CP7A 4CZVA 4E9TA 4P2YA 2WXNA 3O3BA 3VI4F 3ARDD 5GS1C 4QYAA 3X1BA 1YEKH 3HAEB 1BJ1J 4WHCA 4XNZB 2DIBA 4PEEA 2AH1A 4WWOA 5D1QC 1PEZA 3UYPB 4JGJA 1MFBH 1RZKC 4FTVD 2C3XA 1TCMA 5IVZA 5CLTA 2OVPB 3BD4A 1DJHA 2R7EA 3BP6B 4N9GB 4Z23A 4PQXA 3QFJE 3I50L 4ODTL 3T3MF 4NHCL 2DLEA 3MV7E 5ESVA 5FKAB 2AABH 1RUML 2XN9D 3C60B 5IT2L 3KPPB 3IN2A 1ZVHA 2E9WA 2NR6D 4GT7A 4R9HA 1HAUA 3S37X 3IKCA 3WXVH 1YC7A 2CRZA 2DBLH 2WZ5A 4LBEA 5F1NA 3LAFA 2H1PH 4A04A 4Y4FC 4G6JH 2FR4B 2X1OA 5DJZB 1FFPB 4NQQA 5DS8B 5C0DB 1MNNA 3TIDA 1E43A 4N8PA 5LN8A 5B1KA 3RI5F 1KJ2A 2DYPA 4NZTL 3CX2A 3PWJA 1AO7B 2WOBA 3NG5A 1ZHLB 2XKNB 3HHMA 3LN4B 3S8GB 4PJDB 4NUGL 3GT6A 2APVA 4HLJA 4HKZA 4WI0B 3BUIA 2PR4L 5T5NG 3C08H 1OM9A 1VEPA 1YNTB 1DQJB 3ULSB 5L4JA 3TEWA 1A6ZB 4XCYA 3FC8A 4M6MH 4NQUA 1HHGB 5HPOA 1H3PL 1QI3A 5EZJB 3ROOA 1DFBH 4JN1H 4FQXB 1ZLWK 1EEQA 2FO4A 1QFWI 2EXTA 3IT8D 5DJYA 5LXGH 1TUPA 4JB9L 5CZVH 2IUPA 4X60B 4FZ8L 5TH2A 3X1NA 4HJGB 2ZKYA 5I19L 2AXHA 3RVXC 1UZ8A 4EDWH 1E67A 4EPSA 2JTYA 3ZL1A 3WNMA 1IGIH 3V0FA 3EO1A 2HX9A 5GS0C 5DDHB 4HOZA 4IEFA 3V9EA 2F7QA 2WCPA 3D9AH 5KSAC 4NO0B 4HXBL 2BX5A 5GZNA 5I30H 2VN6A 4C59B 4FA6A 5GGUA 5IOPB 3BWAA 5AFU3 4FMFA 2I3TA 1E4WL 1I4FA 2CBPA 3FT3B 3L95B 4XMVA 3IVKA 3RFGA 3KPRB 2R0WL 3RX8A 4AX3A 1F3RB 1JPFA 4M62L 4RMVA 3FQTA 1Q0YH 2WWMD 5KYXA 4Z77A 3RRMC 1X5HA 4RVBA 1MWAA 2J88L 4ODVL 2AQPA 1OM3L 2QQNH 2BHFA 4GXUM 3UAEA 4NRZB 4G5ZH 4E42A 4HH8A 2H2PC 1AP2B 4XAWL 2FIKA 4A1RA 2JJUA 4GAYA 1E6OH 2YPVA 3M7OA 1OARH 5HVGB 1I3UA 2R2HB 1A7QH 4PJEA 2R2EB 3D8MA 3IUQA 4LOEA 4JXMA 1B4RA 1YYCA 3TYGH 3VDBA 4FNQA 3K4ZA 3KEDA 1UJ3C 3LD8C 1Q90A 3JTTA 1YYLH 2XZQH 2CDEB 5T1DL 2QADB 1QP1A 4TSAL 1Z5LB 1H6TA 2UZXB 5H2BB 1ZWIA 3FB5A 4NXSA 1NC2A 4JSPC 2UUDK 2DL9A 3C5SB 2IADB 2J88H 4ODVH 2V9QA 4ZUSB 1QG3A 2KDGA 1JVLA 3M8OL 3NABH 5KSBA 4L1QD 3KVQA 5KJ4A 3RMZD 4G9DB 1KT2B 2GC7C 2WWOA 2QBWA 2Y5TA 3HC0A 3G5VA 5E8NB 4CUCA 5I18H 4M00A 4TRPL 2AEQL 2WYTA 1WA1X 3T8XA 1NEZA 4F37F 5D96B 3R1GL 1N26A 1BFVL 5T3XD 3OKNB 3RWFA 5CR8A 2JIXD 4IBVA 1A9VA 3FTYA 4GRWF 1RQ5A 3IBEA 4RWYH 3WS6A 4AMWA 2DTSA 4MD0B 4N90E 2YAOA 1CICD 5AZUA 5HYFA 2A4ZA 5JLZA 2FL5B 3MV8B 4I0PB 1TSRA 4X4XA 3UCRA 2BZDA 4WENB 1MY5A 1YG9A 1DN0A 3EH4B 4C54A 2UVFA 3EJSA 4NNXA 5C0BB 4N85A 2JJSC 1GGBH 2J1XA 5HBBA 1IGMH 4JZNA 4ELMF 4R4BA 3FFCD 4TSBL 2Q9OA 3QI9B 4MJIE 2AF2A 2BSEA 2J8UB 4ODWB 4WJ5A 4LSPH 1JWSA 1E5TA 4GXUN 4JD2C 1IUZA 1S7XB 5CJQL 1U8NA 4MJIA 3IXAB 4EUPH 2P5ED 4OD1L 4WNQA 5GISL 1HYSD 3T9WA 1DVFD 2V7HA 3MLYH 1A6WL 1SN2A 3HS0C 2AGZA 3AWGA 3MTRA 2VKWA 4NQDA 3WN5A 2QELA 3O11A 4FFYL 5AB0A 4ERSH 4NP4L 1D6VH 3T6VA 3GMPA 2B59B 3ISRA 1KB5A 4FD0A 5DU7A 2QSCH 2XA3A 4HKJB 1N6VA 1WP6A 4F58L 1SQ2N 1IGML 2CM6A 2DQTL 5FGBA 4RGNC 3RWIA 1S7VA 4XCEB 2FJGB 4JM2F 3F84A 2XWJA 3H9YA 3ZL4H 3I6LD 1H8SA 4JG0L 4JS7A 3ZHKA 3ZR6A 2WJ5A 4NAQA 1CF1A 4AL8C 5IY5B 4ES9A 2YD2A 4XOCA 1YQVH 1NGYB 2X4NA 4QRRD 3SYCA 1MVUA 4P2OD 3MRGB 4MCNA 1ASPA 2QV4A 5DK2A 3VXSD 1SLWA 3F01A 5T1LD 2D7TH 3PFQA 2YA1A 3OG4B 3ARGB 2ZKHL 5FYKL 3D3VB 3QQDA 2W1NA 3CHXA 2X4PB 1JZ5A 1NLDH 2NX5D 4JSNC 5A2LH 4WK0A 2VAAA 1TOXA 5HJGA 4K9JA 3PWVA 2CG9X 1UM6L 4P2RA 4BQ9A 3L3OB 3X1EA 1FFOA 1EZLA 3N43B 3IDGA 2E6JA 1IEAA 2B2XH 4QHMB 2PWGA 1S7QB 3SE8L 5I6LA 5CSZB 5I6KA 1LLAA 5EOTB 1XWVA 5CS7A 4FA9D 3MJGX 2IPUG 1S2EA 4YR6A 2EXSA 2F61A 5FXCH 3X12B 4L8SA 2Z35A 4A7QA 2AK4B 4QLWA 4KK5C 3ZGHA 1URLA 5HHXL 2O1AA 3VA2C 1I8LC 4XB8A 3D25A 3S5LG 1R0AH 2PCXA 4PVNA 3ZDYA 1G7MA 4GSDL 1J1PL 1JGUL 1U93B 2XU9A 2IALA 2YMOA 3H3PL 2E8ZA 3CNKA 1HK6A 4Z7WF 2OMUA 4NC0B 4XO8A 4OGZA 4FGMA 4PJBB 4QOKD 4D6VA 5ADOL 5IFHL 4FAVD 5FB8A 3IDJB 3PV6B 3AL8A 4ZXBC 1MAML 4XBPA 4U1HB 4NQDD 1YEHH 4A2DA 4D0CA 1CDBA 4BHUA 2R51A 3P69A 4TUKL 1FNFA 