3FDFA

Crystal structure of the serine phosphatase of rna polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. orthorhombic crystal form. northeast structural genomics consortium target fr253.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
191
structure length
191
Chain Sequence
SKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Orthorombic crystal structure of serine phosphatase of rna polymerase ii ctd from fly drosofila melanogaster. northeast structural genomics consortium target fr253.
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
molecule keywords FR253
total genus 46
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fdfA01
4HNSA 4LE0A 3T38A 2YHBA 4RDCA 4ZPJA 1ABFA 1PNTA 1TVMA 3N53A 4RU1A 3SQNA 1JBEA 3O1HB 1LJUA 4F06A 2QV0A 4Z4CA 5FBHA 3I45A 5IUKC 5TPZD 5B3JC 4OBBA 1Z12A 1E2BA 2A9QA 4IMJB 1E6LA 2VK2A 3LUCA 1D1QA 1S8NA 3OLWA 4E7PA 3CFYA 1T34A 2GWRA 4N0PA 3E61A 1VKRA 3A10A 1RXEA 1JFSA 5BQ3A 5FWXB 3CLKA 3EODA 3QLVC 4LRQA 4JOQA 4N41A 1CHNA 2FEKA 3SNKA 1JLKA 2JBAB 3HDGA 4KVFA 3RVMA 2MYPA 3K4HA 2JVJA 2W42A 1KRWA 4IRXA 1AB5A 1DG9A 5KQPA 2WB4A 1QP7A 1KRXA 4LDZA 1IIBA 3QELA 3H5IA 3QEMA 4MGEA 1AB6A 2AYZA 1DJMA 3CHYA 3K9CA 4S04A 3LMKA 4RK7A 3L49A 1GLGA 4RXMA 1BDIA 1PEAA 1EWTA 3IPCA 3JPYA 5TPZA 1DRKA 2IYNA 1Z17A 5CHYA 5TQ2A 3I09A 1DCFA 2FN8A 3CNBA 3RVKA 3A0UA 3ROFA 1DBPA 3IDOA 4Z99A 3H5VA 5GOTA 3N0WA 4NICA 4OG2A 3C3MA 3O2QB 4DQDA 4MQFB 3Q41A 4RZSA 4W5NA 1HEYA 5IEJA 1URPA 4Q7EA 2NT3A 3OM1A 4W5RA 3KCNA 3TX6A 5JS1A 3OLXA 1H9CA 3F7NA 1E6KA 3VNBA 3H6HA 1JX6A 3SM9A 3TD9A 3EQ2A 1DZ3A 2NZVG 4Q6WA 3ROTA 3F6CA 3HS3A 3GBPA 3D02A 5JNUA 4WZZA 1M5TA 1JYFA 2PLNA 2ZAYA 4RXUA 4TN5A 2JRLA 2FVYA 2FN9A 2HQOA 5EWMA 1GCAA 5KWSA 4RY8A 4P98A 1FSPA 1TLFA 2FLKA 1NXVA 1NTRA 3D8UA 2VYCA 3H1FA 3IP9A 3M6MD 4JAVC 9ABPA 1LJLA 1JYEA 1D5WA 4DADA 1YS7A 5IUNC 2HQBA 2JBAA 3HDVA 2PUCA 1TM2A 4YGXB 4O1IA 2MSWA 1A04A 1WETA 3NNSA 1U2QA 4MR9A 1ZVVA 4F3TA 2ID9A 1SD5A 4MLDA 3O74A 4TMYA 5HKOA 1VLZA 4EGSA 4MYRA 2IDMA 2PL9A 1QP0A 3KYIB 2F8TA 3W9SA 2PUDA 4N0QA 5ABPA 4P1ZA 4QYWA 1ZY2A 3LUGA 4ZMRA 4KNYA 4RK5A 1OXKB 4G0MA 2CHEA 4EVSA 3O2JA 6CHYA 2LP4Y 5IULC 2IPLA 5JNVA 1U2PA 4OTZA 4MAAA 3JVIA 1EHCA 3HEBA 4E7OA 5HSGA 1TJYA 1DBWA 4ML3A 1DCMA 3GWGA 1JL3A 5TPWA 1USIA 4N76A 3JPWA 3RVNA 4HYEA 4D6XA 1JFTA 1QQBA 1CEYA 2PKXA 1BDJA 3HM9A 2LPMA 2XDYA 4W5OA 1JDNA 4Z9BA 4MR8B 2OQRA 2ZWMA 2GBPA 3MF4A 1M2EA 4QYMA 1E6MA 3DZDA 3O2SB 4YP9A 3S99A 4TLLB 5ED4A 1CYEA 3KYJB 3JS5A 1ZESA 3OO1A 4JB2A 4Z0NA 2MYTA 1M2FA 1U04A 5TQ0A 1ZGGA 4YCSA 3Q7SA 3G85A 1FFWA 4RV5A 3HV2A 5F64A 5C5EA 4MR8A 2QVGA 3RVRA 1NY5A 2FKAA 4EVQA 2JVKA 5CNMA 2RJOA 3O1IC 1Y1LA 1D2AA 1DCKA 1U0SY 4O5AA 3OQNA 2FMKA 2FQXA 2LBPA 3QX8A 1VPWA 3O75A 2PUFA 4OLBA 4KREA 4F11A 2FMFA 2LUOA 1ZITA 2R25B 2QZJA 4L4UA 1YS6A 3G1WA 4RK6A 1NXPA 2E4ZA 4MQFA 3MYYA 2NZUG 1USGA 3HO1A 2FQWA 2A9PA 2KYRA 4H3HB 4YRZA 4PE5B 2NT4A 1SXGA 3NHZA 1LK0A 3RVJA 3CS3A 3OM0A 3HCWA 2J48A 3LUFA 3NNDA 1MB0A 4QPJC 5FWYB 3C6QA 5KC9A 2QW1A 4LDAA 1C0EA 1XHEA 4PICA 2N9UA 1FFSA 3ILHA 4F12A 1NXSA 4MS4B 5DLEA 1P8AA 1MAVA 1PEYA 4WWHA 4W5TA 3T6KA 3CG0A 3A3KA 8ABPA 2F8SA 4GPAA 3UK0A 4KPYA 3ILYA 2QR3A 3N0RA 4MR7B 1Z2EA 3LKBA 1F4VA 3O1JC 1Z25A 3RH0A 3R0JA 3FFWA 5EWJA 3UUGA 4FB4A 4MR9B 2GX6A 1GCGA 1U8TA 3KLOA 1NXTA 4RY0A 5FBKA 4YS6A 2JCGA 4ZMSA 4Z9AA 4YWHA 1BA2A 2E4YA 3OMXA 3BREA 3SAJA 1EWVA 1ZHHA 4G97A 3GA5A 1DC7A 4G0XA 3N0XA 1YMVA 5BRAA 1FQWA 4MQEB 3JVDA 1A2OA 3RVSA 3KSMA 3DLBA 3IPAA 4ZYLA 3FMVA 1EFAA 1A0OA 1JF8A 1ISSA 3HK2A 4L85A 4Z4FA 7ABPA 1Z2DA 2FMHA 2HJ9A 2MSKA 4FE4A 3QEMB 4IF4A 4MS3A 4RWEA 5E3JA 1QPZA 5IC5A 4NCBA 2E4XA 2FEPA 4JA2A 4KQ9A 3E3MA 5DKFA 2E4WA 3BRQA 2FEWB 3JY6A 3GT7A 3H5WA 1ZH2A 4WUTA 4KK4A 3H75A 4EYGA 4RK0A 1QMPA 2QSJA 3GBVA 4NV3A 3T8YA 1K66A 3NHMA 3TO5A 3C3KA 3KS9A 3HJFA 1D4ZA 5HM6A 3Q7TA 1DC8A 2IKSA 1NXOA 3Q9SA 2H3HA 2CD7A 3B2NA 3LUHA 4JASB 4MRMA 4YO7A 4LZLA 3DBIA 3H1GA 2YHAA 1PNRA 2R4QA 4B09A 5IX8A 2L2QA 4YR7A 3GYBA 4XLTA 1OXBB 3LTEA 3H6GA 3LUJA 4S05A 2M98A 4RXTA 4F8JA 2PUBA 3N75A 4M88A 1W25A 5JNWA 4DN6A 1MIHA 3DLHA 4KK3A 1EWKA 3KG2A 3MA0A 2PUGA 4MLCA 2FXIA 5TE9A 2ID7A 3F6PA 4JP1A 4IGAA 2P9HA 3FGZA 3MM4A 4KV7A 3EQZA 3H1EA 2PE5A 2FMIA 4LE2A 1F51E 2AYXA 2QU7A 4ETIA 2DRIA 1UDRA 4RK4A 5TPWB 5TQJA 5CNJA 4HNRA 5IBQA 5KQGA 2CWDA 3DGFC 2P4UA 3HSYA 3EDCA 1B00A 2CHFA 3EAFA 3QLVA 1Z15A 3CZCA 4NCAA 3P9YA 2R48A 2WMYA 1W9HA 5JNRA 1SXHA 5EWLA 3LUKA 3H5TA 3OO0A 5JNSA 3CZ5A 2IPAB 3LOPA 5DGCA 2HPHA 1PUXA 2RJNA 2PUAA 1NXXA 4Z4HA 1ZN2A 5KI6A 3HXMA 2PJUA 3Q15C 1QO0D 2GKGA 1RXIA 4PEVA 3CRNA 2TMYA 1DBQA 3RVPA 3CU5A 2JK1A 2NUBA 3IP6A 4TLMB 5EWJB 1GUBA 5GQSA 3H5OA 1BAPA 1QNLA 3JTEA 3KLNA 4XXHA 2E4VA 3IP5A 1MVOA 3GV0A 4WXEA 2B1JA 3FFXA 4JB0A 5CNIA 1ISRA 4EUKA 3F73A 4HNQA 4MS1B 4ETMA 3MMNA 2VUHB 4RY9A 5EWLB 4EYOA 1KMIY 5HQJA 2L19A 2I6FA 3Q7RA 2L17A 3MQ4A 5JNTA 4KRFA 5D2CA 2X7XA 5EWMB 4RS3A 4ETNA 2MYUA 3RVQA 2QVCA 3T95A 3LUAA 3VNAA 5BR1A 4NQRA 2E4UA 3BRSA 3KHTA 2FTKE 3HUUA 3QELB 4PYRA 1BVHA 1VRVA 2MSLA 3LUDA 3NNNA 4YV7A 3N6VA 4RKRA 4UHJA 3TMYA 4MS3B 1BDHA 4Z4GA 1Z26A 1GUDA 1JHZA 4WT7A 2HQRA 