3FCUB

Structure of headpiece of integrin aiibb3 in open conformation
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
461
structure length
455
Chain Sequence
b'GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin, alpha 2b
publication title Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 121
structure length 455
sequence length 461
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2008-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF17205 PSI_integrin Integrin plexin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3fcuB02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3fcuB01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 3fcuB03
4BJ3A 1DZIA 1PD0A 3AL9A 1RRKA 1QCYA 2VDPB 3PPXA 1PCXA 3QA3E 4CN9A 2M32A 3PPVA 1AUQA 3K72B 3OKWA 1M1XA 3ZE1B 2VC2B 4A0QA 1JEYB 5HDBB 3ZDZB 5HJ2A 1ZOPA 3BN3A 4IXDA 2VDKB 2I6QA 3VI3B 3K71A 3AL8B 4GZ8A 1MF7A 3ZDYB 1M2OA 1SQ0A 4FWWA 1M2VB 1L5GA 1YVRA 5KYUA 4O3TB 2X5NA 4CN8A 1MQ9A 5KYNA 4HQKA 4HQFA 4O3UB 4UM9D 5KYYB 1M10A 4IHKA 4C2AA 3N2NA 1UEXC 1IJBA 1TYEB 1T0PA 3K72A 5E6SB 5E6RA 1MHPA 4WK0B 2IUEA 2VDOB 4O02A 3BQNB 4JDUA 4WK2B 1JEYA 1OAKA 1JV2B 3T3PB 3EH2A 2ODQA 1AOXA 3ZE0B 2NUTB 1PT6A 4G1EA 3OL2A 1QC5B 1JLMA 1M2VA 3EG9B 1OLZA 4F1JA 4C29A 3HXOA 4Z7OB 5KYXB 1YVPA 2XWJI 4DMUB 1BHO1 1NA5A 1SHTX 4G1MB 2VDLB 1U8CA 2XGGA 2ICAA 2ADFA 3ZDXB 1JEQA 1N9ZA 3EGXB 1MQ8B 3TXAA 3PPWA 3K6SB 4HQLA 4WK4B 4NENB 3ZQKA 3EOAI 4MMXB 3IBSA 5LN1A 1U0NA 1ZOOA 4HQNA 4HQOA 2NUTA 3FCSB 3HI6A 1RD4A 2NUPB 1CK4A 1M1UA 4XW2A 2WW8A 5E6UB 1IDOA 2P28A 3F78A 1DGQA 5HGJA 1IDN1 3Q3GE 4WFQA 3AL8A 4MMZB 4G1MA 5BV8A 3TVYA 1M1XB 2XWBF 4MMYB 3FCUB 3EGXA 3EFOB 1PD1A 2VDRB 2O7NA 3IJEB 3TW0A 4UM9B 3VI4B 1ZONA 1SHUX 1XUOA 2WINI 1XDDA 4Z7NB 5KYYA 4NENA 1SSLA 1IJKA 2P26A 1LFAA 2I6SA 4MMXA 1V7PC 4F1KA 5KYUB 3EGDB 5ES4B 4JX0A 1FNSA 1RS0A 5E6SA 2VDMB 2I91A 3NVQA 1JV2A 1XDGA 5KYWB 5E6UA 2UZYB 1SHYB 1ATZA 4MMZA 2B2XA 1QC5A 5E6RB 3EG9A 4PN7A 4NEHB 4MMYA 4O02B 2ODPA 3EFOA 3NIGB 1MJNA 3F74A 3T3MB 3OKYB 3NIDB 3IJEA 3NIFB 3EH1A 3V4PB 3AFCA 5KYXA 1AO3A 4G1EB 3EOBI 3OL2B 1T6BY 3EGDA 3E2MA 4IGIA 3GXBA 4M76B 1CQPA 1FE8A 1MQAA 4C2BA 1YUKA 1Q0PA 3M6FA 3RAGA 4CNBA 3K6SA 1U0OC 1N3YA 2QTVA 3K71B 2NVOA 4FX5A 4WJKB 4Z7QB 3BQMB 3TCXB 1U8CB 1L5GB 1BHQ1 5KYWA 1RTKA 3V4VB 1JEQB 3FCSA 4UM8B 3HXQA 2VDQB 3ZE2B 4K3JB 3PPYA 2VDNB 2NUPA
chains in the Genus database with same CATH superfamily
5ULLA 1YC8A 3K53A 4O4IF 4I1YA 4W6YB 1QH0A 2OBLA 1LDEA 4PJXE 5BR4A 2NY5H 2DMBA 3T0IA 2PUTA 4AE1A 5EJ7A 3VA2C 2R1WB 4JRWA 3S2EA 4CM9A 3DTNA 2J09A 3QVAA 1A5TA 1GSAA 4GP4B 2H1OA 1AOZA 2RB4A 4DA4A 5FLEX 1F12A 2MRYA 3HHEA 3BZEA 1ETHA 3ORRA 4Q1AA 4H4CA 2FH5B 3CNOA 2A88A 4MS4B 4S1RL 1QX4A 1OGAD 3S3TA 3X14A 1I8TA 4U7KA 4POYA 3ETCA 3LRGA 3F96A 1KZ4A 3GJ3A 3P9PA 1GGEA 5CFZA 3TH5A 5KG9A 3JU3A 3BFOA 4J3TA 4WNIA 2HA4A 5A7EA 3U7WL 3RWCB 1RRPA 2QYOA 5KVFH 1IE4A 1NMCB 2OLEA 4GYYA 5JSZA 4CMMA 3KSBC 4CVXA 5AZEH 3QZWA 5FYKD 3UJAA 2OL3H 4XQ0A 3CDCA 1F86A 4OQTL 4JQXA 2EQAA 3BMQB 3U2SA 1UK6A 5DD5H 1JTOA 1JH8A 4HT1L 1N34B 3VSTA 4FBGA 2DPYA 2QX4A 1V7QA 4UASA 2DIBA 3GXBA 4TLDA 1E8MA 5AKVA 2RGCA 5C5CA 3QLTA 4UAOB 2K4WA 2A1IA 2EBUA 2P2YA 3LW7A 4ND4A 1D3AA 3T6WA 3SLRA 2AQPA 2RACA 5IREA 3UJ7A 1C12A 4AMKL 1F58H 2RKWA 4QT5B 2OHFA 4XB2A 4WEEA 4KJXA 4LVEA 2R2HA 4R4ND 5HVWA 2X0UA 2EP8A 5IJVB 1IJBA 3ZGZA 4G8JA 5LUBA 2ICWA 2C9YA 3AG2B 3HP4A 3WLJA 3E3NA 1USZA 4PJCF 5KQMA 5IDWA 1X1BA 3OZXA 4KRFA 2AANA 3HPQA 4WY7L 5IVZA 3W05A 1XNQB 4H60A 3PKJA 2WAHA 2MSLA 5EJ4A 3IEUA 5SWZD 3HDJA 3TG8A 4XSHA 4QOKD 1RZKH 5GS0C 3E8SA 3PY9A 3T1FA 1JG9A 4AT6A 2Z1MA 3LRKA 5JPMC 1DBML 2V5TA 1FFAA 1ZK9A 3CURA 3KUDA 3KXDA 3MAAC 5JCOC 1GCIA 3VX4A 4YMWA 4QRIA 1IT9H 2GABA 4S04A 3QJUB 3F6LA 1U8ZA 5FK9B 1HQYE 3Q2KA 5DS8A 2VN6A 4LL1A 1XX6A 3U46B 3L3JA 4GXVL 3W5DA 2HT6A 5GSRB 2Z6VA 1YJBA 3QRWA 3IPXA 5JS6A 4MCJA 4G6JL 1IAOA 1JJIA 1BAFH 1H65A 2QPDB 1XZPA 1OLXA 3H42B 2A30A 2NY6D 1P7ZA 3GSUA 4CVZB 1TOAA 1KJ9A 3QZUA 5E7BA 5B2EA 4M49A 3Q3EA 1GGHA 2PK3A 1BIIB 2X13A 4WWNA 3K9NA 5KTKA 5FYJL 3X1WA 3ABKB 3W04A 1U4FA 1RWWA 2BHNA 1LW7A 5L6YL 1B42A 3BKWA 4KGXA 5AK0A 3HG4A 2RCYA 3OBBA 3TQHA 3PJGA 4TSFA 1ZOPA 4RYLA 3DT8A 3OCUA 1JGLH 1TC1A 1H15A 2VLKD 1SQFA 3PGMA 4I0KA 3JWOL 4X6CA 4PRDA 3VGJA 4QU5A 1OP4A 4TUKL 1ISJA 4R97B 4K3EH 5CLLA 4D0BA 4NBVA 1Q1EA 4M1SA 4PJHB 2VDPL 2J3QA 2B69A 5HZKA 3RFXA 1L4MA 2X1PA 1IAQA 2A5LA 2OO7A 5FRDA 3WYDA 3K74B 1A7QL 4LDLB 2BSQA 2DH6A 4NRZA 5DQJB 3WYEA 4QHUA 3VR2D 2XUIA 2XN9B 2APBA 1AQHA 3PGLA 3TPFA 1D7DA 3KNBB 3C24A 3RIHA 2F53A 1I7PA 4G2TA 4M22A 4POOA 4L8SB 1NR5A 4BATA 4I4NA 4EQZA 3SJZA 4K3UA 4RGNB 2Q9BA 1CXIA 2GJJA 3QTBA 5INCB 4HUUB 4AK2A 4B82A 3M07A 2OR3A 4QU9A 3QXSA 1UPAA 1XNRB 1CF8L 1U33A 5MEOB 4DR6B 5F9FA 3A3NA 3V6OC 3GEFA 1P0CA 3Q2CA 1U4SA 3AEQB 1ZTXE 2LNDA 3GHYA 1B9KA 2CXTA 4LX0A 4CGYA 1R4ZA 4JI7B 1JU4A 3FULA 2N59A 1S7WB 1IC6A 3DZJA 4Q9RL 2ADFH 1XZ0B 4JL2A 1QSFD 4KQWA 3VSDA 1EVIA 4INJA 3ZGOA 2QP3A 1B41A 3V8QA 5L45A 3F71A 4MYHA 4HQRA 4RCZA 1G19A 5GHWH 1C8PA 1EVZA 1F2DA 2ZJ4A 3ULVC 5C0FB 2FWJA 4CG3A 2OM5A 3IMUA 2OL3A 1E40A 