3LNEA 3RBGA 3LRKA 4OF6A 4POZC 3E8UH 1CDGA 2Y5QA 3SE3C 3MRCA 2R29L 4MS8C 2OYLA 2RAMA 1KYOK 4MS8D 4PJXE 1NEXB 5JDJA 4KUZL 5LNGA 1TQCC 4J12A 3RX7A 4HPHA 4NO2A 4OGAD 4A38A 1U8MB 2BSED 1CGYA 2QTVA 3EO9H 5HJ3A 1N68A 1QWHA 4OTXL 1MFMA 5MEND 4X63B 1SXZA 3QFGA 4X9YA 3VDCA 1J9TA 4PRNA 4KO6A 3F58H 2HJFB 2UXVA 1A0QL 4KX8A 5DYFA 1PYWA 5F7UA 1Q9KA 4F57L 3QIUC 4GJTB 4KTYA 3UDWA 3CN1A 2VZTA 3QJVB 4NOBA 4J73A 3RNQB 3C8KB 5I74B 3EJRA 1CVSC 5FKQA 1FC2D 1RFDH 3P3YA 5D2LF 1RZFL 1R24B 3L4CA 4IS6A 4GZ8A 1R3HA 1TEGA 1YEDA 2V5MA 4H26A 5IJKC 2CPCA 1TSHA 4FLHA 1XCQA 5F3HA 2X6UA 4AYMC 2P9SC 4QRPD 3I6KA 1OCWL 1AR1B 2V9TA 4NPYA 3ISWA 2R2CA 1YJDH 3RB7A 4KMQA 4G6FB 3DGGB 3GF8A 3KS0J 1OSEA 1N64H 1LEGB 3QZPA 3RVTC 3TEZA 1TQSA 1JWMB 2Z31D 2APSA 3CHQA 4L1DA 4PGBB 2IPKB 2P4AB 3FPXA 3ZO9A 1I9RL 1TMQA 2E46A 3NZUA 4K94L 2NR6A 2I0SA 1T83A 4ELMB 4XCFH 4MCZB 5I75B 1N6EA 3GNML 4HV8A 5E1IA 1FNAA 2A7BA 3RP1A 3BIAX 1FZKA 3O3AB 4NM4H 2JQAA 2DQDH 3BN9D 4LU5L 4IMKA 1WC7A 3E8UL 3S3PA 1UADC 2PABA 1VZ2A 2J56A 3BUPA 5FFOA 5I2IB 3FFOA 1OANA 2ZWYA 3ZZ1A 3LKRB 4NJAH 1GC1L 2I7OA 4JFTA 3T2QA 2M2DA 4YSOA 1BIIB 2E47A 3Q48A 4OAWA 1R3IH 4PJIA 4ECNA 1FRGL 3AQZA 1Q0EA 1U8LB 4HUKB 3BSGA 2EE0A 1UASA 3HHRB 3WJLC 1VB9A 3CQQA 3ESPA 4JFEA 5I1CL 3TGXA 4P2QA 3HG4A 2M26A 3IJHA 4LVEA 4J3OG 5KVMC 1GYAA 2OQJB 4YDIL 4OQ1A 1ILUA 1XIWD 3S9DB 2NY1C 3U0PB 1CBJA 3EJYD 3IMSA 3ORVD 4TNFA 3WTVA 1AD0B 4AJ0A 5I71B 1KEGH 2ZJSH 1A12A 2X4TB 5FA5B 3L8QA 5EU5B 4LLDB 4L1SA 3W81A 4IBTA 2VDOA 2R2BA 2BNQA 4K55A 2XHNA 2DEWX 3OC8A 1CDCA 1WAAF 3E9UA 4DFHA 3B9KB 4YVNA 4OD2A 3UABA 4C47A 3SDDB 3JVFC 2ZOLB 1P5UB 1KCVH 3A67L 3D34A 5FGBC 1Y0LA 4QCIA 5LB1A 2VB5A 2NSXA 1T7WA 4ZPVA 2MWCA 3QK0A 4FJYA 5E70A 1M71B 4LLAA 3MR9A 5T1KA 3ZL4L 2FT8A 1L9TA 4F2EA 1J10A 4LASL 5LBVA 1O7DE 4GQ9H 1MDTA 5I8OH 2GEQA 6PCYA 1TETH 4L5FH 1YQVL 4NYLB 3VXRB 3CUPA 3DA0A 4V1DD 5BV7H 1WAPA 2DQMA 3FCGA 4KPHL 4QJ5B 4MX7A 5DHVA 3MJ9A 3QPXL 3RWJA 1I9IH 4XNYL 1G9EA 1PKQE 3WDHA 5FXYA 3VM5A 2SEBB 2BLFA 3MLRH 4U3XA 3V6OA 4WW2B 4PRAB 2GQHA 4BWTA 3NCFB 3DIFA 4PJFE 3TFKD 1FHGA 1O6TA 3KXFD 3OHMB 3WTTA 2E7MA 1IC1A 1AS7A 1D7FA 4KGJA 4XCFL 5DZAA 2EVJA 3UKUC 4H1LH 2VLJA 3D0VA 4LGSB 5D2NC 3MYJA 1JUFA 3WMSA 4ZQKB 3SZ6A 2K8QA 5EBLB 3Q01A 2HFGL 4HIXL 1VEOA 3UJIL 2B4CL 6FABH 2BSTA 5DSCB 5E00B 3VWKA 4FHBD 3GPEA 3VI4A 4CMHB 4JL2A 4CMMA 5DJXA 2PO6C 4F20A 2X0VA 2CLRB 2B5IC 3ZKMD 5EU7E 4MD4B 3UVNA 5CCJA 2JKNA 3UTTE 1BPVA 1GOTB 3FCSA 4J8QA 1B4LA 5MERB 4HF5H 2J2ZB 4PR5A 5IESL 2YK1L 3BQUC 4O5LH 2QVIA 2C7FA 5F9DC 3ZSTA 2F54D 4KJPC 3VI4B 5J6HA 1X4XA 1G7PB 4XPTH 3IF1B 1BZEA 3EO0B 4GKNB 4YDNA 5EBLA 2Z7ZA 4ZQKA 4L9OA 2NQDA 4PJIE 5JPMC 2BCKA 3RGHA 3MYJB 1JMXA 2I69A 5G5DA 3LEYL 1OSPL 1QVOB 5AYQA 1S9WB 3VA6A 4QXGL 3KHOA 3DIFB 1KTDB 3C6LB 4U4BA 2GBUA 1AKJA 1NCCL 3BH9A 5SXMA 3FUEA 2LVEA 2OMWA 5JPMB 4RSYA 1BQLL 5I0XA 1TTFA 4RZKA 1BD2E 3B43A 3BFWA 4PLNC 1NC4A 1KY6A 2N0MA 1H0DB 1QFWL 1UD4A 2G5BB 2GC4C 5E4IA 1RULL 2AJYH 2YMXL 4MX7B 4HUVA 3DUSB 1E5BA 4KKAC 3CUPB 2XICA 4APQA 4KVPA 4FA7B 1YDPB 1Q1JL 4KK9D 4ZS7H 1ECYA 3UXFA 1OOWA 3CIAA 5LQBH 1IQDB 5DD1H 5SWQA 1BLIA 4BZ2H 4FL4B 3S0PA 5F3BB 4Z7NE 3L3GB 5DMIL 3LKSA 2EDEA 3QSKB 5EBMA 3LPWA 4FQ1L 1R5VB 4TL4A 4J84A 2ZOWA 3CFUA 2NMSA 3AREB 4PJ5D 3QRFM 3GHBH 1X5KA 3QFJD 3DXAB 2ZOLA 4NNPH 5DK0A 3ZDZE 2D3JA 3BC9A 4K23H 4UTBA 4JE4B 5JQHC 2E59A 1RMFH 5DEFA 4BWWA 5CSGA 3RVUC 1SFHA 2WAQA 1KCLA 1U8KA 2R2BB 2EDKA 4AKPA 4EDWL 4KDTA 5EU5A 4PREA 4HHWA 3TBWB 4P4KC 1E40A 3DVFA 1YYML 3FUFA 1IGYB 1KYAA 1SMDA 4XP4H 4XMLL 4N8VG 3QFDA 4ZFGL 2DJMA 4HK0A 3UVLA 4JFVA 3DETC 4QHPA 1R5IB 4YFDB 3NJXA 4NFBA 2CIIB 3OHXA 3KCPB 3O9WA 2KS0A 4MMYB 4Q2ZB 4D9RE 1QHPA 3W3BA 2N3JA 4G6KL 1JXGA 3TT1H 3ZT7A 1U8LA 1FL5B 