3FDBA

Crystal structure of a putative plp-dependent beta-cystathionase (aecd, dip1736) from corynebacterium diphtheriae at 1.99 a resolution
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
377
structure length
376
Chain Sequence
GMQFPSIEDLRARNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDGSLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVSDTAASVCITITAPSAWNIAGLKCAQIIFSNPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPGAKITPMQATYLMWIDFRDTTIEGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative PLP-dependent beta-cystathionase (NP_940074.1) from CORYNEBACTERIUM DIPHTHERIAE at 1.99 A resolution
rcsb
source organism Corynebacterium diphtheriae
molecule tags Transferase
molecule keywords putative PLP-dependent beta-cystathionase
total genus 128
structure length 376
sequence length 377
ec nomenclature ec 3.-.-.-:
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3fdbA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3fdbA01
2Z9XA 3AENB 1B5PA 3BCBA 3KKIA 3PAAA 2W7FA 3GBXA 1D7SA 4LNLA 4Q76A 5FT6A 3MAUA 4ZDOA 4KXKA 1TOKA 1C9CA 2GMSA 4WB0A 1AMQA 1AKCA 1SZSA 3MBBA 3ASAA 2BHXA 2OKKA 3FFHA 2JG2A 1OXOA 2VI9A 4W8IA 4JF0A 5FT8A 3G7QA 3NU7A 5HDMA 1AHXA 4K2IA 1M0PA 1GC0A 2C81A 2WK8A 1ASFA 1H1CA 3DR4A 1YJSA 3FD0A 3TATA 2BI1A 3FQ8A 3MADA 5G0AA 4H51A 2VIBA 3FVSA 2VMZA 4TMRA 3BC8A 1H0CA 1MDZA 2VGUA 2YKVA 3QGUA 4ZWVA 4WLJA 2VYCA 3BWOA 3F0HA 5JAYA 1KKJA 1S0AA 3FKDA 1VEFA 3N0LA 4A0GA 2FM1A 4CBSA 1V2DA 5AX8A 1WYTA 2WK7A 3B46A 3E6GA 1TOJA 4ITXA 4JE5A 3RCHB 3FQAA 3ZRRA 4IX8A 4LNJA 1DTYA 2VGTA 1ASCA 2DOUA 1TOGA 3VK4A 4BHDA 2FNIA 5C6UA 3LVLB 4IY7A 1MAQA 4M2MA 4E77A 2W7HA 3HVYA 1G4VA 2ZUKA 2ZSLA 4IXSA 4MSOA 3FZ8A 1DJ9A 1M6SA 3PDBA 4ITGA 2ZY3A 1X28A 2JJFA 2E7JA 1FC4A 1GBNA 3VOMA 4F5KA 2D64A 3F6TA 3HQTA 4F5LA 4M2JA 1SZKA 5M4DA 4PFNA 2HUIA 4RKDA 1J32A 4Q31A 2JJGA 4WBTA 4A0FA 2AY3A 3H7FA 3G0TA 1BW0A 3KGXA 1LC8A 2BWOA 4ATPA 1I41A 1WYVA 3NYSA 1KL2A 2Z9WA 2W7LA 2JJHA 4CXRA 2X3LA 3R4TA 1ARHA 2X8UA 3AELA 1CL1A 3E2YA 2W8VA 3JTXA 3NUIA 1S08A 3B1EA 1AMSA 5D5SA 4WXGA 4EMYA 2PO3A 2QBTA 3AEMA 2V1PA 4J8LA 3WX9A 2Q7WA 3EIBA 2BI5A 1ASNA 1UU1A 3EZ1A 3VK3A 2JGTA 2AATA 5E4ZA 5EAVA 3A9ZA 3PJ0A 2VMWA 3W1HA 5G09A 2YOBA 3QHXA 4W5KA 4Y0HA 3DRDA 1W7NA 3AENA 3L44A 1GDEA 2HZPA 1ELUA 4ZDLA 1B4XA 4WXFA 3EI9A 1TASA 1B8GA 1AJSA 4JF1A 4F5MA 3RBFA 2VGVA 2R5EA 3KGWA 2PB0A 4LC3A 1JS3A 4A6TA 1LW4A 4CVQA 3WCOA 3PPLA 3WKSA 2W8TA 2E7UA 2WK9A 3D6KA 3BN1A 2O0RA 1ZODA 2VGSA 3TCMA 1QJ5A 3NUBA 1YIZA 4ZLVA 4FL0A 4ZSWA 1GEYA 5IWQA 2XBNA 5G4IA 3LVMA 1TOIA 1C7NA 4A72A 4E3QA 3DXVA 5EUEA 2OGEA 3DR7A 1ARIA 3G8MA 3JWBA 3K40A 4UOYA 3PDXA 4DGTA 1RV3A 3LVJA 3B1DA 1B9IA 3I5TA 3IF2A 1O61A 1Z3ZA 5G2QA 1SF2A 2D5YA 2ORDA 4A00A 5EIGA 2OGAA 4BA4A 3AEMC 3ATHA 3E2FA 5I92A 1AX4A 2BIEA 5DB5A 1YJZA 1OHWA 1BJWA 5EFSA 4JEVA 1GC4A 1S09A 2W7DA 1CQ6A 1V2EA 4B98A 4PIWA 2C7TA 3WCNA 2D7YA 3DYDA 2X5DA 4MKJA 2F8JA 4IYOA 1D7RA 1IAYA 2BI3A 1MLZA 3B1CA 2QLRA 1ASAA 1UKJA 3AEPA 3OKSA 4XK1A 1X2AA 4A6UA 1E5FA 3FZ7A 3CAIA 3B8XA 3WY7A 1M7YA 1BJOB 1WYUB 1GC2A 1DKAA 2VMQA 1QIRA 2DKBA 2HP2A 2VLHA 3FFRA 1G4XA 1RV4A 2V0YA 2VLFA 3ISLA 5TF5A 4F5HA 2W8WA 1AHGA 4DQ6A 4RJYA 4JEWA 3MKJA 1CJ0A 2GQNA 4F5IA 3WKRA 4DBCA 4IW7A 3QN6A 3GETA 1TARA 4LW4A 1CS1A 1AIBA 3IHJA 3ACZA 3CBFA 1LS3A 1DJUA 1X0MA 4ZM3A 2Z9VA 3PGYA 3ZRQA 3DC1A 4XQ2A 1W7LA 2W7KA 4CBRA 4AH3A 4CXQA 1AHYA 4GE9A 1UU2A 1CZCA 5K8BA 3BS8A 1N8PA 2AEVA 4WYEA 4WLHA 4Q6RA 2BKWA 2VMNA 4IXOA 1RVUA 2Z67A 3I16A 3UWCA 5F9SA 4WYDA 3GWPA 4GDYA 4OYTA 3EI5A 4WXBA 4U1TA 4WYFA 3EI8A 4ADBA 1M32A 2AY5A 3JW9A 5EUNA 3MC6C 4AO4A 2FNUA 1AJSB 3E2ZB 3DODA 5J8QA 2YRRA 4A0RA 4E3RA 2ZYJA 1ARTA 3QPGA 3BCXA 1DFOA 3N75A 2BYJA 2CY8A 5EUDA 1ARSA 1IUGA 4W1XA 1AY4A 5BJ3A 4RLGA 3H14A 1LK9A 1W23A 3NTJA 1C0NA 3AV7A 3UE8A 5EQCA 1WKHA 1C7GA 1E5EA 1ASLA 1ORDA 1QGNA 1SFFA 3NRAA 3WZFA 2HUUA 3E9KA 3NNKA 2OQXA 5M46A 3BWNA 2ZY4A 2GSAA 4N0WA 3HMUA 3E77A 1TPLA 2VMVA 1YOOA 4ZSYA 4AZKA 1EQBA 2CSTA 1MDXA 3AEJC 4BQ0A 4WD2A 1SVVA 2E54A 1BJNA 3A9YA 2W7GA 2FN6A 1IAXA 1ASMA 1IX6A 5E5IA 4OBVA 3NDNA 3FDBA 2YCPA 1I48A 2BYLA 2EGYA 3DXWA 4R2NA 4ISYA 4UHMA 4F5FA 2W7IA 5E3KA 1AHFA 3AATA 4EB5A 4UHNA 2QMAA 2YKUA 3AEOA 3RBLA 1OHVA 2W7EA 1W7MA 2VI8A 4Q75A 2RFVA 1AMAA 3ZZJA 3MEBA 3VP6A 3ELPA 1UU0A 3QM2A 2AY4A 4IYOB 2Z20A 2FQ6A 3LY1A 5LHAA 1PMOA 1AHEA 2W8UA 2YCTA 1RVYA 2C0RA 3N5MA 1CL2A 2G6WA 3TFTA 1ZC9A 4OCAA 1MGVA 3RQ1A 3JZLA 1ARGA 2HP1A 2R5CA 3HDOA 5FT4A 9AATA 2QB2A 4J5UA 1LC7A 1D7UA 1AKAA 3GZCA 5DX5A 4E1OA 3PD6A 1IJIA 1DJEA 1M4NA 2QB3A 2EH6A 3UAKA 4ZAHA 3LG0A 1V72A 4WYCA 1BQAA 3VK2A 1Z7DA 1ZOBA 1G7XA 3RUYA 3AOWA 3HL2A 4OBUA 4XEWA 1LKCA 1N2TA 1QJ3A 5DJ1A 3VAXA 4MQRA 3FCRA 1AICA 1KL1A 2AY2A 1C7OA 3AEJA 5EAAA 1GCKA 1BS0A 1FG3A 1YNUA 1IX7A 4EFFA 1GD9A 3K7YA 1LW5A 4GRXA 5D95A 3L8AA 1B5OA 2D63A 2ZY5A 1AAWA 2BIGA 2EPJA 2W8JA 2CJDA 4LW2A 4EB7A 1VP4A 4OTLA 1JG8A 1O4SA 4OMAA 3JU7A 1OATA 2VMXA 4AZJA 3MAFA 1M0OA 3GJUA 1IX8A 2Z9UA 4AO9A 2BWNA 2AY7A 3LV2A 1YAAA 2CTZA 2VMYA 3DZZA 4JE5D 4TN4A 2VMSA 3RI6A 4F5GA 1XI9A 2DGLA 4TV7A 5G2PA 1D7VA 3KE3A 5HXXA 4XAUA 1O69A 1OHYA 2YKYA 2TPLA 3ASBA 3M5UA 3W1IA 3PIUA 4F4EA 2JJEA 1BQDA 1QITA 2D66A 3Q8NA 4PVFA 2DR1A 3DU4A 4XJLA 2AY9A 4XJPA 2W7MA 3R9AA 4ADDA 2CJHA 3NU8A 2NMPA 4ADCA 1AMRA 4MQPA 2W7JA 3CQ6A 3GZDC 3WLXA 4GSAA 5DJ9A 3WGBA 2BIAA 4B9BA 4WYGA 3EI6A 3GZDA 3P1TA 1J04A 3FVUA 2HORA 2CANA 4RIZA 2YCNA 3GSBA 1PG8A 1TATA 1P3WA 3EZSA 1AIAA 1ASDA 2D61A 3COGA 4N0BA 4MY5A 2VMUA 1IVRA 4ATQA 3CQ4A 3GR9A 2EO5A 3EI7A 1QISA 1S06A 1ASEA 3I4JA 3MC6A 1YJYA 1WKGA 4ZWMA 4AOAA 3F9TA 2AY6A 2CH2A 3HBXA 4F5JA 2CINA 1BJ4A 2X5FA 1GC3A 1SPAA 4A0HA 1ELQA 1WYVB 1VJOA 3FSLA 4L0OA 3BV0A 4O6ZA 4R5FA 4R8DA 2D7ZA 2YRIA 4HF8A 2C44A 2VMRA 1GEXA 4BA5A 1KMJA 2E7IA 1PFFA 1PMMA 1N31A 3BB8A 1TOEA 4ADEA 4LNMA 4WB0B 2AEUA 3ZZKA 2VIAA 1AY8A 3BWNC 4PFFA 5LH9A 4U2HA 1U08A 1T3IA 3II0A 4W1VA 2Z1ZA 2Z61A 2Z1YA 1AAMA 1QZ9A 1ASGA 2R5CB 1YIYA 3MAFB 3NYTA 3NYUA 3P6KA 