3VGFA 4Y16A 2ID8A 1DUIA 2XSKA 3O0TA 1OFVA 2H9YA 3ZKAA 4FYTA 2JIXA 1KYTA 3S2YA 2Z2YA 2Q2WA 5KAQF 1UWVA 4U2CA 2H2SD 2CWWA 1TF2A 3M6MD 4BHUA 3UH1A 3M6XA 3EXIA 5CXSA 1EFVB 1XL1A 4XB1A 3PQ8A 3TLCA 4E0BA 3QUTA 12E8L 4E7OA 2JB6B 3BVTA 2OAAA 4GRAA 1U36A 1VGRA 2ZXGA 3QPAA 2VI5A 5E6UB 2AWNA 2BSEA 4FQHB 2Z7YA 2C9VA 2ZTMA 3IESA 4GX2A 4ADIA 2I4TA 2PUGA 2ZJYA 3TEWA 1VCNA 4H2AA 5CB6A 5I74B 1KXTA 2LP4Y 3Q1KA 4LPYA 4ZNEA 3JARB 3MUEA 4HIHB 2EUXA 1JG2A 3QWRA 3OE1A 3SLGA 5G0UA 1N6NA 5SZKB 3RTDA 1JZSA 1JA0A 4LPWA 4KFTA 4Y2DB 1J1XH 2DUJA 1SK9A 3MPOA 4EO5A 3GGGA 1XR3A 2AQNA 1T9GR 2C5AA 2B98A 3KWWA 3MOBH 1CBUA 1XZFA 1MRZA 2V7QD 1LDMA 3KYMA 3VWKC 3O2VL 5D4HA 1ZVNA 1HKUA 2R6CA 1ZLUK 3PGJA 1OJLA 2P2LA 1GNTA 1MY7A 2VE6A 4OV5A 1MLBB 3F04A 1I13A 1SQ2N 2HKFL 3KJ6H 1IK4A 4D9CA 3TDNA 4O2AA 4YSPA 1GLNA 4Q12A 1COWD 1T43A 4JFPA 4RQTA 1HTTA 3CR8A 3FT3B 1QO0A 3WEAA 3CE9A 2BC4B 5A03A 2WYVA 1OTXA 2HUHA 3K1AB 3KEMA 1Z6XA 2JCCA 2BNUB 3JRXA 4OUDA 2WAQA 5EU7C 1J8YF 4TXNA 1ND6A 1NYTA 1CMOA 2Z58A 2F8MA 3CKMA 3KW7A 2OWDA 4QLOA 3H0EA 3EZXA 2JAHA 5IQ9B 1EEYB 4MAFA 2J0QA 5LYJF 2XFGB 3DOJA 1LP9A 2AG6A 1XGZA 4DJMA 3WE1A 3W78A 3ZNOA 1DO6A 4MLZA 1DLFL 3H85A 1P73A 1MNUL 2VNJA 1KCSL 2C4KA 2GEDA 2FK8A 1UMKA 4NYMQ 2BE7A 5FTLA 2J55A 1E7VA 1RVV1 1TDJA 4G82A 2WR8A 5DZPA 3T3EA 421PA 4OZFB 3IFPA 2HT4D 4C56A 3GIDA 2QS9A 3BEWB 1RXIA 3MRQB 3O8CA 1D0IA 2WN2A 3RSCA 2QZZA 1N7GA 4P3CH 4AQ1B 2WSIA 2UAGA 4X98A 3JVIA 5AXCA 3FYUB 2AK4B 2WFMA 2QRZA 1BECA 3TSYA 3VNZA 4YRQA 3KPLB 3L4ZA 4EOWL 4ESVA 5D6OA 3BFWA 2YHAA 3BQNB 2FYVA 2O1SA 3BFPA 2VT2A 2R39A 2B37A 2J3EA 1YF3A 3HZZA 1B00A 2BFGA 3QV2A 3CF4G 4XPFH 2GN6A 2IGFH 2ADFA 2VZTA 1I8LC 1LYQA 2VQSA 4RBPK 1JF6A 3RL1A 2EFGA 3AV0B 2ZRCA 1WA1X 4S1SH 4B17A 5I0VA 2G0TA 4A2LA 1KARA 4WESA 4LF8B 1E3FA 4CMHA 1ESMA 4R4NC 1V8FA 4QO8A 4XD7D 2NVWA 3UBMA 5IHPA 3SBWA 3C15C 4G0MA 4YFVA 5M5BA 2XGJA 4HWZB 2ADOA 4G0YA 1CQJA 5JNLA 4RTKA 4G4JA 4J4PA 5B1KA 3U79A 3W8NA 3Q98A 3NDBB 3T9CA 1MOPA 2HU8A 4NOMA 2CMHA 4JKKA 1ADQH 1AXIB 2P6UA 1PZAA 2WVSA 3C3WA 5E8PB 2AEOA 2AXFA 4ODXA 5DUMH 5B1AB 3L4YA 3UG3A 2QPUA 1RADA 1SLVA 1LXCA 5KVDH 2HR1A 4KQ9A 3FAKA 1U98A 3QUQA 3B34A 3RH0A 4LRQA 3UC5A 1L3WA 4P2RA 3VX3A 1F5SA 1MUJB 2XI4A 2X5NA 2OGZA 2IIVA 3U1SL 2IHUA 1S7XB 4RAVB 1WXIA 1R19A 3CH7A 4NL4H 4ZP1A 1XTPA 4B87A 2ZIFA 4HG4K 1YZVA 3ROTA 3GARA 1PVHA 3QJHB 4BP9A 4NO0A 1MI5A 2NY6C 3X2FA 2QTGA 4MQ4A 4QFDA 5DJXB 3TVMD 1J8MF 4L0CA 1JXMA 4JRXE 3S88H 4FOMA 3ET4A 4AQOA 1ZESA 2APTA 3OMAB 1A97A 2BTEA 3Q7JA 4F6RA 4G4GA 3IILA 1HI6A 5GGXA 2MMXA 2H2AA 1JDSA 1AS6A 1E9QB 1T4BA 1IRIA 3V8RA 1DOZA 4AENA 1XGQA 1KBQA 3KLAB 4OZ4A 3MTEA 1BV8A 4FGZA 4ETWA 2Y2YA 4GP5B 1VSTA 4ZQKA 3EQ8A 4FTWA 5J2TB 1D07A 1SJ9A 3FDXA 4F1SA 3IERA 1AIFA 4MJHA 4FABH 2BP8B 3K1JA 2KLRA 5BURA 4U1LB 1LDYA 5EC1A 1T9KA 3WGTA 1Z0KA 3T0EE 3ARBD 4RXTA 1FL5A 5BZDB 1O6GA 2DL2A 2Q2QA 8AT1A 5ACZB 2OP4L 1UB6A 3T65B 1NOJA 4G41A 3WE6A 3CVIL 2QW8A 3QDMA 1EXHA 1U2GC 4L29A 2OCFD 1O54A 1UPUA 1AKJA 1C08B 3HPJA 3M2TA 2D31B 5BN4B 2OSLB 1P5RA 3QLUA 2WYHA 2XY2A 4JJ5B 2IALB 1GT6A 3JV6B 2EDBA 1S78D 3DJSA 2A74C 1PI3A 3B2VL 1WW3A 2XQBL 4K9EC 3NSDA 4KGDA 4DLNA 3T2NL 1P53A 3RRQA 4PAWA 3DK2A 6LDHA 1F90H 1KIQA 2P45B 2AK1L 2ETXA 2GVYA 4NZZA 1GV1A 3L06A 2R51A 4AJKA 2QV0A 4Q24A 3WEXB 5I1JH 4ZA2A 3KLOA 2XG5B 3VB9A 1DR9A 4MLSA 4LBEB 2OMNA 4JDUA 4LZPA 2W37A 4JOCA 3I5AA 1R0AL 1QV6A 4JFED 3K9BA 1UT5A 2FATL 4WFIA 5DTRA 5BCAA 3IPLA 1SXIA 1MOQA 1UWGL 3POCA 1IBYA 2JF1A 2PXCA 1PHRA 4WI5A 1IQRA 1TT7A 3Q4GA 5IT5A 3WLFA 4G86A 5A1TA 1CHNA 2F58H 1S6YA 4BVGA 4TYYA 4X7FC 2OR9L 3DZFA 3UPCA 1PLGL 2P5TB 2GPJA 4DCCA 1ORVA 1AE1A 2BDTA 3O1LA 2C59A 1VYHA 3D30A 1XD9A 4J3WA 2OVFA 2BFPA 3BISA 1NY6A 1BXZA 3U62A 4PNHA 4BVHA 1RQGA 1DE0A 5CCXA 2QNRA 2H2SC 4PS8A 1K2VN 1SCQA 2GFBB 3GO4A 4XMVA 1HQRB 4KKBC 4KQCA 3WNJA 3P32A 2IHNA 1KXQE 1CQPA 4HZIA 4CM8B 5AOAA 2FSVC 1YZUA 1W9MA 3UPAA 3PTZA 1OP5H 3K4DA 2E75C 4K0OA 2HO5A 5A2LH 4U6NA 5D1ZI 3IIKA 4A0FA 2NO9A 3UHFA 1BS1A 3MWYW 3LKOA 3OVUB 5HYJE 1F6LL 4V02A 5IW3A 5HJ3B 3N0VA 3VC1A 1ADQA 4FLSA 2GPAA 2XV3A 1BFVL 1ZS9A 2WWVD 3S37L 1X1AA 5BN3B 5I17B 3UAGA 2A14A 3L40A 3KQPA 1J2TA 3IUQA 3U80A 1UXSA 3GBEA 1S8DA 1HLFA 1UATA 3RA7L 3F2IA 4DBZA 5AXDA 3MW8A 2QROA 4XZ4A 4EE2A 2BVYA 1N2CB 3CJTA 1TTGA 4BQBA 3PL6C 4OZGB 3RUIA 2C4FT 2QZ4A 4HGQA 3OX8A 3ZVNA 3WTBA 2XA3A 4L6AA 5D2NB 5L3SB 2MJWA 3ZL4H 5IESL 2VKQA 1MA0A 1IJKA 5KWJA 5CYPA 4KSCA 4IDJH 1FIEA 3GK3A 4DUPA 4XGZB 4WTZA 3T1YB 2X7LA 4O4YL 1ZCAA 3QI9C 2DQIH 2XA8H 4WF7A 3QVXA 4Z0XA 2ZF9A 1HT0A 1TYDE 1PEKE 2P8JA 5CB4B 2OXHB 2K70A 3ZE6A 5LNK1 4E4RA 4XRRA 2V59A 2ATPB 4LYDA 1B2WL 4BFRA 5JSQA 2VXTH 3LWDA 2RCSL 1S9KC 5CFQA 2QQKH 1FVDA 2YRPA 5DH9A 1L6IA 4OREX 4WW1A 2E4YA 1YMME 1ONBA 2Z31A 1DBSA 1T83A 4DDMA 1GA1A 5IVXF 1KI9A 2ETVA 3VNVA 2V7GA 5H80A 2OYSA 4QJ4B 4GOLD 3A1CA 1ECCA 4DLTA 3F2VA 2ZSJA 4GKAA 3T7EA 2BF7A 1DU4A 1DEDA 4PVLA 4GNKA 3THOA 4TSAH 1RHUA 1W85A 1O9HA 3KE0A 1L7IH 5IT2L 2HCRA 1K3FA 2XTSA 4Y0VA 5I15H 3DZ8A 4WEMB 4M62H 2P42B 3ALWA 3HI1B 2YV4A 3FCXA 3GEHA 3V7MA 3KPRE 3EHBD 2ZEJA 1GUAA 3KYCA 5FI0B 2QTNA 5JW3H 1XZQA 4UNRA 5J2UA 1KGJA 3W0WE 2PRSA 