3FCUB

Structure of headpiece of integrin aiibb3 in open conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
461
structure length
455
Chain Sequence
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin, alpha 2b
total genus 121
structure length 455
sequence length 461
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3fcuB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3fcuB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3fcuB03
1SQ0A 1ZOOA 4MMYA 3V4VB 2X5NA 1JLMA 5KYUA 2IUEA 1N9ZA 3T3PB 1XDDA 4XW2A 1IDN1 1UEXC 4G1MA 3BQNB 4WFQA 4WK0B 5KYXA 2P28A 1XUOA 5E6RA 1U0OC 3AL8B 2WINI 5E6SA 2VDKB 4G1EA 3EGXB 1M1XA 4O3UB 2M32A 3K71B 1MJNA 1T6BY 3PPVA 3FCSB 4A0QA 1L5GB 4WJKB 3ZE1B 2NUPB 2ODQA 1JEQA 4CN9A 4HQNA 1IJKA 3ZDYB 2VDOB 3EGDB 1TYEB 3K6SA 3PPWA 3PPXA 1AUQA 3VI3B 3K72B 1MHPA 1M2VA 4M76B 5E6UA 3RAGA 4BJ3A 4WK2B 2WW8A 1FNSA 3OL2B 1IDOA 3VI4B 1ZONA 4IHKA 2VC2B 3FCUB 1PD0A 1PCXA 5KYNA 3IBSA 4NEHB 4UM8B 2B2XA 4MMXA 3EG9A 3ZDZB 3F78A 2ICAA 5KYWA 3EFOA 4K3JB 4UM9B 2ADFA 4C2AA 1JV2A 1LFAA 1Q0PA 4Z7NB 1M2OA 3NIDB 1SHYB 3IJEA 4UM9D 4HQFA 1U0NA 1ATZA 1SHUX 3HXQA 2NUTB 2XGGA 3ZE2B 3OKWA 5BV8A 4DMUB 1FE8A 1U8CB 1BHQ1 4JX0A 4CN8A 2VDPB 1QC5B 3PPYA 1RRKA 5KYYB 4JDUA 1BHO1 5LN1A 4O02B 4NENA 2O7NA 3EH1A 4MMYB 2I6QA 4G1EB 1OAKA 3EGXA 1M1XB 1PD1A 3E2MA 2XWJI 1MF7A 3TW0A 1YUKA 4F1KA 2VDQB 1DGQA 3T3MB 1L5GA 1AOXA 3Q3GE 4G1MB 2ODPA 2XWBF 2P26A 3HI6A 5HGJA 5HDBB 1T0PA 2VDRB 3AL8A 3ZDXB 1MQAA 3TXAA 1M1UA 3NVQA 4HQKA 1JEYB 2VDLB 4FWWA 3EOBI 4MMZB 2NUPA 1JEQB 1YVPA 1V7PC 4WK4B 4F1JA 5KYXB 5KYWB 3K6SB 3ZQKA 1M2VB 1CK4A 3QA3E 5E6SB 1PT6A 1RS0A 4C2BA 1AO3A 3K71A 1ZOPA 5KYUB 4GZ8A 3EH2A 2QTVA 2VDNB 1NA5A 1XDGA 2NUTA 3EOAI 3EGDA 4IXDA 5E6RB 4IGIA 4Z7OB 5E6UB 3K72A 3BQMB 3M6FA 3NIGB 3N2NA 5HJ2A 3TVYA 1JV2B 4PN7A 4Z7QB 3AL9A 1QC5A 1RD4A 1N3YA 3FCSA 2VDMB 3BN3A 4MMXB 3EG9B 1MQ8B 1SSLA 3TCXB 5KYYA 3F74A 4CNBA 3GXBA 1RTKA 3OL2A 4O3TB 1QCYA 3V4PB 3IJEB 1SHTX 3HXOA 4NENB 4O02A 1M10A 1YVRA 3NIFB 1MQ9A 2UZYB 1OLZA 2NVOA 3EFOB 1JEYA 1U8CA 3AFCA 1CQPA 1DZIA 5ES4B 1IJBA 4MMZA 2I6SA 4HQOA 4C29A 3ZE0B 2I91A 3OKYB 4HQLA 4FX5A
chains in the Genus database with same CATH superfamily
1XLTC 1JH8A 1B0IA 5E1DA 5E2AA 4PJFA 4GX5A 3GXTA 5L2KA 5JCJD 3OXRB 1W5EA 2BBOA 2VVTA 3JD3A 4UCFA 2HO5A 3BTUA 3WGVB 1C8VB 4EI5C 3EAKA 3TL5A 3CX3A 2FHBA 3DUSB 3RTDA 4UIMA 5AXAA 4EJ1C 3MUNA 4L15A 1R10A 1OLXB 3QG1A 2EP6A 3MYJA 1XMVA 2BHUA 3FDWA 4JLMA 5T4FA 3EO9H 4XNYH 5DMJB 5PCYA 5JW5A 4XNYL 3U2SA 3ZZMA 2DIJA 2H5UA 3VR5D 3P71T 3OT5A 4J2XA 4NC9A 5IKOA 3IBYA 5C0CA 1ZA2A 1RXEA 3SGJC 4F45A 2WVVB 1JKJA 1SOVA 4QL3A 1I5RA 2RIPA 3M9LA 1AO3A 1WNTA 4MRAA 4JNXA 3UAFA 3HDVA 3ROXA 2FB4L 4Q52A 3LLSA 1YL5A 5GGYA 2IQ5A 4NOKA 5A4KA 4POUB 5IROC 1UGNA 4BFEA 1ZVHA 2LE0A 4KUHA 2FUNB 3B48A 3GG9A 5DW3A 2BIIA 3BIBX 1MFEH 3ARTA 3MMEA 4X1IA 1ED3A 2M6RA 2V97A 4HDRA 4OV6B 3HG5A 2AUNA 4A23A 4JO2H 4CLRA 4NE2A 4C56B 2DLDA 1OCEA 5KDOA 3ADKA 2K9FB 3RHTA 3LN5B 2DZEA 4EIUA 5EEYA 2EYRA 1SHSA 4JDTH 3ILPB 3VR6D 2MHCA 5B3LA 5IVNA 3EMVA 2VLRB 3AUTA 2BZGA 3OT1A 4NYIR 4ZU3A 1GVHA 4R69A 4U6SA 1MAMH 5L3SA 2Y0PA 5F7MC 2PZEA 2R0WH 3DHYA 3RY5A 1A2BA 3HFJA 5K3FB 2YPLD 5CLYA 1BD2B 2C8KA 3TYFB 4O9HH 1SMOA 2K4MA 4KWHA 4ZOLA 4Q15A 1HO3A 3S37H 4JD5A 1IBRA 1V3MA 4U4AA 4IDJL 3V4PA 4AL8H 4H6WA 2B1JA 2CXQA 3E9NA 4FE3A 4H4NA 1KK0A 5F1KC 3TONA 2QKIA 3WLBB 1ZD5A 4OGGA 1Y0BA 2POCA 2QRJA 3H42B 3FWNA 1KN2L 2ODBA 1HXMA 3O9ZA 4ETQB 1KFAH 3AB0B 4LOVA 2X6QA 1L4BA 4F4JA 4NJMA 4MRSA 2FN8A 3OV6A 2VAAB 3FH7A 4OJYA 2PQMA 1ECCA 1IZ8A 2FK7A 4X6EA 2EAEA 2MTPA 4KPUA 3BKML 1RZQA 2IAND 3U3KA 1FSKC 5HHPA 1EFVA 5E2WH 3D3WA 5EN4A 1Y3BE 5FHBH 2BFEB 3W9EB 5D3MB 3GLAA 1UM9B 2EFCB 2AFIE 4NV3A 4YAWA 3L95B 5KC9A 2OTUB 1DSFL 4J1UA 2NSLA 4NUPA 1KTLA 3B2UD 5C7IO 5DT2A 1G7QB 3UDWA 5BXFA 4RWHA 1C3LA 3O0RL 4Y7OC 1U0HC 4LHYA 3K20A 2IY9A 2Z83A 4WK2B 4H8VA 3HCFA 3P69A 1F8UA 4IHQA 4P2RD 3CSTA 4DVJA 1EJOH 3OJMB 1DUZA 4Y0GA 1AG0A 1KLFA 2H31A 4OM8A 3N8KA 5CFMA 3LQ4A 3OPYI 4YCJA 3FT2A 1PLGH 4LLYA 4OZ4B 4L8DA 1AQLA 1T4BA 4CYMA 3RZCD 1MQSA 1Q1QA 1LA2A 2JLVA 5EB9A 2HFTA 5B4MC 5FPPA 5HKOA 2GBAA 3QJGA 1EXUA 4UOJA 5F73A 4C0LA 2BT4A 1L7PA 5DS8B 2GJ4A 2P26A 4K5PA 2BH2A 4GM0A 4PO3X 2CHQA 3FSGA 1N5LA 3R5HA 3U0WL 3O74A 3V1YA 3BZEA 3QWRD 3EC7A 4PJIE 4M0UA 3DX6B 5F64A 1ZOPA 3OPZL 3JWJA 5KBLA 4ZOLF 3QUQA 1XP8A 4GX0A 2GHIA 4IZHA 3D3VE 4ZS6C 1FNLA 3Q48A 4O33A 2JFYA 2ZCVA 4JXXA 4WA7A 2ZF9A 4LXYA 3KCQA 1MIMH 2YZ8A 2QTNA 3U0PA 1YPZB 1N8NA 2QVGA 3BXOA 4ZMNA 2WIAA 4D3SA 3BUYA 2GLUA 3G17A 5FKAA 1K3FA 2X4RB 4AKHA 4G83A 1GVIA 5CSBA 1HYBA 1OU4A 4DJJA 3I3SR 4Y9GA 2CLDX 1AG6A 4XBEL 1N5IA 4RSVA 4G8GE 4ZFOB 1JEAA 5A1TA 4WERA 4AY6A 4HHGA 2XUKA 3QZWB 2G4CA 2YWBA 2MR6A 4QGAA 1JSRA 4H7KA 5HI3D 3ZOKA 4U4BA 5AVUA 2BBTA 4XNXL 1RK7A 2K87A 1W19A 3VG0L 1C9EA 3AU8A 3JYBA 1N9GA 1YF3A 2YEVB 4X7BA 2AJ3B 4FXPA 4ECEA 1AF4A 1KPUB 2Q86B 5C0GA 2HPHA 2NUTB 2RBKA 4Y9DA 2IWHA 4C0AC 1WJ3A 1T6XA 2BFAA 3SPVA 1JWSB 4M7JH 1XGRB 1T2FA 1B3RA 1KXQE 1T5XA 3V6ZA 1HDIA 1TZKA 2X0FA 1IXSB 3HK2A 3JRXA 3F47A 1NOFA 3LRMA 1SQMA 3ZBUA 