4XNQB 1DZ0A 3KAAA 2ZYSA 3E3QC 3QXAA 5AZEH 2YRBA 5I1LA 5EMKB 2MSPA 4OBSA 4TUOB 4GMBA 1K4DA 3TH2T 5D1XD 3SPCA 2YUVA 3LKRA 3PHSA 1OAZH 2JI1A 2ZXEB 5AOMA 1JGDA 1SOSA 3Q5OA 2MKWA 4TQEH 5FYKE 5L4IA 3DNKA 3RBSA 2HYMA 4AMZA 1UB6A 2P28B 3F83A 1OGAA 3LNGA 1NSNL 3IJ9A 1ZLVH 1N6UA 4CVZA 2AGXA 3Q1EA 4Y88A 3HNTL 1KLUA 4XOBA 3EYFB 4Y2NA 1MI5D 2Z91B 4N3UA 1MJUH 5H4YA 3FULA 3CSGA 3PVWB 2F5AL 4Z7OF 3L48A 4LAJH 3PUUA 3T0DA 3BXNA 4KZEH 3GKWH 5F89A 5I8CB 1AQ8A 5J6SA 1R6VA 3CC5A 4IBYA 4L3GD 2ICWJ 4Z7UA 5FOBB 3FN0H 2CE6A 1I8AA 4Q9RL 3PWNA 4XNYH 3QXUA 1NEPA 5AW1B 4G6JL 4QL1A 1OE2A 1XXDC 3D69B 3VFOB 5ITFB 4LVOC 4F3FB 3UYRH 1CE1L 2VDKL 1SJVA 2XBDA 3IMTA 1UCBL 1YN7B 3HFFA 3P4NA 1NBYB 2X70B 4H8UA 4NFDA 1A4JA 1E8XA 3PREA 1JF6A 5D8JL 3CLFH 2K9UA 2JCCB 4A2LA 4OZFB 4G8FB 3C8DA 3KH3A 4ODTH 1YEDB 1WT5A 4FQQB 3EIFA 2YPVL 5DUBB 1E5CA 2XUWA 3WNNA 5ID1A 4QAMA 1OP9A 1D5XB 4FQHA 4IS6B 4WHYH 3SKUD 1R24A 1EJ8A 5B4MC 1B0RA 4PRPA 1NGQH 5CBEA 1CG9A 4CY5A 4WDIB 4N0FA 2WBJC 2IMMA 4YWGH 1GGBL 4JHWL 5FW8A 4JDZB 5DXWA 3RGVB 1PYWB 3CSTA 4Z7OE 4YDJA 1AOZA 1GS7A 2BSRB 4CA4A 1WEJL 3C9NA 4XNBA 1IX2A 3KPSB 1IU1A 2K8MA 5I26A 5CF3A 3ILPB 2H4EA 5HJ3B 1IC5H 4H0GA 3NJKA 1KOAA 1U8MA 4F15C 3MRDB 3F7VB 4EDXA 3LN9A 1BFVH 2XWTB 2ADFL 4A37A 4BSJA 5HPMA 1MXDA 2HTKC 2V17L 4JFHD 2YKLH 2VXQA 3JZ7A 5CD5C 4Y16B 3O4GA 1W2KT 5JHDB 5FKSA 1GA2A 1M56B 1E4HA 4LQ1A 3VH8A 3CZLA 3AFLA 3CDFA 3GHEL 4W81A 3H53A 2JKLA 1FRGH 3KRWB 4J4PD 3SY0B 5C9JA 3CQPA 1D3CA 3IFOA 3DETD 3LJ3A 3D5OF 1MCPL 4QRRE 3Q9QA 3QEQD 4PJBA 1WBYA 1G1KA 3WOVA 2TRHA 5KVGH 3F7KA 1F6AB 2AI0H 5K9OB 3BX7C 2F7PA 1G7MB 3S3JA 5JIDA 4LDLB 1MVYA 1X5JA 1HKFA 3B56A 5G4OA 2XY2A 4ZTPL 4AT6A 5D7HA 2LLNA 1F58H 1S4UX 1GMEA 1WHOA 3T09A 2HMIC 1ZPUA 2ZYHA 4G7VH 4YHNB 3BO8B 1GW6A 2GTZA 2DMBA 4HXBH 3V8CA 4AC4A 5IJ8E 4KKBD 1IEAB 3IAPA 4X0KB 2VDPB 4G43A 1IE4A 4JRYE 3PL6A 1U3HC 1N67A 4P2RB 4JGMA 4QXGH 2R0WH 4W9DC 1JK8A 2DLHA 3AT8A 5M94B 2FJFB 3N9GL 4J28A 1VGKB 4FEMA 4BDVB 3BI9X 4S11A 4OLZL 5FYLE 4A68A 3DXMC 3D3VA 3OX8A 2X1WL 4OR1A 4P4KD 3ZHLA 3ARGA 1JXKA 3S5LB 2EO9A 4OGQC 2F8XC 3HG1B 4PCYA 1I7TA 1RPUA 3V0AC 4OI7A 1FSKB 4JKNA 1GS8A 1BDYA 1NOAA 3OLDA 4JT5C 3MRGA 4C56E 3PHOA 3OJ2C 3A3YB 4GRWH 4I2XA 2XTJB 1EZVX 3CHSA 4PGDA 5IHBA 5D1QB 1NWPA 2N4IA 1KELH 1NAMH 2XQYA 2VH5L 2K78A 1RZIB 4JZJB 3SDAD 4F9LA 5F1IA 5KVEH 4CSSA 3EUDA 3VXRE 3B4NA 4KXBA 5DK3A 1A1NB 1WRFA 3EDJA 3FQ1A 4HJTA 4R90H 2WM0A 4UMSA 4H13C 1H3PH 2YAQA 1FBIL 4NSKA 1VERA 4ZW7A 3RWIB 5DJCB 3ERXA 4HKJA 4N26A 4AW7A 2VYRE 3V9FA 1J8HE 3MACH 5KBMA 3GMPB 4M3KB 3HHSA 4ZAKD 3FF8A 2MPVA 5HI5D 2BFGA 3U83A 1GTFA 3SO3B 1NLBH 1L6PA 1NGWA 5T5FL 1PEVA 1PZAA 2YGPA 4RGNB 2WO4A 2OJYA 1EGJL 4Y5VC 4JVPA 1CURA 2LU3A 2O93L 1C5CH 3BUYA 4WJ5B 5DMJB 1FO0L 1UATA 3RDTA 4RBPK 1ZLUK 1SNRA 2VO5A 4JM2C 4JZNB 4LLUA 4HOXA 3MROB 1AQMA 3OR7A 1DQMH 2DD8H 5TFSL 1DN0B 1W6WA 3I9IA 5E0FA 5EO0A 3VB9A 1BG9A 1JF5A 4N2CA 4KJYA 5ABAA 3NJLA 2O6PA 4H44C 1XH2A 3CFKB 2MQGA 3EFFB 5I16B 3LKOB 3ZDXE 3L5WB 2Y7NA 2C3VA 3FXIC 1U3YA 3PYCA 2K9FB 4WI9A 4TOYL 2PM9A 4MD0A 3T3PA 3N42B 3D6GA 1G94A 4E41D 1PLGH 1OT1A 1AAJA 3N0PB 1ZGLB 1NEZB 3DO4A 5JO5A 5FHAL 4ZMOA 5BJTA 4DP4X 2Y5TB 2PR9A 3UZQA 4G9DA 4MA1C 1LP9A 1UVQA 5AG9A 3QIWC 1OL0A 3F7RA 4ZUSA 3N2JA 3C5SA 3D85D 5B3SB 1E8YA 1MFDL 1T3FB 3UMTA 1BYNA 3QJOA 1DJZA 4NKMB 1ZWIB 5H2BA 1PZ2A 3KYOB 1C7TA 4RZCB 1Z5LA 2KZWA 2CO6A 1T66C 5F8QC 1PLAA 5HI3C 3ALXA 1BGXL 1TT6A 2ADJB 4K3GA 3VGAC 1SJHA 3ZU8A 4J4PA 5DJDB 4BZ1H 3UYRL 3RN1D 2R2EA 4PJEB 2R2HA 1EBAA 1E9OB 4LLWB 3T65B 1CF8L 4PMEA 2C1OA 2ATKB 4ZDHA 2FIKB 2IMNA 2W0PA 3BP4A 1XB8A 3NJVA 1MLCA 1XF3A 2DM7A 3KLKA 2F8IA 4FQLL 4KOCA 4NJAL 1JZIA 1KTKE 5B3NA 7PAZA 3DMMB 1TVDA 2H26A 3BN3B 3BGAA 4JDEA 4FXTA 4Z77B 2MRYA 