3OJFA 3LUFA 4AZ3A 2HT4C 1LI4A 4FD3A 3OWXA 1ZC4A 3DOEA 1OSPH 4XO8A 2C2YA 2Y0SA 2NPIA 1XR9A 3F6RA 3B56A 4MNHB 1FPMA 1KMMA 3MLTA 2OP0A 4YSTA 1FZQA 4DFIA 3SODB 4QULA 4KXWA 4L3EA 2AQ3A 2FUG1 1O9ZA 3CSBA 1DL7H 1NJ2A 4KZCA 2DL9A 4ER5A 3DUUB 3M46A 3PIQB 2COEA 2OBNA 1FU4A 3D18A 3F5WB 4W9KC 2BW0A 2IYVA 1AKMA 1C7JA 1ZAGA 5ESQB 4X6DE 3IUPA 4MR8B 4MYWB 1AN9A 2BNQE 1QMPA 3CW8X 3L5HA 1E62A 1BFKA 4I55B 2R23B 4HX9A 4HIPA 2F7OA 3OT5A 1UB5B 4E07A 2JLWA 1WHSB 3QBVA 1NN0A 2WDZA 4CW1A 4GPBA 3I3OA 5GS0L 1C3JA 4KI1A 3NEOA 1YZHA 2IPUK 3I30X 2YGVA 1H1LA 3PDOB 4HGMA 4TN9A 2Q7XA 2KW5A 4IJKA 2REQB 3I39X 1VL2A 4HIJA 3THYB 3MX0A 4CGTA 3ZV3A 2ID9A 1PQZB 1UZ8A 3N41F 4KQ3L 3C7TA 3MS7A 4PFJA 5EXPA 5A4IS 4HGOA 4IAOA 2FR0A 4M9UA 3I6GA 4BO0A 4I4TB 1QZ1A 4U3SA 1G17A 4PGDA 2Y1EA 2CK3A 2QVTA 4CKZA 1TA9A 2FFJA 5EJ8A 5G4OA 5C07A 5IH3A 3G5TA 4Q4HB 3DHNA 1BDIA 3EWAA 5H68A 2ZAHA 4EQ6A 1XBDA 3TVMC 3PFNA 3V6MA 2G25A 1I3RB 1QFMA 1EZLA 3QEQB 1QIGA 3O3AB 3ITNA 4YZWA 1SC6A 3KG2A 4F7EA 3A3YA 3BWXA 5L2KA 4KH0A 2DR0A 3V55A 2D0GA 2WLNA 2P0EA 3D12B 3BN3B 4OH2A 3DFIA 4YYEA 2UZXA 2J5XA 5U4QA 3CBJB 4F4IA 1KVQA 1LBIA 1ZX1A 1O0SA 2MYPA 2E0IA 1BCIA 1LVGA 4ZHQF 3B9BA 3BP6B 3ARBC 1UJTA 4K87A 4V1DE 1YAHA 1BWMA 4PJ9A 3UYRH 4HXYA 4DWWA 4J4HA 1O7JA 4AGOA 4M5YH 2BJMH 4PPGA 1J8QA 1YJDH 4FYPA 3NFNB 2ESVD 4MRMA 1A2OA 3HWSA 3TLBA 4F15C 5C0RL 5HYSB 4ACAA 1IAII 3LBYA 5KU1A 1R50A 2SCUB 1UK7A 5A71A 2UVEA 1QHSA 2WTRA 4FN4A 4K2HA 1NBYA 3HA5A 4MWFA 1CR6A 4MJ4A 3TPZA 4ZW6A 1QWUA 3DTVA 1XTTA 2FX8L 1U8CA 3QXGA 3O3OB 3AUVA 4FK8A 2W6JA 1TJIL 1YTUA 3PT9A 1Q9WA 5E4JA 3P2MA 3VU8A 4P07A 1U3JA 2Q1EA 2PYEB 4ZMXA 2CZGA 2EZ4A 3PDJA 4TKUA 5DCLA 3ZBPA 4MDRA 4XX1E 2VUKA 4K23L 2MNUA 5EQJB 3O21A 1N9PA 2A9FA 2C1OA 1K8DA 4X1OA 2AX3A 2ZXAA 1CVIA 2NZ9D 3ULVL 4QVKA 3VE0B 4CXMA 5DRNA 4DN6A 4CIVA 1OPRA 4PZAA 1JYWA 5KSAB 5KBNC 4DC9A 3N75A 1MVYA 3GSVB 1Y1RA 1HEHC 2HPVA 2VQUA 4KXMA 5IB2A 1SUHA 4D2NA 1MJUH 3LXRA 4R8RA 1BKYA 3MKGA 4CL7A 3PGVA 1QLRA 3WHXA 3QZLA 3DUSB 1N2JA 4EO9A 3I75B 4MVJD 2EJWA 2HIMA 3VU0A 1BROA 4TRJA 1I7TB 3L41A 4U7JA 5TMDA 3RRFA 1HZHL 1I2MA 1TEVA 2PSSA 1O9WA 4OSOA 3MCVA 2IBGA 4Y6RA 3UC0L 1F60A 4TZKA 1GH7A 5G3YA 4RPKA 3D8UA 3TTXA 2MHCA 1CR4A 5KSBF 1QPPA 2BY0A 4A15A 3TA3D 2Z7WA 4ENQA 4R8VA 4W1PA 5GWXA 5DR5L 1SBBA 1KPIA 1QZUA 1UMCA 1WUNT 4D9BA 4KWTA 1V1JA 1YA5A 2AFHB 1I32A 1M34E 2WSYB 3MRSA 2ZD0A 4FJ1A 3FB8B 3OXSB 4GMDA 2X6BA 5GRWA 2W2OA 4CIWA 3NHSA 4PJGE 2Z08A 4OHCA 5D7HA 2YIMA 1XCJA 3TW0A 4GQRA 3MXVH 4LOHA 4NYLB 3J07A 3DPDA 4OQFA 2WIIB 1DRUA 4WGGA 5ENZA 4MYPA 4YLQT 4Q5IA 5P21A 4AQ7A 3B6ZA 2AHIA 1G5PA 5D7LE 3IP1A 4N90E 1DFIA 1C4OA 3TBKA 3QRGL 4D74A 1GPMA 2DQUL 3CFCH 2VPTA 3BJZA 4AVIA 1U04A 2CMFA 5C71A 2Q9OA 3DXYA 5DWUH 2FU5C 1FUYB 3TJHD 4ZI8A 4OB7A 4DEXA 3H54A 2WC7A 4DDTA 2B34A 2N0KA 4OZIE 4CQMA 1XTJA 2P8PA 1K88A 1N2BA 1O7SA 4KPUA 3TW6A 3MJGX 5T1DL 3GN1A 2QG9A 3ETDA 5LP6C 4MRVA 2VXCA 3CC5B 2ZAYA 1M56B 3MRDA 2IA5A 4HK4A 2OW6A 3OZWA 2HPZA 5L7XL 3GD5A 2G8LA 1Y89A 2HRCA 4TLAA 2DS4A 4BP1A 4BZZA 2P9GA 1NPUA 4BBAA 1EVJA 3KYNA 1F2QA 4F1ZA 4HBGA 4C7JA 1UCBH 3VXTB 3L7EB 1TZGL 1KFBB 3ZWKA 1SY7A 3HZ3A 2NT0A 3NPZB 4QYOA 2PUCA 1I4TD 3QFFA 1IXKA 4HLUC 3B6SB 2X9GA 4BJ6A 4XAQA 4QASA 3LF1A 4G5SA 1FNGB 3U4IA 4TL6A 2A2ZA 1G38A 4DUGD 2DYPB 4RPGA 4BXOA 1DXOA 3EHBC 3LPPA 4RISL 4U6YB 1YXMA 2XMCA 1J12A 1SHYB 2WE8A 4J0EA 1RULL 4JEUA 4D3XA 5ICYA 3NR2A 3MRCA 1U0LA 2WU4A 3N2KB 2G3YA 3VI4A 3E9EA 3AUUA 3N5CA 4CUCA 4OYRA 3GZJA 1H2BA 3GDHA 3FN9A 3X11A 2H6OA 3BWEA 4XODA 1UA6L 3O8XA 5AVSA 3D2UA 2ZNXA 2R59A 4D44A 3DX9B 3VXSA 1MIEH 2AC4A 3K1YA 7MHTA 1G3MA 3L13A 3D5EA 1S3FA 4L5AA 4OCMC 1RAIA 5KVGE 2IYOA 2ZJAA 4J2TA 4NR0A 2KLSA 4KKAD 3TIIA 2PQ6A 4IIJB 4ZZ2A 4OCNC 2VABB 3HAEG 3JYBA 4Y88A 2AV1A 5IFAH 3L7AA 3RYHA 3G8DA 1RC1A 2E56A 5A0TA 2JPDA 2BS9A 2BJHA 3ETHA 9LDBA 1AURA 4S11A 4JHAH 3S96A 3HUJE 2QT9A 1BM3H 1D5BA 3K3PA 5JW5A 1GIAA 1T2QL 1TB4A 1BQRA 3N0XA 5AOJA 2E4FA 4H6WA 1XD8A 3C97A 1N8ZA 2HRZA 2SKDA 3R0XA 1WVIA 1RJFA 1H0DA 1GSHA 5EIOA 4KLZA 1JDAA 5C53B 1QFWL 2B5OA 1Z25A 1QQ6A 1OTHA 1BJMA 3RKRA 3OM9A 1C0PA 6REQB 1FP4B 1NC1A 3NP7A 1KDOA 1Z75A 4FJYA 3GFVA 1WZMA 2JWHA 2FPGA 4EI8A 1RZFL 5C9KA 2BGIA 3C4JA 3L5WB 3VFGH 2XNHA 2O0KA 4HV8B 3C5HA 1NZRA 4WDIA 2OULB 3CEMA 5AAMC 4JYMA 3FG9A 4MTLA 1Z5GA 1F0YA 2O2CA 4DRZA 1IQPA 5B7FA 5F9OL 2D74A 1E2ZA 3CBKB 4JVWA 2C4VA 4MMYA 4A6YH 4DMLA 3QJFA 2C8NA 4OM7A 4PRBB 3BX1A 4URZR 4RF3A 1JG7A 4JKLA 4O58H 5LZ9A 3WLOA 1RSYA 1RUAH 2VITB 3SKMB 3IJ9A 5F9MA 1TZHA 3C5JA 1KYAA 4GBGA 3OPXA 1VEMA 1P1KA 3GXUB 1RP7A 4D57A 4WADA 2YPLD 4ALAC 3QE5A 2A38A 3PAYA 3OB0H 4XOEA 4MI1A 1XBRA 2VXQH 4BH8B 3QW9A 4H88L 3GZTB 3R7LA 3VFRB 4X41A 3STLB 3A6BH 4FN0A 4ZFGH 1OWLA 1P3Y1 4JFFB 3AONB 3HJEA 5GPRA 3JYCA 1E3WA 3RJ9A 3CXHK 3MRKA 1R3KB 1KIPA 1T13A 3KUKA 4GEGA 1JG3A 1OCRB 3U3OA 1FLAA 4IYKA 1ZI9A 1G6KA 4NCNA 1OO2A 3OTHA 2IDJA 2GCEA 2E47A 3TQSA 4K9EL 1JHRA 3BAWA 2XFXA 5I8KH 9PCYA 5EU4A 1VE5A 5ED0A 1PZXA 2KBGA 3VA7A 1O58A 4ZUVA 3MLVL 3MGAA 3NT5A 1MHEA 4B32A 1A1MA 3V5KB 4PCYA 4E5SA 1R24B 3RVXD 2VZOA 3O4HA 5KX5F 2DC1A 2MU1A 4HYTA 1PAUA 3NIDB 2WMDA 4KKVA 3MJVA 2ZRIA 4LRXA 