1YQUA 5KVCA 4CU6A 3IGAA 3SCMD 3C6LA 2J7PD 4MZIA 1OGAE 5F7EL 1N2BA 2C9XA 3L1OH 2AI3A 4DPCX 4DY6A 3EH3B 5GONA 1TW2A 4XE5A 5TB5A 3FXIC 3D0RA 3L4CA 4P53A 4NMWA 1WU7A 4KODA 4AJPA 1H6CA 2FG6C 4FNLH 3GRAA 1OFHA 2P2DA 4E15A 4FNLL 3N76A 5D5MB 4YXLL 5HJDA 5KINB 1XRMA 3OZDA 4W4OA 3DQZA 5EQJB 3AEKA 4P0TA 1NMBH 3TPUB 2XGOA 4BFZA 4OD0A 5JPNB 1NA8A 2BGJA 1Z73A 1SXPA 2C2ZA 1U3JA 2UV8A 4X6CF 3Q9QA 2WTOA 4JR1A 2XYBA 2DUWA 1W2GA 5UKDA 1VDZA 3QIBD 2GJ6D 4OO3A 1E2GA 5EFIB 4HGQA 4L8VA 1S3KL 2AJBA 3K4ZA 4WUVA 3AMKA 1QTIA 1VQ1A 5T4EA 3HI1A 3EBAA 4B9JA 5K99A 1IVSA 5F1KA 3V34A 3GJEA 4HK3N 3GTVA 3O3DB 3VDAA 2EVIA 1DKRA 2HNBA 3AHCA 4TRMA 1PZMA 5KS2A 2DLIA 3LTEA 5DBOA 3U7EB 1T5WA 1QQTA 4YXHH 4XPFH 1PLAA 4ONOA 3U83A 3LQKA 4YHIB 1BXUA 2QQLL 5HQTA 2P2CA 3APMA 2PYFB 3AF2A 3ZJYA 2YWDA 1IRIA 2GT9B 1RJ9B 1HYRC 4GI7A 2GITA 3UTZA 1JFFB 1G7LB 3B6KA 3TFKD 1XNJA 1L4IA 3IN2A 1TUPA 4BX0A 7ABPA 1Z22A 4D4LA 1L5HA 5JO9A 3TOCA 4MGZR 3UB2A 3BYYA 5D72H 2PFSA 1KEPA 4JFYB 1E5DA 3RCBA 3PC8C 1LS6A 1FMTA 3NSFA 4WUKH 3AY3A 3HC4L 4IIDA 4X2UA 2AD5A 5AW5A 1KY2A 4LQFH 1O8BA 1X9GA 5GV8A 5G53C 1MF2L 4ZTBA 3BUQA 4Z7UB 4FMFA 2BZ0A 3VH2A 1WDKA 3T7RA 4EN3D 1CY8A 4P5KB 2OHXA 5ALYA 2H5JA 5CBPA 1I1AB 4UMDA 4YQZA 4PRAA 3PC2A 1UTDA 1BG1A 2PGDA 1KJMA 3PUHA 2C4KA 3P4OB 5AVSB 4E13A 1T1XA 1V6AA 3RJ9A 5TE6H 3HKFA 5ESQB 4K6CA 5JQIB 2DQHH 5CUSL 4PXSA 5T1LB 3RYHB 3RKDC 4FI7A 4KK9D 5ICZB 3P0VL 2RB4A 5D93B 1X4YA 3O4JA 1ABEA 4TUYA 1YEIL 3VAYA 1YE5A 4CF7A 3D7SA 2IV7A 5CZRA 4KZEL 1DE4B 5K0CA 2PPFA 4KZEH 5JHDB 3FSEA 4X0KB 1YECH 4HS9A 3OUZA 1TYDE 1ZTXE 5AW8A 3I30X 4YPJA 1XEFA 1UJBA 1PEKE 1KHTA 2D62A 2CKDA 5DK3A 3MDJA 3TGPA 1E8NA 4GAYA 4YSDA 4YIQA 3V1TC 4I48B 3W9EA 5FWYA 3MUZ1 3GROA 3NABH 1HCFX 1UMCA 4ND8A 3SEAA 1W7AA 1JHAA 4FG0A 2Z0BA 3CZCA 4R0LA 3ZXAC 5H2BA 3K0EA 3MV8A 5AJVB 4HIPA 1I7RB 3ROTA 4XNQA 5HFNA 3FO9B 5EU6A 5CYPA 1KBBA 3PHGA 4B3RB 2B1QA 1I4EB 1DUSA 5D00A 4Y18A 3CF4G 2NNFA 3GB7B 3QW9A 5H8WA 3C5SA 5C07B 3IU3B 4O2AB 3RNKB 2NXZB 2ZJYA 3IC5A 5TE7H 1IM3D 2NYRA 1SIBE 4JR2A 3K6FA 1G7MB 3ZBTA 2AMGA 1ETHA 3KQQA 3WFCH 2BHRA 4ANUA 3FQUB 5ENWA 4JFXB 3HV0A 3I9NA 4XQGA 2X0RA 4HVCA 1NGPL 1RM4A 2NT4A 2F67A 2EEPA 2ANCA 3GRBA 4G1EA 4NWUH 2FLVA 2QW0X 3SJVE 3U4BL 1NLFA 5HSGA 4X6CB 5AKGA 4JUAA 5F5LA 1UR5A 5JDIA 5C0EB 4LKCA 3OQIB 2DIEA 2FEDD 1MQ8A 5IBUB 1H4TA 3AOEC 1HHKB 4RHTA 4ORGB 1E3JA 1T2EA 5EJ8A 3FT0A 5LWYL 3PFBA 4KIGA 1H4VB 2FMXA 4RF5A 3HZOA 5DC2A 4OCSL 4G6AD 4N8UA 4JKOA 1N6QL 3CO5A 1YY8A 1PJ8A 3CC1A 1YA8A 2ES4A 5HYQB 1PZEA 1A8ZA 4NG4A 1HFEL 1FRQA 1M6UA 3N1GC 5IMKB 1HEJC 2YEZA 3VXPB 2Y7SA 2FFBA 4W9JC 1WCXA 5ACZB 4TLBA 8OHMA 4PZ0A 3EXJA 4OCWL 2VDNL 5IT2H 3M6IA 5B3SB 5CD5D 4N4YB 3QARA 2J5LB 3WY4A 4AFNA 2WXHA 3WS7A 1UBFA 1DXYA 3ZHRA 4Z7QB 2GJ8A 1VGQA 4S11A 3R3JA 5LZ9A 4FDMA 3QCVH 1GY2A 3JARB 1K8RA 2XWSA 3U49A 2K2QB 2OYKA 3BGOS 4IIFA 3J80A 2VLJD 1J0YA 4AT1A 1N2GA 3C3WA 4ZFFB 1AQUA 1QP4A 2AQHA 3DROA 4IHJA 3OJLA 3DYIA 2P27A 3BAFA 5EHXA 1XDDA 3EJCA 2IYNA 3NUZA 2HNAA 2L0DA 1SCKA 1KDTA 3T1TA 3N75A 4DFIA 3D7LA 2HJLB 3S3SA 1U3CA 1F3DJ 4M8QB 3D0VB 1S7VB 1CUAA 1AGYA 1U2CA 3ETDA 1Z3IX 4DV3B 2FN4A 2DQUL 4JFHD 4PXYA 4Q9CA 3CU7A 3H1AA 2WSSD 4ENZA 1UK6A 1HXYB 3F1LA 1V4NA 3CX6A 1VERA 4U7MA 4RCVA 2BMDA 4G3YH 2FAUA 3QWOA 3WWYA 2W8BB 1BJTA 1ZHLB 1LMIA 4M4SA 2F1OA 1DBBL 2HKAA 1P3JA 5AQ0A 1U3HA 1KV3A 4N47A 1PZUB 4WIQA 2CG9X 3OXRA 1KP9A 1FNGB 1WY5A 3ISVA 4HUVB 4IKKA 4CEJB 3G6JE 3R09A 1SRDA 3KPRB 2AK4E 1NUSA 4QECA 1KT2A 1CTOA 4PRNB 2GCNA 4DR7B 5J56B 1E43A 3Q2WA 4WDIB 4A2QA 1RZGA 1UK7A 5B8CA 4YHPA 4Y1RA 4YAKA 3MV7D 5E8PB 1P84K 3S99A 2VUSA 2EDQA 5AW2A 3FQRA 2AC0A 3T5BA 3NZ8A 1X7QB 2E56A 2REXB 4K7JA 5J59A 1Z9MA 4QHMA 5BUZA 4D2IA 1RK1A 4N6RB 1W30A 4Y2DB 4OL9A 3CPHA 4D9JA 1PFVA 4QJ5A 2YD7A 1QZ1A 3L1IA 3NSXA 1N0WA 3NFSL 5CS7A 3EFBA 4OFBA 4DUGD 1HBJA 2LVEA 2SCUB 3QUYD 3RL2B 4H31A 5J4YA 3ET4A 1OEZW 4L76A 2O5YL 2C4WA 2DLGA 3BP7B 3EJZC 4I3RL 1TK3A 2GT9A 1RJ9A 3HSSA 1VHWA 1PG7W 4LLVA 1IBBA 4OB5L 4JBYA 4KY1H 1ZHOA 3N5AA 5D70H 2ZKMX 3A3OA 4HJUA 3NOQA 1R8QA 1A3CA 3X3HA 1A6AA 4B82A 4ZYVA 4KMMA 3GIZL 3HC3L 3D0AA 4YYZA 4JFYA 4IPTA 3CFBB 2VXYA 2XUPA 4HKTA 1TCCA 2B82A 4NUJA 4LJ5A 3SYMA 3KV3O 5I5RA 3T1HB 5L4SA 1KOFA 4B80A 2RAMA 1IQWL 1G9MH 5HYVA 4U1MA 1TI7A 5J23A 3EYSH 3A28A 4CV1A 1RQ2A 2DLFH 1JF8A 3M1AA 2V7GA 4WO4B 5LSAA 3MLUL 3OIUA 1L3WA 1TC2A 1AQKL 2CJUL 5CCDA 2O6CA 3CFQA 4PEEA 1FO0A 4D97A 3LBIA 5BZWB 1RK0B 4JP2A 4M7PA 1SYVA 2AXHA 4FHKA 3ZYZA 5KOHB 2X1XR 4TULL 1NY6A 4NOBA 4DT1B 3JD4A 3V4SA 3PQDA 1U8MB 1J33A 5AHKA 1FS5A 1SZNA 2HP4A 4FKMA 2PMBA 1IBLB 4DWOA 3OFND 1Q16A 4C1NA 1R5BA 3AQ4A 3ES9A 4BP1A 4M1QA 1TJIH 3O1HB 4A7PA 1DCKA 3ZBPA 4AK1A 2CNBA 4WTWA 1N78A 4OM0L 5JUWA 5B3KA 3B2MA 3NP9A 2DFLA 3FONB 3ZE1B 1K4DB 1W35A 2O2XA 3L93A 3AUJB 1JPGA 3L3IB 4B31A 4FQXA 3B9DA 5KYVA 4M1MA 3P97A 2QLBA 3GRZA 2J8HA 4ZA2A 1HLFA 3R7LA 1M74A 1W72H 4P57B 4PCLA 1NIDA 1ZJWA 1TTGA 2FX9L 3T2LA 3ZDQA 4OUOA 5CAYB 1E3LA 5T5FL 3NZUA 3C3EA 3DMFA 1FUYB 5ALEA 3HLTA 5KTYA 4JXKA 3QEQB 2Z4QB 4PJ6A 1D1PA 4QEZA 4XBGB 2ZWVA 1JYEA 5KYTA 1KEUA 3DFUA 4MJ5A 1F14A 4MS3B 1KYAA 4HSQA 