3MIZA 3GL9A 1QQAA 1ZAYA 1RNLA 2JB9A 4YLEA 4LE1A 1SRRA 5IUJC 4D74A 4G86A 1SXIA 3EJWA 4G0ZA 1ZH4A 4H3KB 4QICA 5DCLA 4G0OA 1RPJA 3OMWA 4EYKA 5FWXA 3TB6A 3HZHA 3OLZA 3M9WA 3QEKA 4O1HA 4CBVA 1TMYA 3LFTA 4G0QA 4N03A 4EVRA 5JS2A 3OLYA 1NXWA 5T3YA 1DP4A 1P2FA 1Z13A 4MRMB 2A9OA 5C5CA 2PL1A 3A0RB 2R47A 2WY2D 1QKKA 1Z16A 3C3WA 3IP7A 3OQOA 4RK1A 3URMA 2M1ZA 1RZRA 2QXYA 1I3CA 4MPTA 2FLWA 3OLVA 4H60A 1LBIA 1ZDMA 3KJXA 3CKMA 4G0PA 5T7BA 4KMRA 3M9XA 1ZGZA 1QO0A 5BRJA 1YIOA 1YK0A 4Z4IA 4IILA 1YK1A 2LIVA 4Y9TA 4D6YA 1P6QA 3O21A 5CNKA 4OATA 3RQIA 1FFGA 4G0YA 4EY3A 4OLAA 3FDFA 4MS4A 2Q5CA 3FFTA 4ZJPA 1DRJA 2PMCA 1XHFA 2BGGA 5I4CA 3BILA 4N47A 5FWYA 1L5ZA 2WWVD 1R8JA 2RDMA 3OQMA 3H5LA 3QLUC 4LX8A 5TQ0B 1JFVA 1LBHA 2GI4A 2MYNA 3I5AA 3UKJA 1RZRD 1XWWA 3KKEA 4XAQA 3HVRA 2IPMA 2JVIA 2FW0A 4RKQA 1J56A 1USKA 4KZKA 2WRZA 3SG0A 2V0NA 3RVOA 4KQCA 4RSMA 3EULA 1PHRA 5KQLA 3CG4A 5PNTA 4KFCA 1D1PA 3BBLA 6ABPA 1YVUA 3NBMA 3LKVA 1JWLA 4W5QA 1APBA 4PZ0A 4Z4EA 2FSPA 1KGSA 1QP4A 1C4WA 2FQYA 3GRCA 4UHKA 2B4AA 5DTEA 5TQ2B 3SY8A 4WXMA 3CTPA 3KTOA 2A9RA 4IMIB 3QX9A 1Z18A 3QLTA 1L5YA 3I42A 4MQEA 2H0AA 2O20A 4XASA 4XFKA 5IEBA 1JH9A 2L18A 2VUIB 4EYQA 4FE7A 2WJAA 2RGYA 4MS1A 3QK7A 1JDPA 3HUTA 1P6UA 5KC8A 1K68A 3DGEC 2IOYA 3L6UA 3QLUA 4Q6BA 2PUEA 1NATA 2HSGA 2WJWA 3C97A 5B3JA 3RVLA 5KQMA 1M5UA 4XARA 3N8IA 4GNRA 3EGCA 1ABEA 1MB3A 1EAYA 2OENG 4MR7A 1YTUA 2IPNA 1YMUA 2PAFA
chains in the Genus database with same CATH superfamily
1S3GA 2B2NA 2EYQA 1DWQA 4D4JA 4MUYA 4DDTA 3WGIA 2X22A 2YASA 3LBHA 5AVWA 4E5NA 5AVYA 2ILVA 1OGYA 4AJ4A 3AF4A 1AC5A 4MWZA 1V16B 4PPNA 1YOVA 3NV7A 3WIDA 4D0LB 1RYZA 4GDMA 4GPEA 2A9QA 2BD0A 3GROA 3NBUA 2C61A 3CNOA 3ZQ6A 3MRTA 4JI0B 3IL2A 3IDSA 2N3ZA 3OEEA 4YPOA 3KQQA 1JHDA 1VBMA 3NORA 3OA0A 3A10A 4CM8B 2YZ2A 2AR7A 1XEWY 3HKEA 3C15C 1FW6A 2GRUA 3DBLA 1E4OA 2D2VA 5LQCA 2WIAA 4WY2A 3N2KA 3E4DA 3RTEA 4YRTA 1T2FA 2H16A 1G5QA 4FKMA 1PQYA 2MYPA 3U6BA 5L3SA 4J1TC 3L7OA 5BSRA 3RU7A 2P75A 4YJFB 3MOGA 2O8FA 2ZSDA 4HTAA 2AOTB 4L57A 3O5AA 5FUVA 2YKGA 3JQGB 2JFBA 4TRJA 2CLHB 3EXG1 1YBAA 5L3ZA 1G8KA 1GUAA 3GD7A 3IPLA 3KLMX 4K9KA 1XEXA 1PFYA 2YRFA 2ECQA 2WE7A 3N05A 3IMEA 5AXDA 2AT1A 2Q5FA 4UNNA 1H0KA 1BDIA 4RIHA 1P91A 1DRKA 3H2KA 4U7PB 1CHDA 1L5HB 1N5LA 3K0FA 3EVTA 4M6WB 1B3BA 3QVMA 3O95A 5EZYA 1E8MA 3RHTA 3QHQA 3RVKA 3WLSA 2FHPA 2XF8A 1CVIA 2XDWA 2J4DA 3FWPA 3H5VA 1BDMA 4II3A 4ATNA 5D1HA 4K87A 1NG9A 4W5HA 4B6EA 1C9DB 3N0WA 3SVZA 2A58A 1P5ZB 5ALZA 2G1PA 2X77A 4ENWA 3GAMA 1Z0DA 3SR4A 5HS6A 3Q3EA 2QG9A 3FHCB 3HM2A 2OAGA 1DAEA 4P92A 3AEZA 4BO8A 1YNSA 5BXYA 1M1XB 4CCAA 5JCOC 4LXHA 3CN9A 1GO2A 4PQYA 3F7NA 1E6KA 3HA5A 4L28A 4CTOA 4LQCA 1CDZA 5AICA 2HX1A 1PJAA 3LQ4A 3V4ZA 1BSVA 5D5PA 3F6CA 2AFRA 3ORQA 2HA2A 4N5NA 1TJ5A 2FK8A 1Q50A 4WZZA 3FPGA 2OKCA 4RXUA 1WUTA 2JRLA 2HQOA 3JXEA 5T6BA 2QVYX 3CWZA 4ZAYA 4C0SA 4FR5A 3UC9A 2F9LA 1KMNA 3FUVA 2G8NA 4OREX 4G2TA 3CLTD 5EIEA 1CUDA 2XVYA 2PVSA 3C5CA 2BTQA 3K9BA 1VGVA 4C08A 3HA7A 3TOZA 5C32A 1I3LA 2DAPA 4KNWA 3UH0A 5ALWA 2XGSA 4Q16A 1FCJA 4DVJA 2P2DA 9ABPA 1EFHA 2GJ8A 1R3DA 2XT6A 1V5WA 3HDVA 3T94A 1GZHB 3MWDA 2I4IA 2Z2IA 4WECA 5ECWA 4EQ6B 1NFFA 1ECLA 4OHPA 4DLAA 3GBSA 1UKYA 3N0VA 5JWHA 1L4FA 1QK5A 3AYXB 3PGVA 3PI6A 4Y9DA 4RETA 4DLPA 2O6HA 4ID9A 4E2WA 5JMWA 1FJ2A 3OEWA 3IHWA 3MBKA 4Q47A 2C8LA 5DYYA 5AM1A 4I5GA 4BVKA 5HHTA 1T5LA 2HUPA 4DREA 4QT4A 1DRUA 1C3OA 2F43A 2ZWOA 4FEAA 4KODA 3AGQA 2HK7A 4NIMA 4JY7A 4QBFA 4Q4AB 2R6JA 4TS1A 3GFVA 1EVIA 4JLSA 3VRHA 3LBIA 3O4FA 1I3MA 1LS6A 4G0MA 3ZV6A 1E61A 1SIBE 5JNVA 3CT6A 3LD9A 3AFGA 4XQEA 2W6PA 2ZVPX 3WRXA 3FJOA 4CLXA 1ZUNB 3BTUA 2CN1A 4DRXA 1H0SA 3S3TA 3HB9A 2D2FA 4BNYA 4PNHA 1P4GA 4MKIA 4UCWA 4CI9A 4EELA 2QORA 3K6SA 2PZGA 2Q3FA 4YRJA 1QHFA 1A4XA 5KNCD 3EGDA 3IBSA 4HR7A 3KQHA 4DDMA 3G6WA 1SXJA 3G2NA 4EITA 1TNDA 1AUXA 2PKXA 1QTQA 4MI6A 4WY8A 2YMMA 2LPMA 2COUA 4LDQA 2ZXEA 4TROA 1PG2A 5ENDA 2WF5A 2GVNA 2WQZA 3ZWAA 4BNVA 3ZLJA 5CYPA 1YZGA 1N3YA 2HPVA 3VR0A 2OHJA 3DEYX 1D2EA 2WILA 3HLKA 3QYPA 1Q1NA 1NMYA 1QG2A 5AWFC 4CM3A 4UJ3A 3LA8A 4L5AA 3NUQA 2NO0A 4O33A 1WZCA 3OZXA 1JE1A 3NWJA 2HXGA 3GGOA 4DBLC 2UYYA 5G2OA 1HE3A 4KXLA 1ZNXA 2IHUA 3LQKA 4A26A 1A77A 1IXZA 1XCLA 2ZRJA 3NGLA 4P34A 3ZGZA 1E1CB 2JATA 2QVGA 2ZDQA 2ATEA 4WLNA 1DAHA 1FMJA 1V47A 3UAGA 3LHIA 2H65A 2WSLA 4IH1A 4ALLA 1D2AA 2Y71A 1U90A 1O89A 1OXUA 2D1YA 3ED1A 2UKDA 4N39A 4FSDA 1QSGA 4F71A 4CMEC 1M2VB 3AF1A 1OPXA 1TMGE 2C2KA 1QGOA 1RQRA 3QPVA 4ZA2A 4ZI7A 4HDCA 4BLUA 1O9GA 2R8YA 3ENZA 1ZH6A 3LG2A 1R50A 4DCOA 3BZWA 3IQDB 5ALSA 2DKOA 3U44B 3T7DA 3SFVA 2H00A 3W5AA 1EBBA 3GB9A 5T8KA 4EPYA 3IIKA 1K8YB 2NXEA 4EX6A 3SXPA 3BK7A 2YJTD 2FQWA 2YWEA 2C0CA 1FDRA 2J07A 1Q1AA 2KYRA 4L9AA 2CKMA 3VHLB 3UWKA 5J3JA 4N3AA 4J7AA 4RTRA 3RVJA 4FWTA 1FDSA 2O3UA 4P3KA 1F06A 3JYLA 2CVFA 5IJ0B 2VTVA 2W98A 1UINA 4HDRB 4JV5B 5DNUA 2M1XA 1T1GA 1Q16A 2JDIA 2CT8A 1OV6A 3ZXIA 2HA4A 5A6VA 2GCOB 3CH7A 2EDCA 4MQ5A 4CLEA 1YL6A 2AC2A 2B94A 4HQ0A 5JZVA 1XBTA 4B6JA 1KWKA 3LL4A 1QGAA 3CURA 3WOHA 2V7BA 2QR3A 4ENUA 3J81k 5M5BA 1U0EA 1JRLA 3TLKA 4BNIA 1V2GA 4AYWA 3KRTA 3CZAA 2HEGA 2PZJA 3OQ6A 4CIDA 3GRRA 4DIBA 