1TYRA 5K4AA 3JQ6A 2P1RA 4CSTA 4UDTB 3ESYA 3QARA 3HCDA 4FYVA 2WA2A 3D0LB 1FBNA 3SHVA 3H1AA 3P97A 1V11B 1RQ7A 5SWSE 2BR3A 3FMVA 3ISJA 2TS1A 1MH1A 3GHBL 3MJ9H 1JLSA 3R75A 4QSHA 1T8WA 1RZIA 5IYZB 5F9HA 1GAEO 1FLDA 5TDHA 1PGNA 4Z7OF 1W75A 1V1RA 2XDQB 5EMJA 4DR2B 2OK8A 1WSAA 4HDOB 3LGSA 4QBIA 2H26A 1XV5A 2X2HA 4AM0A 2IDKA 4B71A 1RZ3A 1D2EA 4K88A 1XH1A 4G24A 4JKMA 5ICUA 4YXKL 1TJYA 5JQGB 4OP3A 3R7DA 3DAOA 5I8CB 3QZBA 4KEAA 4M03A 2AHOA 3TIEB 3U0TB 4I08A 4RA9A 4NQCD 3RRZA 3AS2A 2NO6A 4BECA 4ZDKA 3OC5A 3S5YA 3OZLA 5E23A 1M1UA 3DF9A 5C8VA 3M88A 4UCFA 1DVFD 3TWCL 3VW3L 2BH9A 2HCZX 3IGUA 3VJMA 2Y69B 2W00A 2OLDA 2VMEA 3R0VA 3QCTL 5FLVA 1DXHA 1SHLA 3RUGE 4U2EA 3MD9A 2C07A 4RELA 1U8YA 2VISA 1YEDB 4ZW7A 3FT1A 5CK5A 2QN8A 3N28A 1VL5A 3KT6A 4EY4A 2CKNA 2GZ1A 7GPBA 1IL1A 2BZ1A 4HDKA 1FQ9C 1I5RA 1ASPA 4Z9XA 5JI2E 5IJKC 1QBMH 3K70D 4PJBE 5I7AA 5AKTA 2FE1A 2XDAA 1A2QA 2Q3AA 4KUCF 1KHTA 1JFSA 2NUPA 5E2TL 3JSXA 3NFRA 3C8UA 3FNQA 2OTWB 5KOHA 4XBGB 5KSVA 3HBMA 4FNMA 1QDEA 4HLJA 3U3MA 5E94B 4PJAF 2VYQA 3DMRA 4XVCA 4PPYA 3FYSA 3VFTB 2PO5A 2E5EA 4V39A 1CGYA 3VXOB 4RTLA 1EDZA 4A6YA 5G02A 4S1WA 1K7YA 5AW2A 2ZG2A 3VD3A 1QBBA 4ZU6X 2IBMA 5KW9L 1HXHA 3VXME 3WEOA 5AAWA 3TJHC 5DZOA 3W39A 4UT7H 4F12A 4F7MB 2WKPA 2A83A 5IHZA 3RYIA 5FPHA 4DY6A 1RJZB 1JLHA 3CT4A 4EB3A 5IT9A 3BZFA 5F0MB 2PZJA 1QAQA 5D7EA 5FAXA 2VXQA 4MGYR 3JQBA 1J9TA 4L05A 5K33A 3L8DA 3IJHA 3IDAA 1TMGE 4MQFA 1N92A 3H2IA 2DBJA 1BU5A 2NRDA 1FJHA 3HC3H 4C54A 2UZYB 3A23A 2TRYA 3NCWA 2QU7A 3DWTA 4N2OA 4LQLA 1NSNL 3O4OB 2IEGA 4LSGA 3PQ7A 3FRPB 3M3DA 1NMZA 1UKAA 3L2OB 5AM1A 1JYFA 3NESA 4QRRE 4RMJA 3VB8A 3LKPB 4RAQA 2GEUA 5JS1A 3UACA 2NADA 2WXRA 3F5SA 4HKZB 3DJTA 4CFSA 3KPTA 2H9AA 1HJCA 3S0PA 5G55A 3HN6A 4YHLL 4UILL 1MF7A 5ESVB 1V5EA 1RKXA 1GARA 1TPXB 1GZSA 3BVVA 3AY0A 3QBTA 1O2DA 5EINA 3IAS6 4O4IB 2AF4C 4HFNA 4LHWA 5KCZA 2PWAA 1TMQA 2UU9B 3JT0A 4ERXA 3UMSA 3T0VA 2H0PA 3EH2A 2PJDA 4DV1B 2GA9A 2MMGA 2OMXA 2Q5EA 1HWWA 2W92A 1V5WA 3STZB 3A6OA 4L1HA 3ZGVA 3KHTA 1TIUA 2AOTB 1JLLB 4P2QD 4WVFA 5FGCB 3UXFA 5JXAH 4KKAC 2ODAA 1CZOA 1Q72L 3V10A 1AGEB 2YPVL 3MJ9A 1ZVSB 1X80B 4UTXA 4C03A 4OI2A 4ZQBA 4B8ZA 2CLRA 1FORH 2P27A 1G7PB 2VZEA 1XCTB 1PZ5B 5ABAA 4FFNA 4M9OA 1CICA 1DP0A 1CU4L 1NL3A 1DMSA 4WT7A 4BUZA 3KQTA 2IU4A 4DF9A 5GIRA 1JKJB 1YA4A 1KI3A 4O4JF 3SY0A 4E2YA 3FTGB 3HB3B 5JA9A 5CCKH 3IR7A 3N3BC 5J6SA 4NWTL 1UJ5A 4G07A 3OM3B 3T77B 1A8ZA 4QE3A 3HRZB 4GRMB 4G9FE 2VO8A 1Q44A 3K96A 2O3SA 1RZ7L 4X1YB 3C74A 2OHGA 5DVPA 1L1EA 3ILEA 3MMNA 4Q1FA 3CN4A 3FN3A 4FTVA 3TBYB 4ERSH 2FUNB 5J6HB 2YFKA 4LVCA 3RU8L 1YNTB 3FO0L 2GIYA 3MBED 4G37A 3DBVO 1XNHA 2B7DT 3ILHA 4HGYA 4B9CA 3HY6A 2ARJA 4CCWA 3LB6D 1YN6B 3KJGA 3QWNA 4MI6A 4Z7WE 3Q0HA 2CLVB 2B1IA 2E4XA 3L1JA 5K0GA 4PRPB 2YD2A 4P23A 3TASA 4U7DA 4G5AA 3KXFE 4JPWH 5F51A 5D71L 1NPNA 4BWVA 1QHPA 1W87A 3KPNB 2PLWA 4FWBA 4U5QA 4FHGA 5AK6A 4A0GA 3GXOA 2EXSA 1YPZE 3L7FB 1D1TA 2XWRA 2WUBL 1OAQH 4PJCB 4ZPTB 3IHLA 1SJEB 5FO1A 2Y6SD 5IFHL 4US0R 5HIMA 3X2QB 4G8GE 1OQXA 2HXAA 2Y2WA 4P7JA 1YB1A 4LBWA 2PTTB 1PS9A 3LOQA 2EVHA 1WGVA 4Y2OB 4LA4A 1FYVA 1I2ZA 3ZGIA 3ND8A 2PXYA 4PJFE 3LKRA 4JHUA 4D9QE 3WLIA 3S3SA 1W94A 3CC8A 3T38A 2CDCA 4C8XA 3LQZA 2PUWA 1AGDB 4XAKE 3KQWA 2P43B 3REQB 1B0RA 2D0OB 1L4LA 5HGAA 4Y4KC 3GRAA 2CCWA 3U1QA 5A2AA 1CFQB 2FN4A 5FFMA 2H1SA 2VDML 3TESA 1JN6B 1DLHA 1C8LA 3VRJB 4HWBL 4XR8C 5GRXG 3C3EA 3SX0A 5KNDH 4KR7A 1F6AB 1OAKL 4UHEA 4ZV9A 1ETB1 3HHSB 3GO1H 4OZHA 4M7ZC 4AI7A 5HVHC 1E4XH 3RVXC 2E6JA 3ND5A 5G4NA 3B3JA 5HGXA 3WGUB 3EXHB 3JCZA 5CXQA 4RTOA 4K3JL 1LD9A 2J44A 3QRBA 1CYEA 3O4IA 3QHQA 2NPLX 3B9AA 1BCRA 1SOQA 4EF6A 3IF1B 1Z29A 3PXLA 2FECI 2P65A 1M7DB 4JREC 3ZTNH 1MV5A 1YUMA 2HH0L 4N03A 1KB5B 5IBQA 2W6QA 2D2VA 1Y1PA 4Y9EA 4ZAZA 4X4YB 5F2EA 1WFIA 2F48A 1P1ZA 4WERA 5AW9A 2IOFA 1HILA 1RZJC 2ZOLA 4B40A 5EJAA 4QJ3A 2R60A 4C3OB 4LZNA 3H3FA 5F98A 1VRWA 1ZHKA 2R8ZA 4FFZA 1KACB 1JIXA 4BEJA 3DB1A 3KPQB 1Q16A 4HXAL 2J0UA 4W1QA 1RYHA 5CYGA 3SC2B 2EDRA 1IOWA 4E70A 3K9FC 3H9HA 4BSVB 3LDUA 5BMVA 1QYVA 5FYLL 1MG5A 4M9CA 4PBTA 4A2QA 2PIAA 1XMPA 1WCWA 3RD5A 3SVTA 2P46B 2ZT5A 1XZLA 2FP4B 5F0PB 2RI1A 1DVFC 3OCYA 3ZZNA 4GXUN 3K4PA 5I82A 2RG1A 1W6LA 5AOLA 1LKZA 1QB7A 1U95A 4TRPL 2VJMB 2R8PA 3K8LA 2AFNA 4JY6A 2EJCA 2G72A 3WMGA 4IUCS 3H65A 4Y8AA 2DQKA 1KGUA 4PAMA 3T6ZA 2WP3T 3FYEB 4Z95L 1N2OA 3K70C 2Y7MA 2HLDA 1CG9A 1J0XO 1DBJL 2O2DA 4DXDA 1XGRA 4DMUB 3IBFA 5ERGB 1Z6AA 1OX4B 1EGVB 4NDNE 4QKTA 1U1IA 2Q07A 5AVUA 2IIJA 5DYOB 4KQ1A 4D9LH 2DYSB 4FEMA 2PJZA 4AJ0A 4AVJA 2FZ5A 1TT6A 1QRDA 3IRUA 4ZDWA 3ZQ4A 3QS2A 1DAFA 4KW7A 1K4YA 5I75C 1O95D 3MQ4A 3UDWC 1V4NA 4GDMA 3K2QA 1UT2A 4F3CA 3PUWA 2GHWB 2X8AA 3QIWD 4RSMA 2QQFA 4ZJYA 3WNPA 2R1TB 2BHUA 3TC9A 5DEOA 4J94A 2NY2D 3Q8KA 1K3IA 3ZIAA 3U0PB 2FLMA 4F7TB 3K9CA 1AQNA 1RJDA 2Y5QA 3I34X 4DSTA 3PNRB 3FOCA 3R5SA 1I6WA 5JHLL 4Y5XA 3NUQA 3H2HA 4JG9A 5C1OA 1RLJA 3O4GA 3UBXA 1H3FA 5TF1H 4EI9A 5ALMA 4LZAA 4BO9A 5IJ0B 1LO5A 4LQFL 3Q8AA 5J3JA 4H44C 3MACH 3NTUA 4F84A 3JATB 1JHKH 3COYA 1WZ2A 2G1UA 4JJZA 3B8EA 4WW2F 1JE0A 3IDQA 4JQIH 4M43L 1UBFA 2IITA 4HOZA 1CG6A 1QFHA 3BKYH 2RH8A 4G9EA 