3WMWA 4OAWA 3MLSH 2CVHA 3VI4F 2LU7A 3KTDA 4FD2A 2WPGA 1OANA 1YHYA 3K72A 5EIVA 4H7FA 2WLNA 1SN2A 5KW9L 4YLBA 1F1BA 1KPHA 2P8PA 1P1BA 3S5YA 4ZFGL 2QVTA 1QH8B 4Y19A 3LB6C 5JAHA 1EMDA 1MRFH 2NOAA 4TLKA 3TL3A 4JFEB 3L8HA 2FSVA 4CIBA 1PFQA 2HF7A 5FKPA 4E2XA 1G5QA 4R1UA 1YCGA 3ZKSD 2BZDA 4OB6A 3L7YA 2BI8A 1EO7A 4EYOA 4LV5B 3BZEB 4NO2B 1C1XB 5FWXA 1XMJA 7REQB 4GKBA 1ZT7B 4Z9KB 2J1KA 3N58A 3N1QC 5IDXA 1M5TA 1STOA 5HFAA 4TSAH 3RAPR 3WYBA 1MUJA 5HHXH 4AGQA 4N7MA 3KYJB 3CVHB 3E5RA 5HHXL 2VO8A 2ZXDA 1J8MF 3MX0A 4Q56A 4PJGB 5AESA 4B4VA 3APDA 1HWWA 4M8IA 3A6KA 4Q9BA 4V02A 3G89A 4UXJA 4B75A 1OB1A 1U8KA 1DC7A 5C5IA 1XGQA 2YVAA 5I2IA 1N8ZA 4XXWC 3AVUA 1RZFH 4F9FA 3CDGB 3PU7A 1QRKA 2JJ2D 2F53E 4PIRF 3M4YA 3CT4A 5IP5A 3OKNB 4F9LA 4XFDA 4JVWA 1S5IL 4ZMVA 2VMDA 3OZAA 4KW7A 1MEOA 3ZHBA 1BGXH 1GYAA 2R87A 3LX9A 2GKIA 3WNZA 4DKFL 3TMYA 4H3HB 3TMKA 2ZATA 2R25B 2BUBA 3C5WP 4ZSOB 3OPYB 4U39A 2W42A 1KKLA 3OCVA 2YXEA 1B6RA 5I4BA 1NQTA 4ZU6X 1V96A 2X4UA 1G9XA 4UAUA 2HVJB 1KC5H 1J10A 3V7YA 2PSDA 4XPTH 1T1RA 4L1SA 1YZLA 3HBLA 3ICOA 3CN2A 1C8PA 5TF4A 1RC8A 2BRUA 1U99A 1QGDA 4O2AF 2FZKA 4R1SA 4TSBH 1JE6A 3EVTA 2Y7QB 3QJOA 3OX1A 4HCGA 2P5EB 1F0NA 3QO1B 1VBNA 2NTFB 4L1KA 4X1OA 1QRNE 2JI6A 4BX3A 1WD7A 3NQKA 4Y8DC 1RWNA 4D3ZA 1QVOB 5EWIH 1Y8AA 3M6AA 3UC9A 1ZNXA 2C54A 3AJ8A 2OTPA 4HQFA 2JLAA 2NIPA 4N0MA 1EFAA 1QLRA 1WFMA 5AOCA 1TM3E 2QSVA 3QLJA 1U8PA 2DX7A 3CCFA 2XWDA 4B7ZA 3G8AA 3CN7A 3ULVH 1ZGGA 3BTVA 3SX0A 1SHKA 4ISCA 4Z8YA 4A2DA 4OM1H 2LOEA 2JFWA 1QONA 1TYCA 1AB5A 4NB7A 5DM2A 4HWNA 4WWPA 4B3EA 1YS4A 1YG9A 4JG5A 4G6FD 4BQBA 3EUUA 1S7RA 1FS6A 2FE1A 4RQBA 1S8DB 1SCIA 4BE9A 1OF1A 3F3SA 2PGAA 3DYOA 3B5HA 5F72S 3P0YH 2Z92B 5CN2A 4M7RA 1NM5A 2GSIA 2Q8AL 1YL6A 1JGEA 5FL3A 5AM4A 3ULSB 5I01A 1CY1A 2PWYA 4ZANA 2OFQA 4CF6A 2VH5H 1MG5A 2BOVA 1J9CT 2LZ0A 2PJZA 3LPWA 3MV7B 4P0QB 1FUKA 4QO1A 3QXXA 4IZIA 1DX9A 3P9LB 3FPHA 1YGYA 4X7CC 3FB5A 1TAHA 2PWAA 3TUIC 1T0PB 3EUDA 5GHWH 2Y99A 4KMSA 2A6JA 3RVNA 1HZHL 2QEQA 4RZIA 3DTXB 4ABWA 1XHLA 1L4KA 3IKJA 4XC1H 3R8CA 2FX7H 3R0JA 4BBWA 1IONA 1CT8A 2CWRA 1KULA 4RE6A 2HQBA 2ZI7A 3CSGA 1WB9A 3T2NL 3LCYA 2ZUUA 3BFVA 3UZUA 2PL3A 1I2CA 3U3DA 2PCLA 3SO3B 1UM4L 4HU2A 2RK4A 3EPHA 2NY3D 4JM2F 5TQ2B 1JP5A 3HHSB 4YDNA 4R1MA 1T89A 1T20B 4V11A 2V55B 4V2CB 5M3BA 2MPAH 2FKAA 3MJDA 1BVKA 3A04A 3VYOA 1YY9C 2IK8A 2EDCA 4OZFG 3LD8C 5CLTA 2HF2A 2FX5A 4GI8A 2H0FA 3MPUA 3GJEB 4LSSH 1K5NA 1E3FA 5DJ8A 1LM8V 3BVUA 4MCZB 1ZT7A 3PG2A 4OHKA 1QWOA 3P4MA 4FOPA 1JFVA 5EUBA 2ZIXB 3LNCA 4HAIA 4YJFB 3CEJA 3GFOA 2AOTB 2P5UA 1G98A 1MB2A 4PXAA 2AJZA 4KQ6A 5KYYA 3QDAA 4YASA 1UJ3A 3OUTA 4L6CA 1UDCA 3STBA 2CUNA 2SBTA 4XWOD 5IVZA 1OLZA 2I7TA 4P4KD 2CHVA 4M6OH 4QEDA 3RVKA 3DB2A 2OFWA 3PIQB 4ZS7H 1MJJA 1IM2A 4P7BA 2ZE8A 1LE9A 2EKZA 2QQ0A 5JXED 1N3NA 3WLHA 4GP4B 1S7UA 3ZJAA 3CFKB 3RWHB 1Z3RA 3IA2A 4WZAA 3VGHA 1F2XK 1J07A 3E0GA 4J0GA 5D7KE 3G49A 5I3ZA 2FW0A 1Z45A 3ZL2A 2P5TB 4GEJA 3TD6A 4WGWB 2P6RA 1AZSC 1DIRA 2EG9A 2HVKB 4E9VA 1ZSDB 2WBJC 5ENZA 3NJMA 3Q2LA 3V0HA 1C14A 2RK3A 3IHKA 4Z0PA 4B40A 3SIRA 4NK5A 3ZKXC 1XEXB 1FNCA 5DQJA 1WUNT 3ZL4H 2BSTB 2CR3A 4Z51A 2BYTA 1YDHA 1MWOA 1K5WA 3ZGXA 2RR3A 3U1PA 4TYPA 2ZWOA 2ADJA 3M1CA 3PSAA 3MFYA 4AMVA 3T7SA 4GKJB 2FK8A 2BGNA 4MVYA 3BWAA 2RMKA 5FOQA 2WQZA 3CISA 3BDIA 4AJIA 4UOQA 4DEXA 3ZZSA 3HBFA 1OGAD 1L9SA 4M36A 4RYDA 4NWUL 3MS4A 2O54A 3I6ZA 3F6BX 3PABB 5BT9A 2DWEB 5HIMA 3N3AC 2PD4A 2D1QA 4EXKA 5P21A 1ZKAA 2FDRA 2J73A 3MJWA 2RHOA 3NAMA 1AACA 1BZQK 1JZHA 1P5UA 4N2IA 2AQQA 4AS3A 1UQSB 2ZCJA 4YBRA 5LQRA 2XTZA 2NY0D 1WW8A 3QPAA 2EW8A 3IR7A 1B93A 2H26A 2EFEB 4M4RA 3DTNA 1Q1AA 3UK1A 3IJYA 2PGLA 1I1FA 3V9AA 5B4UA 4QLRA 5JIMA 3L79A 2M26A 1XRNA 2HV8A 3WXWL 5BMFL 2CV0A 3DE7X 3O6MH 2BWIA 3DDNA 2GA9A 4L3CA 4CTNA 2VC2B 4ANVA 1W4BA 2XYCA 4K6FA 2X4NB 3CVDA 3IAQA 3AONB 1VAHA 3QJFB 2DOCA 4LCUA 3AXTA 1U8YA 2LCQA 5HSFA 1ZN7A 4XUEA 1W88A 4B4UA 4ENSA 1A88A 1VKJA 1A7UA 2RI1A 2WYOA 3RL2A 2AXGB 5TMBA 1PKEA 4RAVA 4NENA 5DUPH 1J0BA 4FZ3A 5DTIA 3E1ZA 3F12A 5KBKA 4XCYA 4YT5A 3AC0A 1PEAA 3SDDC 4DLNA 3BLKA 3G6KA 5CH3A 1A4AA 2IAMD 3CJJA 4WDRA 1LK3L 2DHDA 3FQTA 5BRJA 4M8QA 1NGXB 2K6YA 2NGRA 5HDBF 1ZUHA 3EFHA 5IK3B 1PWEA 1GITA 4PYGA 5BZZA 4IXDA 1T6WA 3WKMH 4LSVH 4A38A 3LCJA 1APBA 3MLVH 3W1WA 2I7DA 1QGUA 4W9NA 4E1AA 2G6TA 5LMCA 3QWNA 2HA5A 3L54A 1XLUA 4AWBA 3WLLA 3UYRH 2Y1WA 4W5TA 2UZYB 5TY0A 4AGOA 1Y7PA 3N87A 1CUIA 3KPSD 1AP2B 5K3FA 1VFAB 1FIEA 4LEIA 5GADl 2H2HA 4Z2YA 1KU6A 3CCCA 4V1DE 3HRKA 4ERXA 4ZI7F 1BVKB 4LRIC 5TT0A 4XH2A 3VGPA 3RX9A 1YIDA 1QSEA 4P49A 4EN3B 2CDEA 2D4DA 4WDIA 5ADUS 1UBTS 2P0YA 1G0OA 2AG8A 2CZGA 1YC5A 4ZAYA 3P4MB 3H2ZA 1LDSA 3TZVB 1M42A 3OI7A 4Q6IA 4ZCPA 3G8BA 3KH4A 1HE5A 3MA7B 3N50A 3MT9A 3TIXB 2G2PA 4KIWA 1MA0A 3F9IA 4DRZA 1M71A 3MTQA 1PJWA 5C1OA 1F90L 4AXWB 5L9DH 5CT9A 3OKAA 3WSWA 1ONNA 1DAGA 4JBSA 3ZKND 4YXKL 4BMYA 1HLDA 4HDRB 1QU2A 1UXKA 4AZTA 3PWNB 3IVAA 3JD2A 2R69L 3SYRA 3QFDA 3T0AA 1XTJA 2K8QA 2NYZA 1QYXA 2YAOA 1SJEB 3EJSA 5T1LD 2FR1A 1DJMA 4XPGH 4O2CB 2KL6A 4DMCA 3ISWA 4TPRH 4EUPA 2PH1A 5ABPA 4D0RA 2CLLB 4J7AA 1PAZA 2VE6B 2ZZNA 3AT8A 