2HUFA 1CQ7A 2EZ1A 2OKJA 3USFA 2DGKA 1W3UA 1M0QA 2QA3A 4ZM4A 1AJRA 2CH1A 3FVXA 3JWAA 4MKKA 8AATA 2PB2A 1X29A 1I29A 2R2NA 3PD6B 3FRKA 4A6RA 3TFUA 3ECDA 1V2FA 1BT4A 4K2BA 5G4JA 2BI9A 3LWSA 2ZC0A 3E2ZA 1MDOA 5FT5A 2BI2A 1AY5A 2ZSMA 4ZASA 3ZRPA 4RM1A 5F8VA 4KYOA 3A9XA 1EJIA 3RCHA 3FQ7A 4JEYA 4R5ZA 2AY1A 2VMPA 2GB3A 5HHYA 5M4BA 1O62A 1WSTA 4Y0DA 2JISA 1DGEA 4RKCA 1MLYA 2ZY2A 1EG5A 4OC9A 1KMKA 2WKAA 3LVKA 1SZUA 2BWPA 2VGZA 4BMKA 1DGDA 4MQQA 4XJOA 4RITA 1GEWA 2O1BA 3AOVA 1I43A 3FZ6A 3PDBB 3ELEA 2R0TA 2HOXA 4K2MA 5EIGB 4ZDPA 1JS6A 3HLMA 4RJ0A 1IBJA 3WGCA 1CZEA 3CQ5A 1BKGA 4UHOA 4HVKA 3PA9A 4NOGA 1KKPA 5M49A 3BCAA 3K28A 2FYFA 2VGWA 7AATA 2GMUA 3EIAA 2YHKA 2AY8A 4WP0A 3FDDA 3TQXA 2EZ2A 2YKXA 2HOZA 4UQVA 1JF9A 4WYAA 2VMOA 1WYTB 1OXPA 2D65A 4JEXA 1ECXA 4JEZA 2O7CA 4KAMA 1AKBA 4EU1A 4IXZA 1M0NA 3FTBA 3HT4A 3OP7A 2HOYA 1B9HA 4QGRA 1BJOA 1WYUA 1CQ8A 4XJMA 1D2FA 2VMTA 3A2BA 4MGRA 4Y0IA 2DKJA 2CFBA 1LC5A 2DGMA 1G7WA 2XH1A 2CB1A 4P7YA 1ASBA 2ZJGA 3QI6A 1XEYA 4I8AA 3A8UX 2CJGA 4W1WA 3QBOA 3T32A 4P3MA 3W1JA 1MAPA 4OT8A 1Y4IA 2ZP7A 1FG7A 2OATA 3EUCA 5BJ4A 1C4KA 4W91A 4GE7A 4M2KA 3NX3A 4RAEA 4FFCA 4GEBA 1S07A 4GE4A
chains in the Genus database with same CATH superfamily
2Z9XA 3AENB 1B5PA 3BCBA 3KKIA 3PAAA 2W7FA 3GBXA 1D7SA 4LNLA 4Q76A 5FT6A 3MAUA 4ZDOA 4KXKA 4H63Q 1TOKA 1C9CA 2GMSA 4WB0A 1AMQA 1AKCA 1SZSA 3MBBA 3ASAA 2BHXA 1KAFA 2OKKA 3FFHA 2JG2A 1OXOA 2VI9A 4W8IA 4JF0A 5FT8A 3G7QA 3NU7A 5HDMA 1AHXA 4K2IA 1M0PA 1GC0A 2C81A 2WK8A 1ASFA 1H1CA 3DR4A 1YJSA 3FD0A 3TATA 2BI1A 3FQ8A 3MADA 5G0AA 4H51A 2VIBA 3FVSA 2VMZA 4TMRA 3BC8A 1H0CA 1MDZA 2VGUA 2YKVA 3QGUA 4ZWVA 4WLJA 2VYCA 3BWOA 3F0HA 5JAYA 1KKJA 1S0AA 3FKDA 1VEFA 3N0LA 4A0GA 2KFPA 2FM1A 4CBSA 1V2DA 5AX8A 1WYTA 2WK7A 3B46A 3E6GA 1TOJA 4ITXA 4JE5A 3RCHB 3FQAA 3ZRRA 4IX8A 4LNJA 1DTYA 2VGTA 1ASCA 2DOUA 1TOGA 3VK4A 4BHDA 2FNIA 5C6UA 3LVLB 4IY7A 1MAQA 4M2MA 4E77A 2W7HA 3HVYA 1G4VA 2ZUKA 2ZSLA 4IXSA 4MSOA 3FZ8A 1DJ9A 1M6SA 3PDBA 4ITGA 2ZY3A 1X28A 2JJFA 5KTBA 2E7JA 1FC4A 1GBNA 3VOMA 4F5KA 2D64A 3F6TA 3HQTA 4F5LA 4M2JA 1SZKA 5M4DA 4PFNA 2HUIA 4RKDA 1J32A 4Q31A 2JJGA 4WBTA 4A0FA 3H9XA 2AY3A 3H7FA 3G0TA 1BW0A 3KGXA 1LC8A 2BWOA 4ATPA 1I41A 1WYVA 3NYSA 1KL2A 2Z9WA 2W7LA 2JJHA 4CXRA 2X3LA 3R4TA 1ARHA 2X8UA 3AELA 1CL1A 3E2YA 2W8VA 3JTXA 3N7NA 3NUIA 1S08A 2QSRA 3B1EA 1AMSA 5D5SA 4WXGA 4EMYA 2PO3A 2QBTA 3AEMA 2V1PA 4J8LA 3WX9A 2Q7WA 3EIBA 2BI5A 1ASNA 1UU1A 3EZ1A 3VK3A 2JGTA 2AATA 5E4ZA 5EAVA 3A9ZA 3PJ0A 2VMWA 3W1HA 5G09A 2YOBA 3QHXA 4W5KA 4Y0HA 3DRDA 1W7NA 3AENA 3L44A 1GDEA 2HZPA 1ELUA 4ZDLA 1B4XA 4WXFA 3EI9A 3N4RA 1TASA 1B8GA 1AJSA 4JF1A 4F5MA 3RBFA 2VGVA 2R5EA 3KGWA 2PB0A 4LC3A 1JS3A 4A6TA 1LW4A 4CVQA 3WCOA 3PPLA 3WKSA 2W8TA 2E7UA 2WK9A 3D6KA 3BN1A 2O0RA 1ZODA 2VGSA 3TCMA 1QJ5A 3NUBA 1YIZA 4ZLVA 4FL0A 4ZSWA 1GEYA 5IWQA 2XBNA 5G4IA 3LVMA 1TOIA 1C7NA 4A72A 4E3QA 3DXVA 5EUEA 2OGEA 2WB6A 3DR7A 1ARIA 3G8MA 3JWBA 3K40A 4UOYA 3PDXA 4DGTA 1RV3A 3LVJA 3B1DA 1B9IA 3I5TA 3IF2A 1O61A 1Z3ZA 5G2QA 1SF2A 2D5YA 2ORDA 4A00A 5EIGA 2OGAA 4BA4A 3AEMC 3ATHA 3E2FA 5I92A 1AX4A 2BIEA 5DB5A 1YJZA 1OHWA 1BJWA 5EFSA 4JEVA 1GC4A 1S09A 2W7DA 1CQ6A 1V2EA 4B98A 4PIWA 2C7TA 3WCNA 2D7YA 3DYDA 2X5DA 4MKJA 2F8JA 4IYOA 1D7RA 1IAYA 2BI3A 1MLZA 3B1CA 2QLRA 1ASAA 1UKJA 3AEPA 3OKSA 4XK1A 1X2AA 4A6UA 1E5FA 3FZ7A 3CAIA 3B8XA 3WY7A 1M7YA 1BJOB 1WYUB 1GC2A 1DKAA 2VMQA 1QIRA 2DKBA 2HP2A 2VLHA 3FFRA 1G4XA 1RV4A 2V0YA 2VLFA 3ISLA 5TF5A 4F5HA 2W8WA 1AHGA 4DQ6A 4RJYA 4JEWA 3MKJA 1CJ0A 2GQNA 4F5IA 3WKRA 4DBCA 4IW7A 3QN6A 3GETA 1TARA 4LW4A 1CS1A 1AIBA 3IHJA 3ACZA 3CBFA 1LS3A 1DJUA 1X0MA 4ZM3A 2Z9VA 3PGYA 3ZRQA 3DC1A 4XQ2A 1W7LA 2W7KA 4CBRA 4AH3A 4CXQA 1AHYA 4GE9A 1UU2A 1CZCA 5K8BA 3BS8A 1N8PA 2AEVA 4WYEA 4WLHA 4Q6RA 2BKWA 2VMNA 4IXOA 1RVUA 2Z67A 3I16A 3UWCA 5F9SA 4WYDA 3GWPA 4GDYA 4OYTA 3EI5A 4WXBA 4U1TA 4WYFA 3EI8A 4ADBA 1M32A 2AY5A 3JW9A 5EUNA 3MC6C 4AO4A 2FNUA 1AJSB 3E2ZB 3DODA 5J8QA 2YRRA 4A0RA 4E3RA 2ZYJA 1ARTA 3QPGA 3BCXA 1DFOA 3N75A 2BYJA 2CY8A 5EUDA 1ARSA 1IUGA 4W1XA 1AY4A 5BJ3A 4RLGA 3H14A 1LK9A 1W23A 3NTJA 1C0NA 3AV7A 3UE8A 5EQCA 1WKHA 1C7GA 1E5EA 1ASLA 1ORDA 1QGNA 1SFFA 3NRAA 3WZFA 2HUUA 3E9KA 3NNKA 2OQXA 5M46A 3BWNA 2ZY4A 2GSAA 4N0WA 3HMUA 3E77A 1TPLA 2VMVA 1YOOA 4ZSYA 4AZKA 1EQBA 2CSTA 1MDXA 3AEJC 4BQ0A 4WD2A 1SVVA 2E54A 1BJNA 3A9YA 2W7GA 2FN6A 1IAXA 1ASMA 1IX6A 5E5IA 4OBVA 3NDNA 3FDBA 2YCPA 1I48A 2BYLA 2EGYA 3DXWA 4R2NA 4ISYA 4UHMA 4F5FA 2W7IA 5E3KA 1AHFA 3AATA 4EB5A 4UHNA 2QMAA 2YKUA 3AEOA 3RBLA 1OHVA 2W7EA 1W7MA 2VI8A 4Q75A 2RFVA 1AMAA 3ZZJA 3MEBA 3VP6A 3ELPA 1UU0A 3QM2A 2AY4A 4IYOB 2Z20A 2FQ6A 3LY1A 5LHAA 1PMOA 1AHEA 2W8UA 2YCTA 1RVYA 4K05A 2C0RA 3N5MA 1CL2A 2G6WA 3TFTA 1ZC9A 4OCAA 1MGVA 3RQ1A 3JZLA 1ARGA 2HP1A 2R5CA 3HDOA 5FT4A 9AATA 2QB2A 4J5UA 1LC7A 1D7UA 1AKAA 3GZCA 5DX5A 4E1OA 3PD6A 1IJIA 1DJEA 1M4NA 2QB3A 2EH6A 3UAKA 4ZAHA 3LG0A 1V72A 4WYCA 1BQAA 3VK2A 1Z7DA 1ZOBA 1G7XA 3RUYA 3AOWA 3HL2A 4OBUA 4XEWA 1LKCA 1N2TA 1QJ3A 5DJ1A 3VAXA 4MQRA 3FCRA 1AICA 1KL1A 2AY2A 1C7OA 3AEJA 2G7JA 5EAAA 1GCKA 1BS0A 1FG3A 1YNUA 1IX7A 4EFFA 1GD9A 3K7YA 1LW5A 4GRXA 5D95A 3L8AA 1B5OA 2D63A 2ZY5A 1AAWA 2BIGA 2EPJA 2W8JA 2CJDA 4LW2A 4EB7A 1VP4A 4OTLA 1JG8A 1O4SA 4OMAA 3JU7A 1OATA 2VMXA 4AZJA 3MAFA 1M0OA 3GJUA 1IX8A 2Z9UA 4AO9A 2BWNA 3N4XA 2AY7A 3LV2A 1YAAA 2CTZA 2VMYA 3DZZA 4JE5D 4TN4A 2VMSA 3RI6A 4F5GA 1XI9A 2DGLA 4TV7A 5G2PA 1D7VA 3KE3A 5HXXA 4XAUA 1O69A 1OHYA 2YKYA 2TPLA 3ASBA 3M5UA 3W1IA 3PIUA 4F4EA 2JJEA 1BQDA 1QITA 2D66A 3Q8NA 4PVFA 2DR1A 3DU4A 4XJLA 2AY9A 4XJPA 2W7MA 3R9AA 4ADDA 2CJHA 3NU8A 2NMPA 4ADCA 1AMRA 4MQPA 2W7JA 3CQ6A 3GZDC 3WLXA 4GSAA 5DJ9A 3WGBA 2BIAA 4B9BA 4WYGA 3EI6A 3GZDA 3P1TA 1J04A 3FVUA 2HORA 2CANA 4RIZA 2YCNA 3GSBA 1PG8A 1TATA 1P3WA 3EZSA 1AIAA 1ASDA 2D61A 3COGA 4N0BA 4MY5A 2VMUA 1IVRA 4ATQA 3CQ4A 3GR9A 2EO5A 3EI7A 1QISA 1S06A 1ASEA 3I4JA 3MC6A 1YJYA 1WKGA 4ZWMA 4AOAA 3F9TA 2AY6A 2CH2A 3HBXA 4F5JA 2CINA 1BJ4A 2X5FA 1GC3A 1SPAA 4A0HA 1ELQA 1WYVB 1VJOA 3FSLA 