1KTLB 1D5XB 1AKVA 3JD3A 4NCJA 1AB5A 1QYWA 5E5RB 5GZ3A 2QN3A 4W5WA 2I71A 2VHUA 1JNHB 1OA0A 3L6OO 1FNEB 5TPWB 3LZQA 2GUOB 3N07A 1ID2A 3SR3A 3ARDB 2H32B 1GWNA 1CYWA 3T7RA 1ULHA 1NCDL 2V7TA 3KDSE 1MXFA 4HZUB 4CJ0A 1R66A 5KNDA 4KR2A 1P6UA 3MFFB 3IXLA 5BQ3A 1GZQB 1OALA 3ROLB 2EGGA 2OJ1A 2EG9A 4P4KA 2B4AA 4QAWA 2QF7A 3DEYX 2XMDA 4V0KA 2P44B 1NVTA 3QEGL 4X6LA 1G3RA 4DR3B 3GEGA 4DW8A 5DBEX 5I4IA 1K6QH 3I2YX 3J7HA 4JLVA 4PRNB 3UG7A 3DC2A 1OD6A 5B4VA 5L6LB 5B7QA 2YBEA 1JDNA 3UXHA 1J49A 3EQ9A 5IB1A 2W2MA 5I4BA 4OB5H 4YHYC 1IYZA 3DEIA 1Z13A 5ICFA 2QNIA 1KJWA 2DPHA 5AK5A 4WAFA 3UUWA 4CNIA 1GG8A 3NC0C 3WIFB 2BGRA 4U49A 3ND6A 5B57C 1FN4A 1BN7A 4PB9L 3T4AA 4CLDA 2CHZA 3NVAA 4P5PA 1N5AB 3DZKA 1I30A 1NCNA 4A04A 2OZEA 1GNQA 4X9GA 3CZ9A 2XZZA 4BCXA 1F6WA 5K3AA 4ZCIA 5LCVL 5HJ5A 3RKDD 1ISRA 2QB5A 3HMKA 4IMIB 5J59A 4OQZA 4EY5A 3OM8A 3IH5A 3QK7A 4ND3A 4WFHE 5F6IB 2R56L 3KT3A 4X6XA 1JZJA 1BXRA 3FLMA 4URUR 3KH4A 3MBEC 2ATKB 2YHUA 1F18A 4TSFD 1V39A 1XQ4A 3B3IA 1Q0TA 5JVDF 1K7XB 4XWGH 3EVEA 5KNCH 1JHLL 2AN5A 1PEAA 1A25A 1CI5A 4X95A 5EBLB 3JRWA 1ZY9A 1WD8A 3MUOA 4ALAL 2K6GA 4ALNA 1O4VA 1NFDA 1GYRA 2H41A 3KBHE 3F64A 3N0TA 3MV8A 1E1CB 1HHKB 1RYFA 1NPYA 3BRCA 1GZ3A 2KE5A 2ZIUB 1L5MA 1L5HA 2XADA 1S3GA 3MUNA 1TU4A 1Q4NX 3N5KA 4AIEA 3CSYA 4PC6A 2JK0A 5E4EC 2Y6SC 2Y6TE 2YGNA 1NXTA 2F53D 2I3DA 1WE5A 2C2KA 4OGYH 2SECE 3CE1A 4GW1B 2HWXA 4UT9L 1NVBA 4DK3A 1ZK5A 3TO2A 3RI3A 2N42A 4F9PA 2HYDA 1VKOA 3NCJL 5GS1B 4GZ8A 5AKYA 3TLJA 2XNDA 4AV4A 5BS0D 3I45A 2BH2A 1BX2B 4L5JA 3OEHD 5DGIA 3OAZH 3O38A 2Y22A 1N2GA 3SD2A 3ASUA 2FHPA 2PZMA 3ZQUA 2H18A 5IV2B 4MDFA 4YR6A 5ITBH 4F2WA 5HHMB 4H8PA 2XVMA 2ZROA 3OZKA 3A06A 3IA7A 1X7TA 4EUEA 3MUY1 1NQOA 1U0BB 1AK1A 4L4TD 3AMVA 4WLFA 1RZUA 4P1ZA 4HD9A 1PEZA 1VI2A 1LVHA 3SGDI 4JM4L 3O73A 1A6PA 3WFBL 5AUNB 2YC1B 2R2GA 4NK5A 1NYQA 3EOYG 2F54A 4QGSA 1QO7A 2QX7A 2PD3A 5GGUA 2JIXD 4B4UA 4JQIA 2Z2ZA 4WNYA 1YEHL 3W7AA 1UYWL 2XGMA 1E2DA 5FNVF 4D82A 3IKVA 2ZTSA 4PGAA 3UB2A 3C3XA 1HXYA 4II2A 4RDQG 4HHEA 3DTYA 2GAAA 5EFIA 2D1RA 2P2GA 3JS5A 4A5OA 4OTXL 2VAWA 3GMNB 4A27A 1Q0PA 4CM6A 2G9NA 1GZ5A 1PKOA 5GRVK 4HC4A 4GIPD 3E03A 3PX7A 2FX7H 4LOVA 3OP4A 3QITA 3FOLB 5C5IA 4M5ZH 1ACXA 4K7PH 4C0JA 1ZJYA 3HHRB 4G80B 1T2AA 1OI4A 4RADA 1BWWA 3FN0H 2OXFA 3EVAA 4R26H 4R5VA 3GZNA 2AYXA 3EO9H 1AZLA 1J21A 1TVHA 1W5SA 2FGJA 4QUBA 3DK0A 4HUVB 4F5ZA 3IJSB 3SOBH 4RLQA 2DPMA 3GLEA 4NKOB 5ISZD 2IYAA 2YD3A 4HWUA 5GSVB 5F89A 2Q2VA 4KY1H 1F2TB 2J4WH 3M5WA 5T1MA 4PJDE 4M3JA 15C8H 2H4YA 3OKNA 1VIVA 4YDIL 1BJ8A 3IVAA 5T4BA 4OF6A 5BUQA 2VBIA 4H8HA 5KBKA 2WCGA 1ZV2A 4P2YA 4GT0A 1RZVA 1N0VC 3BTUA 3EFFA 4GSUA 2DT8A 4D26A 2P2SA 4YY3B 4P4UA 1ODTC 4Z0PA 4BB6A 1RACA 5DN6A 2D73A 1GCFA 2BS8A 2C94A 4PTLA 2ZJOA 2CBOA 2FR4A 5EXXA 3OJ0A 4DQAA 4YDQA 1ESCA 4BUCA 4WBNF 4JIGA 1VYUA 4IU2A 4LGRB 3K5HA 2IPTL 3CU1A 3BGDA 2WU0A 3LF2A 2ZWIA 1KZ7B 1T10A 3LCCA 1VJ5A 1WFTA 1PCSA 5FI1B 2OHJA 2N0MA 4J7UA 1XA3A 1FF9A 2WXOA 3O8QB 1Y3BE 2HB0A 5DZNA 4D9RE 4RRPM 3QX9A 1G18A 5IC5A 3ELWA 5FV1L 2UZIL 4MKMA 3SFTA 1Z7JA 4XWGA 5FA5A 5KNCA 3CUEF 2EXTA 1I8IA 5D2LF 4P2AA 4I5EA 4P81A 3E1ZA 1O95C 4RFEA 3HADA 1U3NA 4I9WE 4A2FA 1NNI1 3QTTA 3SPXA 2ZICA 3QIWC 5IDQA 5CSBA 2CF6A 4FW9A 4DG8A 5JJ5A 4GKVA 3WS6C 1R6DA 1ZD5A 2YQ5A 3ABZA 3IFNL 1PDKB 1X5XA 2NY2C 2ZUYA 3K72A 2ZOSA 4IDNA 1DG3A 4HS9A 4MJJA 1GC1H 5CWSA 3ESDA 5DSCB 1JK9B 5LAXA 5K1NA 5I5EA 3CLEL 2X0DA 1U80A 2ZTLA 1GZDA 5ABDE 3VOAA 1BPLB 1U58B 1ZEAL 3RPBA 4KDTC 3RX7A 3DL2A 1EVYA 1UM9B 1FZMA 4W9JC 3NYRA 3VJ6A 2ROXA 5DSTA 1I1AB 1TJNA 1WEJH 3IUBA 1GUFA 3VFMB 2I76A 1R9GA 2K3TA 4ZARA 4QHKJ 3FNEA 1UDAA 3AQZA 1J1OL 5I1IL 1J8HD 4US2R 1L7TL 3HKCA 3H3JA 1PFWA 2XZCH 4CJXA 4PMEA 3RS7A 2C9RA 1G2OA 2CA4A 1MRCH 1Z45A 5DKFA 1YVLA 4MB1A 1LE9B 4JO4L 1PT7A 5ITZB 3Q7RA 4KTVE 2SICE 2Q5FA 3PEWA 2ZX7A 3OEWA 4YAQA 1GQ2A 3OZSA 1KIFA 3REFA 3TE7A 1OP3K 1YQDA 3VJKA 1EAPB 1MFUA 2ASVA 4KVNH 4AVYA 3Q2VA 3L7NA 4JR9H 4J43A 3D3KA 3E9DA 1HMYA 4EG5A 5GRUH 1D2HA 3NG1A 4L07A 2X6UA 5B3JC 2C03A 1EO7A 4H1LH 2R8EA 4OSEA 3EJWA 4J3UA 5BOSB 3VPCA 4MJ6B 5I16B 1T4MA 1S7SA 1GZUA 4X20B 1U2DC 2VTBB 5IVXB 3TX4A 2WO2B 4FC6A 3KVDD 3NZHL 4K71B 4UEJA 1M72A 4N2MA 3FETA 1CR0A 3T3HA 3DMMB 3NBKA 2ZR7A 4FQ5A 2PVCA 1BREA 4Q6IA 4P2RD 3M0EA 2X1LA 2DWPA 1JYXA 2PBRA 3W2IA 3K6DA 4RH0A 3FSOA 3H6KA 1YBAA 2WXLA 1U8LA 5DZJA 4NCKA 2D0FA 4JBGA 5JCJA 1NKTA 4ZAKB 3B37A 3UGEA 1PTZA 3SE8H 3SX2A 3GT3A 1H6CA 1JEOA 4HD8A 1ULZA 1JHQA 4J0QA 4C4ZA 3IDMB 5F3WB 1E2JA 4A8JC 3SJVD 3RKDC 2XR1A 4KQ2A 4EUKA 1PF3A 3UKOA 1WHTB 3L02A 2GZ3A 4G3YL 3KZCA 5REQB 1E4KA 1JFQH 2HRRA 5JA8B 3AW5A 1W2HA 4KJWC 4AGPA 1RPKA 4KK3A 1U7TA 4CPDA 3D7PA 4MULA 4ND1A 2FPRA 2ISQA 4JT9A 1GS8A 1T22B 2CLEB 1IEBA 2R4UA 1S7QA 4ZOLF 4GECA 4EJ2A 4LB8A 3ABRB 1MVOA 4MP8A 1VGEH 4O4LB 4ODSH 3C12A 4Z4QA 1B2YA 5JMRA 2OY0A 3K2MC 5E24E 4MAMA 3CSDA 3CYFA 4MH0R 2XUHA 3BXFA 3EOAB 2YHIA 3WIBA 3V34A 2IS2A 3VD9A 3EBPA 4Q9QL 4B95C 1T29A 4BE7B 2DQZA 5HRCA 4EQ2A 4HJTA 1RC8A 3S97C 5FA4B 3O6LL 1GNRA 4HCIA 3Q2IA 2XWPA 2X2PA 5B22A 3N41B 1C80A 4NC1E 4WWKD 1TM1E 1UENA 5AVYA 3QSGA 5EXEA 1NU8A 4AD8A 4ZPVB 5LQAA 3FPKA 5KTYA 4GU5A 3ECAA 