1ORQA 2YAPA 3EXLA 4H2AA 4KKLC 1FO0H 3GSNL 5LXVA 1ACYL 1GZQB 3INOA 3FT3A 3L95A 1S9KC 5T5FA 3RTQC 3H8NA 1KDIA 4HLEA 2K7PA 2QGBA 4XYIA 2G3ZA 2W65B 4NO0A 4B0MM 3KMDA 4YLCA 3DV4B 1DQDH 1PKQA 3N0AA 2IBBA 3F12B 5C9KA 4X9FA 1JSYA 4F1SA 3PV7A 2Y5EA 2EEXA 1FVCB 2OBGA 4TN9A 4D9QD 3FUKA 5DC4B 1IBDA 3UO8B 4ETQB 1A22B 4CADB 3S8FB 3LDBB 4FFYH 5E7BA 3PIQA 5C0FB 2J3SA 1GOGA 3GDBA 4N8UA 2YEQA 5EORL 2BDNH 5TH2B 1CUOA 1I9RH 1HC1A 4PJHA 5DJYB 4I89A 4P23C 2YK1H 1XSJA 2F2HA 3ZHFA 2AEPH 1HHGA 2DWDA 3QDME 4XMPH 5BOJA 5ALBH 4PMFA 3FOLB 1A6ZA 1CXFA 4DP1X 1KCSL 3H54A 1DQJA 1YNTA 5G4NA 1DUZB 3O45A 3DI3B 4AM0Q 1LO3L 3GD1I 4XXDA 3GS4A 3FB7A 2KKQA 4PRHB 4PRPE 4WI8A 1XCWA 3HRZA 2XKNA 2FWSA 1AO7A 4F8LA 4PJCF 1H3WM 1U41A 2DYPB 8FABA 1HOCA 4XMWA 4M7KH 2XQBL 2UZYA 4O2EA 4XPHH 5KANG 5HJDA 3ARQA 1DQKA 4UV4H 4M03A 1FFPA 1WD8A 4HPYH 4U1GC 2Q76A 3KYKH 5D7KD 5DS8A 1SLVA 2PYEE 1K6QL 4ORZC 5C2VB 4H88L 5FO8A 4XC3L 2OKMA 1EXHA 1TU2B 4PS4H 4Y4HC 2XIDA 3SQRA 4B9PA 1A7QL 5JW3H 3E0CA 3KPPA 5KEZA 1JWUA 4M3JA 4CU8A 5GZNC 4NC1E 1N59A 4N0UE 4P2OC 5L0QC 2I25N 1XGYH 2IH1A 2WJ7A 4PWEA 4BZ2L 5C97A 1CFQB 5JWZA 3BP6A 4XH2A 2R59A 3BHBA 1YVLA 3QC6X 5BV7L 1P7HL 1E2WA 5HGDA 4Y2OA 3VG9C 3UYPA 3IJEB 1RCYA 1RJYA 4Q9QH 2C7UB 1D5MB 1RUQL 5IW1A 3GC3A 2ZWKA 1F1DA 4KI1A 2OL3H 3EYOA 3GXNA 4P3DA 5SX4H 4JKPL 3O3BB 2BSBA 1CN4A 2QQKH 4KTEH 5CP7B 4MB1A 5KVFE 1V55B 2K6YA 5DJ6B 5JW4N 2YNNA 1XV8A 1ZS2A 3QS2A 1OOAA 2BVEA 2G2PA 2WNWA 3K26A 3UZEA 2V5SA 2X89A 2HRGA 1SHMA 2JVUA 1C9IA 4FNLH 5CJOL 1H2YA 4XXCA 2LAGB 2VO8A 5KVEE 3MREB 5IM7A 3F6IA 4MJ6B 3QDGE 1ZLSL 5E5MB 4NZFA 5FYJE 2GJ6E 2ETWA 4JY4A 5E8PB 5LCVH 3UFIA 3SFZA 1RIUL 2WSKA 1E2VA 3ATEA 3NCMA 4NN7B 3L6FB 1BVKB 4BWUA 2YD0A 4U1MB 2X6CA 4YK4C 5IHWA 4MGXA 4U1KB 1P7KA 3CIQA 3EHBB 1SN0A 3DX9B 3ULAB 1J5OL 2YB8B 3J80g 4APQD 5EDXA 5AOLA 2DQUL 2VLME 4XPGL 4ZPTA 3ZTJH 2AGLA 4X5XA 2HCZX 1RHHB 4DKTA 1N2RB 4AENA 5BQ7A 2ZICA 2B5MA 5HI3D 4NLAA 3K74B 2F8OA 1SBSL 4KTDH 3H9SE 1PZDA 3GDCA 2JK5A 2X3AA 1AKJD 3SODB 1AE6L 4UM8B 3KM1A 4FI6A 2BP8A 4EBQL 3N43F 4XNXH 2X0WA 2PTVA 3US9A 2H0JA 2XN0A 4OF5A 3QIWD 4HETA 2AQ3A 5JA9A 3ZZSA 3SY6A 4Z6AT 1AZZC 3CFIC 1NANI 2VERA 2JKIS 4LSTH 1BVKA 2VXTH 5GRXG 2J55A 1QMUA 4PLOB 5L2KE 5J6GB 1FYHB 1T22B 4Y1TA 1E3FA 4Z7AA 4PB0H 2QFPA 2CMRL 4LG8A 4WY7H 4PYHA 5AAMC 2WXHA 4OCXL 3SPHA 1NIAA 4CY2A 2IGFH 1GPOL 3HZMB 5DGQA 4GO9A 3IJSA 4LHUB 4F15B 1Q94A 4OCRL 5AVTB 1K8DB 4I5BA 2YEZB 4F7KA 1D9KA 4KKNA 2D3NA 2B14A 3SE3A 5ESQB 3EYOB 4P3DB 5IHHA 3FU7A 1XQ4A 4CC1A 1RJYB 2P52A 3B6SA 3BJ91 1OW0A 2J6EA 3IJEA 5HD8C 2QHRH 4YZFF 4TZ4A 3UX9B 3HMXH 1HHIB 1MHPL 2VDQA 1WIUA 4X5WA 3BLPX 3V6FB 4PRIE 4RGMB 2VDNH 1A25A 3ATFA 4JPKL 4OZGE 1CBVL 1MHCB 3WFDL 5K1JA 5KS9A 3CDZB 2W9LA 4LARL 1TVBB 4B53A 3GRWH 4Z7NF 4UBDD 2PWHA 4RFNB 1XD0A 5H94A 2A6IA 3WBDA 3P0VL 1DLFL 1G9MH 2V3EA 2YQ2A 3C87A 4FTDA 4NC2B 4KXDA 4W9IC 2Y1VA 2Q76B 4U31A 4YAQB 3CZUB 3HC3L 3PQYA 3QHTC 4XOAA 5D1ZC 5FX3A 4JRLA 5FYLH 3RYMA 4NN5C 3FCBA 3SO5A 1S9XB 2WUBL 4NAJA 3FM0A 3B34A 4NAMA 5C0AE 4DVRL 1TZIB 2YXMA 1VIWA 1SLXA 3HRZB 1GSKA 3OBAA 3I02B 5HYQA 4JFZL 4DP0X 1DZBA 1DQML 2DD8L 5TFSH 3I9GH 4WCYH 2OW6A 1DUZA 3O45B 3QDGA 4FXKA 5INCA 3PHAA 5BO0D 2I27N 4HULB 3IDNA 5GMKn 3OMZA 2IXQA 3PAUA 1QBMH 4AYBA 1FI8C 1VA9A 5D7SL 2DWDB 3U4BH 2Q3AA 3WGUB 1DE4A 2XXCB 1NFDF 3WD5H 2DAVA 3DX1A 4MCYA 3X2QB 3RFZA 1C12A 4KO7A 1IILE 3W15A 5JOPD 2ZKXA 3L16A 4K5OA 4B3EA 2R8SL 2LAAA 3VCLA 3O41B 4EXKA 3M07A 5ICZA 3KPLB 5A2BA 3N85L 4DN3H 1J5HA 4CADA 4ETQA 4X6CA 1A5FH 4AL8L 2NDGA 2MCAA 3F65A 3U4EB 3WNKA 1WTGT 2CJTA 4YIQA 4RISL 1QI5A 3ZE1E 3ULVE 4XVOA 2Q2EB 2UWEB 2NY1B 1RD6A 3DV4A 4U49A 4FC3E 4I88A 1WDAA 2GEEA 4PSPA 4F9PA 3JYCA 43CAB 3SDXF 3FUMA 3MBXH 2EAEA 2V5TA 1GZQA 