3MCZA 4P8RA 2YDYA 1DKMA 4INJA 1ZCZA 5DNAA 4RELA 1SMKA 1CW2B 1LPOA 2XNDA 3EXEA 3N28A 4ZZ0A 5ES4B 1IN5A 3KSDO 2C9ZA 3CKYA 4AJPA 4FNGA 4XD7D 5IN4A 5FD8A 4IDCA 2XVAA 1ZQ1A 4ZYUA 4XM0A 1V11B 3MINB 1R0KA 3ZGXA 2R11A 2VSNA 3DLBA 2W2TA 4O0MA 2OG1A 2PR7A 4F9EA 4PNPA 4ZHQB 2QTRA 2WD9A 1ISSA 3W5BA 1XB2A 2O07A 1BGWA 1W2HA 2WVJA 3GX1A 3QI7A 1ZUHA 5DCWA 4MUHA 4A6EA 1GTVA 1V8OA 4OX9B 1CQWA 1MX1A 5TNXA 1CDDA 1PWZA 2DT5A 4JA2A 4MKGA 2VEOA 3AY3A 3NVAA 3O8QA 4XDHA 3UG7A 1XZPA 2OORA 3FVQA 2P9FA 3MMZA 4OH7A 4NKRA 5G1NA 2POCA 3MW8A 2PFGA 2YMQA 4GG1A 3FTCA 3VYUB 2BFBB 3FUWA 2Y1OA 3RKRA 5BUZA 4M0LA 4LDPA 3ELUA 1QLWA 4PZCA 1B3RA 3STUA 4AZTA 4FE3A 1D4ZA 2P30A 2F55A 1EGMB 4U9HS 1FFXB 2WKQA 3B70A 3HBNA 2EP8A 3PNSA 2IKSA 1SC9A 3M2PA 4FYXA 1NT2A 1K0FA 3L02A 3ZK8A 3PPVA 4BVFA 1Q0RA 4LUCA 5CXUA 1JPNA 2C5FA 1KSHA 3FR8A 3L9XA 3ETGA 2ASVA 3CLVA 4YR7A 5IX8A 3A25A 5B5SA 3TLGB 4XLTA 1UBTS 1J8VA 2NGRA 1UMBA 3LTEA 2XRMA 3QP9A 3ZGNA 3N75A 1CF9A 1DE0A 3WJ7A 4YMGA 1EZ4A 1KJNA 3NDBB 2Q5LA 3MA0A 2FX3A 5EINA 4EMBA 2X5XA 5EPUA 1TI7A 1SUBA 3ESYA 3QFFA 4EG1A 2P9HA 4YAIA 1M75A 2A5FA 4IZHA 4J7CA 1G0OA 4QAQA 4EFMA 3EQZA 1GA4A 1BS2A 1U8AA 3ZY3A 4QPDA 4EWLA 1KJZA 1Y1SA 1YQGA 3JYOA 3KNZA 3E8MA 3RS8A 3S8EA 4MP8A 1TXGA 2DRIA 1ZN9A 3EOAI 4KLZA 5TQJA 1X77A 1M2OB 1ZOLA 5KQGA 1PNOA 3BIJA 2X42A 5CDHA 4BO7A 4BRSA 3T3NA 1UBOS 1GSOA 3W8RA 4F5EA 1OIWA 1H2BA 1FS5A 2HRBA 1EI9A 2PRIA 3K0HA 1I51A 2O59A 3QKUA 5CBPA 4G9GA 4CUZA 1XVTA 3TJRA 1JNYA 1YUMA 1L7XA 2P11A 1NVAA 4MYUA 3VPDA 1G18A 2WDZA 2RJNA 5K03A 1NXXA 4RIGA 3DULA 3PXDA 4JLUA 4BYGA 3U9LA 2FWRA 5T4EA 1I2MA 3WR5A 1JDVA 4CNBA 1ISPA 2W6CX 4GWLA 3LO8A 1T4DA 4I8IA 3UGKA 5ALTA 1YR1A 3DKIA 1QVZA 5ALDA 2GAAA 4PCLA 3UCEA 2B1JA 4QJ5A 2QYTA 3CBGA 3U61B 2WD8A 1BXKA 2XIJA 3MMNA 4EHHA 1E2PA 2B30A 3PX7A 4YPVA 2HN9A 1YZKA 5JXJA 1SU7A 1UFKA 3JYHA 1RXSA 4JBWA 4J16A 1W52X 4TSKA 1DLIA 4US2R 1CUUA 4XI9A 2FY8A 1SM4A 2QN8A 1M72A 2ZCJA 5FHQA 3HB1A 1R66A 1Z34A 1ISJA 3H1TA 3H2SA 5K3FA 1S3SA 1VMAA 4X64B 2QYSA 1MZVA 3F46A 3RREA 3DNPA 4W5OA 1BHJA 4JL8A 4JI3B 3S44A 2ONCA 4UBJA 2XZPA 3QVSA 3OLCX 4WINA 4NBNA 1EXMA 1MB2A 3IOYA 1KHTA 3TNDA 5J5CA 1JHZA 1QPGA 2LGJA 2R4UA 1JHPA 4WT7A 4ZRMA 3ZK7A 1USVA 2BJVA 1LPNA 2Y2VA 1YZYA 3A1TA 2XBMA 4GKKB 2CMGA 5I8ZA 2HGZA 4DLSA 5FOUA 3NHSA 5B1EA 4PCAA 1B1CA 1FMCA 2FW6A 3IX7A 1FLAA 2VKQA 1MV8A 3TK1A 1JNXX 1RPJA 3AGPA 3KOYA 3WLIA 4BNTA 3UIEA 1DJLA 4EUSA 3KOXA 3ENQA 2W6NA 3OLZA 4HGYA 5FWXA 3ZZUA 4FYIA 3CRVA 4ACBA 5I01A 1SZCA 4EVRA 1V4BA 2VPIA 2GCGA 3TD6A 4BFCA 4NOMA 2OORC 2WC1A 3FOZA 3TR5A 3GT3A 5AESA 1XU7A 4M99A 4OFXA 2AG5A 4F4FA 1M54A 2M1ZA 2BISA 2X4IA 3D8NA 3N8DA 3TUZC 3WAJA 2A7QA 3A4NA 1R64A 3O8RA 4MPTA 5EZQA 2J33A 3ZY2A 1HETA 2V8BA 4FDMA 3P97A 5IT9A 2CXHA 1RHUA 5IBRA 3V9AA 3K9LA 4QM6A 1ONPA 2EL7A 1TK9A 2NZYA 3B6JA 4K9MA 3RC9A 3KOMA 3CLRC 1V6AA 4KE9A 5K5EA 4J1TA 4G0VA 4XPIB 3OCYA 3O21A 3UJDA 1R6TA 1ZEJA 4HPWA 4IXWA 3ABZA 2RK6A 2QLMA 5HF6A 1W59A 3T1HB 1DRJA 4F2PA 2V58A 4XEUA 2HMWA 3RTGA 1L5ZA 4XUEA 3FRHA 2XRZA 4ZOAA 4XQCA 3VR6A 2LXNA 5TIIA 3VYVA 1GFSA 2W6MA 4MVJP 1JR4A 2VK1A 3VR4H 4UDOA 2ZBGA 1WV0A 3DE1X 3QYAA 4HGPA 1JR3D 5FH9A 2XQFA 2ZITA 2B1GA 4LVCA 5ITWA 4QUJA 5NLLA 4GC9A 3QKRA 2NAFA 2FZVA 4WOBA 1ZXXA 1KSJA 3ZJYA 5LR6A 4K3UA 4B3RB 2OCBA 1JKFA 1R5NA 1OXVA 1FJHA 2IP2A 2VUTA 2XKBA 2X0FA 4CKZA 2R60A 3PG5A 3BBLA 2ON6A 2WNSA 3ETEA 4HLUA 4OLHA 2BFDA 3LP5A 3QU5A 3OC6A 3TLGA 3NM4A 4BCDA 3GRCA 4JJGA 3F6EX 3ZGVA 3MJRA 1L7AA 2ZYGA 1UM8A 4JI7B 1T5DX 1D1TA 4C0KA 2OY0A 4NABA 4DA8A 2GZ1A 2REQB 3S2SA 1JH9A 2WLSA 1JIKA 1L8XA 5EIOA 2VUIB 4GPD1 4UUNA 1S01A 1UZNA 4LJ8A 5FI5A 3RM3A 4EL0A 3KP1A 2RGYA 3RJZA 1NNSA 4PYLA 1OLOA 3K05A 4NV1A 4LV5B 4LWPA 5FV7A 2PFKA 1G8PA 5HRAA 3C85A 1VL1A 2ZYUX 3IV7A 4PLGA 3EZGA 1Z3CA 5IKEA 5LFAA 1FK8A 2HSGA 3UATA 3UM9A 3ZE1B 1SKAA 2D5LA 2HMVA 4IDHA 5KQMA 2PT6A 3FY4A 2JJYA 3K9HA 4QTTB 5I7EA 2PA3A 3KR9A 3N9IA 1HLDA 3NPMA 1BOFA 2WJPA 5I9MA 4DC9A 4J6FA 3C7TA 2GD1O 3SCZA 2C5GA 4MV7A 2J3JA 4BWFB 3WWCA 1ZJ6A 2P5UA 5TGDA 1H1LB 4GZ5A 3V4OA 4BMSA 2WPNA 3QBTA 1ABFA 1DAIA 3N53A 2XOEA 5EHIA 3NHWA 3FWZA 4D9IA 3SZGA 4AKIA 3VH3A 2J7PD 1Q0ZA 2C82A 4JUBA 3SEQA 4FI3C 5E4YA 4NWIA 5ALLA 3PFCA 3AVTA 3QVLA 2VT7A 4FGUA 2V5AA 1L1RA 2HRZA 3WY9A 4A2QA 4ERXA 1BFUA 421PA 5KPDA 4TV8B 1P2GA 1D1QA 3M1LA 3INRA 3AU8A 1A2KC 4QUHA 1J39A 1Q44A 1T9DA 3QW2A 5C2JB 1N92A 2YXPX 1VIVA 4U6SA 2M6KA 3R20A 3TCXB 1Q1QA 1PP4A 3PDHA 1N0VC 2OCLA 4L8YA 3COJA 2W5UA 2Q2VA 1KEVA 3M70A 4UUPA 3IBCA 5BMVA 4YY3B 1E9DA 2WUDA 5J5VA 3NJ4A 4BJ5A 1PFKA 3LQYA 3TFWA 1IOWA 5FUWA 2Y1FA 3G3EA 3LIIA 4NE7A 4QNNA 2VYND 1T3ZA 3BSFA 3LT2A 1AS3A 3BRWD 3ZZTA 3VNSA 5HS4A 5MN4A 4C89A 2BGKA 3IP8A 3LPCA 1TA0A 1X94A 2YX1A 3CRMA 4RC9A 2WDPA 5CIWA 5DVZA 3L49A 1N5RA 3K09C 4PVDA 4YASA 2CLOB 1P5JA 2FRDC 1CDOA 1N8TA 2HA6A 2QPLA 2YUTA 3RI3A 1QVRA 4BEVA 1G98A 1LK7A 2GILA 3ROFA 4UZSA 4GLFA 3IDOA 3LZCA 4D96A 3G9XA 3LWZA 1U3TA 3CNEA 3FSJX 3D7RA 3NONA 3X2EA 1IPHA 3AHFA 3VTZA 1JHVA 4X61A 1RI1A 4CFSA 3RUFA 4HZIA 1T9ZA 3ZWDA 4DWOA 4OQZA 2QXTA 5BMVB 4CKWB 1Z73A 1ZP6A 2OGTA 1XNQB 4W5NA 3NWPA 2HMTA 3NI2A 3FN4A 3R9KA 4C1BA 3CLUC 3CW2A 3DZ8A 3LWNA 