3EXFA 1Z2OX 1NEZA 1Y18B 1UD5A 3ADCA 3UTQB 1Z8NA 4U1KA 4Y19E 3IIIA 3WIIH 5ITSA 5EMLA 3PTAA 2NYAA 4KMMA 4N2EA 1A5FH 4KRPB 2BEUA 4GVXA 4JKPH 2YJ4A 4PYRA 1YOVA 1P5VA 5D87A 4FFYH 5FD8A 1IUNA 4RD3A 4CG1A 1NUHA 3S2SA 1G41A 3IDOA 3BSWA 2BVPA 1QU3A 4PRAA 3HLYA 4FHCA 4MNQB 4I5FA 1KLUA 1M53A 3LPCA 4C4TA 4P8RA 1C1DB 2WJIA 4HXBL 3CNLA 3FTCA 4URXR 4WBXC 2XUJA 2W6PA 8OHMA 2F43B 5ESXA 1W36B 2W58A 3WTYA 1QKZH 1RZJL 4JRFA 3NTCL 1PYOA 3V0JA 1Y82A 4Z7AA 3K0FB 4HX2A 4L9SA 4O9HH 3UGXA 2P1ZA 4ZHQB 1YEKH 5DQDL 2ZSAA 5C2JB 4W6QA 4K9LA 4PWJA 4N3GA 1IAIL 5CEYB 3TQIA 1WE2A 1OAYH 3QEBZ 3EYSH 1RYDA 3IMBA 2LU4A 1J88A 5TDNB 2G76A 4HPJB 5EJ9A 3SB3A 5B4TA 1A6UL 1XO1A 4GLOA 3P5SA 5C2BL 2PCFB 5FO9A 2P6RA 1EGAA 2PWZA 3L54A 4GAJL 3NRPA 3QH3B 5DBHX 1G20E 3EISA 2WPGA 4H1LA 2ZT7A 1JZIA 5SWQA 4YGYA 3X0DA 3PNLA 3IJEB 4YMTA 4LF7B 4J3SA 2F74B 5CLIA 2IYZA 3OIWA 1MTZA 4D1YA 4LF3B 3IE0A 5ERWA 3O91A 3AAZB 3UGUA 4L0MA 1CDGA 4KZDH 1EK0A 3ZC3A 2ZBPA 1W30A 5GGTH 3SHWA 1HSBB 1FMLA 3CSTA 1WS6A 5TGBB 2HLFC 3FUEA 5JDSA 1EIZA 3NV9A 4CC4C 2DD8L 3L08A 4FGWA 3HUDA 4QQ8A 4ZTZB 1MH5B 2O8NA 1XF3A 2V17L 2PV7A 3T3PF 3A14A 4HPWA 1FFPA 3WEMA 3GJQA 4AJJA 4AGNA 5IK2A 1A9QA 1HTBA 2PMDA 4MB4A 1LE5B 2HK6A 1A8IA 1YAIA 4BEWA 2PWFA 3ULVF 1O1YA 5T3ZE 4NKIL 3WKBA 3A1UA 1YYLL 2VFAA 2ZRNA 5TT0A 4JBLA 5EMHA 3M45A 2D3NA 4D9FA 2ZBRA 1TMCB 3QVWA 4HNVA 2C9XA 1F3DH 3TD6A 5H2BA 5EJMA 3PGXA 3F00A 3UOAB 3VXUB 4HDSB 4B7CA 5FL3A 3F49S 5FXMA 3CNHA 2NY0B 1ZV5A 2ZDGA 1EAQA 1F56A 5C0CE 3GRFA 3WL6A 2EL9A 1ZRMA 3SDSA 3RC2A 1FRFS 1XXFC 1PR1A 4OCXL 1QPKA 2M6SA 3GBMH 2CBTA 3MPCA 1SBYA 2J33A 1H2YA 3A4YA 3AK4A 4K15A 1Z3GL 3UICA 3TMAA 3NJKA 1P4BH 1B3RA 2ETWA 4XCCH 3RWIA 4ZZ1A 1GJIA 3FPYA 3ECQA 3ULSB 3CCHB 1YRAA 3R40A 4WFGD 3KJHA 1S8OA 4KV5E 1GU0A 3PWPB 3K5SA 2D13A 4GO8A 1LO2L 2VHQA 1Y3FE 2CDBA 4MVXA 1G7JA 3R6TA 4DIEA 3O3CA 1JP7A 4RKYA 1NQTA 1Z6GA 3BORA 1J1PL 5AW5B 3QPUA 1BVYF 5JPNB 1DDTA 3PUKA 2VDKB 2C9QA 2ZSBA 2DY0A 4G6FB 4X63A 3VO1A 4OFYA 4HH9A 2F5BL 5D7NA 3WNDA 4DCVA 2FIKA 2OZLB 2Y1OA 3WWCA 4HADA 3M9WA 3DVFA 2GCNA 4YHOL 4AZ8A 4BZYA 1BE6A 3KVPA 4MARA 4KXZI 1EDQA 1LV7A 1FMFA 3RGWS 2ZK7A 1PRYA 4CIAA 3TM4A 2QT6A 4FFYA 1A9VA 2B78A 2VBCA 2PLRA 3RWGB 3X1YA 3JUYA 1V48A 3OLIA 1O5IA 5CA0A 2FBRA 3QEAZ 2WAOA 4AIRA 5EP3A 4RVNA 2DQJL 1EHLL 5ILQA 1V7MH 3IM1A 5M04A 4JU8A 3NBFA 5COBA 1C3XA 3HC0B 2IH8A 2F1IA 3A4NA 3MO1A 4NZPA 2RB5A 1JGIA 4P5RA 3Q3HA 3Q05A 2MIIA 3I3EA 1XD2A 2FPIA 3BIJA 4TQHA 1I8KB 1UM4H 1ZA3B 1UXWA 1IMHC 3LQ4A 4G72B 4CKQA 4IIQA 4E6EA 1LB1B 4IHBA 3HNRA 2V2XA 3U3RA 3GJFK 1MAKA 2G9KA 4DRXB 5F21B 4HMEA 4PY8J 2JJUA 5F1NA 2YFHA 2X1VA 1S3KL 5TK2A 3ZTJG 1YCDA 1WTAA 4AYWA 2ZB4A 1EMTL 2XWEA 4MD0A 3QFJB 3HGQA 4RRPG 2JNWA 4DVJA 4FLRA 4ZQHA 4CCSA 3AY2A 3R09A 2XYPA 2FG6C 4LVUA 5DUPL 3OEYA 4F3FB 4PJ8B 3MQIA 5D7KE 5HQ3A 2KX7A 3T0GA 5KU7A 4OM1L 3G2QA 2BM9A 2RHTA 1XF5A 1R9NA 4O33A 3BTOA 3VFWB 5GGTA 4BB0A 3EIEA 2P30A 2D7QA 3P3RA 5JSYA 1AM4D 1G0NA 4DFHA 1HE8B 4ONEA 1HYBA 3ECSA 1XELA 4WK4B 3K0EA 2BDNH 4QEKA 3VH1A 3O2WL 3G04A 4Y1AE 4XYMA 3TKAA 1XH3A 5AK4A 2AJUL 5DJAA 5HP5A 4GRWB 5CT5A 2VSCA 1LPMA 2X9VA 3I6LD 4C59B 3CVUA 3V2HA 3US9A 4IO1A 1RYYA 3EYOB 2BSCA 4EI0A 3T1QA 3AEKA 1H1TA 3FVQA 4LPXA 3RGBA 1QO3A 2VXUL 4G6KH 1QVVA 2J56A 3NVQA 4WH0A 4OAWA 4F2MB 2DIJA 2CHDA 1HYEA 1W44A 2VP3A 5EUCA 1H22A 2E48A 4QTIH 1LF0A 3AS0A 3M5DA 3WBBA 4WWKC 2PGDA 4C7KA 1LV8A 5D1QA 2HTKD 1A4UA 3FGPA 5EJIA 4WJKB 1LA2A 1R5BA 3DW1X 1MF2L 4XEHA 1X14A 2XVXA 4BBZA 4K9MA 4XSVA 5AYUL 5L88L 4ZKEA 5CJXC 1PG5A 2Q0HA 3IAHA 1B15A 1V3MA 1T6XA 1JHPA 4JUIA 3N2EA 4D3CL 5G5DA 2B25A 5EVJA 4G42A 4H1UA 4OV6F 3O26A 5I6XC 4N49A 3UUFA 3PQYD 2I03A 1HKLH 4FSHA 1M5TA 1D03A 4HK0A 4ICWA 4CMCA 2AJXH 3HZKB 4PZ9A 5DS1A 2AEPL 1S7CA 3SN6A 2VVTA 3IKCA 4DZZA 1AD9B 4X5RA 2ZTUA 2H2FA 1NUFA 4CRWB 3ZKQD 4O08A 3R20A 1G9NH 2O07A 2ET6A 4BGVA 4DR1B 1V47A 3NBXX 5KPDA 5A0FA 1LPSA 3MA9L 2FVNA 1L7XA 2HCBA 3JTEA 1JZEA 3NM6B 3UO1L 1UZMA 3OHXA 1JXGA 4EMUA 1JAEA 3IBTA 3WLBA 4Y2NA 4MQTB 3SDBA 3EJPA 4IMKC 5TE4H 2EG5A 4ODHL 3KQNA 4FBMA 2YPKB 1X0XA 3OJVC 2I7CA 5ARDA 1P18A 1ZH6A 1PW5A 2WJ6A 2JK5A 2VJLA 4MVJI 5CP8A 1CS6A 3OKEA 1W4AA 1XGYL 1K5PA 4KOAA 5CF3A 3RHSA 1JE1A 5ADPH 3ZUNC 5C09B 2HT2D 2VN7A 4PBWD 2X2IA 1I7RB 1WMEA 3ALPA 3LW8A 3DO6A 3LYHA 1UAYA 3EWSA 4YK4C 1NGYA 5KX5B 2P3OA 4GMKA 4C5CA 5J11C 5JR1H 5ECJE 1GGYA 3NPSB 2G0LA 1EK2A 2X1QA 4XCXA 4BK5C 1DZBA 3PDHA 1TJHL 5A9RA 4ZFZB 3AG3B 4U1MB 4ACTA 4C0WA 4EMZA 4MAZA 4JFWA 5JHDE 1O03A 5DSZA 1YUHA 3OKPA 3RV4A 4DTIA 2P6MA 5CG2A 1ICIA 5LNGA 2I3ZA 4Y2UA 4V2CB 2P2CA 4ARCA 2Q86A 2GH1A 3OMNB 4A2MA 4LHSA 4Q9HA 2D0DA 2VJDA 2WJPA 2D7MA 3K9LA 3TJMA 1F4WL 3P4NA 2DULA 4I1OA 5TR9A 1UBJS 2R85A 2IANE 1IC4L 1I6KA 5F2FA 3V4PL 1MY5A 4Z7OB 2GGSA 2ZIAA 1G7HB 2H5LA 2QL5A 1FG9C 1IGFL 3BZ4A 4LQDA 4N9GB 4IQGA 4DSAA 3S2AA 1UZLA 1GZHA 1AZTA 2D8MA 4I4WB 4Y1GA 1EX9A 4HQOA 2BZGA 4DLUA 5EO1B 3MNVB 2OSVA 1EWRA 4BUJA 4XPIA 3OOEA 5JDIA 2AUMA 3ULUE 4I1UA 1CR9L 3RB8A 2BVUA 4TTRA 1QFZA 2HI0A 1PUXA 5LOVA 4J3XA 5HHVH 3F3KA 4GUPA 1DKLA 3MS2A 5C6TH 5F3FA 4A4DA 4M7JL 1R3JA 1AGRA 4EI6A 3OU6A 4E5DA 1E3JA 5EUOF 3ZGYA 1JSYA 2YS7A 2ACEA 