3QUMB 4OZHF 5JIKA 4XTRC 4OJCA 5T3ZH 5DGRA 1SQJA 4OCMC 4LCIL 2WLHA 4MLIA 3HBGA 1AIZA 4HWBL 4NQDE 1ORQB 2K4AA 5EZIH 3SPIA 3C5XA 1AKPA 2H26B 3UMNA 1MCIA 3RZWA 2VDLL 1EDYA 3SOBH 5BVJA 5DUML 1I3VA 2WBJD 1CJYA 1XF3B 3BAXA 3IIYA 2HLEB 4PJGE 5DTFB 3WSQH 1EMTH 1DVQA 2Q5BA 3MOBH 4Y5VA 5CXCB 3IMVA 4AWJC 4AVKA 1X5IA 2WYZA 4G6KH 1TFHA 1Y1DA 3GTVA 3WEXA 4G8EB 5JUEL 4FZ8H 4LGNA 2CO6B 1IT9H 4TRPH 4LO9A 5J5EA 3KYOA 4ZMLA 4JFEE 4GSRA 3MMYA 1ZT7B 2RA1A 3TNNB 2BRQA 2J71A 3MX0A 4ENZA 2Q86A 4C57C 4XI5C 5FC9A 5DFVD 3BAEL 3VD0A 4OZIB 1RPQA 4FNLL 1GXEA 1E4XH 5DMGD 1YPZB 4DO5A 2EDQA 4ZNCD 2ZSVA 4UM9B 4ZMYA 1RSYA 4HS3B 4N0UB 3RAJH 3UIZA 5BJTB 1RV6X 3JTBA 5FO9B 3C5MA 4PGEB 2FGWL 1TNNA 2Z8WC 3E0GA 3S3DB 5GSRA 5J1SC 4C83B 3T0XA 4XP5L 1LYQA 3S98A 3VRIA 2HWZH 2IFFH 2PM9B 3SLED 3E38A 2C3VB 3T3PB 4A11B 3ODTA 3D51A 2OSLB 2R4SL 4HT1H 1QW9A 1OTUC 4FQCH 4KJYB 1KB3A 1PU0A 5EO0B 5I1GH 5F7LB 4KZCA 4U3CA 1SDDB 3V4VA 2D3VA 1X7SA 1OLZA 2ENYA 3J07A 3JV4B 2P9RA 1MCSA 4BSWA 5ACLA 4NO3B 1QNIA 4D8OA 4YSPA 4N6RA 5FWRA 3GZOA 4FE9A 4HXAH 5TQ0H 3SDXE 3OKMB 3QCVH 1HWGB 1U4FA 1R4XA 4HIIA 3V0IA 2FBJH 2TRCB 5KVDL 3D52A 1NGWB 3DLQR 4WFEE 4W6YB 4P2CG 3ARUA 5C3IA 4MSWB 5DVMA 2NTFB 4DTGL 2OR9H 1CDUA 3VXUD 1A1MA 2WO2B 1NCUA 2I60L 3CHPA 4H0HB 3FPYA 4ONGH 4DAGH 4XPAH 2X09A 5IQLA 3WFDH 1I1AB 3KGRA 4TSCL 4D0DA 1TJGL 5DJCA 1GZHA 4KKCC 4ZODA 4GI9A 4WFED 1DEEB 1N70A 2DDQL 3KJ4C 3NCBB 1DBAL 3MCLH 3P73A 5F1IB 1Z3GL 1RZIA 4JZJA 4O02A 5MENB 4UZGA 4YVDA 3ARFC 3D30A 5FYKU 4GXVL 2P9PC 2QSCL 3L5HA 2XIBA 4UOQA 3L54A 5CILL 3GS0A 5DC0A 2J4WL 4ZO6A 5AOIA 1NDMB 5CJ8A 1S7RB 3LMJH 1JV2A 3N41B 4QY8A 3S5LA 1O5PA 4OB5H 1XGTB 2E27L 1G7JB 5AW5B 1LE9A 3NCCB 4DEPC 5ACZB 2L3BA 1INDH 4OFYA 3SWSD 3ZRSA 1VGKA 2GJ6D 4BDVA 2AHIA 3P54A 2FJFA 4B41A 2ZOOA 2BSSB 3T6XA 1GGUA 3U9UA 4JHPC 3U7YH 3HN8A 1NCWH 4G43B 4IRJD 2VDPA 3CXFA 4X0KA 3PUCA 2P5WA 3QQ3A 1XGQB 1U91A 2FO8A 3PDGA 3A23A 2AK1L 3MRIA 3CVHH 4G6FD 3MV7A 4IBSA 5DEGA 3UTTB 3WKMH 3GI9L 5HHOA 5HYSA 5AVUB 4JT6C 3ZDZA 1LGVA 3N1FC 4RAVA 2BJMH 5FOJA 1MFCL 4LPYA 3W2DL 1UG9A 4RMWA 4AT6B 5H17A 1BZ8A 3VYPA 1TBGA 1A6UH 1HOEA 4JREB 2ALAA 2UWEF 1QEWA 4NBYB 4HG4J 1DUYB 2BOLA 5F0MB 2PCPA 2R83A 4KU1A 3WKQA 1E9QB 1FQ9C 2H5UA 3RZCB 3UTQA 3L4TA 3L17A 2Z0BA 4U1LB 2NY2C 4HJJH 1QBBA 2C3WA 2VLMD 4XP9L 2ZG1A 5J11C 1EAQA 2MEJB 5CBAA 2VXSL 4FFWD 4A2HA 1DFXA 1OAKH 5D1XA 1IZJA 4M5YL 4J0XA 3CE1A 3IRCA 4YGVB 2AXJA 4P07A 4AYDC 4U7KA 3ZE0A 4F57H 5C6TL 4X4ZA 1OF2B 2FNWA 2B39A 4X8XA 1R9FA 3LB6D 4AQEB 1MCJA 3QDJD 3IJ0A 3ILPA 5A2IH 5AYUH 1BFOB 1T2QH 3C9NB 3Q0HA 1J0ZA 3RL2B 4XPAL 2LTQC 3BMVA 4GP5B 1EAPA 2ZCKL 3IMUA 3RGVA 2EXWC 2AEQH 3NJMA 2VZVA 4ZW6A 4MYPA 1YMHB 2NY6D 5L8JB 1B0RB 1NMBL 4PRPB 5GJSH 5CBEB 3F64A 3TA3D 4G6AC 3BIBX 4RQQA 4U6VH 1NFAA 3UC0L 5GZOC 4J8RA 3K81A 1BP3B 3UTSD 2J5LB 3RAJL 4FQQA 3G5XB 4URTB 4Y19B 3WJMA 4AY0A 4OZFA 1R3IL 2JCCA 4L8SC 1MJJB 3QEQE 3A4FA 3SDDD 3OW8A 1CXEA 2HT4D 5DZNA 5JW3L 3MCKB 4GQ1A 3QUXB 1AH1A 1ZAGA 3I89A 4PJAA 4F3FA 3J7HA 3K3QA 3BT2L 5GRJL 5JW4M 1GVIA 5CUSL 3T4AA 5JIIA 1AZVA 1GOHA 1BQSA 3QXVA 1UTCA 2BIIA 5I1GL 3FMGH 4HLZH 4Z7UB 4YBLC 1NOFA 5FOBA 4OWRA 1GCYA 1UA3A 1FYTA 3OXSA 4KV5F 4GG8B 4CI1A 1WTLA 3SBRA 2E6QA 2YAEA 3BXNB 3JXAA 2BINA 2IAMD 4KKQA 3UTZA 4I18C 3AS1A 4AJVA 2P42B 5EZOL 2YQGA 1A6TA 5TK4A 1OV8A 1QRNE 4FMVA 5HGHA 3QIBD 1QRKA 4ZS6C 1GYWA 1OGAB 4M4PA 3NA4A 3VG9B 4RFOH 1U8IB 2OTUA 1Z9SA 3SGJC 2D0HA 3ESOA 2UY7A 2CK2A 1CGXA 1LO0H 4XMPL 3PS6A 2DMGA 3EAKA 2COQA 4PWFA 5FA3A 3KXFB 4FL4C 4B27A 4B9FA 4E9XA 1N10A 4CC4C 1TEYA 1VZGA 3QXAB 1TZGH 3FSWA 1FL5A 4XNQA 4LSUL 5D1ZB 2YBAA 2O5YH 1V7ML 2HZHA 3JRPA 3VAEA 2WMPA 2YPLB 4GFTB 5I17B 2V8MA 5SV4A 5KZCB 2K6WA 3KCPA 2XXFA 3O9WB 4MMYA 3QI0A 2CIIA 2X9WA 