4C76A 4LA4A 5BV7A 2WYHA 2ODAA 3NDJA 1GGNA 2ZSJA 1DWPA 3BG5A 2CNLA 2HIGA 2O2EA 5GM2A 3JATA 5SY6A 2H4XA 4JLDA 1E32A 1EFDN 2QGFA 1E58A 2V74B 3GBPA 3HS3A 3JQDA 2A5YB 4HYTA 4MKHA 5FQOA 3ZY4A 5IC4A 3DE7X 5E9AA 3RS7A 4MKRA 1A9RA 4DS3A 4Z3KA 1XKLA 3BA1A 2HWXA 4ID3A 4CN9A 3WJAA 2G4LA 5EWMA 1R4NA 1KQFA 1ZAYA 2X3YA 4RY8A 1C7RA 1ECBA 1ST2A 2I65A 4ZI7B 2H52A 4M1QA 5E38A 1WEKA 5HX7A 3W5HA 1ZD5A 2QRKA 4F97A 3OBIA 2WU0A 5ILGA 5BN5A 2VRCD 1U7PA 3C39A 1SWWA 4JL5A 3EIQA 3PGKA 4UQPA 1N7HA 5KQRA 2BTEA 3RAEC 1YS7A 4Y1GA 5T67A 3JQAB 1TM2A 2JFVA 4JU9A 3AR8A 4R01A 2MSWA 1XL0A 5LOVA 1SCKA 3RR2A 5JPDA 2UXDB 2FR1A 2NTJA 4KX5A 3I4CA 2RC6A 3QZUA 2OCDA 2UYOA 1U0GA 1QYDA 1QGZA 4DQLA 4GBMA 5B6IA 1COWA 4FGKA 5F73A 5CITA 1YQQA 1NDUA 2W48A 3KSRA 3KYIB 5C4IA 2F8TA 4FSHA 3R7WA 2RHCA 4YRRA 5LJLA 3TIFA 3WX0A 2EJCA 2LP4Y 5IULC 3G1UA 1YFZA 1L4LA 1XLWA 1JU4A 2H2AA 4QYIA 4ZT6A 4KLNA 1U1GA 5K0NA 3OP4A 4WJZA 3SZOA 5K4HA 4P7KA 3C8DA 3TTVA 1T10A 2ZI4A 4DQVA 1EA5A 2GBLC 2XVMA 3O31A 2QRNA 3WKDA 4L7QA 3MT8A 3GVCA 4ML3A 2Y66A 1ZK3A 1CP2A 5HUHA 1C3OB 4TKVB 4D6XA 1WJGA 1NVUQ 1AO3A 3PQFA 4UFPA 1JQ5A 1SY7A 2AJDA 3JYQA 4BP3A 4BZZA 5JBQA 3DXYA 4YYEA 4EX7A 4RTOA 4TT8A 1JKJA 1RFGE 1SUFA 4D1YA 1K08A 4MR8B 2ZP1A 3A9VA 4BX3A 3AP3A 3I2KA 1DIAA 5CT5A 2RHJA 5CPFA 3M1AA 3WQHA 2GD0A 2ID8A 2O9JA 2CDRA 4RD2A 3WYAA 4DYHA 1HE8B 3DVAA 5I4IA 2AW5A 1GDHA 1OBHA 5K09A 4H4CA 2XVZA 3RRZA 1GR0A 2ZIXA 3IRUA 1QK3A 2QP3A 4PRKA 4B76A 2WD7A 4PGAA 1K86A 4IIXA 1P1FA 3D6VA 4Q3BA 1HYBA 4ZT2A 4B5KA 2XPCA 3JQGA 1NFQA 4KQEA 3PD1A 3ZW8A 2O5RA 4MVJF 4CODB 2F9MA 3QF4A 4GP9A 4IJQA 3W4JA 3ASVA 3WMEA 3NMUF 1FLVA 3GMIA 3V7FA 2Y6UA 3ICPA 3P52A 3R0QA 5BOSB 2DWPA 1J7JA 2C8VA 2J08A 2B5VA 5LCXA 1X7HA 1H69A 1PL7A 1Y1LA 1ZGJA 2X8BA 3OT1B 1S3FA 4QUIA 5DSZA 1LTQA 4BVEA 4QOHA 3CSSA 1Z6ZA 1SHTX 3H86A 2Z6VA 4KREA 1N3LA 5T8KC 2QPOA 4AMZA 2PUHA 2JD0A 4FTWA 1QIGA 2XDQB 2X8LA 3LVFO 4WKNA 4GF5A 4YHBA 1TEVA 1X1QA 3PYXA 4ND7A 4RY2A 1UEXC 2UVPA 4WJKB 2IY7A 3MC1A 4HI0E 4YRZA 3AUJB 1AX9A 4IWNA 3PC8C 4YO8A 2OHVA 2FKNA 5C0OE 1WMAA 5LBTA 4X65B 3LUFA 4TV9A 4BE7B 2CJFA 3EUEA 2GWHA 1R4NB 3AI3A 4AZWA 4FYJA 1H2ZA 2B8JA 1K6IA 1TYAE 3C3BA 3C6QA 3PITA 2AJLI 4F1JA 4LSGA 5BPHA 1E98A 1Q11A 1AD2A 2JKYA 4PZEA 1S5PA 2OFWA 4B85A 2FPRA 3G2QA 4F12A 5LWHA 4QOFA 1RJDA 2YNMD 1E1MA 2BHNA 3BJIC 4WNYA 3QWHA 4LI0A 5EE0A 2I4OA 1WNFA 3WQRA 2E5FA 3FPFA 2ZJ4A 5BSTA 1G8GA 1R4MB 4BO6A 5KVCA 3EOBI 2J5BA 1JU9A 4FXOA 2I34A 4E5UA 2PS0A 2P2NA 1B14A 3LIPA 1KS9A 2GN6A 1U2ZA 1OFIA 3OQHA 4LNHA 1OU4A 3BGDA 3NBFA 2CXOA 4YP1A 2XBUA 4GX5A 1NVVQ 4JT2A 5DM2A 3HCBA 1AQUA 5JG7A 4N5IX 2Q9UA 3OTOB 2AN1A 1W4CA 1C0LA 1EH5A 3QXCA 4S1VA 2QAGC 3CF2A 3UAOA 2ZVDA 3R41A 1DXOA 3U3JA 1Z0ZA 3P0RA 2RGXA 1NYRA 4ZRNA 3IIIA 5K8CA 1IG0A 1XD2A 3NHBA 1IOLA 1QH9A 5CLLA 5E1MA 5I7HA 4Z9XA 2HNBA 3O47A 1A69A 3QEMB 2J0QA 4WOCA 2WVHA 3QWBA 3ZYCA 1P4HA 1CZUA 3B1XA 5HZKA 2P6NA 4AUNA 1WCIA 3FMFA 1M5RA 2DBYA 4HFNA 3JY6A 5EP1A 5KHAA 4NLLA 1G20E 2PFSA 1QHHB 1NVXQ 1J90A 3IQXA 4RVOA 4TTQA 4ZC1A 2PS9A 3UH1A 4D3YA 4K9RA 1T9CA 1Y37A 2QSJA 4W1QA 4ZZ1A 1GKYA 4G8CA 5BSFA 3WGUA 1GPDG 4J9VA 4JUCA 2PH1A 4B9EA 2NPOA 5HJEA 5FJIA 3L82B 2H2DA 2DR3A 3EZ6A 4MWSA 3IIJA 4YUZA 1RBQA 1VPTA 3KOWA 2C4KA 4TL8A 2D3WA 3LUHA 5COBA 2WQ6A 3P0JA 2ZSHA 1R74A 221PA 5DBIA 4DCSA 1ZJJA 2AUTA 2HSDA 2I7TA 5EE3A 1JAXA 1ODFA 5K45A 5IXYA 1PWYE 3GYBA 3WJ1A 1NZJA 3EC2A 2JC3A 1UJ2A 1WDWB 2SKDA 2PR2A 4GEGA 3G2MA 4BLTA 2UUAB 4Y7CA 2DLCX 2YNMC 2ZYWX 3KG2A 5B4UA 1IN6A 3PIIA 3T1VA 1FRZA 1IHPA 1YIDA 1QAMA 1J22A 4JC0A 5LBUA 5AVXA 4WOJA 3IUMA 1EP9A 3UQZA 3COYA 1ULTA 3DJFA 1E66A 5IWCA 5KB3A 1XP8A 4L3WA 5ESXA 3TEFA 1XNHA 3B89A 4M9CA 5JSHA 3K5HA 3DC2A 3GJ5A 3A1EA 1Y4AE 2JAQA 4I1UA 4HXGA 4Z2AA 3EX7C 2CWDA 2CVQA 2EC5A 4R41A 3WLLA 2IEDA 4XFJA 1QHYA 4JVOA 1V9SA 3ZTYA 3EEOA 4POOA 5K8JB 4ND5A 3T12A 1Z4NA 2CHFA 3Q9NA 3WK5A 2BKEA 2WKSA 1ZMOA 3ZS9A 1A8SA 1CIVA 2W11A 4XSVA 3CONA 5EY5B 2HPHA 3W06A 2OYSA 2QTLA 2R7LA 3SLGA 5LQDA 2GYYA 3UMCA 1GUYA 3CRNA 1ST3A 4CEIA 1DBQA 3TZ6A 5TXGA 1AN0A 4H4EA 1PX0A 4LF7B 4FDVA 2KJQA 1LNZA 2ODPA 3P2YA 3FI9A 4HB3A 5EE9A 2QOEA 5F4BA 3H3JA 4X97A 3SLRA 1CY2A 1IHXA 5ENVA 1MVLA 1R0YA 3UHPA 4RY9A 1T13A 1DC4A 2XUPA 1L4HA 3T7SA 2ESRA 3RUIA 3ZU5A 3TDKA 4D42A 4Y6GB 5BYKA 2I6FA 4YCLA 3AUTA 4FS8A 1ZAKA 1L6RA 2X7XA 4AJ9A 4JJIA 5ULLA 1XTJA 2QVCA 1BFDA 4MYCA 3V55A 5K1ZA 4B34A 1SUAA 3CGWA 3ELYA 4K9DA 3MERA 3HNRA 4J16C 3CE6A 4C4XA 3KPWA 3QELB 3TDNA 2BGMA 4PYRA 2Z5GA 4RANA 3LUDA 3VVLA 5I7FA 2QRJA 4W63A 3GC6A 2JGEA 4OK3A 1T4GA 3TW0A 2A94A 3GPDG 4UHJA 1O4WA 2WUFA 1N8KA 1W4ZA 1XF9A 3R2JA 4QAJA 4X20B 3GLIA 4XYMA 2BFDB 1W2GA 3TTYA 2IF0A 2AZMA 4MRNA 3K6JA 1X1RA 4JBHA 4LE1A 3CUEF 3LSYA 1XRSB 2QLJA 4IWYA 1M73E 5F3RA 3UJCA 3L6DA 4CDNA 1ZH4A 2IHYA 3OQBA 4KMMA 2RHTA 3VVMA 3SYRA 2JLYA 2JLVA 3JVVA 4UVGA 4UHDA 2ZS7A 3SJZA 3GFSA 2WTNA 2H8GA 5ECDA 3D3EA 3TN7A 5EIFA 1ESNA 1XT6A 2OHIA 3I3SR 1KR2A 1YL7A 4FZ5A 1KJIA 3K16A 4QE3A 3EK2A 5DRYA 4YAGA 1A9OA 3A1NA 2NO5A 2G9RA 5DX0A 1F8YA 4KVAA 4DWJA 5ICSA 1T9HA 2J3MA 2A0FA 1KIFA 3NOVA 1IEXA 1XJ0A 3L04A 3FGPA 3WLMA 4ZYXA 4GXRA 1UOEA 4YP5A 3UV7A 1FNNA 5L3SB 1TLTA 4JIGA 1U1EA 