4X6FB 5FTKA 1CDOA 3KVDD 1WIPA 3EPKA 2O2EA 4IJMA 2VZEA 3V0VB 1XX9C 4F5YA 1NJ9B 3FYIB 1CXHA 2OX5A 3TD2A 4IIZA 4NQVB 2AXJA 3BUTA 3K81A 2NVOA 3IMBA 2VRWA 4COOA 5G4KA 1XCTB 4LDCA 2AW3A 2J44A 4TUJB 4TOIA 2ATKB 2ZRNA 2GTWA 2WWOA 1IO4C 3M3HA 5FUVA 1X7YB 5BXQC 3ZCPA 1AGBA 5HDWA 2O3UA 1FBTA 5GZOD 1RXYA 2RB5A 3ZBMA 3QHTC 3EVFA 3FCSB 1AXGA 1D6MA 2GY7B 4A0SA 2GBUA 1TMOA 5A4MS 1UADC 4B3XA 4BCDA 2FUEA 4E9XA 4JN6B 5AW3A 1C16A 4JL8A 5CNHA 4M0FA 2QV7A 1WMSA 3T99A 1O9HA 3HVNA 3HB1A 2VIIA 2B1HL 2BDNL 3ML9A 1E8WA 2I4RA 1M3SA 3F5WA 2ZJSH 4LGCA 3QLVA 3A6ZA 4XMLH 5I6DA 3EWSA 4DKAA 3B85A 1DJXA 2D0HA 4L8YA 1J7VR 3W3AH 3A2KA 2P8MA 3HZMA 1Q7CA 5HZGA 3SDDA 4YMSA 5TMEA 2XNKA 4KN5A 1F4YL 4FHDA 5IJDC 5SX5K 1JHQA 3DT8A 2XAUA 3PLYA 4P31A 2PHZA 3FAWA 4IHBA 2RGXA 3DQQA 2B1HH 3L13A 3JQPA 4DZTA 1ZLVH 1A8HA 3KR3H 3MUJA 2C0CA 2PDAA 4B96A 3KJHA 2HRPL 3JWOL 4X6DA 4AC9A 1REIA 2JAQA 5T5FA 4V2BA 4FQQB 3GDHA 1S5PA 4RDIA 3I2CL 5C3TA 1NDHA 3WJ7A 3HUUA 4UASA 4HOZA 5EEZA 1THGA 3EPPA 3U9UB 1QLFA 4C4XA 1G8PA 4B3VA 2IWEA 5IFJA 3TM6A 2H2GA 2NSXA 5H68A 2BP7A 1UXMA 5KZCD 3SDXF 4Q24A 2QROA 2Y3NA 4XGQA 5DSTA 2HXSA 4PCAA 5BSHA 1KXQA 4F7MB 1YNOA 4E5DA 2D0OB 5C0IB 3DF9A 4OYHA 3MRJA 4FW9A 3H4HA 4PSVA 2WLSA 1MG0A 1U8MA 4GQPH 4RFNB 3BT2H 4KX7A 5C0AD 5CHYA 1EE9A 2YV5A 4FDLA 1A22B 1UMDB 3ZLVA 2ZX8A 3G8YA 3SO5A 2Q4BA 2QAJA 2XYHA 4BO0A 4BNJA 1TT5B 1Q3HA 1JBQA 2DM7A 3Q3GB 4JEUA 4N5EC 4XBEH 2V2TA 1R6AA 5C2JB 3UTCA 4Y2VA 1AR1B 1S1MA 4NP6A 4C4PA 5EA2A 2C3GA 2OXGA 1WQ4A 4YI3A 2MWCA 2ENQA 1UKCA 5FOVA 2Y5TA 2DIAA 4L0YA 3QNYA 6PFKA 4NECA 4UANA 1UJCA 3ETNA 2NQCA 4RFNC 2A0WA 3A3NA 3CCBA 1SCBA 2O2IA 1CY2A 3ULVF 4JL5A 2DMKA 3U3ZA 3S2SA 4EW1A 3MRDB 5F2KA 3D25A 3AV0B 1P6QA 2ARJA 4J7UA 1Z62A 5AG9A 3IJEB 5JI2E 3HBJA 3II3A 1JQ5A 1CKEA 2R7AA 4KTDH 4J4HA 5DOZA 4NM4H 5HDQL 1XZ0B 3FOLB 5CX4A 3JTSB 3CRQA 1ZD8A 4R3SB 1G0YR 4EN3C 3TEWA 1WU8A 3TURA 1ZOLA 2WKGA 1NBMD 1ODCA 3FAZA 2GYWA 3NTUA 3TG2A 3C6LB 4ZO7A 4JT8A 4Z0BH 3EYSL 1B43A 3T0WA 2OW6A 1XU4A 3FBWA 3NPZB 1QF6A 3MRGA 1OREA 2XUWA 3G7NA 5BW6B 1N5JA 1LU9A 1MCBA 2ZTSA 4EGAA 5AHRA 1XH3B 5T3XH 1EVTC 1LFAA 4K88A 5FPTA 5EMLA 3PWLB 4GUPB 3OTWA 2C3VB 1A71A 5AQEA 5EZQA 1BPLB 2QXYA 2OXHA 1RJGA 4L4RA 1YJ5A 3N43F 1LO3H 2GD0A 3UAVA 5AVXA 2XKNA 1LSOA 3ABOB 3EZ9A 5J47A 2WUDA 3FQWB 5TGBB 2XCMC 5GS1B 2Q7YA 2N47A 3R7QA 4ARZB 2VP0A 1LK2A 1BQ4A 3HMQA 1CFSA 4BZ2L 1UD5A 4JFSA 5DFVD 1K2WA 1QW9A 1W0CA 4PJCE 3ROGA 4BZWA 4CKZA 2QG9A 3VB9A 4HALA 4RPGA 5KS9E 3F0TA 3NG1A 4OLWL 4GW4A 1J2JA 5TQ2A 3ABIA 5DYOA 4PRID 2Y0CA 4ZUWA 4BQ8A 2FW6A 5LA6F 2VYNA 3VI3A 1L5VA 1AMUA 1MO5A 3GIVA 4UNUA 1B0GB 4NI6A 3PGMA 3AJ9A 3SGKC 2DPLA 1BFVL 2OB1A 3H8SA 3QEGH 1HN1A 2QN1A 1NEZA 4GSQA 3OLEA 4BZYA 4FX2A 1E2KA 1GPWB 4D6XA 4MCNA 5DHSA 4C7VA 3MC1A 3QP9A 4DCCA 2WQWA 1XEAA 2GO1A 4LJKA 2FJFA 4DEVA 1PIGA 4HWZB 3IDIB 2DP4E 5FO8B 2JIDA 2QYOA 3ROLA 3OPUA 1OGTB 3CVUA 3S1LA 1MOQA 4EZKA 3NVAA 1OB5A 3RDTC 3EBPA 3FRUB 3ECVA 3O2NA 1ND5A 4EB0A 3H6AA 4H0NA 2XUGA 3KTOA 3V8MA 3QAZC 2YFNA 5LFAA 8MHTA 3MV7A 4GIAA 1UJ4A 5KN5B 3FNGA 1OXMA 4EX7A 4FFLA 3OHXA 5DNWA 3ZHUA 3PFHA 3QXCA 5B7QA 1DQDL 1MO3A 1HU8A 4I0PD 4C6TB 2WCPA 2J59A 1QEXA 1NP3A 3NBFA 2M6SA 1FYWA 1RZPA 4HJTA 4NCC2 2P2SA 1DTWB 5C7XH 3SE4C 1YS1X 3H1TA 5JANA 2XQBH 5HRAA 5FEBA 4N39A 3OZBA 4N2HA 1KSJA 4ZAVA 4K23H 1EEZB 2MYUA 1T2CA 3CRW1 3HG3A 3C5ZD 1E8XA 1VCIA 3C8HA 1VF5C 1HNXB 1P29A 1E3TA 3HYLA 4RX4A 2XXJA 5LJLA 4ORGA 2Q7XA 3F3YA 3MJTA 1OZUA 2BPOA 1GIGL 2WLLB 2OYRA 1P5UC 4PW3A 4IM8A 4ZIRB 1AIFB 5T57A 5I9QB 3IEXA 3U6RB 2NY1D 5F3DA 3N8IA 1IYZA 4LC0A 2MNWA 4I1PA 4RV9A 1Z13A 3L06A 1ISGA 5ESXA 5L3VA 4X7TB 4N8EA 4JFEE 4QO8A 5AAMC 4PR5A 4NZ8A 3D7RA 5AWNH 3L8CA 4NX2A 5CDHA 3K1ZA 3V4VL 1WM1A 2V7WA 3FO9A 3KSRA 2LKCA 3JUYA 1O0SA 1C1HA 1UC6A 2R85A 4DNPA 2W9DH 4LE2A 1Y42X 4KIFA 3DOJA 1I8TA 4N9WA 2GDJA 5DOVA 4U1GB 4LZJA 5J06A 1FV1B 1KTDB 3F7VA 4GYYA 4DREA 5CLGA 2A6PA 5DDHB 3DX3A 1JWAB 3WNCA 1FYTA 2BY1A 1R37A 2BSSA 2DT8A 1OOAA 2V4ZA 3W5VA 1S3IA 3H83A 3IDNA 2XAAA 4ZOEA 1U81A 4LESA 1BE0A 3VRLF 3MRLB 3BERA 5C71A 3D54D 3S96A 2FF5A 1BQKA 4INOA 5DK2A 5AZ2L 1X7DA 5IGXH 4TL9A 1SUEA 4GRDA 1M6VB 3KKNA 3NZHL 3P5BA 1EEUA 5HIAA 4NYJQ 2O2YA 4H26B 3A6DA 3TR6A 1KP3A 2WMOB 2BINA 2PCJA 5L4NA 1SLXA 5H83A 4DIMA 2FRVA 1USVA 3QJYA 4JO4H 2OBBA 3C5ZB 4ZI7B 4PYIA 2KBEA 3NTVA 3ABGA 2NU9A 4DSTA 5FW7A 1WWWX 1YMHA 2ABWA 4FJYA 3BDXA 3INUL 4LU5L 1MIOB 4GYWA 1I85A 1S8OA 1NTRA 3KEOA 3I2FA 1WAPA 4GSDH 1ZTXL 3NRJA 2JLCA 4Q4AA 3AZUA 4HHEA 5FYJD 5DZPA 2EEXA 1IAIL 3VFNA 2V6GA 4TWAA 3U17A 1OH8A 4NWIA 1QF7A 4NC2B 3RVRA 5ENVA 2R6ZA 4XQEA 3HE7C 2J3IA 4MK4A 4U6XA 4LIQE 4RSGA 4JHAL 2VZTA 2P3OA 2P5EE 2FO4B 3V0WL 5JR1H 1P7WA 3MJFA 4S1QL 5BXYA 3FETA 4RD4A 1XFDA 4UQ2A 4UNNA 1ISFA 1YFKA 2ZS9A 2CXPA 3DOHA 4ELME 5L3QA 1BEUB 2OQJA 1UDRA 3ZGOA 4MZDA 4IOJA 4NBRA 3DO6A 1S2NA 5EU5B 2WN2A 5JYMA 2O2CA 1B6SA 3GFRA 4AJYV 3D4LA 1PFCA 1FJXA 3DTVA 4ESKA 1QRNA 1OP3K 2J07A 1E77A 3S36L 4B50A 2PAFA 2QVXX 3ELWA 3L2MA 3ATFA 2BP8A 5BMFH 3T5TA 1FG2A 1JYSA 4YDZA 1FRVA 3KEDA 4BO2A 1C30B 2QT1A 2ZRGA 1RU9L 1OD9A 5FF6B 4ESEA 3HW7A 5FRDA 4ITVA 3MPCA 2P7IA 