3OHXB 2Z4QB 3OKOA 4WK4B 1DQIA 1FZOA 1J1XH 4BFJA 2LU4A 4JY5L 4O2FB 2XDWA 2CHDA 3QFDB 1TMCB 4DO4A 1C9SA 3QORA 1ZKAA 4P99A 1CTNA 3O4OB 1MUJA 3L4YA 1MFNA 5E8DL 5IBTL 2WAHA 1DCLA 3AU1A 4AQ1A 4GKZA 1O6GA 3TBWA 3PAVA 4F91B 5PAZA 1WUNT 2ZCHH 3WUZA 4CVWA 1KBGL 2XPGB 1U8KB 3FGBA 3UR4A 1NKOA 2IH3A 3MOQA 1T6VN 4JL1A 3BPCB 2A5UA 4YXKL 1MI5E 3R8QA 3WFHB 2NYYD 2DQJL 4F8NA 4G3YL 1MFAH 2Y7SA 3GZQA 5AL0A 3PXLA 4OB5L 1WCBB 3TBYB 2EVGA 1YEEL 4F7EA 2V2WA 4ZMNA 1T03H 4PJ8B 1R5VA 4LRIA 4P4RA 4QO1A 1KULA 5EBMB 1ZTXL 2EQDA 1EUUA 3DPDA 2YFOA 3LKSB 5F3BA 3PVUB 3MO1A 3C6LD 5SWQB 2XV2A 2H0FA 1BA9A 4FLRA 1SXSA 3ZDXB 1GRWA 4ZSOE 3HBPA 5IK3B 4NGHH 1F6LL 3CZFB 5IMOA 1KUMA 4ZX5A 2G5BA 4XNUL 3HZKB 2WTPA 4M8RA 5H37H 1QATA 1TQBC 1V5JA 5I6XB 4I18A 3NSDA 1R5WB 3C5ZB 4GIOA 4S1SL 4OKVB 4YE4L 3EH2A 3MFFB 4XODA 3D4CA 3O8XB 2WB1A 2P24B 3ARRA 3BUDA 4IOIA 1GS6X 4YDIH 5JOFA 1N5YL 1KTDA 4E9WA 4IBQA 1OP5K 1H2ZA 4IK6A 4Q74A 1CFNA 1ND0A 1S9WA 4M7LH 2NNRA 1JXDA 3VD7A 1KIRB 5FK9A 4AVIA 1S5HB 2AJSL 2BCKB 1F1GA 1AZUA 2QDVA 4ZO7A 2ZOUA 2QVMA 2CPUA 1IL1A 3CJJA 3EO0A 4GKNA 3DV6A 2LW3A 3V4VH 3V7MA 3KBFA 3JWOL 3P2DA 3JPXA 4L05A 4GW5A 3WKML 3BD5A 4KGLA 3RI5K 3MNVB 4MNGA 5HDBF 5C6PB 5LGJA 3HC3H 3STLB 3H9SD 3QE5A 4AYFA 4MLSA 2J2ZA 1MCBA 1XVSA 2FQDA 5BZWB 4JSXC 3TWCH 4KDVA 5KVDE 4ZG1A 1IAIL 5J89A 4YXKH 4JBSA 5IFAH 1IZKA 1MCWW 2DM4A 4UQEA 1QD0A 1T5WB 4L2LA 4FXGB 2AANA 3PNWB 1XGYL 1JZEA 4CMMB 1BMWA 5D7IE 2DQ6A 2UXTA 4GG6F 5E00A 3MUY1 1N3NA 2Q7AA 3APDA 4FYQA 3NEOA 4H8QA 4M61A 3MXXA 2ZAGA 3LRMA 3NFSH 5E4EB 1OSYA 1PX4A 2YRPA 3KRXB 3MODH 1JUFB 3D0VB 1DBBH 1UZ6E 2VLJB 3GRGA 4N9OB 5INDB 2F1EA 1N6FA 1AGBA 1JNNH 1TNMA 3D2UA 2Y7OA 4QWWC 4S10A 2EDYA 3L13A 2EEDA 3ATAA 4R5VA 1U30A 1Z9LA 3MI6A 5C0CB 1CFTA 4RGMC 4F8QA 3BWSA 3C5ZC 4OCYL 1JGEA 2SEBA 4GNKB 5C86A 2X6VA 3QJFA 2YMUA 2AABL 3N40P 4GKSA 1SOQA 1HDMB 2MQ3A 2JQZA 5DHVB 1FV1B 3CCHA 1RL1A 3N42F 4BQ8A 1KGCD 3BMWA 2BVOB 4NN5B 4XPBL 5HGBB 3SJVB 3O3EB 2Y23A 2AQSA 1YO4A 5EIIA 4WEBH 3VGBA 2BNRB 2I9TB 1UHVA 1PG7L 4DKAA 4JFOA 4N2EA 3CH1B 4U6YA 4YHLL 1AQHA 1CDJA 3MR9B 1CFMA 1DANT 1SEQH 5T1KB 1FFNA 4BFBD 5K59F 1IC7H 3NBNA 1BZ7B 1NUGA 2YD7A 1DJYA 4NENB 4IMMA 3BE1H 4HC1L 5DZOA 1U2CA 3SDDA 3BRFA 4OD2B 1EGJA 2C9VA 2VLRA 3FU9A 1BVZA 2DWSA 1VADA 3B9KA 3FQ2A 4TSAH 4UIMB 4CZXA 5L9DH 2VITA 1ET8A 3ARYA 1M7UA 5TGBB 4D9LL 2YBRA 3SQOH 1E7UA 2I85A 4P49A 1CLYH 4LLDA 1AHWA 2X4TA 4IOSD 4OFVA 1AD0A 4MB4A 2ZXCA 4LPUA 1ES0B 2R15A 5BPPA 2MTAA 1RZGA 2QV2A 3MV9E 3QISA 3EQ9A 4FQ1H 2R4SH 1XGRA 1HINL 5E2WH 2G9AA 1IGFL 3P40A 5LBSL 3TEXA 1QBML 3FU3A 1AHKA 2APFA 3H2WA 4EI5D 1IGJB 4JFEB 4FFZH 3K72A 1NCIA 1EDHA 2AQNA 1NJ9B 1KTLB 4DSYA 3NMEA 4URKA 3NACL 4JQVC 3GO1H 1U2HA 3GSUA 2X1PA 1KG0B 1F4XL 4OAWB 3GSXB 4PJIB 2KBGA 1R3LB 1P53A 3KPNA 2MOGA 1H3XA 4G11A 1B4TA 4U1SB 1A4BA 4CNIA 3MLUL 2CAKA 2VMFA 3W38A 1H8OA 4IRSC 3LZFL 4J6IA 4WHYG 3I9GL 4WCYL 1OD7A 1YMMA 1A3RL 2CXKA 4AGOA 1W15A 4AXWA 3VRLF 3E9TA 5F96L 4WAFA 2XG5A 3PWLA 5B1JA 1FZKB 3O3AA 5ID0B 5FW6A 1AGCA 3FTSA 5HJBA 3WFCL 1A9BA 1SM3L 4ELMA 3GRWA 3P1VA 1ERNA 2XCMC 1NPUA 3SE8H 3B7SA 4G9FD 3HTLX 1LDPH 2CO4A 2WZ0A 3D50A 4BH7A 5DZJA 4ODBD 4WEUD 4CC0A 3LNDA 4FJZA 1JWMA 3ZWLB 1OAYH 2VQ1A 3IGLA 3QEHB 4K3EH 4MNQE 2CD0A 3MA7A 4AK1A 2WWKO 1BW8A 5AAPA 2XOTA 4NM8L 3ZE1B 3S7GA 2NLJB 4NPYB 5FYKH 2Z65C 4YNYA 3TESA 2HRPL 4HGWA 3SQBB 1JHTA 1WFNA 1OP4A 2ITEA 1MHPH 3K6NA 3LEVH 5LWYL 2CLZB 4TPRH 2E7LA 1PDKB 3TF4A 2HT4C 2WQSA 5HHPA 3SDDC 4PHZA 2XX1A 4Y16C 2MTAH 2XE4A 2X9ZA 2I9LA 3I3DA 4YDKL 2CH8A 4JM2A 1PAZA 1RZJH 1TITA 4JRYD 4HJ0C 4Z3IA 5C08A 1HHJA 5D6CB 1URIA 1D2OA 1Q9KB 5IVXF 1FNEB 1TZ8A 3WY4A 1HXKA 4UOJA 3B2VL 2HLFC 4PAZA 4A7TA 1EGJH 2J55H 1PD0A 1BWWA 3HLAA 3RPBA 1OAQL 4K3JH 4QEGA 3VD3A 