4L0OA 3BV0A 4O6ZA 4R5FA 4R8DA 2D7ZA 2YRIA 4HF8A 2C44A 2VMRA 1GEXA 4BA5A 1KMJA 2E7IA 1PFFA 1PMMA 1N31A 3BB8A 1TOEA 4ADEA 4LNMA 4WB0B 2AEUA 2A1VA 3ZZKA 2VIAA 1AY8A 3BWNC 4PFFA 5LH9A 4U2HA 1U08A 1T3IA 3II0A 4W1VA 2Z1ZA 2Z61A 2Z1YA 1AAMA 1QZ9A 1ASGA 2R5CB 1YIYA 3MAFB 3NYTA 3NYUA 3P6KA 2HUFA 1CQ7A 2EZ1A 2OKJA 3USFA 2DGKA 1W3UA 1M0QA 2QA3A 4ZM4A 1AJRA 2CH1A 3FVXA 3JWAA 4MKKA 8AATA 2PB2A 1X29A 1I29A 2R2NA 3PD6B 3FRKA 4A6RA 3TFUA 3ECDA 1V2FA 1BT4A 2EYQA 4K2BA 5G4JA 2BI9A 3LWSA 2ZC0A 3E2ZA 1MDOA 5FT5A 2BI2A 1AY5A 2ZSMA 4ZASA 3ZRPA 4RM1A 5F8VA 4KYOA 3A9XA 1EJIA 3RCHA 3FQ7A 4JEYA 4R5ZA 2AY1A 2VMPA 2GB3A 5HHYA 5M4BA 1O62A 1WSTA 4Y0DA 2JISA 2FKIA 1DGEA 4RKCA 1MLYA 2ZY2A 1EG5A 4OC9A 1KMKA 2WKAA 3LVKA 1SZUA 2BWPA 2VGZA 4BMKA 1DGDA 4MQQA 4XJOA 4RITA 1GEWA 2O1BA 3AOVA 1I43A 3FZ6A 3PDBB 3ELEA 2R0TA 2HOXA 4K2MA 5EIGB 4ZDPA 1JS6A 3HLMA 4RJ0A 1IBJA 3WGCA 1CZEA 3CQ5A 1BKGA 4UHOA 4HVKA 3PA9A 4NOGA 1KKPA 5M49A 3BCAA 3N4SA 3K28A 2FYFA 2VGWA 7AATA 2GMUA 3EIAA 2YHKA 2AY8A 4WP0A 3FDDA 3TQXA 2EZ2A 2YKXA 2HOZA 4UQVA 1JF9A 4WYAA 2VMOA 1WYTB 1OXPA 2D65A 4JEXA 1ECXA 4JEZA 2O7CA 4KAMA 1AKBA 4EU1A 4IXZA 1M0NA 3FTBA 3HT4A 3OP7A 2HOYA 1B9HA 4QGRA 1BJOA 1WYUA 1CQ8A 4XJMA 1D2FA 2VMTA 3A2BA 4MGRA 4Y0IA 2DKJA 2CFBA 1LC5A 2DGMA 1G7WA 2XH1A 2CB1A 4P7YA 1ASBA 2ZJGA 3QI6A 1XEYA 4I8AA 3A8UX 2CJGA 4W1WA 3QBOA 3T32A 4P3MA 3W1JA 1MAPA 4OT8A 1Y4IA 2ZP7A 1FG7A 2OATA 3EUCA 5BJ4A 1C4KA 4W91A 4GE7A 4M2KA 3NX3A 4RAEA 4FFCA 4GEBA 1S07A 4GE4A
chains in the Genus database with same CATH topology
2Z9XA 3AENB 1B5PA 3BCBA 3KKIA 3PAAA 2W7FA 3GBXA 1D7SA 4LNLA 4Q76A 5FT6A 3MAUA 4ZDOA 4KXKA 4H63Q 1TOKA 1C9CA 2GMSA 4WB0A 1AMQA 1AKCA 1SZSA 3MBBA 3ASAA 2BHXA 2OKKA 3FFHA 2JG2A 1OXOA 2VI9A 4W8IA 4JF0A 5FT8A 3G7QA 3NU7A 5HDMA 1AHXA 4K2IA 1M0PA 1GC0A 2C81A 2WK8A 1ASFA 1H1CA 3DR4A 1YJSA 3FD0A 3TATA 2BI1A 3FQ8A 3MADA 5G0AA 4H51A 2VIBA 3FVSA 2VMZA 4TMRA 3BC8A 1H0CA 1MDZA 2VGUA 2YKVA 3QGUA 4ZWVA 4WLJA 2VYCA 3BWOA 3F0HA 5JAYA 1KKJA 1S0AA 3FKDA 1VEFA 3N0LA 4A0GA 2KFPA 2FM1A 4CBSA 1V2DA 5AX8A 1WYTA 2WK7A 3B46A 3E6GA 1TOJA 4ITXA 4JE5A 3RCHB 3FQAA 3ZRRA 4IX8A 4LNJA 1DTYA 2VGTA 1ASCA 2DOUA 1TOGA 3VK4A 4BHDA 2FNIA 5C6UA 3LVLB 4IY7A 1MAQA 4M2MA 4E77A 2W7HA 3HVYA 1G4VA 2ZUKA 2ZSLA 4IXSA 4MSOA 3FZ8A 1DJ9A 1M6SA 3PDBA 4ITGA 2ZY3A 1X28A 2JJFA 5KTBA 2E7JA 1FC4A 1GBNA 3VOMA 4F5KA 2D64A 3F6TA 3HQTA 4F5LA 4M2JA 1SZKA 5M4DA 4PFNA 2HUIA 4RKDA 1J32A 4Q31A 2JJGA 4WBTA 4A0FA 3H9XA 2AY3A 3H7FA 3G0TA 1BW0A 3KGXA 1LC8A 2BWOA 4ATPA 1I41A 1WYVA 3NYSA 1KL2A 2Z9WA 2W7LA 2JJHA 4CXRA 2X3LA 3R4TA 1ARHA 2X8UA 3AELA 1CL1A 3E2YA 2W8VA 3JTXA 3N7NA 3NUIA 1S08A 2QSRA 3B1EA 1AMSA 5D5SA 4WXGA 4EMYA 2PO3A 2QBTA 3AEMA 2V1PA 4J8LA 3WX9A 2Q7WA 3EIBA 2BI5A 1ASNA 1UU1A 3EZ1A 3VK3A 2JGTA 2AATA 5E4ZA 5EAVA 3A9ZA 3PJ0A 2VMWA 3W1HA 5G09A 2YOBA 3QHXA 4W5KA 4Y0HA 3DRDA 1W7NA 3AENA 3L44A 1GDEA 2HZPA 1ELUA 4ZDLA 1B4XA 4WXFA 3EI9A 3N4RA 1TASA 1B8GA 1AJSA 4JF1A 4F5MA 3RBFA 2VGVA 2R5EA 3KGWA 2PB0A 4LC3A 1JS3A 4A6TA 1LW4A 4CVQA 3WCOA 3PPLA 3WKSA 2W8TA 2E7UA 2WK9A 3D6KA 3BN1A 2O0RA 1ZODA 2VGSA 3TCMA 1QJ5A 3NUBA 1YIZA 4ZLVA 4FL0A 4ZSWA 1GEYA 5IWQA 2XBNA 5G4IA 3LVMA 1TOIA 1C7NA 4A72A 4E3QA 3DXVA 5EUEA 2OGEA 2WB6A 3DR7A 1ARIA 3G8MA 3JWBA 3K40A 4UOYA 3PDXA 4DGTA 1RV3A 3LVJA 3B1DA 1B9IA 3I5TA 3IF2A 1O61A 1Z3ZA 5G2QA 1SF2A 2D5YA 2ORDA 4A00A 5EIGA 2OGAA 4BA4A 3AEMC 3ATHA 3E2FA 5I92A 1AX4A 2BIEA 5DB5A 1YJZA 1OHWA 1BJWA 5EFSA 4JEVA 1GC4A 1S09A 2W7DA 1CQ6A 1V2EA 4B98A 4PIWA 2C7TA 3WCNA 2D7YA 3DYDA 2X5DA 4MKJA 2F8JA 4IYOA 1D7RA 1IAYA 2BI3A 1MLZA 3B1CA 2QLRA 1ASAA 1UKJA 3AEPA 3OKSA 4XK1A 1X2AA 4A6UA 1E5FA 3FZ7A 3CAIA 3B8XA 3WY7A 1M7YA 1BJOB 1WYUB 1GC2A 1DKAA 2VMQA 1QIRA 2DKBA 2HP2A 2VLHA 3FFRA 1G4XA 1RV4A 2V0YA 2VLFA 3ISLA 5TF5A 4F5HA 2W8WA 1AHGA 4DQ6A 4RJYA 4JEWA 3MKJA 1CJ0A 2GQNA 4F5IA 3WKRA 4DBCA 4IW7A 3QN6A 3GETA 1TARA 4LW4A 1CS1A 1AIBA 3IHJA 3ACZA 3CBFA 1LS3A 1DJUA 1X0MA 4ZM3A 2Z9VA 3PGYA 3ZRQA 3DC1A 4XQ2A 1W7LA 2W7KA 4CBRA 4AH3A 4CXQA 1AHYA 4GE9A 1UU2A 1CZCA 5K8BA 3BS8A 1N8PA 2AEVA 4WYEA 4WLHA 4Q6RA 2BKWA 2VMNA 4IXOA 1RVUA 2Z67A 3I16A 3UWCA 5F9SA 4WYDA 3GWPA 4GDYA 4OYTA 3EI5A 4WXBA 4U1TA 4WYFA 3EI8A 4ADBA 1M32A 2AY5A 3JW9A 5EUNA 3MC6C 4AO4A 2FNUA 1AJSB 3E2ZB 3DODA 5J8QA 2YRRA 4A0RA 4E3RA 2ZYJA 1ARTA 3QPGA 3BCXA 1DFOA 3N75A 2BYJA 2CY8A 5EUDA 1ARSA 1IUGA 4W1XA 1AY4A 5BJ3A 4RLGA 3H14A 1LK9A 1W23A 3NTJA 1C0NA 3AV7A 3UE8A 5EQCA 1WKHA 1C7GA 1E5EA 1ASLA 1ORDA 1QGNA 1SFFA 3NRAA 3WZFA 2HUUA 3E9KA 3NNKA 2OQXA 5M46A 3BWNA 2ZY4A 2GSAA 4N0WA 3HMUA 3E77A 1TPLA 2VMVA 1YOOA 4ZSYA 4AZKA 1EQBA 2CSTA 1MDXA 3AEJC 4BQ0A 4WD2A 1SVVA 2E54A 1BJNA 3A9YA 2W7GA 2FN6A 1IAXA 1ASMA 1IX6A 5E5IA 4OBVA 3NDNA 3FDBA 2YCPA 1I48A 2BYLA 2EGYA 3DXWA 4R2NA 4ISYA 4UHMA 4F5FA 2W7IA 5E3KA 1AHFA 3AATA 4EB5A 4UHNA 2QMAA 2YKUA 3AEOA 3RBLA 1OHVA 2W7EA 1W7MA 2VI8A 4Q75A 2RFVA 1AMAA 3ZZJA 3MEBA 3VP6A 3ELPA 1UU0A 3QM2A 2AY4A 4IYOB 2Z20A 2FQ6A 3LY1A 5LHAA 1PMOA 1AHEA 2W8UA 2YCTA 1RVYA 4K05A 2C0RA 3N5MA 1CL2A 2G6WA 3TFTA 1ZC9A 4OCAA 1MGVA 3RQ1A 3JZLA 1ARGA 2HP1A 2R5CA 3HDOA 5FT4A 9AATA 2QB2A 4J5UA 1LC7A 1D7UA 1AKAA 3GZCA 5DX5A 4E1OA 3PD6A 1IJIA 1DJEA 1M4NA 2QB3A 2EH6A 3UAKA 4ZAHA 3LG0A 1V72A 4WYCA 1BQAA 3VK2A 1Z7DA 1ZOBA 1G7XA 3RUYA 3AOWA 3HL2A 4OBUA 4XEWA 1LKCA 1N2TA 1QJ3A 5DJ1A 3VAXA 4MQRA 3FCRA 1AICA 1KL1A 2AY2A 1C7OA 3AEJA 2G7JA 5EAAA 1GCKA 1BS0A 1FG3A 1YNUA 1IX7A 4EFFA 1GD9A 3K7YA 1LW5A 4GRXA 5D95A 3L8AA 1B5OA 2D63A 2ZY5A 1AAWA 2BIGA 2EPJA 2W8JA 2CJDA 4LW2A 4EB7A 1VP4A 4OTLA 1JG8A 1O4SA 4OMAA 3JU7A 1OATA 2VMXA 4AZJA 3MAFA 1M0OA 3GJUA 1IX8A 2Z9UA 4AO9A 2BWNA 3N4XA 2AY7A 3LV2A 1YAAA 2CTZA 2VMYA 3DZZA 4JE5D 4TN4A 2VMSA 3RI6A 4F5GA 1XI9A 2DGLA 4TV7A 5G2PA 1D7VA 3KE3A 5HXXA 4XAUA 1O69A 1OHYA 2YKYA 2TPLA 3ASBA 3M5UA 3W1IA 3PIUA 4F4EA 2JJEA 1BQDA 1QITA 2D66A 3Q8NA 4PVFA 2DR1A 3DU4A 4XJLA 2AY9A 4XJPA 2W7MA 3R9AA 4ADDA 2CJHA 3NU8A 2NMPA 4ADCA 1AMRA 4MQPA 2W7JA 3CQ6A 3GZDC 3WLXA 4GSAA 5DJ9A 3WGBA 2BIAA 4B9BA 4WYGA 3EI6A 3GZDA 3P1TA 1J04A 