4XD2A 1ZGZA 5LYJA 2R97A 3K0SA 1ZL2A 5AK0A 5E4JA 3C8HA 1R16A 5DM1A 3C3XA 5GVRA 2OD9A 2G67A 3S7TA 1K5PA 2DHEA 2QD4A 3OAAD 2G4VA 5AO9A 3LGAA 3OX1A 3IVGA 1V9LA 3IXLA 1F8XA 4FYPA 2WM9B 1GGEA 2REBA 3IQEA 3IIEA 3KYDA 3ESRA 4G9EA 4ZJPA 3HVUA 4ZAWA 4WHMA 3PT9A 5I4CA 4F4DA 3BILA 4NAHA 2QTWB 4RKEA 1NAHA 5L53A 3QTLA 5JSZA 4MINA 4MI3A 3N74A 4RSGA 4XVUA 4N82A 4DLBA 5A1TA 2MSCB 3IT2A 1W4LA 5ARCA 3TFQA 3RAGA 5DYTA 1RHQA 2UZ4A 1NUSA 2YN0A 1XEWX 1F2VA 1T9BA 2R65A 3LECA 4QGAA 3UK6A 2H2HA 3W3AD 3F4BA 3Q7IA 4F9GA 5I9LA 1CUSA 4M9QA 4QGBA 4L3OA 2PZAA 2X9VA 1JR3E 2XYGA 3A26A 3LM8A 5FO1A 3RVOA 3Q8MA 1VZ2A 3JATB 2I03A 2QG4A 5GY7A 2ZVQX 1BGVA 1A88A 3L6BA 3VNRA 3HRIA 2JFWA 5J2UF 5F2KA 3AVXA 1CE8A 1TZCA 3DEFA 4R3NA 5I48A 4M21A 4ZCPA 2TMKA 2VK8A 2YC4C 2WP0A 3D8HA 1X74A 2O57A 2P3OA 1N2JA 1ZWKA 4K0RA 3PCXA 1GL7A 3ZKWB 5TQ2B 3R3XA 1D4AA 3CTPA 3GRFA 3U16A 5C1DA 1WB5A 2QTZA 4V2UA 2NVWA 5ADWA 2GNAA 5JRDS 4P0QB 1WPRA 1MORA 1ZJWA 3OI7A 4G5SA 3ICCA 1GPNA 5GV8A 3ZVLA 3KB8A 2RC5A 2WJAA 4C0QC 4LPKA 4GOJA 3CRZA 1XA0A 4J43A 1E3QA 1X7GA 2YWJA 2K7FA 3DYVA 1J2UA 1G17A 5DCUA 4F38A 5B12A 1J06A 2PXAA 3OQJA 2QN6A 3KM0A 2CLMB 4RA9A 4BVGA 3HUEA 4HCJA 2D1QA 4DHWA 1IE3A 4DTCA 1QX4A 1JAZA 2WJWA 1NOJA 1WXXA 2JHFA 1KP9A 4I14A 3SPXA 4MPJA 3PXGA 3EMKA 2WM8A 1EAYA 4IIDA 5DRTA 2PD3A 4BQQA 4XVRA 1XALA 1QOPB 4H0CA 3BXPA 5HM6A 1T6NA 4UMEA 2ZCUA 1TVMA 3B3FA 3MS4A 3IMKA 4OJTA 1FFYA 5EQTA 4CF3A 4URVR 3IAEA 2O2IA 3UMMA 3ZHCA 4CVNA 1RWXA 3N5CA 3KDAA 1HI9A 4I55F 1OAKA 3KQKA 1UAYA 4O2AB 5TPZD 2IYXA 1N2ZA 4L8GA 1IPEA 1IZ9A 3GFTA 3EPHA 2HSJA 5HFAA 3PHHA 4R1MA 1BMDA 4H7KA 4DEYA 3W4KA 3CX3A 5A4DA 6PFKA 3N8NA 4UMDA 2WSSA 3AFOA 2WTAA 4LRQA 3RNLA 3DJYA 5I7AA 6YASA 1F6WA 5EUBA 4AN4A 2FV8A 2JBAB 4OJQA 3F6BX 2IUFA 4ZT3A 3RCBA 3DO8A 4L4SA 2C7PA 2B37A 1YB2A 3UYLA 3GNTA 3EW9A 4LY3A 5KSPA 1IIBA 3ZIAD 3O73A 3HL4A 4CIVA 4CR6A 1CS4C 2J9YB 3BWDD 3GLHA 4HDNB 1C3XA 4LZAA 1DJMA 6AT1A 2J3HA 2TSYB 1XRJA 3K4PA 4MGIR 4DV0B 1NW7A 2Z95A 1S1CA 1NVVR 5FP0A 5G4KA 2SKEA 1CUGA 1RTKA 3IPCA 5ALJA 3SF8B 4BNXA 4DIUA 4DYVA 1Z17A 5C1BA 1KRWA 3VPAA 3I09A 2P2SA 2QROA 4XFDA 4LYDA 5EXXA 4EKEA 5KKCA 4XDGA 5KNDD 5F33A 4YJGB 3CVYA 5TMBA 3F97A 5DH9A 1BOOA 5A4AA 4BNLA 3AR5A 4O08A 1U6KA 3T54A 5F76A 4G4GA 4GM4A 5F9FA 3ZH9B 2R6HA 2VHXA 1Y1RA 2D13A 2HU7A 1QB8A 1HEYA 5K0EA 2H8KA 4L15A 4AY3A 3USZA 1DDOA 3D7MA 2VA9A 3ORSA 2GERA 1LPPA 1XLUA 2GKOA 4LX0A 1I80A 1USWA 2NG1A 3H2JA 4NCXA 4S0XA 3N1UA 5CA0B 1GTRA 2X58A 1A5AB 3KC2A 4YRBA 4BQIA 4XGIA 5GONB 1GQRA 1YZVA 1BEZA 2GF2A 2OP0A 4GUAA 3RUEA 1Y5NA 4BKMA 5K8IA 3UJBA 4F3CA 1CP3A 4LTDA 5CEFA 2PMWB 2NUTB 2IYTA 3ZLVA 4G8DA 2C7BA 4GI1A 4ILEA 3M4NA 5A3QA 3FX2A 1ZD9A 5ALQA 3FKSA 1MKYA 5JS8A 3FKJA 5SV2A 3CLRD 5EL0A 3RAJA 3WNBA 2VYCA 3F7MA 3PVZA 4LK3A 1M6VA 6REQB 1EDZA 2I7VA 3FTFA 3A6KA 2Q28A 1KQOA 5DTRA 4F6RA 1QIIA 2OEPA 3L8MA 2PX6A 3VU1A 2XKKA 4GKAA 4ABTA 2HT1A 4PYNA 3VU9A 3EH1A 4HB0A 1VKOA 2LE0A 1ZPDA 2J09A 2JCSA 2P9YA 3DC7A 3S28A 3R9XA 2VSOA 2ID9A 4NZ9A 1XNJA 1QZUA 3GEBA 3JZMA 4F5ZA 5A6SA 4BS9A 3LV8A 4C9BA 4YMLA 2WFZA 1O97D 2ZJOA 3A2LA 2O2JA 3H5RA 3RSZA 3ZD7A 2P4EA 1MBZA 4WESA 1XJQA 3ROPA 2R2GA 3IHLA 2C1ZA 4QYWA 4UOEA 3UK2A 4KI7A 3TNYA 3V8EA 5A5VA 1PJQA 4PYKA 2QBYB 1U2PA 3L0BA 4LQ4A 3ZXXA 2FJUA 1MHTA 5F5NA 4QDTA 3H3FA 3AK4A 1EHCA 1MG5A 4TQ9A 4ECEA 2P1DA 5IK2D 1WLSA 5LZ8A 2CHQA 1D8AA 1MQAA 1T25A 3R7NA 4PYIA 1CR4A 1RYFA 2X86A 5H80A 16PKA 3TD2A 3WO1A 5E7JA 1TJ4A 3TBFA 4O2LA 5E2IA 4N76A 2LTAA 2DQSA 1JFTA 3PF9A 1TYEB 1V37A 1WEHA 1CEYA 1MJGM 4HDMA 4RTQA 1SN7A 2E49A 3BCSA 4M38A 4HP8A 4ZQGA 2G5CA 8AT1A 1I7NA 1IULA 2P2LA 5CLIA 4RW0A 2QMYA 1YRWA 2J3QA 4HQNA 4QG7A 4AZVA 5AJYA 5GONF 3GJQA 4JVLA 3DOUA 4EZIA 1E3SA 4TV9F 4M9ZA 1Q0LA 1ABBA 1MGOA 4ZOBA 1JIIA 1CYEA 4JI4B 3PQCA 1R5OA 1W5SA 2A9FA 2FPGB 2IYSA 1G8MA 2JRCA 2NNLD 2Q5OA 3NBQA 4WZAA 3SSOA 3EDOA 5JBNA 3DYIA 3X1KA 4TV8F 3W8NA 1QIEA 3HKBA 1BU8A 2C3MA 3LCRA 4X84A 1YVPA 1N6KA 1E5DA 1PV2A 3HDQA 2FKAA 1Q7CA 1YDWA 1XZLA 3RVRA 5MN5A 2QMZA 2FFHA 2BGNA 1HRDA 4FLFA 4M9UA 3TRJA 2IC5A 3SSNA 3QE9Y 2WT8A 2K2WA 4R2HA 5FNVF 4LTNA 4LI3X 1QORA 2Y8EA 1ZW1A 2DHQA 4OXQA 4PGMA 2DQKA 2R1TB 4TXMA 4DY6A 3VOAA 2R25B 1AUPA 3CUTA 2DY0A 3KQPA 2DFDA 3TRDA 5ALPA 3K9WA 1K3UB 3D31A 2V5UA 4G24A 5DHSA 2ADOA 3UMYA 2AS0A 4CM4B 1GZSA 2IFTA 2H2IA 4I50B 4EGJA 3QBEA 3ZBTA 3VO1A 4D92A 3MWJA 4YREA 1B42A 3FCXA 2C59A 4LJAA 1HUQA 5KAMA 3K1JA 1JG7A 2G77B 1U0RA 3IGFA 4P7BA 1T8TA 3O84A 4NMMA 5KNDA 2P9CA 2ZBUA 3D0RA 4WNIA 2A57A 3OZCA 4DMLA 1KJWA 2FW8A 3NYRA 5FPQA 3AB3A 3WICA 3QNUA 3D2CA 3UT5A 5CFZA 2KHZA 3EVZA 3KU1A 3UPTA 2N9UA 2DULA 1AKTA 3ILHA 4J7XA 4JWTA 4Q1DA 1TM1E 1UM9B 4TPKA 2ZIEA 1AKRA 2HLNA 4Y2XA 1I2DA 1XZIA 3AJEA 4PLFA 1TECE 3UJPA 3A3KA 5ISMA 3UMGA 4NZYA 3JCZA 1QBKC 1XXHE 2OCGA 3DTVD 3N0RA 3LKBA 3L7AA 2C5BA 1XNRB 1U65A 2NQ2C 1M6VB 6REQA 2PIDA 3FJ1A 1ULSA 2QTFA 4PLTA 1GCGA 2KWIA 1TRHA 2P8JA 4F4HA 4N48A 2PX5A 3A6ZA 3EEFA 3R4CA 2YIDA 3KQOA 3L7CA 4TM8A 4ZO6A 5BMVF 2LZ0A 4HGQA 4M4SA 1WOMA 3R7FA 1KVRA 2ZRNA 4YUYA 1IMOA 2Z83A 3G9TA 5KKNB 2GLUA 3I58A 2ZWVA 3IAAA 3OIFA 2O8VA 5LKRA 2WT4A 3U80A 1T0HB 4BV9A 2BEJA 3ECSA 6ADHA 5B1SA 1WUKS 1SXPA 