4TUJB 3T4YB 3K8MA 3QO1B 4MRCA 4GFXA 2J5LC 3MRCB 2GI0A 1L9OA 3IRPX 1H6UA 3OAYH 1FNLA 3L3JA 4PV1C 3VWKD 3FKUS 2A4EA 3L2NA 4X6EB 4YDKH 3HLKA 1JD7A 3DRTB 4OIAA 1D5IH 2CCLA 2IPTH 1N7ML 1DDTA 4JQXC 4JY6A 5FM5M 1TZGL 4U1HA 1CI3M 1MRDH 4ZAKB 4R8WH 2R39A 3WD5L 3N1MC 5TK2A 2OMUB 1PJWA 3CFTA 1BBJA 2W8CA 2WXJA 5D7JC 1MKFA 2BRRL 1RLWA 2R0ZH 4YDLC 2PPEA 3D25B 4J3TA 4YDVA 3K2KA 5E8OB 1A0QH 1TIUA 2Q3XA 1DBML 2Z35B 3IFLH 3LHAA 5D7LB 4YR6B 2CO0C 3H2QA 4PJ9C 5JPNC 4L3AA 4MJ5B 4K2UL 4MNHB 2NOYA 3QZLA 3UAJD 2H0EA 4Y0GA 4U1JB 3S36L 4E41A 1S7QA 1RJCA 4M8UA 3AG3B 3IDGB 1BFSA 4QHMA 2JQMA 3O2DL 5AKSA 3T0AA 5M95B 5J13B 4DAGL 3ZMRA 2R29H 43C9B 4AGMA 3QJRB 4XRCB 4W9GC 2V4LA 3EGSB 2VAAB 4WK0B 3VTMA 2F15A 3NJHA 3T4AC 2Y7QA 2NY2D 1L6ZA 2X4PA 3HAEH 4HMEA 4Y8DC 3NN8B 1JPTH 3QAQA 5B39A 3L2MA 1EEYB 4PY8J 1OGPA 1CFBA 2DF3A 2CKBB 2ZXGA 3TBVB 3DI2B 2EVIA 1C5CL 1BVOA 3UVMA 1U58B 3FO0H 4DGVL 3BUTA 3GMRB 3ASOB 3I3EA 5I1KH 1MCHA 1Q72H 1GAFH 2NZ1A 2X4NB 1EZVY 1NGYA 1WZMA 3IPFA 3K4AA 4LVNB 4UYPA 4C58B 5IJVA 4HEPG 2O72A 4NT6A 4RIRB 4UTBL 1UZ6F 2YJQA 5E2WL 3W9EB 1R3KB 3W39B 5EU6B 2DKMA 2OI9C 3QR1A 4L3ED 2FJGA 4IRJC 5CN2A 1S7VB 2C9AA 3BAEH 3DHPA 3ESVF 3HN3A 2PTTB 4WJKB 1S46A 3D9AL 3IXTA 1MEXL 3PLYA 4ZTOH 1KJ3L 3IPEA 2DLIA 5D7EA 1C08B 1MWAH 1KB5B 4Y9GA 2B59A 5C0RH 4HYTB 4Z8LA 4H8WH 3GFCA 5AW8B 1ZV9A 5SX5H 1KELL 2VLRE 1OF0A 3E6HB 3FQ4A 5D72L 3EOTH 2ZKHH 4O1QD 4K94H 1A2YA 1Z5YD 2H9GB 4M7ZC 3QHZL 2EIKB 1SVZA 1U8QB 3AAZB 3JWNE 4FG0A 5ERWB 4AQ8A 4Q4IA 4WK2B 3A0FA 4DNUA 2FHCA 3PHQB 1MN4A 1JWSB 2UVEA 1KLFB 3Q1SH 1YC8A 2IANB 3TVMA 3ZZLA 2D73A 4B9ZA 4KKZA 2W94A 1HHKB 2IURA 3R8BB 3BRDA 4WRLA 2VN3A 3MLSH 3PE9A 4R4BB 5TPWH 5EMJB 3MA9H 4NKDA 2BM3A 1BAGA 2ADIA 4PSWB 2OJEA 2WYHA 4RGOH 3PGCA 4HD5A 3VI3B 4BINA 2B5NA 3TBSA 1IM3A 2E7CA 2IBZY 4X4XB 3MODL 2JB6B 4KX7A 1HHHB 1JAEA 4MMZA 3BIKB 4WEEA 3BAKA 4L3HD 4QT8A 2KZ1B 4HBCL 4BCCA 2EE2A 3ZE2E 3PCYA 5IV2B 5D2LA 4ONHA 4UBDC 2QT6A 1WGOA 1HIML 5BRZD 1IGCL 2EXWD 3G5VB 5E8NA 3Q1SL 3G5YA 4AV0A 1KT2A 4DGYL 3MV7D 3JZNA 4MNQB 3RWCA 3MRLA 2IADA 4G1MA 4GRLA 1NC2B 2NY0D 4X6CF 3F5WB 3OKEA 4JKMA 3RNKA 2OIZA 1ZSDB 1U3NA 1KEML 4DKFH 2P5EE 2OK6A 1MFEL 4N0RA 2CDEA 2NXZC 5K19A 1QYGH 3X14B 1A4AA 3KL5A 5B4WA 5B8CC 1KJ3H 4WHDA 1XZ0A 1RIHH 1KC5L 1VPOH 3MUHL 4DEPB 4BZ1A 5ES4B 1AOHA 3BLBA 1MI5A 5EUOF 3LRSA 5M61A 5TE7H 1VSCA 3LQAC 1AP2A 3QPQC 4Z76B 5JTWA 1BIHA 1LMIA 4NRZA 1T0MA 4XOEA 4OZ4B 4DVRH 1PZUB 4LPVA 4QHLB 5HI4C 5D7JD 5KYXB 3GMNA 2VRAA 4QOKB 5TDNB 4IMLB 1KGIA 4KVNL 3SKMB 3OKKA 4XN1A 2XYCA 3KPRA 3QWOA 1H2WA 3IVKB 1SEBA 2C4FT 3G08A 3ZL2A 1I4FB 1TTRA 2Y1ZA 3BWAB 4C4KO 1UM5H 3L5IA 3WHE0 5GGUB 1Q9WB 1MRCH 1G6VK 3VXSE 2MOVA 4ZFQA 2IOOA 1WO2A 2VXSH 2ICCA 2X0UA 4LRNH 4M6OL 5JXED 4AMYA 3N50A 3KG5A 1UTDA 2CO1A 4JAMA 2WK2A 1N0XH 1OQXA 4WWNA 3AG4B 4QAWA 3Q6FB 4QTHA 3IMWA 3TO4D 4O5LL 2HKFL 1S7SB 1E7VA 3ZKND 4E0RB 2D8KA 2IV8A 4XT1C 4F37K 1YNLL 4J3UA 1UZ8B 1W8OA 3Q13A 4GGDA 3WV0A 1B2WH 1WS7A 1TYEA 5GGSY 1A3ZA 3CN0A 1FLRL 1KYUA 4P59L 3M46A 3BKML 5ECGA 1XF5B 4OQTA 4U7AA 1I1FA 1KLGA 4HJIA 1ZK9A 2PF6A 4GAGH 3TC9A 5EZJA 4G55A 3NGBC 1DBKH 4KNSA 5DLMH 2CO7B 2VIRB 3NRFA 3EHBD 1D5BA 3DTXB 2QJDA 1WZLA 4WI0A 1FG2A 2AXFA 4JFPA 5A2JH 3DM0A 2V37A 1HE8A 1UJ3A 4QRPB 1ZHLA 3PWJB 1OZUA 1KENH 3EG9B 1KJ2B 1T5XA 2F58H 3ARXA 5HE3B 2QGCA 1B6DA 1EHAA 5CD3B 4FG6D 4H1LA 1UD8A 3BCFA 5FKPB 4CZYA 5C0DA 3BKMH 1N8ZB 2AERT 5DJZA 2YC1B 4G8IB 3QUZD 1T1XA 1NBVL 2Z1PA 3QQNA 4MA1B 3IKCB 1NAMA 4HWEL 1O6SA 2BS71 2WWKT 2EACA 4G2AA 4PJFA 4PJXB 5GRVL 5CEZL 5J11B 3ZT5A 4F92B 4MDJA 2EYTB 3FDWA 5ESVB 1A9EA 3UBXB 5D9SA 3TIEA 3ZUCA 1K2DB 1ZXKA 2PUQT 5E1AA 1FVDA 4EOWL 1X9LA 4R7XA 1OTTD 4R4FH 1G0XA 3AXLA 4ANWA 2IUQA 2LV4A 3RTLA 2Z0UA 2CHNA 2HG5B 