3FVUA 2HORA 2CANA 4RIZA 2YCNA 3GSBA 1PG8A 1TATA 1P3WA 3EZSA 1AIAA 1ASDA 2D61A 3COGA 4N0BA 4MY5A 2VMUA 1IVRA 4ATQA 3CQ4A 3GR9A 2EO5A 3EI7A 1QISA 1S06A 1ASEA 3I4JA 3MC6A 1YJYA 1WKGA 4ZWMA 4AOAA 3F9TA 2AY6A 2CH2A 3HBXA 4F5JA 2CINA 1BJ4A 2X5FA 1GC3A 1SPAA 4A0HA 1ELQA 1WYVB 1VJOA 3FSLA 4L0OA 3BV0A 4O6ZA 4R5FA 4R8DA 2D7ZA 2YRIA 4HF8A 2C44A 2VMRA 1GEXA 4BA5A 1KMJA 2E7IA 1PFFA 1PMMA 1N31A 3BB8A 1TOEA 4ADEA 4LNMA 4WB0B 2AEUA 2A1VA 3ZZKA 2VIAA 1AY8A 3BWNC 4PFFA 5LH9A 4U2HA 1U08A 1T3IA 3II0A 4W1VA 2Z1ZA 2Z61A 2Z1YA 1AAMA 1QZ9A 1ASGA 2R5CB 1YIYA 3MAFB 3NYTA 3NYUA 3P6KA 2HUFA 1CQ7A 2EZ1A 2OKJA 3USFA 2DGKA 1W3UA 1M0QA 2QA3A 4ZM4A 1AJRA 2CH1A 3FVXA 3JWAA 4MKKA 8AATA 2PB2A 1X29A 1I29A 2R2NA 3PD6B 3FRKA 4A6RA 3TFUA 3ECDA 1V2FA 1BT4A 2EYQA 4K2BA 5G4JA 2BI9A 3LWSA 2ZC0A 3E2ZA 1MDOA 5FT5A 2BI2A 1AY5A 2ZSMA 4ZASA 3ZRPA 4RM1A 5F8VA 4KYOA 3A9XA 1EJIA 3RCHA 3FQ7A 4JEYA 4R5ZA 2AY1A 2VMPA 2GB3A 5HHYA 5M4BA 1O62A 1WSTA 4Y0DA 2JISA 2FKIA 1DGEA 4RKCA 1MLYA 2ZY2A 1EG5A 4OC9A 1KMKA 2WKAA 3LVKA 1SZUA 2BWPA 2VGZA 4BMKA 1DGDA 4MQQA 4XJOA 4RITA 1GEWA 2O1BA 3AOVA 1I43A 3FZ6A 3PDBB 3ELEA 2R0TA 2HOXA 4K2MA 5EIGB 4ZDPA 1JS6A 3HLMA 4RJ0A 1IBJA 3WGCA 1CZEA 3CQ5A 1BKGA 4UHOA 4HVKA 3PA9A 4NOGA 1KKPA 5M49A 3BCAA 3N4SA 3K28A 2FYFA 2VGWA 7AATA 2GMUA 3EIAA 2YHKA 2AY8A 4WP0A 3FDDA 3TQXA 2EZ2A 2YKXA 2HOZA 4UQVA 1JF9A 4WYAA 2VMOA 1WYTB 1OXPA 2D65A 4JEXA 1ECXA 4JEZA 2O7CA 4KAMA 1AKBA 4EU1A 4IXZA 1M0NA 3FTBA 3HT4A 3OP7A 2HOYA 1B9HA 4QGRA 1BJOA 1WYUA 1CQ8A 4XJMA 1D2FA 2VMTA 3A2BA 4MGRA 4Y0IA 2DKJA 2CFBA 1LC5A 2DGMA 1G7WA 2XH1A 2CB1A 4P7YA 1ASBA 2ZJGA 3QI6A 1XEYA 4I8AA 3A8UX 2CJGA 4W1WA 3QBOA 3T32A 4P3MA 3W1JA 1MAPA 4OT8A 1Y4IA 2ZP7A 1FG7A 2OATA 3EUCA 5BJ4A 1C4KA 4W91A 4GE7A 4M2KA 3NX3A 4RAEA 4FFCA 4GEBA 1S07A 4GE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z9X A;  3AEN B;  1B5P A;  3BCB A;  3KKI A;  3PAA A;  2W7F A;  3GBX A;  1D7S A;  4LNL A;  4Q76 A;  5FT6 A;  3MAU A;  4ZDO A;  4KXK A;  1TOK A;  1C9C A;  2GMS A;  4WB0 A;  1AMQ A;  1AKC A;  1SZS A;  3MBB A;  3ASA A;  2BHX A;  2OKK A;  3FFH A;  2JG2 A;  1OXO A;  2VI9 A;  4W8I A;  4JF0 A;  5FT8 A;  3G7Q A;  3NU7 A;  5HDM A;  1AHX A;  4K2I A;  1M0P A;  1GC0 A;  2C81 A;  2WK8 A;  1ASF A;  1H1C A;  3DR4 A;  1YJS A;  3FD0 A;  3TAT A;  2BI1 A;  3FQ8 A;  3MAD A;  5G0A A;  4H51 A;  2VIB A;  3FVS A;  2VMZ A;  4TMR A;  3BC8 A;  1H0C A;  1MDZ A;  2VGU A;  2YKV A;  3QGU A;  4ZWV A;  4WLJ A;  2VYC A;  3BWO A;  3F0H A;  5JAY A;  1KKJ A;  1S0A A;  3FKD A;  1VEF A;  3N0L A;  4A0G A;  2FM1 A;  4CBS A;  1V2D A;  5AX8 A;  1WYT A;  2WK7 A;  3B46 A;  3E6G A;  1TOJ A;  4ITX A;  4JE5 A;  3RCH B;  3FQA A;  3ZRR A;  4IX8 A;  4LNJ A;  1DTY A;  2VGT A;  1ASC A;  2DOU A;  1TOG A;  3VK4 A;  4BHD A;  2FNI A;  5C6U A;  3LVL B;  4IY7 A;  1MAQ A;  4M2M A;  4E77 A;  2W7H A;  3HVY A;  1G4V A;  2ZUK A;  2ZSL A;  4IXS A;  4MSO A;  3FZ8 A;  1DJ9 A;  1M6S A;  3PDB A;  4ITG A;  2ZY3 A;  1X28 A;  2JJF A;  2E7J A;  1FC4 A;  1GBN A;  3VOM A;  4F5K A;  2D64 A;  3F6T A;  3HQT A;  4F5L A;  4M2J A;  1SZK A;  5M4D A;  4PFN A;  2HUI A;  4RKD A;  1J32 A;  4Q31 A;  2JJG A;  4WBT A;  4A0F A;  2AY3 A;  3H7F A;  3G0T A;  1BW0 A;  3KGX A;  1LC8 A;  2BWO A;  4ATP A;  1I41 A;  1WYV A;  3NYS A;  1KL2 A;  2Z9W A;  2W7L A;  2JJH A;  4CXR A;  2X3L A;  3R4T A;  1ARH A;  2X8U A;  3AEL A;  1CL1 A;  3E2Y A;  2W8V A;  3JTX A;  3NUI A;  1S08 A;  3B1E A;  1AMS A;  5D5S A;  4WXG A;  4EMY A;  2PO3 A;  2QBT A;  3AEM A;  2V1P A;  4J8L A;  3WX9 A;  2Q7W A;  3EIB A;  2BI5 A;  1ASN A;  1UU1 A;  3EZ1 A;  3VK3 A;  2JGT A;  2AAT A;  5E4Z A;  5EAV A;  3A9Z A;  3PJ0 A;  2VMW A;  3W1H A;  5G09 A;  2YOB A;  3QHX A;  4W5K A;  4Y0H A;  3DRD A;  1W7N A;  3AEN A;  3L44 A;  1GDE A;  2HZP A;  1ELU A;  4ZDL A;  1B4X A;  4WXF A;  3EI9 A;  1TAS A;  1B8G A;  1AJS A;  4JF1 A;  4F5M A;  3RBF A;  2VGV A;  2R5E A;  3KGW A;  2PB0 A;  4LC3 A;  1JS3 A;  4A6T A;  1LW4 A;  4CVQ A;  3WCO A;  3PPL A;  3WKS A;  2W8T A;  2E7U A;  2WK9 A;  3D6K A;  3BN1 A;  2O0R A;  1ZOD A;  2VGS A;  3TCM A;  1QJ5 A;  3NUB A;  1YIZ A;  4ZLV A;  4FL0 A;  4ZSW A;  1GEY A;  5IWQ A;  2XBN A;  5G4I A;  3LVM A;  1TOI A;  1C7N A;  4A72 A;  4E3Q A;  3DXV A;  5EUE A;  2OGE A;  3DR7 A;  1ARI A;  3G8M A;  3JWB A;  3K40 A;  4UOY A;  3PDX A;  4DGT A;  1RV3 A;  3LVJ A;  3B1D A;  1B9I A;  3I5T A;  3IF2 A;  1O61 A;  1Z3Z A;  5G2Q A;  1SF2 A;  2D5Y A;  2ORD A;  4A00 A;  5EIG A;  2OGA A;  4BA4 A;  3AEM C;  3ATH A;  3E2F A;  5I92 A;  1AX4 A;  2BIE A;  5DB5 A;  1YJZ A;  1OHW A;  1BJW A;  5EFS A;  4JEV A;  1GC4 A;  1S09 A;  2W7D A;  1CQ6 A;  1V2E A;  4B98 A;  4PIW A;  2C7T A;  3WCN A;  2D7Y A;  3DYD A;  2X5D A;  4MKJ A;  2F8J A;  4IYO A;  1D7R A;  1IAY A;  2BI3 A;  1MLZ A;  3B1C A;  2QLR A;  1ASA A;  1UKJ A;  3AEP A;  3OKS A;  4XK1 A;  1X2A A;  4A6U A;  1E5F A;  3FZ7 A;  3CAI A;  3B8X A;  3WY7 A;  1M7Y A;  1BJO B;  1WYU B;  1GC2 A;  1DKA A;  2VMQ A;  1QIR A;  2DKB A;  2HP2 A;  2VLH A;  3FFR A;  1G4X A;  1RV4 A;  2V0Y A;  2VLF A;  3ISL A;  5TF5 A;  4F5H A;  2W8W A;  1AHG A;  4DQ6 A;  4RJY A;  4JEW A;  3MKJ A;  1CJ0 A;  2GQN A;  4F5I A;  3WKR A;  4DBC A;  4IW7 A;  3QN6 A;  3GET A;  1TAR A;  4LW4 A;  1CS1 A;  1AIB A;  3IHJ A;  3ACZ A;  3CBF A;  1LS3 A;  1DJU A;  1X0M A;  4ZM3 A;  2Z9V A;  3PGY A;  3ZRQ A;  3DC1 A;  4XQ2 A;  1W7L A;  2W7K A;  4CBR A;  4AH3 A;  4CXQ A;  1AHY A;  4GE9 A;  1UU2 A;  1CZC A;  5K8B A;  3BS8 A;  1N8P A;  2AEV A;  4WYE A;  4WLH A;  4Q6R A;  2BKW A;  2VMN A;  4IXO A;  1RVU A;  2Z67 A;  3I16 A;  3UWC A;  5F9S A;  4WYD A;  3GWP A;  4GDY A;  4OYT A;  3EI5 A;  4WXB A;  4U1T A;  4WYF A;  3EI8 A;  4ADB A;  1M32 A;  2AY5 A;  3JW9 A;  5EUN A;  3MC6 C;  4AO4 A;  2FNU A;  1AJS B;  3E2Z B;  3DOD A;  5J8Q A;  2YRR A;  4A0R A;  4E3R A;  2ZYJ A;  1ART A;  3QPG A;  3BCX A;  1DFO A;  3N75 A;  2BYJ A;  2CY8 A;  5EUD A;  1ARS A;  1IUG A;  4W1X A;  1AY4 A;  5BJ3 A;  4RLG A;  