3F2IA 5CVUA 1P0IA 1PVVA 3C70A 1N5MA 4Y6LA 1GGFA 1G5RA 1G8SA 3ADCA 5IPFA 5JO0A 3WYDA 1EK1A 3G2PA 1UK8A 5JUWA 4FHDA 4BGDA 2UZ0A 2ZIFA 2OCXA 5D6NA 2QK4A 3F47A 2DWQA 4CLOA 4XSHA 2EFEB 5IBPA 1ONBA 3MGGA 4OI1A 5E1BA 1B6RA 4WASA 3U7QB 3SIPA 5KX5A 5CT8A 4DDVA 1EBFA 1ZIOA 3H2BA 4KN5A 4XQ9A 1W48A 4D5EA 1XTRA 5C4MA 4FN4A 2OG2A 3OZBA 3WKAA 5C8YF 4Z54A 3OZFA 1E92A 3TW8A 2P6PA 3GJ8A 4IDPA 1OH8A 2FWJA 2QE7D 4AF7A 1OH6A 3FOWA 2DJIA 4QPPA 1WF3A 3H4MA 4IKEA 3ZWQA 4WN3A 1L4EA 3D8RA 3MTAA 5LQJA 2G9UA 1UFOA 2R4QA 4DB4A 4ZTUB 1N2SA 2V3VA 2QLLA 1LW7A 4R69A 1K3TA 4C7OB 2XSZA 5EIBD 1YQWA 1I4WA 3EH2A 2Q8QA 1UZLA 2O3SA 5JNWA 3ISTA 2C31A 3EIWA 1YR9A 5KU1A 1EQAA 4DGQA 1S4QA 4OB8A 2ORVA 2ZWAA 3NBYC 3ZXSA 1QR6A 3DEHA 1EESA 2F3SA 3U0BA 4AW9A 2WUEA 1G8JA 4X20A 3KOOA 5TS2A 3T1QA 1K75A 2PL3A 1Y8AA 1RXYA 3VH1A 4ZDIA 1M9NA 5BT8A 3GLGE 1Z28A 1P2BA 3IP1A 4B32A 1UMKA 5EUMA 4UBNA 1MP0A 1I4DD 1NVMB 3JASA 2VAVA 3PRJA 1CIPA 1OPRA 4A8HA 1N3BA 4RL6A 3AJ9A 5G1OA 5IDXA 3RE1A 1P0FA 3N6XA 4CMHA 3G5AA 4YCBA 2VHEA 2IIVA 2Z4SA 3QLVA 2OGUA 5C81A 4TTJA 4HAYA 4LDRA 1HE5A 1UF9A 1U3WA 1T24A 9ATCA 5NULA 2VDOB 1I6MA 1NUTA 1QS0A 4F93B 2P5YA 3SF0A 1T0IA 2G82A 1K5DA 2VIIA 4XYLA 3ELDA 3B38A 4PEVA 4OOFA 5AK3A 3I28A 4H1WA 5KHOC 2P27A 2X8AA 4I1SA 1H23A 5DV9A 1T3TA 4LMRA 5DSXA 4Q3KA 1VXOA 1EVKA 4I6EA 3VSBA 4JWKA 1KBOA 3FFXA 1PSZA 3QMVA 4LVNA 1T6XA 3M4JA 3IOEA 4JB3A 2ZTUA 1IOZA 1G6Q1 1WM1A 4OY3A 2IYVA 5IW8A 3E23A 5SYAA 3R76A 2CJWA 3IAM1 4XKJA 4D8XA 4E33A 2L19A 4JEMA 1BROA 1NR7A 1OLSB 2P90A 3F98A 3N0TA 3MWYW 3NETA 4HH4A 2JFNA 3T3DA 5IHXA 4F4IA 3FDIA 1VRWA 2E85A 1KO4A 2IYAA 1VYUA 3R5HA 4G4SP 3VNAA 4B4KA 3LCMA 3QLEA 3O0DA 4NAVA 1ZN7A 2C94A 4KLCA 4JVSB 4PG6A 3U7EB 4CNQA 5EHNA 4B3GA 1TVEA 1B93A 5DBOA 5FFFA 5AW9A 2GXQA 3EIFA 1ZI8A 1RWQA 2X0NA 3L7LA 4G5RA 4IGEA 4OPMA 4QEZA 4GIBA 4WTOA 3ZBUA 1CULC 4NEQA 3REOA 5BY2A 1RYDA 1VPLA 1WUYA 5JMTA 1UPTA 4AI6A 2AI1A 1EDBA 4I08A 3ZWNA 1QCYA 1HE2A 1FQOA 3R3SA 3PNYA 4E2XA 3AIIA 3TPFA 3PKIA 4JYPA 3WK4A 5KSOA 3PFKA 3C5EA 3L41A 1LD3A 5E6RB 3DAGA 3M9WA 4I4TF 4LFBB 2FGJA 4N03A 2NU8B 1F14A 2QBYA 4BFXA 1B0PA 1Z6YA 4PAMA 2JH8A 1UBHS 5ITZB 2QMOA 5AUPB 2Y27A 2YWDA 2CF6A 2XITA 3VTKA 1MGPA 5DNYB 4IOJA 1RLUA 5IP5A 2QL5A 2JIMA 3URMA 3ZVRA 5TR9A 1VIMA 3KQSA 1R18A 3ZDEA 3TMKA 2J5QA 2X5OA 4YIHA 3UNXA 4M8SA 2FLWA 1B8VA 1C0IA 3ABOB 3TXXA 1LBIA 4NS4A 4KC0A 5JD6A 2KLHA 2YHIB 3VR3A 2SNIE 3BICA 2ANCA 5LDDC 4RPIA 1PFGA 3W2FA 1JMVA 1YU9A 2DPLA 3CLTC 3M33A 4Y9TA 4D6YA 2E6UX 1GVNB 4G5YA 4FYMA 4Q21A 2Y67A 4EY3A 4ZEOA 1Y1QA 5E3HA 3B6ZA 3KZNA 4ESEA 2B78A 3DE5X 1FUEA 1DC5A 5INTA 4QOIA 3WLOA 2VP4A 4YCNA 2D0OB 2G6TA 3AEQA 3FF1A 4MO2A 3ZZNA 4WK0B 1I0IA 4QUBA 4KW7A 2WP8J 4HTFB 1MEEA 3BB3A 2GI4A 1J00A 1HMPA 1HORA 3M8KA 3NHJA 4Q7LA 4QNMA 4R4JA 4RV4A 1XWWA 3I5MA 5G0VA 2EW2A 4JC8A 5A2GA 1J56A 1NVFA 4FX2A 4YUVA 2Q29A 4JDUA 2G63A 4YB8A 1Z5PA 3C1UA 2GB4A 3OESA 3SC6A 3FPAA 4A2CA 3WIOA 5DK4A 2IZ1A 2Y0DA 4RSMA 1E4VA 1S4MA 5KQLA 1PE0A 1SBCA 1VDMA 4L76A 1NF8A 1T9AA 2COKA 4O2AF 5B55A 4FXPA 1M33A 3NAMA 2VHTA 3UW1A 1N0UA 4LF4B 3O8OA 1G1AA 5L4LA 3RFCA 4BBZA 3UUEA 1QP4A 2B4AA 1PVOA 1D04A 5LUBA 2OZKA 4KXUA 4MUFA 1CR0A 1NN3A 5ED4A 1JP7A 4LOLA 4MQEA 1OFTA 1ZM7A 1PQUA 3BFKA 3FMIA 5ERGB 4XWKA 1KFKB 1B0AA 3BH0A 3ZZMA 3RSOA 2RH5A 4MPDA 4BTLA 2VDUE 2BFBA 4EDFA 1DX4A 1JDZA 3AV3A 4OQXA 3TAXA 2W8BB 1KEWA 3FWKA 3GP5A 1IVYA 2VBCA 2DBZA 1E9AA 3FTPA 3P9KA 5IU6A 5JH7A 5G3ZA 5LP6F 1V3TA 1NW3A 4LFCB 3LX4A 1MQ9A 2VT3A 4GL2A 1CU1A 1O1YA 2A5GA 1C7ZA 2IPNA 1O58A 3HVIA 4QU5A 4OFBA 1P7VA 4RPCA 2CSUA 1GPJA 2HPAA 3ELWA 1SIUA 3B3JA 5F35A 3O90A 4G4JA 2B92A 4WX2B 5DT2A 3TPZA 1NIPA 1ZSVA 2VCEA 4FHEA 4JJAA 2IXFA 1JV2B 5DYNA 3FYSA 5A3VA 4OKIA 3DWFA 4FQ5A 3HR8A 3LHFA 5IDYA 4V0SA 3SN6A 1RFLA 4D8TA 1RXUA 2GHQA 1JTFA 2ZUBA 1W2WB 1Z12A 5CTJA 1HK7A 1RYYA 1E6LA 3ZWPA 5JYBA 2G1JA 3NKVA 4L51A 3CFYA 2QPAA 5FPTA 3W5UA 4JYBA 4OV6B 5FLKA 1VRCA 4FCWA 3MNFA 1OGIA 2XNSA 3AHDA 4NJMB 5CU7A 4C3OB 3CLKA 4IXNA 5A04A 5ADVA 1ZIXA 2WOJA 1GNPA 1RJFA 1J20A 3DVAB 3ZGOA 4F21A 1C29B 2PGOA 1AUQA 3WLFA 1E3MA 3BS4A 4XGKA 1Y6ZA 2BM0A 1R88A 1OFUA 3K4HA 4IWXA 2W42A 1G5TA 1R6UA 1KEEA 3UO8B 3ZU4A 2PQ2A 1H6DA 1QGUA 1KEUA 3BMOA 2YXNA 4A0GA 3B3GA 4HX5A 2H1RA 2EX1A 4HC4A 3CEPB 1Y9DA 4OQEA 4IVPA 1GKIA 2PN1A 4S04A 3LMKA 1F38A 1U4OA 3SX0A 2QX6A 4YFYA 4C4ZA 3UKOA 4QOSA 3CCBA 3TX2A 5TPZA 3U48A 1RMYA 2HJRA 3VOBA 1N2HA 1U3CA 3AR4A 3CUUA 4I66A 1MT0A 4EHJA 3GH3A 1DUSA 4CV2A 2P9EA 2VWPA 1QQ7A 5AKZA 2PKWA 2WFMA 1TU4A 3B7WA 3NIDB 5FUYA 3MCTA 4YT4A 1NR5A 3OVMA 1Y42X 2HFJA 2GEBA 4RVDA 3ESCA 3NTQA 5FTKA 1PT7A 4LYEA 5LP6B 1MW8X 1ZNYA 3MOSA 4N5MA 2I1QA 1OGJA 1NJ2A 2NT3A 2D1RA 4NYIR 4O4IA 4W5RA 3KTAA 5BXQC 1N33B 3DBRA 1TIPA 4FVTA 4H0FA 3SKYA 7GPBA 4YAUA 3RDPA 3SP1A 2RK4A 2CNWA 1AJEA 3U3XA 4LY6A 3HP1A 1EE9A 4HHEA 4OJKA 4WCFC 1B15A 4BMZA 4W6QA 4R0MA 3DB1A 1NVGA 4JJ6A 4DWWA 5GQSA 3Q5GA 1JIXA 2OZLB 3GUVA 4W9MC 3WB0A 1GV0A 1G9TA 3HXKA 2HYIC 1G9SA 3B1FA 1NN1A 1QDLB 4EYEA 1YUBA 3VZSA 1AHHA 4TRNA 4ZVVA 2D0DA 5IJAA 4ZI5A 4D56A 2VKTA 3L8HA 3NOQA 3LYUA 2JLWA 4GP7A 4DR1B 1ODKA 2O7QA 2AWOA 2LKDA 2W2VA 3HZZA 4RJIA 5KOJA 4DADA 4MI1A 