2A5GA 1FW8A 3G5LA 2V3VA 3WKYA 4IH1A 4Y5XC 1CGSH 3EJRA 3IMSA 5FA3B 3JR3A 1CVSC 2CLRA 5I4IA 3L0IB 2C3VA 1ZNZA 2H48A 2WKWA 2VLRE 1E30A 4Q6YA 4TT3D 4HKJA 1Z3CA 3VH1A 4GWGA 2EKSB 2OR7A 5FGCB 3NHJA 3PF2A 3PUKA 1BH2A 2OR9H 3HU2A 2ZUYA 1R15A 5CP7A 4NHCH 5DD5H 3HI6L 5EIOA 1OI4A 3GP3A 5T1KD 1HGXA 4HSEA 5DHEA 2PQ0A 1IC6A 1X5ZA 3PDGA 4U8HA 3IB6A 2C5SA 5TDPB 5EO9A 4YUEH 2OOKA 1E9RA 1Q38A 5KSBA 4ND5A 1T89C 3LXBA 1MFBL 4KRMB 2R0WL 2E6UX 1H15B 3AP3A 3EF3A 2F9BT 5FYJL 2GTQA 1Q1EA 2VDPB 5FKAB 4K9JA 2DY2A 4UTXA 3WLKX 1ABFA 3TC9A 5LQBL 2V6IA 1GS6X 2O1XA 2D0IA 3KPRE 3D69A 3DD1A 4DHWA 3T6ZA 3LPPA 3MJHA 3ML1A 4AQ8A 4OKVB 3S7ZA 4RJJA 3QUXD 4JO1L 4DN4H 2GCOA 2GN4A 4L78A 4J3XA 7PAZA 3IM1A 3HA2A 2G9KA 2J8UE 5F33A 4ZW6A 2XPYA 1E0DA 2ZYAA 1FFGA 2PUWA 2OSWA 1OXUA 4AK9A 1N5YL 1DJOA 4OGWA 3R06A 4IJWA 1AMXA 1FTQA 3IPLA 1TLMA 1ORSA 1FRFS 3TF4A 2VDWA 4I0WB 4MV6A 5G4LA 3RUFA 1C4KA 4ABQA 2AK4A 1X2EA 4OIIL 2APFA 5CEZH 1P5VB 4ORZC 3IURA 2HLDD 1G0XA 3AQZA 3RGBA 3RY6A 2AW5A 3PQEA 1V27A 3VTFA 4YWHA 3H2WA 4B6PA 4MD0A 2OQ2A 1BFKA 4IIYA 2C1XA 3ZVMA 5FO1A 1DAEA 4L74A 3SHWA 3QCTH 4ZT7A 4TWBA 1JW9B 3FA2A 4AIXA 3QWHA 2WTXA 1AMOA 4E2WA 3HCAA 1J9ZA 3GCDA 1RAIA 1I9IH 2NU8A 2Q5EA 2JKSA 4JZJB 3DJ9A 4P5MB 1KJ2L 3SDAB 1TZAA 2Q3BA 4QTXA 4PRIA 3FFXA 4O4JA 3QBJA 1Z9SB 2XI4A 3DI3B 2C3PA 1I4TD 3D2AA 1RXWA 3WO0A 5I7OA 1CDIA 5FDYA 3MI6A 2VF5X 5EIEA 4HBQA 4XN5A 3ARBC 4HC1A 1D2PA 2TYSB 3TNDA 1N8KA 3FB4A 4MV5A 3WMXA 4Y7MA 1UC9A 3ZQ4A 2VR6A 4C3UA 5C7LO 2NU6A 3PGFL 5FV1L 3F49S 3SKXA 1G20E 4NONA 3TR0A 3CUSA 1V16B 3SQBB 4EEZA 1E3WB 5IREA 3INGA 4DADA 1IBHA 1GCUA 1R24B 2O05A 3NGBB 2RONA 3L49A 1VEOA 2APXA 4NCC1 2OHOA 3LHDA 4QHKJ 1UXOA 4M8SA 1FFPA 5EG5A 4K5OA 3A4EA 4B6JA 5E4FA 1J2TA 2XQFA 3RWDA 2N3ZA 5FAXA 1A4KB 4IIVA 1PFWA 3PQFA 3WTYA 4UFOA 1XTZA 4GZLA 2R0KL 1AKMA 2C1EA 2VYCA 3PXBA 1NNUA 3QMPA 2UZ0A 2XIDA 4O4LA 1S3RA 2WOJA 2J6EH 5ESWA 3F6RA 3IFOA 4HOXA 1RAGA 4PZZA 1FL3A 4J0KA 2OTWA 2WNHA 3G0IA 1TLLA 3ZU8A 2HQRA 5IQ9B 1MOZA 5CX1A 1JZ6A 2WUBL 3PXEA 1XMWA 4XWYA 4J8RA 1AQNA 1BZDA 1GA2A 3DOUA 4I3SH 4ER3A 3V80A 5MP6H 5KS9A 2VRQA 1OW0C 3IFSA 2C7UB 3V79C 1ND6A 1N5MA 3H9QA 1W8NA 4Y1GA 3B3FA 4HPXB 2VBCA 2BVQA 3VU0A 4KNQA 1ISIA 3RKRA 4Y2GA 5JH7A 2O8DB 3L8EA 2NY0B 4PJFF 1CGTA 3WMEA 2V54A 2FMIA 2QN2A 3FSGD 2ZSUA 1H93A 2BKUA 3GMIA 3TG8A 4KX9A 1TDQA 1C1XA 4JDVA 2BFCA 2Q6TA 1LRJA 2IW3A 1OCZB 2NU7A 1Z2AA 1XT6A 1I82A 2I34A 1D09A 1UZGA 1T80A 4DXHA 2FK9A 1A7OL 2P3YA 3KV1A 2AQSA 4AYFB 2W6JD 3FN4A 4TQEH 3ECCA 3GR6A 5I76A 3AR7A 2XWEA 3SJ7A 5IHXA 3QE9Y 5E8DL 4XVSL 1MENA 3IUPA 3BBPA 1R1DA 2ZJBA 4XZUB 2HFGL 3VSEA 2R97A 3ZHTA 1LJMA 3CDGA 5DO2C 5DT1H 5DXWA 3UJCA 4OYYA 2F8SA 4W9MC 4D26A 1UZUA 4IMLB 4XC3H 5DGHA 2GQHA 1D6EA 3GTTA 4ZFOL 4JWTA 4Q0MA 1Q9WA 3TBHA 3HC0B 3QI7A 1Z6XA 4BWGA 5GSRB 5FCDA 1SY6H 1TOXA 1H2WA 4YTEA 3TEUA 3ELAT 5E7BA 1GJUA 1AOHA 4WU5A 1Q3KA 4ZFNA 3FMOB 4X6DE 2O3JA 2PKXA 1LP9F 3MW8A 2A5DA 1VDMA 3WO4B 7TAAA 4EY7A 4U63A 2XNCA 3D8HA 3TAXA 2VOJA 3FUIA 2J30A 4JZNA 4HQKA 1CULC 5E9QA 3NK3A 4JO2L 3S36X 3FF7A 3FFCB 1PZXA 4CLHA 1CIPA 4PCTA 1ZZEA 1J0ZA 3ZLTA 2LCFA 2LP4Y 1LDGA 1U63A 3JTTB 1MCCA 2HLAA 2WZBA 1WGOA 3CX5K 2XVZA 1HTWA 4D3FA 2EKBA 4KOBA 1JPEA 4D5GA 3DLBA 3KBHE 2CV1A 3II2A 5ICGA 5B7NA 2N1MA 1AD9B 1YHNA 1L7RA 4CN6A 1TJNA 5E08H 5CD3B 3DXYA 5FYLD 4WXHA 1YDPA 4R5HA 2XB9A 5HHQB 3K09C 1FIGH 1AQMA 4MD4A 4KLRA 4OSPA 1S02A 3ZQXA 3KMDA 1GSHA 3PWJB 2HLEB 4MAAA 1UWYA 5DISB 2NY3B 4L5FL 4HLZG 1ASPA 5IXSA 1VZIA 1IOZA 4AQEA 2Z2JA 4GRLA 4BWFB 2DEUA 1AO7A 1QSZA 2IYTA 1GPBA 4HXAH 1M1YE 2VUKA 3QVUA 4UDYX 3X1NA 1KSFX 4MV3A 4AIEA 3V4LA 1SCQA 3NRCA 1OT1A 1UKTA 2H5IA 4AQ7A 1I3OA 3ULUH 1RIVL 2OCIA 1BCSB 1WKVA 3LN9A 3A4IA 4FYRA 2G82A 1ZRHA 1VPOL 3NJGA 4I0CC 2XE8A 3AS3A 1U6AH 2J8ZA 2OECA 1JIVA 2YXVA 3GLFA 4UTAL 1Y7IA 3HNOA 5JBNA 3VC3A 5KW9H 2JFFA 5IBLC 2XWCA 1OF0A 2GUOB 1V41E 4L51A 4CKCB 2DBZA 2FNWA 3FTDA 1HSZA 4RD1A 5F8QC 4I4WA 5HGHB 5BS0E 2XVBA 3PGVA 5FJIA 3CZEA 3P9YA 4FZEL 4RETB 4YSSA 2PUBA 1ZIDA 2UYOA 5ALDA 2V1XA 5KSUA 1CRZA 3A22A 2P9QA 4CF5A 2E21A 4HQOA 4PC2A 3PHQA 2CLHB 2AJYL 2O3TA 1VJTA 1KI2A 1GYUA 2PWHA 1RHJA 5EZOH 1BOOA 4B6EA 1RU9H 1H6AA 4KJQC 1ZE3C 4HNGA 1C1DA 2XKJE 1NFDE 4G81A 4YECA 1JN6A 1YMQA 4KGJA 2OORA 2NW3A 3RX5A 4PSKA 4TKVA 4FZ8H 3RRFA 3SY0A 1OVGA 2Y22A 4OQ4A 3VI3B 3RF6A 2VDLH 2FJUB 1CE1H 1B8OA 1H9AA 1W25A 1WUHS 5DIZA 1GMIA 3BXXA 2JIXA 3EMKA 4PREB 1ZISA 2BM8A 4MO2A 1TNDA 5JATA 4GG1A 1Q7TA 3BFKA 3CLFH 1EEYB 5E9DA 3NFNA 1UANA 5EF1A 5C81A 1A8JH 1EUDB 2CNLA 2DT5A 2FX7L 4AY4A 1KELL 1EUQA 4EVNB 5D3KA 2ZRFA 1BMQA 3K4DA 2CIIB 4K71B 3OC6A 2H6EA 2VDLB 2H1VA 1E1RD 1IHUA 1PKQB 1E0SA 3U7AA 3QR2A 4XVUD 2DLEA 2FR4A 2D54A 5CFLA 2IYPA 1AYOA 4H1LB 4B9GA 5KJ4A 2JH8A 1FNEB 1JZ3A 4TWRA 5GS2H 2LU5A 2OAAA 5D2LF 3IWUA 3S7GA 4FMCF 3ZS9A 5DXAA 4CM1A 3P2KA 2DWDB 3JQAA 4MBOA 4ZYWA 5JORB 2MCFA 3HPLB 5D5QA 4NX0A 2ENYA 3KNZA 1F38A 3TASA 1I3UA 5HI4C 4RZHA 1P4AA 1YB4A 1ZSVA 3ZE7A 3S5LB 4D6PA 3CC5B 1DOHA 3U25A 4DVBA 2QU8A 4PY7B 1UDXA 3O11B 3G7SA 4X99A 1COBA 4P06A 3KVNA 4AYDC 1J5OH 3PAUA 4D92A 5FFNA 3HJRA 1R3LA 1WQ3A 3MUGA 4QNPE 2DC1A 2PBFA 