3H14 A;  1LK9 A;  1W23 A;  3NTJ A;  1C0N A;  3AV7 A;  3UE8 A;  5EQC A;  1WKH A;  1C7G A;  1E5E A;  1ASL A;  1ORD A;  1QGN A;  1SFF A;  3NRA A;  3WZF A;  2HUU A;  3E9K A;  3NNK A;  2OQX A;  5M46 A;  3BWN A;  2ZY4 A;  2GSA A;  4N0W A;  3HMU A;  3E77 A;  1TPL A;  2VMV A;  1YOO A;  4ZSY A;  4AZK A;  1EQB A;  2CST A;  1MDX A;  3AEJ C;  4BQ0 A;  4WD2 A;  1SVV A;  2E54 A;  1BJN A;  3A9Y A;  2W7G A;  2FN6 A;  1IAX A;  1ASM A;  1IX6 A;  5E5I A;  4OBV A;  3NDN A;  3FDB A;  2YCP A;  1I48 A;  2BYL A;  2EGY A;  3DXW A;  4R2N A;  4ISY A;  4UHM A;  4F5F A;  2W7I A;  5E3K A;  1AHF A;  3AAT A;  4EB5 A;  4UHN A;  2QMA A;  2YKU A;  3AEO A;  3RBL A;  1OHV A;  2W7E A;  1W7M A;  2VI8 A;  4Q75 A;  2RFV A;  1AMA A;  3ZZJ A;  3MEB A;  3VP6 A;  3ELP A;  1UU0 A;  3QM2 A;  2AY4 A;  4IYO B;  2Z20 A;  2FQ6 A;  3LY1 A;  5LHA A;  1PMO A;  1AHE A;  2W8U A;  2YCT A;  1RVY A;  2C0R A;  3N5M A;  1CL2 A;  2G6W A;  3TFT A;  1ZC9 A;  4OCA A;  1MGV A;  3RQ1 A;  3JZL A;  1ARG A;  2HP1 A;  2R5C A;  3HDO A;  5FT4 A;  9AAT A;  2QB2 A;  4J5U A;  1LC7 A;  1D7U A;  1AKA A;  3GZC A;  5DX5 A;  4E1O A;  3PD6 A;  1IJI A;  1DJE A;  1M4N A;  2QB3 A;  2EH6 A;  3UAK A;  4ZAH A;  3LG0 A;  1V72 A;  4WYC A;  1BQA A;  3VK2 A;  1Z7D A;  1ZOB A;  1G7X A;  3RUY A;  3AOW A;  3HL2 A;  4OBU A;  4XEW A;  1LKC A;  1N2T A;  1QJ3 A;  5DJ1 A;  3VAX A;  4MQR A;  3FCR A;  1AIC A;  1KL1 A;  2AY2 A;  1C7O A;  3AEJ A;  5EAA A;  1GCK A;  1BS0 A;  1FG3 A;  1YNU A;  1IX7 A;  4EFF A;  1GD9 A;  3K7Y A;  1LW5 A;  4GRX A;  5D95 A;  3L8A A;  1B5O A;  2D63 A;  2ZY5 A;  1AAW A;  2BIG A;  2EPJ A;  2W8J A;  2CJD A;  4LW2 A;  4EB7 A;  1VP4 A;  4OTL A;  1JG8 A;  1O4S A;  4OMA A;  3JU7 A;  1OAT A;  2VMX A;  4AZJ A;  3MAF A;  1M0O A;  3GJU A;  1IX8 A;  2Z9U A;  4AO9 A;  2BWN A;  2AY7 A;  3LV2 A;  1YAA A;  2CTZ A;  2VMY A;  3DZZ A;  4JE5 D;  4TN4 A;  2VMS A;  3RI6 A;  4F5G A;  1XI9 A;  2DGL A;  4TV7 A;  5G2P A;  1D7V A;  3KE3 A;  5HXX A;  4XAU A;  1O69 A;  1OHY A;  2YKY A;  2TPL A;  3ASB A;  3M5U A;  3W1I A;  3PIU A;  4F4E A;  2JJE A;  1BQD A;  1QIT A;  2D66 A;  3Q8N A;  4PVF A;  2DR1 A;  3DU4 A;  4XJL A;  2AY9 A;  4XJP A;  2W7M A;  3R9A A;  4ADD A;  2CJH A;  3NU8 A;  2NMP A;  4ADC A;  1AMR A;  4MQP A;  2W7J A;  3CQ6 A;  3GZD C;  3WLX A;  4GSA A;  5DJ9 A;  3WGB A;  2BIA A;  4B9B A;  4WYG A;  3EI6 A;  3GZD A;  3P1T A;  1J04 A;  3FVU A;  2HOR A;  2CAN A;  4RIZ A;  2YCN A;  3GSB A;  1PG8 A;  1TAT A;  1P3W A;  3EZS A;  1AIA A;  1ASD A;  2D61 A;  3COG A;  4N0B A;  4MY5 A;  2VMU A;  1IVR A;  4ATQ A;  3CQ4 A;  3GR9 A;  2EO5 A;  3EI7 A;  1QIS A;  1S06 A;  1ASE A;  3I4J A;  3MC6 A;  1YJY A;  1WKG A;  4ZWM A;  4AOA A;  3F9T A;  2AY6 A;  2CH2 A;  3HBX A;  4F5J A;  2CIN A;  1BJ4 A;  2X5F A;  1GC3 A;  1SPA A;  4A0H A;  1ELQ A;  1WYV B;  1VJO A;  3FSL A;  4L0O A;  3BV0 A;  4O6Z A;  4R5F A;  4R8D A;  2D7Z A;  2YRI A;  4HF8 A;  2C44 A;  2VMR A;  1GEX A;  4BA5 A;  1KMJ A;  2E7I A;  1PFF A;  1PMM A;  1N31 A;  3BB8 A;  1TOE A;  4ADE A;  4LNM A;  4WB0 B;  2AEU A;  3ZZK A;  2VIA A;  1AY8 A;  3BWN C;  4PFF A;  5LH9 A;  4U2H A;  1U08 A;  1T3I A;  3II0 A;  4W1V A;  2Z1Z A;  2Z61 A;  2Z1Y A;  1AAM A;  1QZ9 A;  1ASG A;  2R5C B;  1YIY A;  3MAF B;  3NYT A;  3NYU A;  3P6K A;  2HUF A;  1CQ7 A;  2EZ1 A;  2OKJ A;  3USF A;  2DGK A;  1W3U A;  1M0Q A;  2QA3 A;  4ZM4 A;  1AJR A;  2CH1 A;  3FVX A;  3JWA A;  4MKK A;  8AAT A;  2PB2 A;  1X29 A;  1I29 A;  2R2N A;  3PD6 B;  3FRK A;  4A6R A;  3TFU A;  3ECD A;  1V2F A;  1BT4 A;  4K2B A;  5G4J A;  2BI9 A;  3LWS A;  2ZC0 A;  3E2Z A;  1MDO A;  5FT5 A;  2BI2 A;  1AY5 A;  2ZSM A;  4ZAS A;  3ZRP A;  4RM1 A;  5F8V A;  4KYO A;  3A9X A;  1EJI A;  3RCH A;  3FQ7 A;  4JEY A;  4R5Z A;  2AY1 A;  2VMP A;  2GB3 A;  5HHY A;  5M4B A;  1O62 A;  1WST A;  4Y0D A;  2JIS A;  1DGE A;  4RKC A;  1MLY A;  2ZY2 A;  1EG5 A;  4OC9 A;  1KMK A;  2WKA A;  3LVK A;  1SZU A;  2BWP A;  2VGZ A;  4BMK A;  1DGD A;  4MQQ A;  4XJO A;  4RIT A;  1GEW A;  2O1B A;  3AOV A;  1I43 A;  3FZ6 A;  3PDB B;  3ELE A;  2R0T A;  2HOX A;  4K2M A;  5EIG B;  4ZDP A;  1JS6 A;  3HLM A;  4RJ0 A;  1IBJ A;  3WGC A;  1CZE A;  3CQ5 A;  1BKG A;  4UHO A;  4HVK A;  3PA9 A;  4NOG A;  1KKP A;  5M49 A;  3BCA A;  3K28 A;  2FYF A;  2VGW A;  7AAT A;  2GMU A;  3EIA A;  2YHK A;  2AY8 A;  4WP0 A;  3FDD A;  3TQX A;  2EZ2 A;  2YKX A;  2HOZ A;  4UQV A;  1JF9 A;  4WYA A;  2VMO A;  1WYT B;  1OXP A;  2D65 A;  4JEX A;  1ECX A;  4JEZ A;  2O7C A;  4KAM A;  1AKB A;  4EU1 A;  4IXZ A;  1M0N A;  3FTB A;  3HT4 A;  3OP7 A;  2HOY A;  1B9H A;  4QGR A;  1BJO A;  1WYU A;  1CQ8 A;  4XJM A;  1D2F A;  2VMT A;  3A2B A;  4MGR A;  4Y0I A;  2DKJ A;  2CFB A;  1LC5 A;  2DGM A;  1G7W A;  2XH1 A;  2CB1 A;  4P7Y A;  1ASB A;  2ZJG A;  3QI6 A;  1XEY A;  4I8A A;  3A8U X;  2CJG A;  4W1W A;  3QBO A;  3T32 A;  4P3M A;  3W1J A;  1MAP A;  4OT8 A;  1Y4I A;  2ZP7 A;  1FG7 A;  2OAT A;  3EUC A;  5BJ4 A;  1C4K A;  4W91 A;  4GE7 A;  4M2K A;  3NX3 A;  4RAE A;  4FFC A;  4GEB A;  1S07 A;  4GE4 A; 
#chains in the Genus database with same CATH topology