1Q6YA 3FFCE 5FUQA 4Z7UE 3HL0A 3HXTA 3U6KA 3F65A 5JUEL 4HI0E 1K4MA 1PFOA 3NAMA 5TMEA 4YV0A 1NVAA 2DFDA 3DO7B 3G5MA 4A2WA 3HEIB 2TYSB 3NVMB 2P4EA 5L4SA 1J5DA 3LS4H 2IZ7A 2P9RA 3VU9B 2FW6A 4EF5A 2IXAA 4RV4A 4X8MA 5DTFB 5EBWB 4R7LA 3DOFA 3KAPA 4QGHA 3D3WA 5BRZB 5F7LB 3KRTA 1ZM4A 5FBKA 7PAZA 1PQ4A 1KGCE 4P5MB 1MCOH 2P8SA 1I7ZA 2CUZA 3MILA 1KMQA 3WSTA 1S2EA 2PX6A 1TU3A 1UUNA 3UY4A 3MRNB 4NM4H 3SE9H 1P7YA 3O94A 3BJRA 1DT3A 1K8YB 3DOIA 1MJFA 5EOCH 3GGOA 2W1NA 4FQLH 1YNLL 1WULS 5KOYA 5DHQA 2C2BA 5IDVA 3GIVB 1ZK2A 3TNMA 1ODAA 3P54A 2PZFA 2QD1A 3RIMA 2ZT8A 2ZYAA 1HOCB 1BAWA 4PICA 2W6OA 3Q9NA 1BMQA 1EZZA 1GRQA 1LPBB 1I8MB 2WYIA 4EQ3A 3O0RH 1N5DA 4L8CA 2H7XA 1LEGB 1Y6ZA 2XJ4A 3GS4A 2IZ6A 5FLYA 2WY3B 2SHKA 2UVFA 3S27A 4LIQL 3SSMA 4Z7QF 4YOKA 1Q1NA 3JQ8A 4EXKA 5E2UL 2QPEB 5BVPH 2DQHL 5DJ6B 1JVBA 3ZJTA 2DUMA 2H92A 1BEZA 2OMZB 4DIKA 1EHXA 4H6XA 5GGRB 3T0DA 3FQRA 3R6GA 2XT9A 5KMGB 2MOVA 2B08A 1IEXA 4GC9A 3RZCB 1S2GA 2CFIA 3BF7A 1W8EA 1FVEA 2A5YB 5C0GB 4NQXA 5C7IO 2LW3A 3PX2A 1HNZB 3RREA 4E0RA 3TO4D 4G43A 1RUML 3F05A 1VG8A 2R4QA 4CHGA 3D0KA 5EIIG 4HD5A 3GA5A 3HUEA 3MCZA 5I76A 3ZQWA 2Z2JA 1LX6A 3A6EA 3MWGA 4PONA 1U9CA 3AP2A 4IJ3B 4L9LB 4ZCLA 1M2NA 1KO1A 2EERA 1A14H 3CBQA 2AKRB 1DJPA 4B9ZA 1EZ4A 4OFWA 4OI0A 4WRRA 5DLEA 4I8DA 1YQQA 4G1VA 1YDWA 1OL0A 5HHTA 3EZ9A 3L18A 4P3NA 1DJMA 1C9MA 3T7TA 1T0UA 3BD7A 2PGNA 3L4EA 1E2BA 1ZT7A 3TQFA 1N2SA 4ZDHA 4CT4B 2L19A 1UTDA 3IQIX 2X22A 4LL9A 2GJ6A 1YKFA 1UD8A 5C0JB 1QRNB 2VDNH 4RVDA 4MDJB 3BBPA 1WZKA 4LVNC 4FQCH 3OG9A 3G6AA 5AH0A 1R46A 3LPMA 4WW0A 5E9NA 3G9AB 2CL5A 2QZJA 5KSUB 5M95B 3KR0A 1FU8A 4HNGA 1K4DA 4CLOA 4MUHA 5IHUH 3ZLUA 3ZI7A 5A6SA 4KMTH 4I36A 3KR3L 4O4JB 5JXIA 2WTXA 4FCCA 1FFYA 2OD7A 2P6OA 3CZSA 3K8KA 4UAJA 4HWOA 1R4NB 2BCJQ 2EKJA 1UXMA 3EDEA 3MJ6A 2B8OT 3OAAD 1PJZA 5C9JA 3ER6A 2O61A 2WM3A 4W9ZA 4ALMA 1NUNB 1YJXA 2Q4OA 3X44A 4H0IA 5LZ2A 3D50A 5DZVA 3QKIA 3CVDA 2ZGVA 1NDTA 2WZ5A 2I4OA 4HBZA 2C4MA 4AQEA 3D9QX 2FTKE 3KT0A 1T3FA 3NFSL 2P5ED 1DN0A 1U8IA 2KMWA 3LOPA 3DECA 3IU3A 3GJ6A 1OFUX 3ZUGA 4FILA 3GGCA 2HTKC 4KDWA 4B31A 1NLDH 1IB0A 4MUEA 1AO7A 5GZ6A 4DCQA 4OIBA 4TGLA 3ZJ4A 1ZHLA 2VSKB 4MW5A 3S34H 5ALPA 3L43A 1QYXA 4I87A 4GS5A 4QF1B 4ZVUA 5EN2A 2QDKA 3SYPA 1LQBC 5BSVA 1W8DA 3QYFA 4L51A 1QSEE 2Z9BA 3I1FA 5BUZA 4EABA 2R27A 1CRWG 2YJZA 1AZRA 3FMGL 2RAVA 3DVNB 1CUAA 5AW3B 1X8XA 4E51A 1EX0A 4H0HB 5IB3B 5U9CA 3APFA 1JWBB 3ETBF 1KY2A 4FYMA 4NHCH 1V6AA 5IVOA 2BVEA 5CKAA 2D2CC 1IZ7A 3GRZA 3PWVB 4HFRA 4W9RA 2JD2A 5ALRA 4WDQA 5IN5A 1DELA 1R0YA 4CFYA 1XVSA 2DQGL 4MGKR 2G36A 2CUAA 2WKOF 3PC2A 3DLBA 3ARGA 1D5ZB 2ZKLA 1E0AA 2QDVA 3ZWWA 4WI9A 3GMTA 3PXJA 3Q3VA 2X0KA 1G2IA 4I3SL 5JORA 3SYNA 1S78C 4HH4A 4HPHA 4J3OD 3IJYB 2VDWA 2TSYB 5JAOA 3A24A 4QRPE 3RM3A 1P3DA 3W4IA 3CG8A 3C16C 3VV3A 3K81A 4CG0A 2HT2C 5HYSG 2FSFA 4AY2A 4JRYA 1I24A 5JIBA 4Y9TA 1XAIA 4N2KA 5AT1A 1HINH 3K4QA 1KCUH 1PAMA 4MOWA 2FECL 4KY2A 1A7OH 1DWOA 1VSBA 4KQ6A 3L3GB 2JI2A 1SUBA 2JTDA 4R3SB 2C1PB 3NHUA 3HPLA 5ICZA 2PO6D 1B0UA 2W95A 5I1EL 3FKSD 3VDBA 3EGSB 2F9FA 2Y6UA 4PIPA 3CRMA 1VJGA 3EO1A 4UHKA 4YGVA 2A6KA 3O6FB 2XV0A 2IPXA 4QNRA 4QHTA 1XJ0A 5H8WA 3G5WA 2X3UA 2IKSA 1ONOA 4E2WA 4JCLA 3U7RA 5E6RB 3KKOA 2FPSA 2Z43A 1DBKL 1UWYA 3WV0A 4AQAA 4X6UA 1IGCL 3RGVB 1UADC 4CMGA 3VG9C 5JW4R 1D4FA 1Z0FA 2QAGA 2M2IA 4RFLA 5AW0A 4MBRA 3ZCRA 1P81A 4MA3B 3MLPA 1CUCA 4DKFL 2CDFA 4MV9A 1OK0A 4LHUB 4NFLA 1UKTA 3FY4A 2VDPB 2JH3A 5C3LD 1KF9B 2QMUA 1NBVH 1T0NA 1OXTA 4HC1H 4F58H 2DBYA 1QTQA 1R00A 1DJZA 5TE9A 2QR2A 2F62A 3F0TA 1MFMA 4DMMA 4HP8A 1GTJ1 2GMWA 4QC2A 4FFMA 4KI7A 3IHKA 4PM4A 5AWNH 1TM5E 3OJDB 3RNKA 1D5IH 2VR9A 4YLGA 1OWWA 3HXMA 1DWPA 3D4YA 3HVHA 2OSXA 2VR7A 2HVJB 3CDGA 2EZ8A 2VKTA 2R15A 2HNAA 2EE3A 4JL8A 3CFBB 4AZTA 2Z5FA 1Z3IX 4NN5C 5D70H 2H6EA 3BH8A 4HQLA 3C09C 5GZND 3P02A 1E63A 1F38A 2RBKA 4QRQB 5F73A 3AEUB 5B38A 5FQOA 4BCCA 3LHDA 1KBBA 3GLIA 3ROZA 4WA7A 5HA5A 1QP0A 1GTSA 4FEAA 4R7ZA 3T5CA 2VCHA 2VRCA 4CGUB 1VGKA 5CEZD 3ZEIA 4RU1A 5E4TA 4HFJA 2VK8A 3OLQA 2FHBA 3Q8EA 3EZFA 2A9QA 1JAIA 3M5CA 3MF4A 1G6HA 4MW7A 5KSPA 1SEQL 3SZOA 2BFVL 1SOVA 4H0FA 4PN7A 3LYAA 3FF1A 3NXKA 2JB5H 3KQLA 2PWDA 5BV0A 3TUJC 4Q4LA 2IQ9L 2BVQB 5HVFB 4AEHH 3ASNB 4NYJQ 1E9BA 3KQVA 1DXQA 2GNPA 4XB3A 5C0BD 3U3KA 5DM1A 3EGVA 2OMYB 4ITVA 4PJ7E 5EZYB 3DFZA 2Q62A 3AR4A 3ZK9A 2E27H 4IW4C 4NQRA 4PG2C 4P9HC 3G6JB 2GAOA 1ACMA 1NGZA 3QW4B 1PFKA 3S2UA 2XNAA 2QUBA 5DDHA 4UUQA 4F2HA 2ICES 4NUGH 3QORB 3N86A 1YDMA 3FU0A 4BFOA 1K72A 4EI5B 3H3PL 4EZIA 2X8LA 1WWAX 2BOCB 4JHLA 5LP6F 5J5AA 3GMOA 3WWDA 4XMXA 5DMIL 5FYQA 3GNML 4EZMA 3QIBB 2J48A 4EHKA 1OIWA 3MV7E 1FYTE 1KK2A 1R5IB 5FYKL 2GITB 3GGWB 3NIGE 3IS3A 5FAAA 3BZUA 3D81A 5EH1A 5HKAA 1TPZA 4H0CA 2RFXB 4IEFB 3SKOA 2AOWA 1JDTA 2A6JA 3UGTA 3TO4C 5BSUA 1CLZH 2GK6A 3QG1A 5EU5B 1B0PA 1PU0A 3R0MA 2JI3A 4M0EA 5CVVA 1B0AA 3LM8A 3M4JA 1N6VA 1ZXQA 2PCJA 2XWZA 5LQBH 4LNUB 1NUQA 4R7TA 2CSPA 1DC6A 1YRHA 5D6NA 2O7RA 1TTRA 2FKAA 3V5HA 1W76A 4P2CG 3JQGB 1CE6A 2C7UA 1AGXA 2IJ0C 3TLAA 1TQDA 4HBQA 1XH2A 5EQTA 1OASA 3C7AA 1RNLA 2L82A 4Z3EA 1SKBA 1M0SA 4ZQIA 3V4LA 2ERYA 4IDBA 2J9FB 1A66A 3CX2A 