5E51A 1ADQA 1G1YA 2IU0A 3PD7A 4MVCA 4PRZA 1GY8A 7ADHA 2W83A 5DSZA 1YR2A 3DUFA 4OFVA 2FZWA 3M45A 4QF1B 1P5RA 5I6XC 4D57A 3HM2A 1IJEA 5LDHA 3KRTA 3MRPB 5J2TF 1P2TA 1RAFA 3A1TA 3KQOA 4GMDA 1R6XA 3FHEA 4G8CA 3RPBA 3ARBD 5KX5B 4D3CH 5C0RL 1OBOA 3LYUA 1M1YB 4HLUC 2DVMA 4GUAA 5HRUA 2YNMD 1WIUA 2YPLE 5IJKC 3KE8A 2DEWX 3PXGA 4PYRA 1EJ6A 2P2GA 1VL6A 1S6YA 2GZHA 4WESB 5F35A 4D98A 5BNTA 1EUUA 2R62A 4F80A 5AIBA 3VYPA 1DAOA 2MQCA 4NC1C 2VCOA 1NKRA 721PA 2LT9A 4LRNL 3HNTL 1ZMYA 3A6FA 1E50A 2IANE 3WD5H 5BVJB 2C3UA 3C3KA 3NAGA 2Z6UA 3LVBA 2L69A 2H11A 5BNIA 4DLPA 3PE6A 5JXEA 4GRWE 3KELA 3RUCA 1W76A 3WGKA 5KSWB 2FPWA 4J3NA 4OHZA 4X8XA 1E79D 3MRRB 4XD7D 1S7RB 4NI3A 1GL4B 3TCXB 4P86A 4JJ7A 1V2HE 5F7BA 2OD9A 2CPUA 4NF2A 3I6KB 3I5XA 4H5SB 4I8IA 1UBNA 4XB7A 1ZLUH 2AK4B 1DN0A 1KAMA 5I7VA 1XRRA 1X14A 4I9WD 1CMOA 4NR0A 1Z26A 1MJUL 3RQ3A 5DRYA 2VT7A 3LWDA 3E84A 4QXTB 4W70A 4XWGL 4YFEA 4CN8A 1ZY9A 1S9XB 5T1MA 1Z4NA 2WK1A 1ILSA 4YRKA 1U7TA 1YEFH 1GGNA 4NPCA 1CY7A 2VJ0A 1O9WA 5A7FA 4BTLA 1E7QA 3WK8A 5GGUB 5KHOC 4BV8A 4LVCA 3ZMRA 1U8TA 1Z28A 4JB8A 3ZWMA 1RW4A 4PM1A 1NMYA 1ROWA 5KYWB 1KB9K 2GF2A 1OH7A 2W07B 3QORD 2C5AA 4LSZA 4AJWA 5JQGB 4G8AC 3NIGE 1I8IA 4LAQL 1FDWA 5CN1A 3U44B 3L5WA 1EP3B 1RYHA 5COQA 3Q2KA 1Q7EA 3L1OL 1MAVA 2G4GA 2NTFA 2JBHA 4O8CA 2Q8NA 4QRIA 3B1VA 2V0CA 3UA4A 4G9FE 4RBPK 2VC2H 2HF9A 3QPUA 2WKPA 1FNGA 3M6WA 4QD3A 4Z23A 2BHZA 3T3OA 2APVA 2EFJA 4KR0A 1L9PA 2CPCA 1D8TA 3QZWG 4BUZA 2WB7A 3RGWS 1D2CA 4PJHF 3SLRA 4KZ0A 2ED7A 3CKMA 1Z6YA 4JL1A 3WJAA 3C3YA 3WBKA 1GOHA 3PPVA 5CUQA 4MCZA 1RSZA 2ZBDA 1C30A 3FWZA 4QTIL 3FUDA 4RGOL 3W5AA 2A5LA 1OAJA 4UT6H 3DR3A 4HUWB 3R7AA 1OAQL 1GZ6A 4K6GA 5SX5H 4M62L 4JREC 3V3KA 2XRFA 3O0LA 3NUGA 4X6YA 4JAVC 2ZULA 1SXHA 3RBSA 4LJ4A 3QYJA 2IO5A 3SHOA 3IR5A 2J71A 1O0VA 1BM3H 4P23B 4KWEA 1CDDA 3OJEA 4XYMA 1VJGA 1TETH 3SS7X 1R6VA 1I24A 4MCYA 1A9BA 1W0KD 1JZTA 2CDGB 5BZXA 1INQB 2HTKD 2ZRQA 4GH7B 4PW9A 5IJVB 3Q6GL 3QUCA 2YBEA 2QX6A 1J23A 3NWPA 4XTCS 3ZBQA 4G86A 4LOJA 1C80A 5AUNB 1SUBA 2WP8J 2X9QA 1U7DA 4KITB 4KO7A 3V2AR 3SXUA 4WHTA 2WHQA 3WFBL 1I30A 1JZEA 4A6YB 1PZ3A 3JALA 3IIJA 4LBZA 2VNKA 3TWYA 5HDQH 1WSWA 4LFBB 2YWXA 1P2BA 3WJLC 2ADIB 3ORSA 3ARPA 2AXNA 1E98A 2EF0A 3GM0A 5I6NA 5JHAA 3RNQA 4O2EB 3LBAA 1YUKB 5IJWA 3CZJA 2CVPA 1J25A 3DEAA 4JJ5A 2R11A 3DYBA 2XDHA 4NCXA 2IBSA 3BXHA 4EHLA 1WISA 2JCBA 3ICPA 5BO1L 5JROA 1VL5A 4YX2H 1JR3D 1QOPB 4XFJA 3IPAA 1QACA 4WI8A 5DIFA 3DBOB 3JWGA 1NFIB 3STTA 4PE5B 4XZUA 3O8RA 1PZ2A 4AL8L 4GUQA 4YGVB 5TE6L 1CFQA 3DEIA 4OGLA 2YVQA 2ZJ3A 1NUDA 1XTUA 5I51A 2YFYA 3TS1A 4RMJA 5AD0B 4AF6A 4B3MB 4TV9F 4ZEOA 3V4VH 1KMHB 1UOQA 3OA0A 4V3BA 5EP3A 3PUZA 3DAHA 3DGGB 2YDXA 1LI7A 4NAUA 1H2AS 3RAJA 4WNSA 2YKKA 3SM3A 1KC5L 3DAGA 2XBZA 3DRQA 3IDQA 3ZHXA 2R7KA 4H5SA 4KK4A 1F13A 1LJUA 1X8JA 5DULA 1JZSA 1KENL 3EBIA 3FX2A 2AXGA 2JKYA 1IQDA 4ODBD 3U48A 2H16A 4FNMA 4RAVB 4NSKA 3KHOA 1QLJA 4W6XB 3RODA 3NHAA 1QNZH 5DS1A 1SFRA 3ZWAA 3LVEA 5JS8A 2XD4A 5I9LA 5AVZA 5JZ7D 1E4EB 3A58B 4NKRA 4U0KA 2PLTA 2CCVA 1U0SY 3UG6A 1R5VB 1D5MA 5CINL 2VHYA 5I9IA 2VDKB 3D1VA 3ZWPA 2R4RH 3QR0A 5IK3A 3H4IA 3VNVA 4IZOA 3TBCA 4M55A 4RVDA 4BVEA 2P6NA 3UBXI 4G82A 3FQXA 4BVFA 2XSZD 1NDTA 3KLMX 1XSJA 4I5GA 4MHSA 3IETA 1N26A 2OMTA 1MZVA 4PJDA 1RAHA 3TBYA 4AKIA 4RD2A 1UQSA 2XPZA 4NOJA 4BX2A 4UT9L 3PABA 4JGNA 3PU6A 1I8LA 4CMKA 1DHKA 3B56A 3PDHA 4IMKA 3FGPA 1QJCA 2Z1KA 2YYZA 1KY5A 1JJ7A 2CDBA 3STXA 4IIUA 5IB1A 4YP0A 1HL4A 1EYZA 1X3LA 1A65A 3TOPA 3NT2A 3SWWA 3SCMB 1WO2A 1IVLA 3R9KA 2CYBA 1YQGA 1U95B 4UU0A 4AYWA 5TQ0H 1DIGA 1M7DA 2MMCA 1KYQA 4QOSA 1PJBA 2O4UX 5FGCE 3OOWA 2W6QA 1PR6A 4BOYA 3MRRA 2GPYA 5FKJA 2PXAA 2HVKA 3FZNA 3HUFA 4KKQA 1E4XH 3WK9A 3C6KA 5IEJA 3KALA 1U93B 3H2IA 3FTUA 1YY9D 4ZW7A 4W9LC 1N2XA 1JEDA 4LFHD 1DAKA 5DFAA 3X0DA 1KP2A 5FTWA 5IM4F 1VBKA 2C95A 4Q7MB 2Z6AA 3QIUD 4XN9A 1MCQA 1ZS8A 4JM4H 1L5HB 1NKSA 5EIHA 5K4GA 4EKYA 3SJCA 5HA5A 4IDPA 1G59A 4I5BA 1E42A 4YCAA 1P77A 2GI0A 2QTTA 3PQ6A 5DUBA 4E41A 3VFRA 4XBGA 4I4TA 1NUTA 2JV6A 1GM5A 2CHXA 4EUPG 3QVOA 5BMVB 1L7TH 2R60A 2OZ4L 4OLUL 5HHOB 1CNEA 3DK0A 5AVRB 2NDFA 1YGPA 4F3YA 4XMPL 5MHTA 5B4TA 3EH1A 1L7XA 5AKXA 2F43A 2JNWA 4U4IA 2NSYA 4DCGA 2XXMB 3T5DA 3RTQB 4DP6X 1NU6A 1NCAL 4WKZB 1DANU 3KLDA 4TSRA 4AEEA 3CSDA 3ZXSA 4CSZA 2EEDA 4X4XA 4D4JA 5IMOB 1HHIB 4GMKA 2J9RA 1F9AA 3OFKA 4WKXA 4HS6A 1C7TA 3HAEH 2YS6A 5B1DA 3WG9A 3K6RA 1UZ8B 2EU8A 3BHBA 3CH1B 1I4DD 1TZGL 3LPLA 4XIIA 1MCKA 2BP0A 5LCVL 2G5TA 4X3OA 3VDMA 4CC1A 3Q13A 1Y98A 4M93C 1FGVL 2IW1A 3L4VA 2V98A 2PXHA 5C7YA 3UFXB 2FHFA 3LX5A 1XTIA 3PENA 1ONOA 3I32A 5IK2A 3SBWC 1NC2A 3T77B 1QH9A 1T5XB 1BDBA 5I7AA 4TVOA 1M1NA 3D6AA 1HI6B 4WTXA 2R4QA 3EXHC 5C5EA 1YMMA 4YAEA 3TFQA 1XMXA 1ZVSB 4KBPA 2AN1A 4CQMD 2Y0BA 3T4XA 3NHRA 1V6SA 4XPZA 3TZLA 4C0QC 4YIKA 4MDRA 3CMOL 2J9GA 1Q94B 5F3BB 2D0GA 4AXXA 3NCYS 4KQ4H 3DHNA 2FLWA 4BO5A 1J0DA 1XCTA 3RWJA 5BV2P 4X6FA 2I03A 3COYA 5A3QA 4LSQH 1B0WA 3P9LA 4PP1D 3MV01 5DYTA 3GBNH 1Y5RA 2DRIA 1DO2A 3C5VA 5M29A 1NJGA 4Y5XA 1EGQA 3ZDXB 4X7DC 3SD2A 3JSAA 3LD9A 2A33A 3W1VA 1Y89A 4TKVB 3NRFA 1RACA 1W2WB 3U4DA 5IEHA 4G5AA 3VO8A 3GSVA 4J75A 2ZAMA 4DGYH 3KB6A 1TSRA 4BL5A 3LZDA 5CIYA 4Q01A 1E8YA 3O6ML 4P84A 1UODA 3TZVA 2V2XB 4E32A 4DV0B 2X77A 4EY6A 3V1UA 4A2WA 4I1YA 3U2SB 1EVYA 1WZ2A 1P2DA 1M71B 1IKFH 2NXWA 1DQSA 5AM3A 1OAXH 2MYTA 2PZGA 4AJ4A 1Q7BA 4PYOA 1D4OA 4FEGA 3KLKA 3QEBZ 4EOGA 4IDJH 2PO6B 1NCHA 5BV7L 2ZANA 3SE8H 1U3FA 2CUAA 5AJWA 1JA9A 3EZNA 3VA7A 2FTKE 3ZI7A 3SE4A 2ZOTA 5IS2A 1G9TA 3V5KA 4KKBD 2O5EA 4N0UE 3LLCA 1FYTB 1P3DA 1KDRA 1SMAA 5LYJB 2Z09A 4BCXA 3CQQA 3VDRA 4HQNA 5DNYB 3L04A 2DERA 4M9RA 5DV9A 2NPIA 2OV1A 3UTTA 4F72A 4NO3B 1J0XO 3MLRL 3IU3A 3QX9A 4KQWA 3QDGE 3NBUA 3O4LE 4B5KA 1KJWA 2CO3A 3AEYA 1Z0ZA 3ZL4L 3G5TA 4PJBF 1OARL 4D46A 4CUKA 2D3NA 4DZBA 2Y24A 1W581 1LO4H 3UXHA 3CZRA 3N2YA 1G8YA 1GNRA 1K4YA 4IOKA 3CY6A 5DF1A 4MS1B 4N3TA 1EGJA 3EUWA 1RLOA 1WE2A 2YMPA 3TNNA 1N7GA 4ECNA 1NEZG 4UV7H 2HJLA 2V5TA 3FSJX 3T1FA 3VFMA 2HR1A 3D1MC 2VYVD 3WJ1A 4CM4A 3W2HA 1DBKL 2B30A 3O2VH 4YXLH 1UEJA 2UYGA 4ZVSA 1GPUA 3SNKA 2NO7A 2SKCA 3OAWA 4TWZA 2X88A 2GO7A 1ILWA 1IY1A 5TH2B 3RVQA 1NWOA 2P68A 1EE1A 3DXAE 4EGSA 5JDCC 1NPJA 1GWNA 3KPLA 2YIDA 3EDYA 2JBWA 4EDHA 3H2HA 4Z1MA 1IEWA 4ITRC 4TMFA 1E64A 1SB9A 2FBRA 2ITFA 3OJDB 4N20A 3LRSA 1F4XL 1AKVA 3H1GA 3CPUA 1YR3A 1WCBB 5DD1L 5BWOA 5LLDA 1M1XA 1ODTC 3K71B 3PL6C 4LBEA 4NYLA 4X95A 4YDHB 1YQVL 1ECLA 2JJSA 3OR6B 1KEZA 1VSUA 2UX6A 3E1GA 3DMPA 1AN9A 5DEOA 2ZZMA 5KQSA 3O8OB 3OZTA 4FFPA 3V8NA 1OKKA 1Q91A 1IJNA 5JMRA 2WQRA 4PB9H 4ECAA 5EU6D 4O6VA 2E4VA 4PNPA 2ITDA 2YC1B 3LPDA 5H80A 5BZDB 4OIBA 4QRPA 2K4AA 1BQHG 4NQSA 2C9RA 4LPXA 4HUWA 3HBZA 3IAHA 1Q9OA 1ZIBA 5EIAA 4GX1A 1GTJ1 5DM70 4DUVA 4RVFA 3MXVL 5EG6C 1QBML 1E69A 2Z5LA 3EGDA 4XPGL 2IIBA 3Q6NA 3QXVA 2FYTA 4Z1OA 4F3FB 3F00A 2YD0A 4L8SA 2IUTA 1KPIA 5F2NA 1RR6A 1MRDH 4X9BA 2OM6A 1PGPA 1KE1A 3US1A 5GGRY 2L8AA 4OLWH 3ZDAA 3RF7A 1UP6A 2G1JA 5FCUL 4Q3BA 4DYDA 4F4DA 3T4AB 1VM6A 4HSGA 3SVZA 1O0BA 2Z35A 1KRHA 2LVCA 1ISMA 1BWRA 1I14A 3PIRA 1A77A 1AQKH 3CG8A 5DUMH 3A4DA 2D31B 4BVAA 3BLPX 1SHJA 1DTSA 5DASA 5LDDC 2BWQA 1QASA 1AY1H 2Y68A 4N2DA 4NN6B 4L08A 1B0GA 2YLHA 3V95A 2EBHX 1AAJA 2WWGA 4EJ2A 2NP6A 1KK1A 4QYWA 4JKMA 3BWZA 5I74C 3BB1A 4P5SA 1KIRA 3CH1A 1MC8A 3ME0A 1YDWA 1T5OA 4JR9H 4X9GA 1P1CA 1AY1L 1K6JA 1SVBA 1FIUA 4YE4H 3IF1A 2I60L 4RA3A 1EUCA 3O3MB 4JQYA 3G2KA 1KCBA 4RXMA 4WUUE 2XUQA 2BZCA 4YNYA 3S35H 2R8EA 1QCCA 3HN7A 2UUOA 4JQXC 4MFHA 3QOXA 4FLFA 4OD3L 5KSPA 2YHIB 3FB1A 2EEAA 1A3RL 3CR7A 5HHMD 3HUEA 1AO0A 1JWSA 1O6SB 4A67A 3L4BA 5F1IA 1C3JA 5T33L 3HVDA 2G07A 4N5ED 4RTSA 1ZANH 3LEVH 4RZXA 2B0JA 3BN9C 1KZ1A 4L9LC 4PJIB 4IDDA 4JZJA 2X8AA 1L3NA 1E4VA 4DDVA 3DBRA 5AR1A 3SDYH 5DD6A 3VCLA 4D2NA 2DQIL 5EXDA 3IMWA 3ROQA 3UN1A 1HV8A 2CA4A 3V9CA 4KXQA 3PL6D 3E22B 2PD3A 1NMAH 3LUHA 1OGYA 1Q7RA 1YR1A 1B8PA 4O2FB 3LNGA 2D5CA 5FOBB 3LKRB 4ZI5A 2CBGA 3UMMA 2JVUA 2VSKB 3WISA 1DBSA 3RYFB 421PA 2BGUA 2BMJA 3G0HA 2PTGA 4ZUTA 3LUDA 4R98A 4GWLA 2IGLA 2DLTA 1NHWA 2EHJA 5FPSA 4WGFA 3BJRA 3CX2A 5LN8A 1K9VF 2F58H 1Z32X 2J9XB 4FLEA 4CTKA 3CUUA 2VDOL 1EO5A 4TROA 3NCJL 2A0XA 2PM8A 2ZTUA 5HG0A 4HEME 2IHJA 2Q3JA 2GEKA 2FHCA 4X5QA 4B48A 3WKEA 3M6LA 4O51B 1EWQA 3TBYB 5E8RA 1EJ2A 3SZLA 2WWNA 4RTQA 4N3BA 1AHWA 3X3GH 2R6FA 3RFZB 3ROZA 1JQJC 3TNLA 2GVZC 2PUJA 1VSVA 3MQIA 2JJMA 2ADYA 3ZGYA 4DF3A 1A6VL 4E4TA 4EG1A 3P30L 2VQDA 2ODEA 3ZVVA 5C46F 3E8XA 1FVXA 4GOJA 3L7FA 1J9GA 4LVEA 3ESCA 4LVOA 1S2GA 2D13A 1JDBC 5KOJB 5F7EH 3MRIA 3GLUA 4TQHA 1G7RA 2BTOA 1K2DB 3ME5A 1U0BB 3A5VA 5E6RA 4G7SB 4NGHH 1R4NA 3BWDD 1N77A 3UTDA 1Q15A 4MA8L 1G5AA 3SU8A 1LVUA 3MJ7A 4ZZ3A 2ZAHA 3MXOA 4KC0A 1SRQA 3ESUF 4L0QA 4UU9B 1XE3A 3SO3C 3S2AA 3UICA 1JIBA 2C88A 1EBAA 1GTG1 1SOUA 1ASOA 5I8CB 3AKZA 3GP8A 4NQZA 2I8LA 2VTKA 2YW2A 3M5PA 3IMRA 2HUEA 1IHDA 1N5AB 3OAYK 3RTAA 1Q9LA 2Z35B 4E5YA 4LF9B 4O2RA 2GI7A 1ST2A 3C85A 1O1YA 3FRPB 1UKZA 1I0IA 4GW5A 4RMUA 5DBFA 5KNDH 1OBVA 4CNIB 1CE8B 4CEIA 4FPXA 3IAM1 5FBLB 4IKOA 4IJVA 3FT1A 3CVCA 2PKYX 1JD9A 4Z53A 2CBMA 4XGIA 4I99A 4J9UE 3IGKA 2I66A 1EFQA 2ZI9A 4BDSA 3CLKA 1JF1A 1Z6JT 2B98A 3TPKA 1B9ZA 2AE1A 3OQ1A 2REQA 1G7HB 5DXJA 4LHVA 4Y5VB 1DPFA 2IADA 4I0PC 1EAYA 4DGYL 4LDZA 2ENSA 1XF1A 2JD1A 3QZBA 3MYJB 3HC2A 1FVFA 3I2HA 3R76A 3TEJA 2EIDA 3ODPA 1MJNA 5JNYA 1I9GA 3O4RA 2D2CC 3S5LG 2WTRA 5C07A 2A6DA 5BN4B 2WMPA 3ULAB 5FF6A 4QOFA 3RJMA 3TSOA 4HLDA 1LPSA 5FFOA 4C20A 2QF7A 3MCZA 5BV7C 1D9KD 3LGSA 2VLLA 1DAMA 15C8H 1JKIA 4PCVA 4AO8A 1B2WL 1HORA 2J5BA 1NQUA 2VFAA 2VJAA 4Q05A 5F1NA 1T8PA 2JJTC 1CU4L 5EWJA 3TWCL 5CEYA 1THMA 2EKDA 3U40A 3AR4A 3RUIA 4MDFA 2GBTA 1HHKA 4DUZB 4ELMA 2IYEA 3PKJA 1N18A 1CC1S 1MEJA 3UIYA 3UY4A 3BH9B 4QD2E 4RHEA 2OQIA 2C5GA 3REVA 1X2BA 2HTLD 2C1PA 3NACL 2P9TA 3LZOA 1SIOA 3THSA 3NM6B 4GS7C 2BGRA 1GH7A 1MF2H 2E8ZA 1Y5IA 3L92A 1NQBA 2VTBA 1H6UA 2CMRH 5AI5A 1PQUA 3FCOA 3TBWA 3A4MA 1DE4A 1KN2H 3MQFA 4JFWA 1TUEA 5J4KA 5L6LB 3PGLA 4G1VA 3MRMB 3QF4B 1MPTA 4Q5IA 1QG6A 3Q9PA 1I1AC 1E1CA 5IMLB 2V6MA 4TV9A 3UANA 4RDBA 3EVBA 1BFOA 2VDKL 5EPMA 4HWEH 1SJHA 4BN5A 1CDBA 4ZK8A 3UTSA 4DWHA 5HYIA 4N0CC 2XJLA 3ZWKA 4U49A 4PBXA 3ER8A 5DJXA 1E32A 2GESA 1RLUA 5DTFA 4XXCA 1U8CB 