The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
121
|
sequence length |
461
|
structure length |
455
|
Chain Sequence |
GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb |
| molecule tags |
Cell adhesion/blood clotting
|
| source organism |
Homo sapiens
|
| molecule keywords |
Integrin, alpha 2b
|
| total genus |
121
|
| structure length |
455
|
| sequence length |
461
|
| chains with identical sequence |
D, F
|
| ec nomenclature | |
| pdb deposition date | 2008-11-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00362 | Integrin_beta | Integrin beta chain VWA domain |
| B | PF17205 | PSI_integrin | Integrin plexin domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | ntegrin, alpha v. Chain A, domain 3 | ||
| Alpha Beta | 2-Layer Sandwich | ligand-binding face of the semaphorins, domain 2 | ligand-binding face of the semaphorins, domain 2 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | von Willebrand factor, type A domain |