5K9ZA 1NHWA 2EVWX 3NHKA 4R5MA 4NVRA 3REQA 4A0RA 2DEUA 2WZDA 2CDCA 1R00A 2Z9CA 4MSUA 4PSDA 3CE9A 1ORIA 4GSLA 4B79A 2BEVA 4EKDA 3OETA 5AD1A 1WWKA 4HX2A 5E6UB 3S4YA 3QEBZ 1FS6A 5HKOA 2VXOA 3JSXA 4YPFA 1TJPB 1YGYA 3DOEA 3W7VA 3GUUA 3GCWA 2V7GA 2BEWB 4H31A 4F46A 3JVEA 2VH1A 1T6ZA 3C74A 3C6YA 4ZMRA 1HC7A 1L3BA 5AJUA 2QJFA 1JZQA 1YZLA 3P2IA 4B6GA 4F85A 6CHYA 1A9SA 3QPWA 5FNVB 3TAUA 2IIBA 5CLQA 2H5JA 5BSMA 1IHYA 1RAGA 2DYKA 2L82A 3N7AA 1T29A 3MJHA 4IJKA 4ZC8A 5C51B 4NZOA 1GXSB 4JQCA 5CHEA 3PPYA 4TQAA 1DCMA 1NVEA 4YR9A 1QYXA 3THYB 1OI3A 3JPWA 4CG2A 3RANA 3D7SA 1TEZA 3BK2A 2CXQA 4Q0MA 4A8JA 1E5QA 4MWGA 3ZC3A 1IUOA 2ZWIA 2X5KO 3EGXA 4M46A 1B73A 2BHRA 2IYUA 1NN5A 2B99A 3FKQA 1KNQA 3D4NA 4ZARA 2YV4A 3F71A 1OBOA 5B7GA 3GLIB 2Z04A 3DL2A 3G23A 3KEFA 5L3QB 1RC8A 2IS4A 3K9GA 4MVXA 5KTSA 2W93A 2VATA 1PKEA 1AGYA 2QRVB 2W8BA 5GM1A 4B3IA 2P67A 2IBSA 5CFNA 5F4ZA 3I4FA 4BO0A 1KYTA 3HH8A 4R31A 4R40A 1NYLA 3UV3A 2O1SA 1QDEA 2VQDA 4A8JC 4P7JA 1FFWA 3IPRA 5EIBC 3TG2A 5I9SA 4MR8A 3NT2A 1OVMA 3EY9A 3N2ZB 2DG2A 1RWVA 4Y2SA 2PGNA 3RFXA 1DCKA 4UEKA 3NALA 4P7GA 1VPWA 3TTUA 3NJ8A 3V6MA 3ZV5A 1U8CB 3BGOS 2VP5A 2VN8A 4L5CA 4NXMB 3NXSA 4L5BA 4PXAA 5EQFA 4F11A 2FMFA 3MCVA 3LQFA 1Q84A 1SVNA 1U3UA 3QBJA 1OE0A 1X92A 4H17A 4L4UA 1FUYB 1K8RA 1AQNA 4RK6A 3KKKA 4A2WA 4DAOA 5A4FS 3TW4A 1C3LA 1P9OA 2PBFA 4OSOA 4R1SA 2AR0A 4K86A 4MA4A 4PHFA 2ACKA 5HIJA 4BFTA 4LDNA 3R7LA 2A9PA 3ZX4A 5IYZB 1NJFA 2ISCA 1KPGA 1UC5B 1PYOA 1E64A 3HB0A 4OFWA 1J0DA 1RLIA 2ZR0A 3PEVA 5KMGB 2NYVA 4NZMA 3QUQA 5B53A 3D6TB 3ZJUA 3EMDA 4JBXA 4IEIA 4YUWA 3UY4A 2AWNA 2P7HA 1Z0AA 1KVTA 3IAUA 5AM0A 4JLVA 3AEQB 4UU8A 3E2IA 3QLJA 4D97A 1C14A 3IOCA 4UCFA 1VSVA 4Q00A 2QW1A 3HY4A 4AMVA 2GFQA 1C0EA 2D1SA 4ZREA 4ZJZA 3A3PA 4RVCA 4K2AA 2PHZA 4W5TA 2WKWA 3E9MA 1IQUA 4I1YA 1OH7A 1LV7A 4D9JA 2DCMA 2FZEA 5AHOA 2FZ4A 1JI0A 3UFXA 2O2GA 2W58A 4QDOA 3C16C 1WHSB 2AC4A 2XLBA 4AB1A 1RYEA 4MR9B 3GH1A 3ZS8A 2BMVA 1JXOA 3P5BA 2O14A 4AAYA 2YHUA 3T3OA 3F8SA 5IKMA 4YRFA 3FVTA 1DXQA 4CL0A 3WWZA 3G5TA 1K7YA 2DFTA 4MWTA 4X94A 1ULBA 5ED0A 4EW1A 2OCKA 5FO0A 1BXRA 2ZYRA 4UE6A 1II9A 5HILA 2V54A 4Z51A 3GA5A 4KZPA 3I6BA 1PT8A 3QPCA 3LQ2A 5AFSA 2Z6QA 4LY0A 3TNFA 1MF7A 4AQYB 4FJ1A 4RKFA 1P4JA 2JJ2A 4LSZA 3SJUA 4WLEA 5EE5B 3NVKI 2QPTA 1XZBA 4M1KA 4DWVA 1UXKA 2FMHA 1Z2DA 4FGZA 2H0RA 4IF4A 4PTLA 5JAUA 4NCBA 2W2LD 3GP3A 3AIKA 2J3IA 4JYMA 4PZLA 4FYWA 1JVSA 3V8MA 4DCGA 1S9HA 5AJVB 3A6LA 1KZYC 3D6NB 4C5CA 4EYGA 1K8ZB 4JMLA 2PGIA 3KZVA 1UOOA 1TC2A 1M83A 4XLLA 2ISQA 2A0KA 2HV8A 3PSAA 1KU0A 1COWD 3OFND 1QVWA 3IE1A 2Q3LA 4OI2A 3MGAA 1NXOA 1RZ3A 1HDGO 4DLRA 4RJ2A 4ZYYA 3ZW9A 4R1QA 4YALA 1VMEA 1M1NB 4FOTA 4HUQB 4TKMA 2FG5A 2W90A 3S8MA 3CRQA 4OGLA 4AZ0A 4BMNA 1UBJS 2JIZD 3I9V1 4FYVA 4A27A 1RE1A 2QLTA 4OBEA 1TQHA 2IDZA 3OEED 1X7XB 4JLNA 1XE3A 2A1TS 1YRYE 3DAYA 3PJFA 5J1TB 5HMMA 1A5ZA 1H2WA 1NBWB 1NYTA 4RE6A 3UFXB 4EY7A 1Y63A 3SHVA 5CLFA 5HYVA 5GINE 3SMVA 5I6DA 3I1YA 5LMCA 2J4CA 3FOBA 3I0MA 3KD2A 2EQBA 2KBEA 1OHHA 2YDXA 4L9SA 1O5IA 5AI0A 4E5SA 3ICEA 2XB2A 2XA1A 1GQ2A 1J8MF 1TEXA 3RV3A 5A5GA 1WXIA 3R9WA 4W5WA 1CWUA 4C1NA 2AG1A 2YBDA 3A04A 2ICAA 1JHXA 2ZJ7A 1OAOA 3GLIE 1F51E 3G7NA 3I92A 2X7HA 3VC1A 3SBDA 2P4UA 2C2YA 3D4OA 2R68A 5ITVA 3GVPA 4TV9B 2UVPB 1Z15A 1JB1A 2C99A 3ZQKA 4LZJA 2P0AA 3UK1A 1BMQA 1U3VA 3LYLA 4JC4A 1ZH8A 4B80A 5LNK1 4WADA 4MO9A 1Y6GA 4K81B 1MEOA 1UPAA 3NC1C 3OJFA 2I80A 4HAIA 5J9FA 5AM2A 3ICQB 2N42A 4GE0A 2JHGA 1ND6A 3DQPA 3JQ7A 4J3JA 4OKNA 1UXGA 2AI3A 1U2DA 1Q7BA 5KVVA 3PE4A 2JFOA 1JIJA 4V24A 3M49A 1QNLA 4YAEA 4XYGA 5CW1A 3IP5A 1MVOA 2R6R1 1M66A 1QKIA 4BMPB 3KOZA 1W7AA 1R0CA 2I3AA 3DFMA 3K70B 2OFXA 1KMIY 1RQNA 4KSYA 3JAWB 4DIOA 3WWYA 1L5QA 2BFEB 2WWWA 3RV4A 2AFHA 4R1LA 2X4LA 3OX2A 4I50F 2FWPA 3E81A 3TSYA 1GZDA 4H6WA 3Q4GA 4KWTA 3GG9A 4F92B 3DXXA 5A0VA 5JRJA 4WDRA 2FEOA 3I5YA 3I04M 2WF9A 2XHZA 3CZ9A 4W7IA 4H59A 1H8HA 4BNWA 4TYNA 1QHNA 4MV8A 4BFUA 1XIVA 1VCIA 2C54A 1NDHA 2MSLA 4NFYA 1XELA 3C1TA 3D54D 3NNNA 2WAYA 2YCBA 4CKCB 1X1SA 5FUMA 4MS3B 4EUHA 1Z0SA 2O8CA 4BZWA 1QQAA 3UAXA 1QTIA 2RBKA 2UUBB 4IZ6A 4RIFA 5CB4B 1O6FA 5EKTA 4QNRA 3EYAA 3SS9X 1FVXA 3EJWA 4W1RA 2VZLA 1ICIA 1RAHA 3I5UA 1UM9A 2ZRAA 1NIJA 3RHFA 3A4VA 4Y9RA 3GFRA 3U62A 3DZIA 4DV7B 1M8GA 1W1IA 3R7BA 2C04A 4ZEXA 4IPTA 4RTPA 3K20A 2XHEA 3DO6A 4EGAA 2CE7A 3COSA 5AKHA 3ZHBA 3PXEA 5I9BA 4TMZA 5G0WA 1CB7A 5L3RA 1AUOA 3S1LA 2B4TO 3TRFA 3HBFA 1XZEA 2AOTA 4JZKA 4D3XA 5CFRA 2CL5A 1SVWA 1SUEA 1M67A 3RABA 2OAEA 3AW8A 3VX4A 2I6TA 1PGNA 2X1VA 3AEYA 3H8VA 4GEKA 5ALKA 5EJ8A 2H1IA 2QQEA 4PGGA 2H2FA 4NPAA 4UUAA 4YT5A 3D5EA 3TSCA 1RR6A 2FSIA 3HP4A 3KX2A 4A8TA 4RD1A 4B40A 1M0EA 2IUEA 3Q0IA 1KI6B 1J1IA 1YQ9A 4IS2A 4LSMA 4H08A 4HQLA 2XQGA 4B48A 3MCUA 1JSXA 1W94A 2VJYA 4ENQA 4HKTA 3RJMA 1VJTA 3VPBA 1YDMA 3ESAA 2QKYA 1L7MA 3BTSA 2QN2A 2X3FA 4NCNA 1T9KA 3HNPA 1Y7PA 3L1UA 2PSDA 2HGSA 2JFHA 1CJCA 4LCJA 4KN9S 4U39A 1CR1A 1KYQA 1PQWA 1X1BA 3HCFA 5BQFA 1KWGA 3VNUA 4NZNA 1T4CA 3EQ9A 2VRBA 3HR4A 1GRRA 3ZCTA 5JALA 3I6ZA 3LC2O 5B3KA 3U1BA 4NESA 4AKTA 4N8EA 4M83A 2Y68A 2YJNA 2DPXA 3SR3A 1I2CA 2WZBA 1YR3A 2GPYA 1V96A 1AKYA 2QI9C 3F7TA 4ZVNA 