3KH4A 2K1MA 4KHTL 4KFMB 1SF5A 3RURA 2VE6A 4MTMA 1MWOA 1JJUA 2K45A 4JHAH 6FABL 4JPVL 2EIDA 3A4AA 1T83C 3WAKA 4U6XB 3A6CL 2AEOA 3O2WH 4JM2D 1HXMA 2MNWA 4JZJC 1P1ZB 2E7LC 2A73B 3D39E 3VFVB 1B4JL 4J7RA 4UNTA 2VDKB 3I6SA 1IEBB 4YPGA 3TTSA 3MZGB 5BZDB 5IC7A 3VXNB 3CK0H 2VDOH 1U0QA 3OKLB 4OZIF 5K39B 1ZVNA 5E9DA 3VFMA 4PGZA 5AAWC 4W9EC 4PXWA 3H0TA 3FCTB 3RKDD 3UJTH 1MDAA 5CFHA 4J82A 1RULH 2AJYL 5F7BA 4NBXB 3B2PA 5I75C 1OAXL 3H7BA 3OB0K 4I3RL 2F18A 2R56L 5C0AA 2NY5L 4F33A 4C4BA 5CP3A 2CUHA 1H3TA 5DRNB 2YWYA 2BMKA 3AY4C 4L9LB 1BWMA 1CYWA 3SKNB 1PCXA 4CU7A 2R29A 1UJTA 3CDCA 3ABKB 3V4UL 4JMXA 4D8PA 3ZE2F 3DVNB 4ZMWA 3WNLA 1WJ3A 4NZUL 5IEKA 4KJPD 2DBJA 7FABL 1QPPA 1YSOA 3FTWA 2BCMA 1PKOA 4TXVB 4ZSOB 4NX0A 4F7MA 2QSTA 3LRGA 3VE0B 1CU4L 4B7IA 1RHFA 1U4EA 1XAUA 3EWEA 2OXHA 4I48A 5LLIC 5L8KB 4OLWL 4J3SA 4NOFA 1L5GA 4N68A 2W07B 3T5WA 5CGBA 1UOOA 6TAAA 5HYSG 2N7SA 1K32A 2H7WA 2VLKA 2IEPA 4KROD 4E9QA 2J8HA 5EDSA 2FSEB 4HKXA 3K8LA 1CI5A 1NAML 1U3HA 3RE0A 5C0IA 2JNZA 4GT0A 3L3IB 4JM4L 3H2PA 2NX5E 4F7PA 3SBQA 5C7XL 2NW2A 2ZXWB 2YHGA 2BVUA 1JCVA 2N01B 4ZRGA 2JFCA 5DUJA 4BH8B 4P3WA 5DJ2A 1PG7H 3GXIA 3EG6A 1QSEE 5DD6A 1QSED 1N12A 3IAGC 2G0LA 5I76A 3OKDA 4ZQTA 2VC2H 4TLUA 5I76B 4EUPG 2C26A 3U6RA 5JQ6L 4E54B 4R96A 3HRZC 3ZYOA 4PJBF 3GGWA 4K3DH 5L0QB 3D87B 3K71B 1EJOH 2XX0A 3QPKA 1JGVL 2R1YA 1KJVA 1AS8A 3CFJA 3MRQB 1QR1A 4A67A 4UILL 2EADA 2I5YL 4PBXA 4WKZB 3VJ6B 3WIIH 3ABLB 1ACCA 1XX9C 4L1LA 2A77L 4YL4A 12E8H 3SXTD 2QADC 3L3DB 2F54B 1TJHL 2ZWZA 1K4CB 1WWBX 4HCRA 4WIQA 2VLKB 4DT2A 5IMKA 4NQTA 2EDNA 3I7OA 3K2UH 1EO8L 1NWOA 1VFOA 2R1WA 1SMAA 2W07A 2AI0L 2WLYA 1HKLL 1QRNB 1OE1A 2OXHB 3OMNB 2CLVB 4I48B 4P2AA 3HFQA 1GG2B 4A6YA 3RWDB 5EF0A 2PO6A 2X4RA 1HL8A 4WY7L 5EUOE 5AYTA 4HFUL 4BZYA 1JK9B 4GS7C 3X11A 1BAWA 4C55A 5KSVB 3DVNA 4IJ3B 2LVCA 5F9AC 1AANA 1HL4A 4ERZA 5TE6L 3FHEA 2BMKB 2QPDB 4O00A 1FO0B 2DMKA 4GAAA 3GMLB 3GXTA 1K8IB 4CSZA 4TNVF 4QNPF 1R3JA 2HRPH 4Y4HD 3RFRA 1JS4A 4LKXA 3VXTB 3QNFA 2EDWA 1KCUL 5AYUL 3VFMB 5K39A 2R9HC 1DSYA 2XN9A 3EBIA 3OKLA 3TVMC 2X1XR 3QUYD 4Z18A 5DWUH 1LMKA 3DROA 1OE3A 5AKTA 3ZYIA 3BPOC 4P57B 1BVLA 4X99A 5HY9B 4MFHA 1P1ZA 1M7IB 2WC7A 2LLLA 4IGBD 4PJHE 3ZDZF 3P9WB 1AMXA 1L0QA 4BUQA 5KW9H 1NA8A 1MW1A 3A22A 3P0GB 3QCVL 3JWNH 1JZHA 5E9AA 1NKRA 2W88A 3MNZB 2HXCA 2CKNA 3BAJA 3PY9A 1JJUB 3QYNA 1ZS8B 4FFZA 3P9MB 4HUUA 1U8HA 2FTAA 4KNUA 4OFQA 5KOVC 2WZPD 2Z7WA 2HG5A 4KFMA 4QF1A 1WBXA 4ABWA 3U1PA 3BAYA 1FL3B 1O9WA 4AGQA 2WN3A 4KTGA 3M8OH 2FIRT 3NABL 1AXIB 1OB1B 4OV5A 1HYSC 2ZUYA 5BS0E 1IM9B 4QRUB 1NIDA 2VL4A 2C4XA 3BVWA 1TZHB 5IB2B 3EJJX 5EC2B 4HT1L 4LCUA 4Z3EA 5I73C 4QLRA 1P7QB 4X4ME 2CR3A 1TQCB 3NRPA 3E1ZA 2EYTA 1C8PA 2DQHL 1I9EA 4TLKA 2PPDA 4UT9H 4GW1B 4JFFA 4P8QA 4ES8A 4M02A 4BK8A 3KS0H 3QNZA 2C1PA 1T1XB 1ZA3B 5L9DL 1PX8A 2EC8A 4W9FC 5CCKH 1AMYA 2GTQA 3KPMA 1ZT4A 5DUPL 1VZ3A 1K9TA 3IJYA 2ZX6A 12E8L 4KHXH 2NY4C 4Z9KB 2OX5A 3MMEB 4BFRA 5CD3A 2FEEL 3LIUA 2V3DA 2XDHA 3OJMB 1R1CA 2IFFL 3AT9A 1W91A 4L4TA 2DI8A 4JLRA 5I82A 3WSQL 4EVNB 1F56A 4E9YA 1EO8H 3IFPA 5FYJU 5IMMB 1UJ3B 4QRPA 3V0EA 2IO5A 3H85A 3SDYH 1FNSL 4OCSH 2ZNXA 3HMXA 3VTAA 2DRUA 4EIGB 2FLMA 3RPIA 3DTXA 4N8CL 1D5BB 3MLTA 4TQEL 4U2ZA 2CO7A 3I2NA 3ZDWA 2X2YA 4ZFZB 3IJ1A 1KLGB 1I1FB 4MDIB 4BE6A 5F44A 3RGVC 3KGUA 3AH8B 2ZE0A 1UXSB 4J6RH 1ADQA 2JI3A 2VDLH 3NJIA 2LE9A 4KBPA 1HTYA 3QJZA 3ZMEA 1HH9B 4D7PA 3EOTL 3EFDL 2P44B 3TCXA 3HUJB 4MQXD 5IWLC 3K91A 1QEXA 1YUHB 2R1XB 4AKQA 4OCSL 1MHEA 4I79A 2JWYA 5FFGA 3APCA 3Q6FA 4QTHB 4E0RA 1OTUD 4UI9R 4KZ0A 1JIBA 3OLGA 5BCAA 1A21A 1QBLH 2XWXA 5CEZE 4FFWC 4HK3N 3JZGA 1LDPL 3D05A 3P4MB 1Q9WA 4U7SA 3D07A 1S8DB 4XYHA 1O9ZA 4HWBH 1BJMA 3LNFA 3QPXH 4CAGA 1MFUA 3OKKB 4FHJA 3UC0H 3ETBF