4HFUH 1USUA 4HB4A 5K93A 1HWYA 4X9YA 1MA3A 1XMXA 4E41D 4W9EC 1JF1A 4TV8F 2PXYD 3W9DB 1KI8A 1T0HB 2HWKA 5H7XA 4N86A 5J3HD 1E2PA 3FVWA 2P0YA 3RWEA 4HQKA 2QSUA 3DOUA 4BVLA 2D1TA 1CQYA 3SE0A 3BG5A 2ZWAA 3CN0A 3H11B 4ZC8A 1PKQB 1KN4L 2A77L 4PJIF 3FQWB 1N7IA 4AP9A 3UEZA 2E6KA 2Q3ZA 3R8XA 3L3HA 2VAJA 1KBGH 4FZEL 1UWFA 4R0VA 3CVHH 3ATAA 4C1NA 1JIUA 1BFSA 1Q1BA 4FQ2H 1XRPA 3WI9A 2DM7A 2W2VA 3ZJVA 1UBCA 2OENG 1W4LA 4CIDA 3H0CA 2UKDA 1KSRA 2GEVA 4FFVA 4LEIA 4YE4H 4HC1A 4NX2A 3O8RA 4L5CA 1KBVA 3AL8A 2MCPL 1SG0A 5ALWA 1X9GA 4E2ZA 3IQEA 4PGEA 1TU0A 1V43A 4PRIB 4KO4S 4K07A 1QS0A 2ZWZA 3OT1B 5L9AA 5JVDB 5GJSL 2Y06H 2WMOB 2DQ6A 3SF8B 2QKIB 3K1TA 3AY4A 1JWMB 4YA6A 1NVEA 1X5JA 4NCC2 3DUFB 4DBLC 5BZWA 1POWA 2A4CA 5L9DL 3ARTA 2I27N 5EWMB 2C5SA 3LEXB 3DRQA 3BXEA 3NW9A 1NN1A 2FWPA 1ZBQA 3NJFA 2EDFA 2WNGA 1QLEL 2B1AH 4AG4H 1BWPA 1IY2A 2HQRA 2W91A 4P9MH 2X8BA 5CVCA 2F5AH 4RCVA 1WWWX 5D6CA 2UV8A 4II3A 5DPMA 4ZCSA 4ASUD 3JTSB 4WV1B 4YYZA 3T9EA 4Z7JA 4APQB 3KQHA 3PNMA 4RTRA 3H1EA 4AW9A 2I8LA 3KL4A 3IXAA 3IODA 1KMIY 2X23A 2QTTA 3CQ9A 5DHFA 3CV3A 4Y5VA 4DCUA 1XSIA 1SYSB 3BAEH 1XR8B 1A4CA 3GMPA 4XXWA 2BMVA 4RQBA 3S70A 1BQHA 1V45E 4WOBA 5FBZA 4JFDD 4MSWA 3K94A 3OM0A 1MAVA 1U8JB 4XVTH 1EVKA 1T9BA 4NUMA 4DM7A 4DYVA 2EDEA 1T1JA 3QXXA 3S98A 4UYQA 4JZOA 3TLYA 4EH1A 4J3OC 1L1QA 2WLSA 3GUFA 1NUUA 3P0RA 1DQTA 2J2ZA 2VMJA 2V96A 4DLRA 2GUYA 2PWHA 5FA3B 4UQ2B 4QGTA 3JTMA 1ZIXA 4FNGA 2XZLA 3D25A 2QVZX 4DPAX 2Q41A 4Z4GA 4LHQB 3ONVA 4H13C 3EW3B 3LY7A 5EKDA 1CY2A 4JO1H 1FNSL 3S5UA 1XEAA 3ERXA 4HIQA 4F46A 2A0UA 3PRHA 1ZNYA 4YUEL 1OF2A 3N70A 5C2UB 3BMNA 5F2OA 2NZ9C 3MGTA 5BVHB 1TVKA 3EASA 2RAFA 1Q3HA 3DBLB 5HYEA 4YROA 4U4IA 2YD4A 3K9HA 5KS9F 2GRUA 1T7WA 5LO7A 4YXHH 2PO6C 4S2SA 3ETSA 5FBQB 4PMFA 2EYQA 3CZRA 5GAJA 5IKMA 4WASA 5TH2A 2F0CA 1GY1A 1P9RA 5BYAA 2K7QA 2VL5A 4FHJA 2X0NA 1INDH 5B1DA 4LSVH 5EU3B 5KYUA 1E69A 4H4EA 3L3KA 1EX1A 3FQ4A 5GQBA 2C9CA 2WHPA 5IABA 4TWBA 2VYFA 4OD3L 4PJEF 5B7PA 4GX5A 3CN9A 4D9IA 1KLGA 1CE8B 4TMXA 3P69A 1JDBB 1VZHA 1X7QB 3SE3A 4RA6A 4B4DA 4HWNA 1MO5A 1WBXA 5FBLB 5B1JC 5I0WA 3ZHOA 5KBPA 2GD0A 3MMEB 5AM5A 4G1MB 4EEEA 1DC8A 2BFCA 2TMYA 3JQBC 4P08A 3TA3C 2QTWB 4EVNB 4KI5E 4GKJB 2OK0H 5FECB 1HN1A 1BJKA 5DHAA 3FNFA 4CMBA 1CFVH 4HCRL 4MVJF 1L9KA 1O6ZA 3Q6FA 1E4EA 3PL1A 3FPHA 4OF3A 4PJ5B 1D2PA 5B5SA 2YYSA 4F3KA 1QLWA 3MRTA 5K39B 2KLBA 4YQXH 2J8OA 4R4BA 5CGMA 2WWRA 1YI1A 3GT6A 1RYBA 4P0QB 3L3OC 5JWHA 1M42A 4CDNA 2F3SA 3TNLA 1U0GA 2X4NA 3RP1A 1IXSB 2RQ8A 3CVHA 5F7DB 2JG3A 5FYJU 3VHXB 4QYMA 4WBNB 3PVCA 1ETJA 3L7KA 2YEZA 5GZNC 3G0DA 5KNDD 1J5XA 3VI3F 4KQHA 2R7AA 2XY1A 3WFDH 3D85B 1JQ5A 2YVQA 1LNUA 1Q7RA 3ANYB 3L7BA 4DM4A 3LBNA 3HA3A 2O19A 5JH7B 2WY2D 3PPVA 4HEA6 1KZ6A 2XSZA 1BOOA 2GSGB 4P34A 4CV1A 1AR1D 2SODB 2C9OA 5B6IA 3N7TA 2P75A 3DX3A 1OYVA 4B3MB 4GSQA 1E1MA 5F1IB 1XB3A 1IXYA 1EK1A 4LDJA 5D2LB 1BJRE 2ZIWB 3UTTE 4IUDS 4XP9L 1XTRA 3UA3A 4F04A 1EK6A 4K9DA 3RVJA 1PY9A 1Z5ZA 3I0ZA 1ITCA 3L5OA 1K0UA 1E9PB 3DMYA 1CFNB 1NWOA 3U7AA 1DFBH 3VQMA 4MUYA 1DE4A 1I1RA 5JIQA 3MWDA 2WF6A 3DXAA 2VSNA 5DGDA 1PF7E 3PDWA 1YRBA 4Z7VE 2QN7A 2DBRA 5D4QA 4XE5B 4L4VA 3HB4X 4MUFA 1I9CA 3NCTA 5G0TA 2OZKA 1F1BA 2WJHA 4KKRA 4B97A 5J1AA 2GEBA 2EIDA 2QL7A 2Z8RA 4PYHA 5IEKA 1L8AA 4HHAA 4YP0A 3ZWVA 3TDMA 1DVZA 1N64H 2EEBA 1MSPA 5FUCE 5E9DA 1GDDA 3C08L 4DKEH 5EWLA 5DRXA 3H4MA 3P4MA 1WMDA 4FFZH 3CX3A 4YRZA 2WTPA 3IDUA 3RHZA 2LVCA 2XCQA 1KO4A 1TTUA 4Q4CA 1RY7B 1YYMH 1QH1B 2C4XA 2EIZA 2H0RA 4DIFA 1JLKA 4JJOA 4DV5B 5GP1A 1VKHA 1Z4KA 2OA9A 1DJQA 3I1YA 2BCKB 3LP5A 4R3WA 1JVOA 3MV8D 2E87A 4PGCB 1AGPA 3EQ7A 3W9SA 1WV7T 2V7PA 5HD8D 2GHZA 2I9KA 1SQ6A 1JR3A 2WUCL 4K8OA 4MINA 5IJ9B 2H1VA 1F7UA 3L7JA 4ACBA 2Q6OA 2YASA 2Z9DA 1V4VA 1QC5B 2Y1GA 4BC0A 4NMHA 2GI4A 2ATIA 2L0DA 2PCPB 1I2BA 5HYQB 4AN1A 3H8SA 4WZBA 1E0KA 2HA6A 4IMPA 5F33A 4IHJF 3X12A 4F5WA 5B8CA 2R29H 3EEBA 4ZX4A 1QQTA 5J3HC 4ZZ3A 3BVNB 4RJ2A 1Q0XH 3LRMA 4UPDA 4N0YL 4FNRA 1W4RA 1OT4A 5CITA 4YALA 5LZ4A 3MLZL 1Q9LB 3LCYA 3BSZH 4FMBB 2CIIA 5KZCB 2RJNA 3EULA 4ARIA 3IDIB 2EDDA 3OF6A 4X4ZA 5EMYA 3QCUL 3SYQA 3CRQA 3CDZA 3FH8A 3IRCA 4LPCA 1MKYA 1J9GA 1QFSA 4ZGBA 1T20A 2JC3A 5I8EA 2JJTA 4CL3A 4B6EA 1KVRA 1NLUA 1CLCA 1X7ZA 2C4FU 3M6IA 1A7NL 2D9CA 4DP1X 4HRAA 3C6SA 3S4YA 2Q1TA 4K6MA 1K8XB 1DVXA 4KDCA 4H7KA 1BMTA 1W0WA 4U2BA 4A26A 2X4PA 1UC9A 4ETIA 1S02A 4KI0A 5BVGB 4DFDA 1RVFL 5J9PB 4KPGA 4RMHA 5BORA 4UNUA 3G1WA 4ZOLB 4KDVA 4WDRA 4M1DL 3KR1A 5E1GA 3GUCA 3VX0A 4E5PA 1YMUA 5KNBD 3VR3A 3LVRE 4ZT2A 5FV2A 3E3AA 2AQTA 2NNWB 1ZIBA 2BWJA 5G4KA 2ROQA 5EAIA 5DXWA 3NKFA 4BHUI 4OT1H 1EEZA 2RB8A 4DR5B 4NV1A 1E3QA 2CO3A 4GE0A 3F3HA 4JEMA 3UAVA 5DNEA 1E5BA 3TZVB 1T4CB 3C3MA 4C0LA 3MJWA 1UBRS 3KJIA 5G3ZA 2EDYA 3V5DA 1T2NA 1C7ZA 4MHSA 2D2XA 5IF9A 2ZI4A 3RE0A 2J6HA 3BD3A 5KWSA 4GQAA 3HDTA 1OHHA 2VTEA 5CA1F 3F90A 3TTVA 4AW4A 4A7GA 5IARA 3RY4A 1KMHA 5DI9A 3P0GB 5K6AC 1O9GA 1PQWA 3WDMA 1Y34E 2FSEA 3BH9A 4NEHB 3LQYA 5FW7A 4JFQB 5C37A 1AHWC 2W9EH 5MEQA 1IPEA 4JBYA 3BUSA 4IF6A 3MRLB 2E6PA 3MUGA 1TQHA 3R7WA 4FL4C 1M05B 1K27A 1DUYA 4PO1A 4ZVKA 1CGSH 1PQUA 1TKCA 2D7OA 5CDGA 1GRWA 1XA4A 4DA8A 3B2EA