3UOGA 1A5TA 2JLZA 1ECFA 2AQIA 3QEJA 1V3UA 3ZIUA 2DFLA 1QFSA 1PHRA 2YWGA 2B36A 3GJ4A 1KY2A 4B3DA 1RQ7A 1WSBA 3LKVA 2OM6A 3HXOA 3BRWA 5HG0A 1LDEA 3MTGA 2CFTA 1ZFNA 2AJCA 4JK3A 5EN4A 1KYVA 1WABA 1Y34E 3O3OB 1CJBA 4J76A 1S3IA 5I47A 4E5PA 3QX9A 4TTPA 3DPUA 3HCCA 2QIOA 1P2VA 3ZBQA 1L7RA 2UYQA 3VV2A 2EFGA 1PK9A 1UJBA 3KXDA 4EYQA 2OR3A 3E9YA 1P3DA 4CMEA 3E58A 4ENSA 1Q95A 3FHLA 2WV9A 3OQPA 2CNKA 1IM2A 3P20A 3U4IA 4J7UA 1EA7A 4Q4LA 3B1JA 3IEPA 5F5LA 3KKNA 1E2BA 2I8LA 4GR5A 1ORRA 2PUEA 1C0KA 1H0HA 3MCAA 1DQSA 2GEDA 4BP1A 5D7NA 1UPFA 3PJRA 3MXOA 3IO3A 5CBPB 1YTUA 3MTIA 4KE7A 2O8EB 4Q1VA 2C5SA 1CZOA 2Q6TA 3RS9A 4EECA 2E0IA 2ZRQA 4IDQA 4QXAA 2ZYAA 2JW5A 4Q3LA 2P65A 3TFOA 3EG9B 4QIHA 4WXPA 2NUPB 4YROA 3F9RA 4OHZA 1J2RA 3H1BA 3VKUA 1OH5A 2CW5A 4HFRA 5HKKD 1KETA 5EMJA 4QZVA 3PUKA 4QFCA 1VHJA 3ETJA 4BE4A 4DRYA 1TYCA 1M2WA 2XD9A 4JP8A 1G1MA 4MIEA 1SU6A 5JQWA 3HJBA 1OX5A 4IMJB 1WAMA 5I45A 4HXYA 1YFKA 4X9XA 4MW6A 5DM60 2J8ZA 2CL7X 4HBGA 1FXUA 1GV1A 2H1OA 4JI1B 2XNCA 1TD9A 2HEIA 2OHXA 4HZGA 3U4AA 4P35A 1Q14A 1PNQA 5DIFA 5LM3A 3E48A 2WV7A 3HDGA 2JEZA 2XWPA 2YMPA 2EBUA 2XCIA 3RVMA 5B1YA 1T5IA 3EWAA 3W90A 1K9VF 1IXKA 2AFIB 1IG3A 4JC5A 2W2PA 4K6CA 2PMEA 1QCZA 1SKUA 2HU2A 3QELA 1ENYA 3A4IA 4BV8A 3U81A 4MGEA 3ZDBA 3ZG6A 4MYHA 2HIMA 1VHWA 2ZREA 3GJTA 5HKLA 3L0YA 2AXEA 1HQDA 4JB8A 3K9CA 4WZBE 5CP8A 721PA 4I4TB 3PDIA 1T5TA 2YR0A 4RHYA 5EZ5A 5JPCA 4OSEA 4A0QA 4YA6A 3R7AA 5IKPA 3NW9A 1HURA 3CNNA 5BYJA 3WL5A 1OASA 3A0UA 3LJKA 1ZUNA 1MX3A 2ECFA 2TRSB 5IUJC 3PDJA 4ZPXA 3G8CA 2ACWA 1IBSA 2EJUA 4BY9E 2DP4E 4INZA 1R4AA 1MOQA 2NX2A 4GDFA 1CV2A 2WHPA 1KF0A 1OXXK 1T8YA 2Y9PB 3C4JA 3CNLA 5LZ7A 1WVIA 5I7OA 3B85A 4C43A 3ER6A 4X92A 1E79A 4ZK2A 5H8WA 3OUUA 2R8XA 5J43A 1Y5MA 3PA8A 4NQZA 4KDCA 4J94A 5DBEX 3DHEA 4OI4A 3FNBA 3V48A 2W71A 1H9CA 4LJYA 3LX6A 4L6IA 2ADFA 4OCZA 3STTA 3L43A 1QIMA 4CHGA 4E32A 4Q6WA 1BHQ1 5FTMA 3ZNOA 1UMDA 3IDQA 2UUOA 1JEYA 2BRUC 3LHSA 1VCHA 2IU6A 1QYVA 3BN3A 4XQGA 4ZALA 2ZAYA 4CN8A 4IIEA 3WGKA 2PTHA 3USCS 4JNCA 1DJOA 4NBRA 1FSPA 2OLKA 3D8UA 1RWWA 3H1FA 4R1OA 1HDOA 4GXTA 2REQA 3EUWA 1KYWA 3WYNA 1FP6A 3RC7A 1LJLA 1QV9A 2R62A 2XVXA 4I0WB 5BUQA 4CQMD 2VJQA 2AH5A 4U8GA 1J8YF 1DU4A 1N2CE 3OTWA 1AA6A 1WETA 2J0UA 4NG5A 4Z1OA 3Q6IA 4S1NA 6LDHA 4L8VA 2AFIA 1D0IA 3WQSB 3R40A 2EZ8A 2Q0SA 3I05A 4HS4A 1O96B 1X7XA 1L2TA 3CT4A 3UANA 3WFJA 4EGSA 4LRUA 1N5OX 4H6PA 4J4BA 1CCWA 3FNGA 4TWIA 4KMOA 3N3AC 4WK6A 2K87A 1U7ZA 2BKLA 3DQQA 2VZ9A 3TRIA 2B69A 4B8YA 4TZ0A 3G8DA 2OXEA 2HRQA 2NU8A 2QT0A 1NJ6A 3KWFA 3O2JA 5JAZA 4QRDA 1BGXT 3D5QA 5CDYA 2ZRDA 2GZHA 3VTFA 3CISA 2ZYDA 3G7SA 4G4IA 1K3FA 1NULA 5JD3A 3U7GA 4AWXA 3HEBA 1MIOB 3ESDA 3V6LA 4WBNA 4E7OA 3J7AC 1OFGA 3OZDA 4PFQA 2JNWA 1YL5A 4WNAA 3DPSA 4GGPA 4DSOA 5EHGA 1USIA 4MITA 3WL7A 3O4VA 1U9ZA 5AOVA 1Z08A 4OHBA 4EAQA 5L6LB 1YJCA 1VIAA 1PSWA 4KRYA 2XDYA 4K2HA 1L1EA 4FUQA 1SOMA 4JX8A 4Z9BA 3SJCA 3KJHA 1XYVA 4WEOA 1X2EA 1L5VA 1JKIA 2OWEA 4PHGA 4XJSA 2IYWA 2NXNA 2VYFA 5ADHA 3AVWA 3OPYA 3VFDA 3DZDA 3WIBA 1SOWA 5EZSA 4PX5A 4FU0A 5K4AA 4ZVQA 1Z4LA 3ABIA 1FEZA 5IJXA 4JBGA 3MSXA 1NQ5A 3KYJB 2WU8A 4XWGA 4BN0A 4Z0NA 3I01A 3E5HA 1U04A 1BXRB 4JBIA 2WNHA 2I2FA 3T15A 4O0LA 2Y1KA 1F5NA 5EOVA 3PTAA 3BMNA 2O1EA 5EXTA 5JHGB 3JRXA 3OPYI 3H9GA 2GNPA 2Q4BA 1XCMA 1FQJA 2EKDA 1FNDA 2YWBA 4XRRA 5CA1F 1OBVA 1N36B 1HH4A 4RFSA 3V3KA 4IHKA 1XJ5A 2IYZA 4MW0A 4PC7A 3X1DA 3P2OA 3RO7A 3G02A 2YQ4A 2XZLA 3VH2A 4ZOLF 4M0PA 1HE1C 2DH6A 2YNMA 4W7HA 2EBHX 3K9FC 1U7OA 2P78A 4WUVA 1YSCA 3UWOA 1YZNA 5LP6A 4IDOA 2NPIA 3P9XA 5HK8A 4G37A 4EMUA 1U3DA 2Z4RA 3AYZB 2XTMA 1XVLA 2F3TA 3MWEA 1P7CA 1KH3A 1UOQA 1QZZA 3C4VA 1X1EA 4DRXB 2DERA 1E2JA 1LEHA 4NDAA 5T57A 1NUUA 4NBWA 4FEGA 3G49A 2X76A 4H1HA 1MTZA 1F8GA 2J59A 4ARCA 2H51A 1BCSB 2WOOA 4NYMR 2WM2A 1LLCA 3KEGA 1D6NA 3LS2A 1ZD4A 3HJRA 3KYDB 2I6QA 2WAAA 3GPCA 4NK5A 3E9NA 5KO2A 5EP4A 2PKRA 2VSFA 3PD7A 1JTEA 1L4MA 1GNVA 4QHYA 1P1BA 1GSAA 3JRWA 2IZZA 3LGXA 4U0JA 4UDYX 4CW7A 2FWMX 3O1LA 4MGKR 1JQAA 1LI4A 3LLVA 1LGYA 4RCYA 4RLSA 1FMLA 2ECPA 1TMKA 2Q9AA 2ZUWA 4PSAA 4HWSA 3AJDA 4UVIA 2V1UA 4UNIA 2QTGA 4K8OA 1L5KA 4YT2A 1QH8A 2UU9B 1A7KA 4F1KA 4LF5B 4Q9AA 2OFFA 4Z9AA 1VL6A 3KXLA 4UE2A 5ERXA 4C3VA 4R8RA 5BWLA 4AWAA 2WWRA 4W9NC 3K35A 3I2GA 1WLYA 1G60A 1DJPA 2QM8A 5IARA 3TXYA 4EIWA 5BRAA 3H2YA 3ME5A 4C6SA 3R44A 4JGGA 3FPCA 4G8JA 4U7FA 1MPXA 1DTWA 1M6EX 1E7WA 4HNAB 3Q3CA 5AXCA 2I66A 5BQ5A 1TM4E 5BV1A 5HVNA 5JZOA 1XP5A 1SVIA 1ZC4A 2G71A 4KQFA 4CQNA 5H59A 4ZVOA 3IUJA 2PWZA 5ALGA 1IZ7A 2AN9A 4BBAA 4QJ3A 3VC3A 4XH9B 3ZCUA 5JQGF 5JYEA 1JZSA 1YJQA 2KM1A 2IXTA 4FGWA 2ZTHA 3WTCA 1DARA 2AV6A 3LW8A 5BO5A 3I9MA 4PC3A 1UBKS 1BJRE 2PRYA 4BRUA 4R3UC 2R84A 3DMNA 2HMYB 1QAQA 2HXYA 3QV1A 5E4TA 4CR7A 3TIXB 1ORWA 3TGLA 2XQVA 4YAJA 3WGQA 1PD0A 4C4TA 2FF5A 3TO5A 1BIFA 3EIHA 1BD4A 1Y8RA 1IK6A 4P08A 4AKSA 5KSWB 3SFTA 4WKBA 1JQKA 5JCOA 2ADMA 4S2UA 2BFEA 1DC8A 4CKYA 3JR7A 1SULA 4HDOB 5FOSA 4D4HA 2I55A 1TL7C 1WBBA 3ZVNA 3V2GA 2G72A 2R79A 4GKJB 2IHJA 3KSBC 1EM6A 2HNKA 2O8DB 4KQ2A 2ATVA 5FAXA 2EAUA 3DBIA 3LGSA 1QXSA 1SVSA 5FPKA 4PZUA 3MSCA 1KDYA 3ID6C 1OXBB 5JJBA 2R8RA 2AI2A 3P9PA 2X2OA