 2Z9X A;  3AEN B;  1B5P A;  3BCB A;  3KKI A;  3PAA A;  2W7F A;  3GBX A;  1D7S A;  4LNL A;  4Q76 A;  5FT6 A;  3MAU A;  4ZDO A;  4KXK A;  4H63 Q;  1TOK A;  1C9C A;  2GMS A;  4WB0 A;  1AMQ A;  1AKC A;  1SZS A;  3MBB A;  3ASA A;  2BHX A;  1KAF A;  2OKK A;  3FFH A;  2JG2 A;  1OXO A;  2VI9 A;  4W8I A;  4JF0 A;  5FT8 A;  3G7Q A;  3NU7 A;  5HDM A;  1AHX A;  4K2I A;  1M0P A;  1GC0 A;  2C81 A;  2WK8 A;  1ASF A;  1H1C A;  3DR4 A;  1YJS A;  3FD0 A;  3TAT A;  2BI1 A;  3FQ8 A;  3MAD A;  5G0A A;  4H51 A;  2VIB A;  3FVS A;  2VMZ A;  4TMR A;  3BC8 A;  1H0C A;  1MDZ A;  2VGU A;  2YKV A;  3QGU A;  4ZWV A;  4WLJ A;  2VYC A;  3BWO A;  3F0H A;  5JAY A;  1KKJ A;  1S0A A;  3FKD A;  1VEF A;  3N0L A;  4A0G A;  2KFP A;  2FM1 A;  4CBS A;  1V2D A;  5AX8 A;  1WYT A;  2WK7 A;  3B46 A;  3E6G A;  1TOJ A;  4ITX A;  4JE5 A;  3RCH B;  3FQA A;  3ZRR A;  4IX8 A;  4LNJ A;  1DTY A;  2VGT A;  1ASC A;  2DOU A;  1TOG A;  3VK4 A;  4BHD A;  2FNI A;  5C6U A;  3LVL B;  4IY7 A;  1MAQ A;  4M2M A;  4E77 A;  2W7H A;  3HVY A;  1G4V A;  2ZUK A;  2ZSL A;  4IXS A;  4MSO A;  3FZ8 A;  1DJ9 A;  1M6S A;  3PDB A;  4ITG A;  2ZY3 A;  1X28 A;  2JJF A;  5KTB A;  2E7J A;  1FC4 A;  1GBN A;  3VOM A;  4F5K A;  2D64 A;  3F6T A;  3HQT A;  4F5L A;  4M2J A;  1SZK A;  5M4D A;  4PFN A;  2HUI A;  4RKD A;  1J32 A;  4Q31 A;  2JJG A;  4WBT A;  4A0F A;  3H9X A;  2AY3 A;  3H7F A;  3G0T A;  1BW0 A;  3KGX A;  1LC8 A;  2BWO A;  4ATP A;  1I41 A;  1WYV A;  3NYS A;  1KL2 A;  2Z9W A;  2W7L A;  2JJH A;  4CXR A;  2X3L A;  3R4T A;  1ARH A;  2X8U A;  3AEL A;  1CL1 A;  3E2Y A;  2W8V A;  3JTX A;  3N7N A;  3NUI A;  1S08 A;  2QSR A;  3B1E A;  1AMS A;  5D5S A;  4WXG A;  4EMY A;  2PO3 A;  2QBT A;  3AEM A;  2V1P A;  4J8L A;  3WX9 A;  2Q7W A;  3EIB A;  2BI5 A;  1ASN A;  1UU1 A;  3EZ1 A;  3VK3 A;  2JGT A;  2AAT A;  5E4Z A;  5EAV A;  3A9Z A;  3PJ0 A;  2VMW A;  3W1H A;  5G09 A;  2YOB A;  3QHX A;  4W5K A;  4Y0H A;  3DRD A;  1W7N A;  3AEN A;  3L44 A;  1GDE A;  2HZP A;  1ELU A;  4ZDL A;  1B4X A;  4WXF A;  3EI9 A;  3N4R A;  1TAS A;  1B8G A;  1AJS A;  4JF1 A;  4F5M A;  3RBF A;  2VGV A;  2R5E A;  3KGW A;  2PB0 A;  4LC3 A;  1JS3 A;  4A6T A;  1LW4 A;  4CVQ A;  3WCO A;  3PPL A;  3WKS A;  2W8T A;  2E7U A;  2WK9 A;  3D6K A;  3BN1 A;  2O0R A;  1ZOD A;  2VGS A;  3TCM A;  1QJ5 A;  3NUB A;  1YIZ A;  4ZLV A;  4FL0 A;  4ZSW A;  1GEY A;  5IWQ A;  2XBN A;  5G4I A;  3LVM A;  1TOI A;  1C7N A;  4A72 A;  4E3Q A;  3DXV A;  5EUE A;  2OGE A;  2WB6 A;  3DR7 A;  1ARI A;  3G8M A;  3JWB A;  3K40 A;  4UOY A;  3PDX A;  4DGT A;  1RV3 A;  3LVJ A;  3B1D A;  1B9I A;  3I5T A;  3IF2 A;  1O61 A;  1Z3Z A;  5G2Q A;  1SF2 A;  2D5Y A;  2ORD A;  4A00 A;  5EIG A;  2OGA A;  4BA4 A;  3AEM C;  3ATH A;  3E2F A;  5I92 A;  1AX4 A;  2BIE A;  5DB5 A;  1YJZ A;  1OHW A;  1BJW A;  5EFS A;  4JEV A;  1GC4 A;  1S09 A;  2W7D A;  1CQ6 A;  1V2E A;  4B98 A;  4PIW A;  2C7T A;  3WCN A;  2D7Y A;  3DYD A;  2X5D A;  4MKJ A;  2F8J A;  4IYO A;  1D7R A;  1IAY A;  2BI3 A;  1MLZ A;  3B1C A;  2QLR A;  1ASA A;  1UKJ A;  3AEP A;  3OKS A;  4XK1 A;  1X2A A;  4A6U A;  1E5F A;  3FZ7 A;  3CAI A;  3B8X A;  3WY7 A;  1M7Y A;  1BJO B;  1WYU B;  1GC2 A;  1DKA A;  2VMQ A;  1QIR A;  2DKB A;  2HP2 A;  2VLH A;  3FFR A;  1G4X A;  1RV4 A;  2V0Y A;  2VLF A;  3ISL A;  5TF5 A;  4F5H A;  2W8W A;  1AHG A;  4DQ6 A;  4RJY A;  4JEW A;  3MKJ A;  1CJ0 A;  2GQN A;  4F5I A;  3WKR A;  4DBC A;  4IW7 A;  3QN6 A;  3GET A;  1TAR A;  4LW4 A;  1CS1 A;  1AIB A;  3IHJ A;  3ACZ A;  3CBF A;  1LS3 A;  1DJU A;  1X0M A;  4ZM3 A;  2Z9V A;  3PGY A;  3ZRQ A;  3DC1 A;  4XQ2 A;  1W7L A;  2W7K A;  4CBR A;  4AH3 A;  4CXQ A;  1AHY A;  4GE9 A;  1UU2 A;  1CZC A;  5K8B A;  3BS8 A;  1N8P A;  2AEV A;  4WYE A;  4WLH A;  4Q6R A;  2BKW A;  2VMN A;  4IXO A;  1RVU A;  2Z67 A;  3I16 A;  3UWC A;  5F9S A;  4WYD A;  3GWP A;  4GDY A;  4OYT A;  3EI5 A;  4WXB A;  4U1T A;  4WYF A;  3EI8 A;  4ADB A;  1M32 A;  2AY5 A;  3JW9 A;  5EUN A;  3MC6 C;  4AO4 A;  2FNU A;  1AJS B;  3E2Z B;  3DOD A;  5J8Q A;  2YRR A;  4A0R A;  4E3R A;  2ZYJ A;  1ART A;  3QPG A;  3BCX A;  1DFO A;  3N75 A;  2BYJ A;  2CY8 A;  5EUD A;  1ARS A;  1IUG A;  4W1X A;  1AY4 A;  5BJ3 A;  4RLG A;  3H14 A;  1LK9 A;  1W23 A;  3NTJ A;  1C0N A;  3AV7 A;  3UE8 A;  5EQC A;  1WKH A;  1C7G A;  1E5E A;  1ASL A;  1ORD A;  1QGN A;  1SFF A;  3NRA A;  3WZF A;  2HUU A;  3E9K A;  3NNK A;  2OQX A;  5M46 A;  3BWN A;  2ZY4 A;  2GSA A;  4N0W A;  3HMU A;  3E77 A;  1TPL A;  2VMV A;  1YOO A;  4ZSY A;  4AZK A;  1EQB A;  2CST A;  1MDX A;  3AEJ C;  4BQ0 A;  4WD2 A;  1SVV A;  2E54 A;  1BJN A;  3A9Y A;  2W7G A;  2FN6 A;  1IAX A;  1ASM A;  1IX6 A;  5E5I A;  4OBV A;  3NDN A;  3FDB A;  2YCP A;  1I48 A;  2BYL A;  2EGY A;  3DXW A;  4R2N A;  4ISY A;  4UHM A;  4F5F A;  2W7I A;  5E3K A;  1AHF A;  3AAT A;  4EB5 A;  4UHN A;  2QMA A;  2YKU A;  3AEO A;  3RBL A;  1OHV A;  2W7E A;  1W7M A;  2VI8 A;  4Q75 A;  2RFV A;  1AMA A;  3ZZJ A;  3MEB A;  3VP6 A;  3ELP A;  1UU0 A;  3QM2 A;  2AY4 A;  4IYO B;  2Z20 A;  2FQ6 A;  3LY1 A;  5LHA A;  1PMO A;  1AHE A;  2W8U A;  2YCT A;  1RVY A;  4K05 A;  2C0R A;  3N5M A;  1CL2 A;  2G6W A;  3TFT A;  1ZC9 A;  4OCA A;  1MGV A;  3RQ1 A;  3JZL A;  1ARG A;  2HP1 A;  2R5C A;  3HDO A;  5FT4 A;  9AAT A;  2QB2 A;  4J5U A;  1LC7 A;  1D7U A;  1AKA A;  3GZC A;  5DX5 A;  4E1O A;  3PD6 A;  1IJI A;  1DJE A;  1M4N A;  2QB3 A;  2EH6 A;  3UAK A;  4ZAH A;  3LG0 A;  1V72 A;  4WYC A;  1BQA A;  3VK2 A;  1Z7D A;  1ZOB A;  1G7X A;  3RUY A;  3AOW A;  3HL2 A;  4OBU A;  4XEW A;  1LKC A;  1N2T A;  1QJ3 A;  5DJ1 A;  3VAX A;  4MQR A;  3FCR A;  1AIC A;  1KL1 A;  2AY2 A;  1C7O A;  3AEJ A;  2G7J A;  5EAA A;  1GCK A;  1BS0 A;  1FG3 A;  1YNU A;  1IX7 A;  4EFF A;  1GD9 A;  3K7Y A;  1LW5 A;  4GRX A;  5D95 A;  3L8A A;  1B5O A;  2D63 A;  2ZY5 A;  1AAW A;  2BIG A;  2EPJ A;  2W8J A;  2CJD A;  4LW2 A;  4EB7 A;  1VP4 A;  4OTL A;  1JG8 A;  1O4S A;  4OMA A;  3JU7 A;  1OAT A;  2VMX A;  4AZJ A;  3MAF A;  1M0O A;  3GJU A;  1IX8 A;  2Z9U A;  4AO9 A;  2BWN A;  3N4X A;  2AY7 A;  3LV2 A;  1YAA A;  2CTZ A;  2VMY A;  3DZZ A;  4JE5 D;  4TN4 A;  2VMS A;  3RI6 A;  4F5G A;  1XI9 A;  2DGL A;  4TV7 A;  5G2P A;  1D7V A;  3KE3 A;  5HXX A;  4XAU A;  1O69 A;  1OHY A;  2YKY A;  2TPL A;  3ASB A;  3M5U A;  3W1I A;  3PIU A;  4F4E A;  2JJE A;  1BQD A;  1QIT A;  2D66 A;  3Q8N A;  4PVF A;  2DR1 A;  3DU4 A;  4XJL A;  2AY9 A;  4XJP A;  2W7M A;  3R9A A;  4ADD A;  2CJH A;  3NU8 A;  2NMP A;  4ADC A;  1AMR A;  4MQP A;  2W7J A;  3CQ6 A;  3GZD C;  3WLX A;  4GSA A;  5DJ9 A;  3WGB A;  2BIA A;  4B9B A;  4WYG A;  3EI6 A;  3GZD A;  3P1T A;  1J04 A;  3FVU A;  2HOR A;  2CAN A;  4RIZ A;  2YCN A;  3GSB A;  1PG8 A;  1TAT A;  1P3W A;  3EZS A;  1AIA A;  1ASD A;  2D61 A;  3COG A;  4N0B A;  4MY5 A;  2VMU A;  1IVR A;  4ATQ A;  3CQ4 A;  3GR9 A;  2EO5 A;  3EI7 A;  1QIS A;  1S06 A;  1ASE A;  3I4J A;  3MC6 A;  1YJY A;  1WKG A;  4ZWM A;  4AOA A;  3F9T A;  2AY6 A;  2CH2 A;  3HBX A;  4F5J A;  2CIN A;  1BJ4 A;  2X5F A;  1GC3 A;  1SPA A;  4A0H A;  1ELQ A;  1WYV B;  1VJO A;  3FSL A;  4L0O A;  3BV0 A;  4O6Z A;  4R5F A;  4R8D A;  2D7Z A;  2YRI A;  4HF8 A;  2C44 A;  2VMR A;  1GEX A;  4BA5 A;  1KMJ A;  2E7I A;  1PFF A;  1PMM A;  1N31 A;  3BB8 A;  1TOE A;  4ADE A;  4LNM A;  4WB0 B;  2AEU A;  2A1V A;  3ZZK A;  2VIA A;  1AY8 A;  3BWN C;  4PFF A;  5LH9 A;  4U2H A;  1U08 A;  1T3I A;  3II0 A;  4W1V A;  2Z1Z A;  2Z61 A;  2Z1Y A;  1AAM A;  1QZ9 A;  1ASG A;  2R5C B;  1YIY A;  3MAF B;  3NYT A;  3NYU A;  3P6K A;  2HUF A;  1CQ7 A;  2EZ1 A;  2OKJ A;  3USF A;  2DGK A;  1W3U A;  1M0Q A;  2QA3 A;  4ZM4 A;  1AJR A;  2CH1 A;  3FVX A;  3JWA A;  4MKK A;  8AAT A;  2PB2 A;  1X29 A;  1I29 A;  2R2N A;  3PD6 B;  3FRK A;  4A6R A;  3TFU A;  3ECD A;  1V2F A;  1BT4 A;  2EYQ A;  4K2B A;  5G4J A;  2BI9 A;  3LWS A;  2ZC0 A;  3E2Z A;  1MDO A;  5FT5 A;  2BI2 A;  1AY5 A;  2ZSM A;  4ZAS A;  3ZRP A;  4RM1 A;  5F8V A;  4KYO A;  3A9X A;  1EJI A;  3RCH A;  3FQ7 A;  4JEY A;  4R5Z A;  2AY1 A;  2VMP A;  2GB3 A;  5HHY A;  5M4B A;  1O62 A;  1WST A;  4Y0D A;  2JIS A;  2FKI A;  1DGE A;  4RKC A;  1MLY A;  2ZY2 A;  1EG5 A;  4OC9 A;  1KMK A;  2WKA A;  3LVK A;  1SZU A;  2BWP A;  2VGZ A;  4BMK A;  1DGD A;  4MQQ A;  4XJO A;  4RIT A;  1GEW A;  2O1B A;  3AOV A;  1I43 A;  3FZ6 A;  3PDB B;  3ELE A;  2R0T A;  2HOX A;  4K2M A;  5EIG B;  4ZDP A;  1JS6 A;  3HLM A;  4RJ0 A;  1IBJ A;  3WGC A;  1CZE A;  3CQ5 A;  1BKG A;  4UHO A;  4HVK A;  3PA9 A;  4NOG A;  1KKP A;  5M49 A;  3BCA A;  3N4S A;  3K28 A;  2FYF A;  2VGW A;  7AAT A;  2GMU A;  3EIA A;  2YHK A;  2AY8 A;  4WP0 A;  3FDD A;  3TQX A;  2EZ2 A;  2YKX A;  2HOZ A;  4UQV A;  1JF9 A;  4WYA A;  2VMO A;  1WYT B;  1OXP A;  2D65 A;  4JEX A;  1ECX A;  4JEZ A;  2O7C A;  4KAM A;  1AKB A;  4EU1 A;  4IXZ A;  1M0N A;  3FTB A;  3HT4 A;  3OP7 A;  2HOY A;  1B9H A;  4QGR A;  1BJO A;  1WYU A;  1CQ8 A;  4XJM A;  1D2F A;  2VMT A;  3A2B A;  4MGR A;  4Y0I A;  2DKJ A;  2CFB A;  1LC5 A;  2DGM A;  1G7W A;  2XH1 A;  2CB1 A;  4P7Y A;  1ASB A;  2ZJG A;  3QI6 A;  1XEY A;  4I8A A;  3A8U X;  2CJG A;  4W1W A;  3QBO A;  3T32 A;  4P3M A;  3W1J A;  1MAP A;  4OT8 A;  1Y4I A;  2ZP7 A;  1FG7 A;  2OAT A;  3EUC A;  5BJ4 A;  1C4K A;  4W91 A;  4GE7 A;  4M2K A;  3NX3 A;  4RAE A;  4FFC A;  4GEB A;  1S07 A;  4GE4 A; 
#chains in the Genus database with same CATH homology
 2Z9X A;  3AEN B;  1B5P A;  3BCB A;  3KKI A;  3PAA A;  2W7F A;  3GBX A;  1D7S A;  4LNL A;  4Q76 A;  5FT6 A;  3MAU A;  4ZDO A;  4KXK A;  4H63 Q;  1TOK A;  1C9C A;  2GMS A;  4WB0 A;  1AMQ A;  1AKC A;  1SZS A;  3MBB A;  3ASA A;  2BHX A;  2OKK A;  3FFH A;  2JG2 A;  1OXO A;  2VI9 A;  4W8I A;  4JF0 A;  5FT8 A;  3G7Q A;  3NU7 A;  5HDM A;  1AHX A;  4K2I A;  1M0P A;  1GC0 A;  2C81 A;  2WK8 A;  1ASF A;  1H1C A;  3DR4 A;  1YJS A;  3FD0 A;  3TAT A;  2BI1 A;  3FQ8 A;  3MAD A;  5G0A A;  4H51 A;  2VIB A;  3FVS A;  2VMZ A;  4TMR A;  3BC8 A;  1H0C A;  1MDZ A;  2VGU A;  2YKV A;  3QGU A;  4ZWV A;  4WLJ A;  2VYC A;  3BWO A;  3F0H A;  5JAY A;  1KKJ A;  1S0A A;  3FKD A;  1VEF A;  3N0L A;  4A0G A;  2KFP A;  2FM1 A;  4CBS A;  1V2D A;  5AX8 A;  1WYT A;  2WK7 A;  3B46 A;  3E6G A;  1TOJ A;  4ITX A;  4JE5 A;  3RCH B;  3FQA A;  3ZRR A;  4IX8 A;  4LNJ A;  1DTY A;  2VGT A;  1ASC A;  2DOU A;  1TOG A;  3VK4 A;  4BHD A;  2FNI A;  5C6U A;  3LVL B;  4IY7 A;  1MAQ A;  4M2M A;  4E77 A;  2W7H A;  3HVY A;  1G4V A;  2ZUK A;  2ZSL A;  4IXS A;  4MSO A;  3FZ8 A;  1DJ9 A;  1M6S A;  3PDB A;  4ITG A;  2ZY3 A;  1X28 A;  2JJF A;  5KTB A;  2E7J A;  1FC4 A;  1GBN A;  3VOM A;  4F5K A;  2D64 A;  3F6T A;  3HQT A;  4F5L A;  4M2J A;  1SZK A;  5M4D A;  4PFN A;  2HUI A;  4RKD A;  1J32 A;  4Q31 A;  2JJG A;  4WBT A;  4A0F A;  3H9X A;  2AY3 A;  3H7F A;  3G0T A;  1BW0 A;  3KGX A;  1LC8 A;  2BWO A;  4ATP A;  1I41 A;  1WYV A;  3NYS A;  1KL2 A;  2Z9W A;  2W7L A;  2JJH A;  4CXR A;  2X3L A;  3R4T A;  1ARH A;  2X8U A;  3AEL A;  1CL1 A;  3E2Y A;  2W8V A;  3JTX A;  3N7N A;  3NUI A;  1S08 A;  2QSR A;  3B1E A;  1AMS A;  5D5S A;  4WXG A;  4EMY A;  2PO3 A;  2QBT A;  3AEM A;  2V1P A;  4J8L A;  3WX9 A;  2Q7W A;  3EIB A;  2BI5 A;  1ASN A;  1UU1 A;  3EZ1 A;  3VK3 A;  2JGT A;  2AAT A;  5E4Z A;  5EAV A;  3A9Z A;  3PJ0 A;  2VMW A;  3W1H A;  5G09 A;  2YOB A;  3QHX A;  4W5K A;  4Y0H A;  3DRD A;  1W7N A;  3AEN A;  3L44 A;  1GDE A;  2HZP A;  1ELU A;  4ZDL A;  1B4X A;  4WXF A;  3EI9 A;  3N4R A;  1TAS A;  1B8G A;  1AJS A;  4JF1 A;  4F5M A;  3RBF A;  2VGV A;  2R5E A;  3KGW A;  2PB0 A;  4LC3 A;  1JS3 A;  4A6T A;  1LW4 A;  4CVQ A;  3WCO A;  3PPL A;  3WKS A;  2W8T A;  2E7U A;  2WK9 A;  3D6K A;  3BN1 A;  2O0R A;  1ZOD A;  2VGS A;  3TCM A;  1QJ5 A;  3NUB A;  1YIZ A;  4ZLV A;  4FL0 A;  4ZSW A;  1GEY A;  5IWQ A;  2XBN A;  5G4I A;  3LVM A;  1TOI A;  1C7N A;  4A72 A;  4E3Q A;  3DXV A;  5EUE A;  2OGE A;  2WB6 A;  3DR7 A;  1ARI A;  3G8M A;  3JWB A;  3K40 A;  4UOY A;  3PDX A;  4DGT A;  1RV3 A;  3LVJ A;  3B1D A;  1B9I A;  3I5T A;  3IF2 A;  1O61 A;  1Z3Z A;  5G2Q A;  1SF2 A;  2D5Y A;  2ORD A;  4A00 A;  5EIG A;  2OGA A;  4BA4 A;  3AEM C;  3ATH A;  3E2F A;  5I92 A;  1AX4 A;  2BIE A;  5DB5 A;  1YJZ A;  1OHW A;  1BJW A;  5EFS A;  4JEV A;  1GC4 A;  1S09 A;  2W7D A;  1CQ6 A;  1V2E A;  4B98 A;  4PIW A;  2C7T A;  3WCN A;  2D7Y A;  3DYD A;  2X5D A;  4MKJ A;  2F8J A;  4IYO A;  1D7R A;  1IAY A;  2BI3 A;  1MLZ A;  3B1C A;  2QLR A;  1ASA A;  1UKJ A;  3AEP A;  3OKS A;  4XK1 A;  1X2A A;  4A6U A;  1E5F A;  3FZ7 A;  3CAI A;  3B8X A;  3WY7 A;  1M7Y A;  1BJO B;  1WYU B;  1GC2 A;  1DKA A;  2VMQ A;  1QIR A;  2DKB A;  2HP2 A;  2VLH A;  3FFR A;  1G4X A;  1RV4 A;  2V0Y A;  2VLF A;  3ISL A;  5TF5 A;  4F5H A;  2W8W A;  1AHG A;  4DQ6 A;  4RJY A;  4JEW A;  3MKJ A;  1CJ0 A;  2GQN A;  4F5I A;  