4NK4A 1E9AA 2IX3A 4C4RA 2JI1A 2RBLA 4N2GA 1T36A 4OAPA 3RDTA 1A2KC 2YZ2A 4MI3A 5HHNA 3CFCL 1XDTT 1KDOA 4PJ5B 4Z78B 2VLKE 5BWBA 3DVNB 2AMFA 3OAUL 5C0CD 3NDJA 1WPRA 5LBTA 4P3DB 5AKEA 2BIHA 1RI4A 2SICE 2A4KA 3B2EA 1MAJA 1WP9A 1TL7C 2Z1PA 2FXIA 2AEQH 4KJQD 4JLVA 3F71A 1XR9B 2AJUL 2IDQA 3QKSA 2R86A 1F2DA 1O6ZA 2D2IA 2CLFB 5K0BA 1HQRA 3PHSA 4OREX 3S48A 5FV7A 4WNIA 1WVZA 3ESNA 4RUKA 4JCCA 1NUAA 2BGGA 4ZOLB 3ORJA 4E41D 1A4UA 1Q0RA 3KDSE 1X8XA 5J11C 4FW8A 4JWKA 2D5BA 4R7NB 1GVNB 5HVFB 1YACA 4QHNA 5B8CB 1WWCA 2WJ7A 4X7PA 3WSQL 1AGEB 2VT0A 1AE6L 4B6QA 3AXHA 4NDZA 1KJ2H 3RYIB 5L2KD 5JCJA 5IAAA 1NVXQ 3BWUC 4B4KA 3FQ2A 1BQRA 5AOLA 3MRFB 4HGYA 1X7QA 5SZJA 4UBDD 1DJLA 2HFFB 4OJNA 2B59B 1XWFA 43C9A 2W2KA 3WL8A 5DX8A 1IXZA 4JEIA 4DPRA 2PWDA 3SQLA 1VE1A 4FADA 2VDWB 3ZO0A 4HQQH 2AJXH 3QWQB 3QLUC 4UBDC 2PX6A 3L6DA 4DPLA 4AUNA 1J11A 3HKCB 4JL2A 2WPDA 4WJZA 4Z6KA 4G5YA 2REOA 1F2VA 1GZ3A 1VPEA 4QTYA 1SC4A 3KYDA 3O2WL 4OXQA 3S5UA 4ND3A 2G1PA 2FQDA 5BWNA 3NAAH 3G5VB 3NO4A 5CX1B 5JQGF 2JFBA 3CPLB 1KH3A 5IH3A 4LE0A 2VLBA 5T8KA 4Z3FA 4GP7A 3AINA 2BOBA 4KVCH 3IMKA 2UWEE 3EJUA 3NEPX 1J18A 5EUOE 2K5UA 5JYBA 1GZUA 3H2KA 4U7SA 2D8AA 4C7OA 4ED9A 2EFGA 3NWOA 2XVXA 4K8RB 1UUFA 3QORC 4CFYA 5CILH 2VK8A 2UXVA 4PVDA 4MQTB 5C9KA 4Q4HA 4M0PA 1GGMA 3BJ91 5KQMA 1V54B 2A9RA 1GV0A 3GLIB 3IAXA 2EVFA 2RKBA 2IPNA 3PL6B 1C50A 2IU6A 1AF7A 3H7IA 3O21A 2VMEA 4J28A 3NOXA 3EO0B 4A03A 2MSDB 2HA3A 1EH5A 1PLBA 4QT5A 4GI3A 3ZCXA 2Z1MA 2AKAB 4N0YH 1OIXA 2SKEA 5F7XA 3HGMA 1R0XA 5DD5L 1PR5A 4PJ5E 1TIKA 4XCCH 1MGOA 3E27A 1YZGA 1AQHA 1H8EA 3I72A 3V1NA 4XE5B 2ID8A 3WX0A 1Z4QA 4FFBB 3FYDA 5CB6A 1P80A 2WT9A 3ZX4A 1CD0A 2EL9A 1UZ6F 3MRDA 1L6ZA 2IYSA 4RZ3A 1B88A 1QHPA 1KJ2B 4OFDA 2O2JA 3EOTL 4OCRL 1K4MA 3K0FA 5BS0D 1WCBA 4CIYA 4L5CA 4RGNB 4KTYA 3H5TA 4RBPH 4P5TB 2O57A 4U1HB 1OAUH 1A2OA 1EZ1A 3RVLA 5IRCD 3MBKA 3UCEA 3VJRA 2QJOA 2EEBA 4S1SH 2VBGA 3JS5A 3DMTA 2J5LC 1DO8A 3WS6A 4KAJA 1W0WB 1GOTA 2HN7B 3UENA 3KB2A 1B2LA 3KKQA 3FU6A 4QWWA 3BGMA 4S1WA 2TMKA 4BFUA 2I8CA 3WLWD 3WFBH 2WXMA 4XP5L 2WY2D 3RW9A 4Y2LA 5TQ0B 1GJRA 3I2JA 4BSJA 2D0FA 2A30A 3DG9A 1E1DA 3N1FC 4TQGA 5CNMA 4DEYA 5DPMA 4ZK2A 3I52A 2IYQA 2E4FA 1IL1B 3S2IA 4Q4CA 1AQDA 1DQML 4HS3B 5EZLB 2IAAC 3BPSA 3L1KA 1M2OA 4KROD 2Y1DA 1G21E 1BYOA 2RCSL 3ZWCA 2QPEB 1M6VA 2H2SD 2Y0DA 3IQHX 4FMKA 1FYXA 4DXAA 1H2HA 1E3MA 2ZJAA 4RGOH 4CC0A 2VO5A 1E1KA 2WYWA 3C60C 4NBNA 5TT1A 1B15A 1FTWA 5F1SA 2FW8A 4L75A 2AI1A 1P2VA 4QIRA 1DSSG 5ALSA 1URLA 2GN8A 2BVEA 3L02A 1HNZB 5ICYB 4D9KA 5D2CA 3MRMA 4P2OD 4PPFA 5IXYA 4KE9A 3QIUC 2QADD 4XO8A 2EDXA 1JYVA 2PNJA 3TW4A 1KKUA 3GJ5A 1L9OA 3L81A 1KAOA 3FYEB 2XNDD 3QS2A 1FFDA 4FQJL 4ALJA 1RCTE 5K09A 4HIQA 3BI9X 5CEZL 2Q0QA 3MWFA 2YBDA 3B83A 3D4PA 1XQ4A 5BW4A 5AOIA 5IJCC 4MGKR 1YBHA 5HKKD 1QOKA 2R7EA 1MCRA 3F12B 1ZOSA 3F5DA 3PX2A 3G5ZA 3RC7A 1S9YB 4AUKA 3WIOA 3ZZTA 3I01A 4GXTA 3PD0A 3UV3A 5DJ2B 3BEVB 1W4AA 2AUTA 4UVIA 2DTDA 4JFUA 4KXAA 1AS3A 5BO0D 4I50F 4X54A 3WFDH 4C6TA 1DBML 4BJ1A 3HB3B 1QRNB 2MCPL 3OBIA 2HLFC 5EERA 4U2BA 4J2QA 2UY7B 4BMOB 1QTRA 4FA6A 1S3SA 2XNDA 5DDIP 3E70C 4JCOA 4ONEA 3EZJB 4UBIA 5L4IA 3BZDA 1GGIH 1I6KA 3SPHA 1NFKA 4CG3A 5L45A 5JVDF 1M6OB 1ZWIA 1HX0A 3U4CA 3VQTA 1KEEB 5EVCA 1VTKA 1CUVA 2NZ8A 1F56A 4EM6A 3DYMA 2Z8WC 2QQKL 2X0WA 4RDXA 3EXAA 1OVMA 3KHUA 4RPKA 5IG7B 5KYUB 1AS7A 3OQIA 2MH4A 3FCTB 1BD2A 2J0SA 4GKOA 1Z7EA 3NXKA 3ALXA 1FEZA 4YL4A 3TESA 5G4NA 4PYNA 2NZ9C 4FUQA 1EESA 1QG0A 4Q6IB 2GXUA 3DBVO 1EMTL 3FB8A 4YBLB 3PJGA 3CYFA 2EW2A 2CD7A 1M72A 4P0PB 3VNUA 3BKJL 1P4LA 1YC7A 1Z34A 3VKFA 4OZIE 4ZQBA 1BDJA 3EGSB 1Q19A 1FSSA 1JIJA 4B8ZA 4XAKE 1DMSA 1WUYA 1KYDA 4ZK6A 2GPSA 3MT0A 3IOBA 4B35A 3Q8EA 1A1OA 2NXZD 4JZKA 3UWMA 2MINA 4FNTA 5DNEA 2RH4A 1S6NA 1TYEB 3MLXL 3H9HA 3ECAA 3KVOA 2EXXA 2DMBA 3LPMA 1QE3A 4ZDJA 2F7IA 4XNXH 4M49A 1UH3A 3EW3B 3MV8B 4WFFE 5CXQA 3MNMA 4ABVA 3H17A 3T5CA 3QEQD 1MNQA 3DZBA 3HXPA 3EXEA 3KWJA 3T2NH 4FR0A 4CT5A 4K05A 4KRNA 2ZM5A 4OD1H 2PBLA 3QDJE 2CDRA 4D02A 4N8SA 2BFMA 2WTMA 3V9EA 5J1TB 4P3YA 2JFHA 1V10A 3JX9A 2ZUXA 3WYNA 3BGFB 4DIDA 4LKXB 4ZVNA 2A5UA 1JVLA 1MWAB 1T22B 4RIFA 1P7BA 2W0LA 4HNAA 5IHUL 4J3FA 3DL2A 1H42A 4MW1A 5F6HI 3F4LA 3A1CA 4CM5A 1N6IA 3CZAA 2QL1A 2F54B 3WGIA 3BPNC 3O0RH 2JIXB 4KKBC 5FS5A 2C2OA 2C8VA 4S1OA 1ZTMA 1Q1PA 2WWHA 4HXGA 2IYRA 1B76A 5DUML 2XDYA 4HS3A 3K6JA 3L6CA 4AG5A 2SNIE 4CE6A 5LQJA 3L4SO 3B3BA 2VSCA 2F6RA 2IIPA 5EUQB 4UM5A 1J20A 4NN6C 2ILVA 4BNUA 4GUPA 4W9CC 3G9ZA 1LEGA 5HYFA 3CC8A 4LMPA 2PVPA 4F1WA 4PPQA 1MMFB 5BRZA 2V5MA 2GZDA 2VDJA 4NZUH 5I1HL 2O2GA 4MJ3A 3IEMA 4JLPA 3P3UA 4AENA 3FFAA 4OZHF 4I77H 3I74A 4JEMA 1LX6A 3K8OE 4Q37A 4LDNA 4R4FL 3HC4H 5C92A 4Z3TA 3BSWA 2GM5A 4P2QD 3AM8A 5LVEA 3ENQA 3GBMH 3PDJA 4ZT1A 3BD7A 4A6DA 4YREA 2QTLA 2BFNA 4D5EA 4IW4C 2O8CB 4YDVA 2V9PA 4PJXB 3CNEA 5EC1B 4G4GA 3N59A 4N1AA 2XIBA 3OX8A 1NF9A 3LIZA 2WP3O 2P5SA 4XNAA 1P0QA 4CM8B 4NM8L 4EG3A 1A5SB 4JXZA 1EANA 4XJSA 4Q9JA 3ICQB 2WQXA 4HSCX 5SY6A 5EL0A 2WOOA 1KDIA 4FA8A 4UCQA 4C88A 5AI4A 1FVEB 3IPRA 3GMRB 1TTTA 1P2SA 3A05A 3FF4A 4YUAA 1RABA 4R5VA 2IZ1A 3D18B 3EDQA 4BK5A