3WKR A;  4DBC A;  4IW7 A;  3QN6 A;  3GET A;  1TAR A;  4LW4 A;  1CS1 A;  1AIB A;  3IHJ A;  3ACZ A;  3CBF A;  1LS3 A;  1DJU A;  1X0M A;  4ZM3 A;  2Z9V A;  3PGY A;  3ZRQ A;  3DC1 A;  4XQ2 A;  1W7L A;  2W7K A;  4CBR A;  4AH3 A;  4CXQ A;  1AHY A;  4GE9 A;  1UU2 A;  1CZC A;  5K8B A;  3BS8 A;  1N8P A;  2AEV A;  4WYE A;  4WLH A;  4Q6R A;  2BKW A;  2VMN A;  4IXO A;  1RVU A;  2Z67 A;  3I16 A;  3UWC A;  5F9S A;  4WYD A;  3GWP A;  4GDY A;  4OYT A;  3EI5 A;  4WXB A;  4U1T A;  4WYF A;  3EI8 A;  4ADB A;  1M32 A;  2AY5 A;  3JW9 A;  5EUN A;  3MC6 C;  4AO4 A;  2FNU A;  1AJS B;  3E2Z B;  3DOD A;  5J8Q A;  2YRR A;  4A0R A;  4E3R A;  2ZYJ A;  1ART A;  3QPG A;  3BCX A;  1DFO A;  3N75 A;  2BYJ A;  2CY8 A;  5EUD A;  1ARS A;  1IUG A;  4W1X A;  1AY4 A;  5BJ3 A;  4RLG A;  3H14 A;  1LK9 A;  1W23 A;  3NTJ A;  1C0N A;  3AV7 A;  3UE8 A;  5EQC A;  1WKH A;  1C7G A;  1E5E A;  1ASL A;  1ORD A;  1QGN A;  1SFF A;  3NRA A;  3WZF A;  2HUU A;  3E9K A;  3NNK A;  2OQX A;  5M46 A;  3BWN A;  2ZY4 A;  2GSA A;  4N0W A;  3HMU A;  3E77 A;  1TPL A;  2VMV A;  1YOO A;  4ZSY A;  4AZK A;  1EQB A;  2CST A;  1MDX A;  3AEJ C;  4BQ0 A;  4WD2 A;  1SVV A;  2E54 A;  1BJN A;  3A9Y A;  2W7G A;  2FN6 A;  1IAX A;  1ASM A;  1IX6 A;  5E5I A;  4OBV A;  3NDN A;  3FDB A;  2YCP A;  1I48 A;  2BYL A;  2EGY A;  3DXW A;  4R2N A;  4ISY A;  4UHM A;  4F5F A;  2W7I A;  5E3K A;  1AHF A;  3AAT A;  4EB5 A;  4UHN A;  2QMA A;  2YKU A;  3AEO A;  3RBL A;  1OHV A;  2W7E A;  1W7M A;  2VI8 A;  4Q75 A;  2RFV A;  1AMA A;  3ZZJ A;  3MEB A;  3VP6 A;  3ELP A;  1UU0 A;  3QM2 A;  2AY4 A;  4IYO B;  2Z20 A;  2FQ6 A;  3LY1 A;  5LHA A;  1PMO A;  1AHE A;  2W8U A;  2YCT A;  1RVY A;  4K05 A;  2C0R A;  3N5M A;  1CL2 A;  2G6W A;  3TFT A;  1ZC9 A;  4OCA A;  1MGV A;  3RQ1 A;  3JZL A;  1ARG A;  2HP1 A;  2R5C A;  3HDO A;  5FT4 A;  9AAT A;  2QB2 A;  4J5U A;  1LC7 A;  1D7U A;  1AKA A;  3GZC A;  5DX5 A;  4E1O A;  3PD6 A;  1IJI A;  1DJE A;  1M4N A;  2QB3 A;  2EH6 A;  3UAK A;  4ZAH A;  3LG0 A;  1V72 A;  4WYC A;  1BQA A;  3VK2 A;  1Z7D A;  1ZOB A;  1G7X A;  3RUY A;  3AOW A;  3HL2 A;  4OBU A;  4XEW A;  1LKC A;  1N2T A;  1QJ3 A;  5DJ1 A;  3VAX A;  4MQR A;  3FCR A;  1AIC A;  1KL1 A;  2AY2 A;  1C7O A;  3AEJ A;  2G7J A;  5EAA A;  1GCK A;  1BS0 A;  1FG3 A;  1YNU A;  1IX7 A;  4EFF A;  1GD9 A;  3K7Y A;  1LW5 A;  4GRX A;  5D95 A;  3L8A A;  1B5O A;  2D63 A;  2ZY5 A;  1AAW A;  2BIG A;  2EPJ A;  2W8J A;  2CJD A;  4LW2 A;  4EB7 A;  1VP4 A;  4OTL A;  1JG8 A;  1O4S A;  4OMA A;  3JU7 A;  1OAT A;  2VMX A;  4AZJ A;  3MAF A;  1M0O A;  3GJU A;  1IX8 A;  2Z9U A;  4AO9 A;  2BWN A;  3N4X A;  2AY7 A;  3LV2 A;  1YAA A;  2CTZ A;  2VMY A;  3DZZ A;  4JE5 D;  4TN4 A;  2VMS A;  3RI6 A;  4F5G A;  1XI9 A;  2DGL A;  4TV7 A;  5G2P A;  1D7V A;  3KE3 A;  5HXX A;  4XAU A;  1O69 A;  1OHY A;  2YKY A;  2TPL A;  3ASB A;  3M5U A;  3W1I A;  3PIU A;  4F4E A;  2JJE A;  1BQD A;  1QIT A;  2D66 A;  3Q8N A;  4PVF A;  2DR1 A;  3DU4 A;  4XJL A;  2AY9 A;  4XJP A;  2W7M A;  3R9A A;  4ADD A;  2CJH A;  3NU8 A;  2NMP A;  4ADC A;  1AMR A;  4MQP A;  2W7J A;  3CQ6 A;  3GZD C;  3WLX A;  4GSA A;  5DJ9 A;  3WGB A;  2BIA A;  4B9B A;  4WYG A;  3EI6 A;  3GZD A;  3P1T A;  1J04 A;  3FVU A;  2HOR A;  2CAN A;  4RIZ A;  2YCN A;  3GSB A;  1PG8 A;  1TAT A;  1P3W A;  3EZS A;  1AIA A;  1ASD A;  2D61 A;  3COG A;  4N0B A;  4MY5 A;  2VMU A;  1IVR A;  4ATQ A;  3CQ4 A;  3GR9 A;  2EO5 A;  3EI7 A;  1QIS A;  1S06 A;  1ASE A;  3I4J A;  3MC6 A;  1YJY A;  1WKG A;  4ZWM A;  4AOA A;  3F9T A;  2AY6 A;  2CH2 A;  3HBX A;  4F5J A;  2CIN A;  1BJ4 A;  2X5F A;  1GC3 A;  1SPA A;  4A0H A;  1ELQ A;  1WYV B;  1VJO A;  3FSL A;  4L0O A;  3BV0 A;  4O6Z A;  4R5F A;  4R8D A;  2D7Z A;  2YRI A;  4HF8 A;  2C44 A;  2VMR A;  1GEX A;  4BA5 A;  1KMJ A;  2E7I A;  1PFF A;  1PMM A;  1N31 A;  3BB8 A;  1TOE A;  4ADE A;  4LNM A;  4WB0 B;  2AEU A;  2A1V A;  3ZZK A;  2VIA A;  1AY8 A;  3BWN C;  4PFF A;  5LH9 A;  4U2H A;  1U08 A;  1T3I A;  3II0 A;  4W1V A;  2Z1Z A;  2Z61 A;  2Z1Y A;  1AAM A;  1QZ9 A;  1ASG A;  2R5C B;  1YIY A;  3MAF B;  3NYT A;  3NYU A;  3P6K A;  2HUF A;  1CQ7 A;  2EZ1 A;  2OKJ A;  3USF A;  2DGK A;  1W3U A;  1M0Q A;  2QA3 A;  4ZM4 A;  1AJR A;  2CH1 A;  3FVX A;  3JWA A;  4MKK A;  8AAT A;  2PB2 A;  1X29 A;  1I29 A;  2R2N A;  3PD6 B;  3FRK A;  4A6R A;  3TFU A;  3ECD A;  1V2F A;  1BT4 A;  2EYQ A;  4K2B A;  5G4J A;  2BI9 A;  3LWS A;  2ZC0 A;  3E2Z A;  1MDO A;  5FT5 A;  2BI2 A;  1AY5 A;  2ZSM A;  4ZAS A;  3ZRP A;  4RM1 A;  5F8V A;  4KYO A;  3A9X A;  1EJI A;  3RCH A;  3FQ7 A;  4JEY A;  4R5Z A;  2AY1 A;  2VMP A;  2GB3 A;  5HHY A;  5M4B A;  1O62 A;  1WST A;  4Y0D A;  2JIS A;  2FKI A;  1DGE A;  4RKC A;  1MLY A;  2ZY2 A;  1EG5 A;  4OC9 A;  1KMK A;  2WKA A;  3LVK A;  1SZU A;  2BWP A;  2VGZ A;  4BMK A;  1DGD A;  4MQQ A;  4XJO A;  4RIT A;  1GEW A;  2O1B A;  3AOV A;  1I43 A;  3FZ6 A;  3PDB B;  3ELE A;  2R0T A;  2HOX A;  4K2M A;  5EIG B;  4ZDP A;  1JS6 A;  3HLM A;  4RJ0 A;  1IBJ A;  3WGC A;  1CZE A;  3CQ5 A;  1BKG A;  4UHO A;  4HVK A;  3PA9 A;  4NOG A;  1KKP A;  5M49 A;  3BCA A;  3N4S A;  3K28 A;  2FYF A;  2VGW A;  7AAT A;  2GMU A;  3EIA A;  2YHK A;  2AY8 A;  4WP0 A;  3FDD A;  3TQX A;  2EZ2 A;  2YKX A;  2HOZ A;  4UQV A;  1JF9 A;  4WYA A;  2VMO A;  1WYT B;  1OXP A;  2D65 A;  4JEX A;  1ECX A;  4JEZ A;  2O7C A;  4KAM A;  1AKB A;  4EU1 A;  4IXZ A;  1M0N A;  3FTB A;  3HT4 A;  3OP7 A;  2HOY A;  1B9H A;  4QGR A;  1BJO A;  1WYU A;  1CQ8 A;  4XJM A;  1D2F A;  2VMT A;  3A2B A;  4MGR A;  4Y0I A;  2DKJ A;  2CFB A;  1LC5 A;  2DGM A;  1G7W A;  2XH1 A;  2CB1 A;  4P7Y A;  1ASB A;  2ZJG A;  3QI6 A;  1XEY A;  4I8A A;  3A8U X;  2CJG A;  4W1W A;  3QBO A;  3T32 A;  4P3M A;  3W1J A;  1MAP A;  4OT8 A;  1Y4I A;  2ZP7 A;  1FG7 A;  2OAT A;  3EUC A;  5BJ4 A;  1C4K A;  4W91 A;  4GE7 A;  4M2K A;  3NX3 A;  4RAE A;  4FFC A;  4GEB A;  1S07 A;  4GE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...