3FDFA

Crystal structure of the serine phosphatase of rna polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. orthorhombic crystal form. northeast structural genomics consortium target fr253.
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
191
structure length
191
Chain Sequence
SKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGTKYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLVVMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEFEERRKRVILHSVLFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FR253
publication title Orthorombic crystal structure of serine phosphatase of rna polymerase ii ctd from fly drosofila melanogaster. northeast structural genomics consortium target fr253.
rcsb
source organism Drosophila melanogaster
molecule tags Structural genomics, unknown function
total genus 46
structure length 191
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04722 Ssu72 Ssu72-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fdfA01
2PL9A 2QZJA 3QK7A 1JWLA 4RK1A 1JDNA 1J56A 4E7PA 2NZUG 3C6QA 2E4XA 4Z9AA 6ABPA 2PUAA 3Q7RA 1M2FA 2LBPA 5KC9A 1VLZA 4MLDA 2GX6A 3LUHA 3OLVA 1LJUA 5HM6A 4N76A 1TVMA 3RVSA 3QEMB 4KQCA 1ZVVA 2FKAA 3SAJA 4EVRA 1YMVA 2E4WA 3KTOA 3LKBA 1EWVA 5BR1A 3QLUA 4IRXA 2IPAB 3EGCA 4ML3A 1A0OA 5TQ2B 4MR8B 5EWJA 6CHYA 4O5AA 3HDGA 3OLZA 5EWMB 1Z12A 3CHYA 5JNTA 3G1WA 3T95A 1QO0D 3NNNA 3GRCA 3M9XA 3OM0A 9ABPA 1JX6A 3KLNA 1YK0A 1QQBA 4KK4A 4L85A 4ETNA 2QXYA 1ZY2A 1RXEA 3O74A 2GI4A 2PKXA 4ZMRA 3QEKA 8ABPA 1AB5A 1OXKB 2B4AA 3N8IA 1USGA 4WZZA 4W5OA 3KYIB 3L49A 5TQ0A 3IP5A 2FVYA 5GOTA 3D02A 4YR7A 2MSLA 4XFKA 4YRZA 2CHFA 2MYUA 2L2QA 3HXMA 2PUCA 3RQIA 1QP4A 1C0EA 4MQEB 2JB9A 1D2AA 1SXIA 3O1IC 2RJOA 3Q7TA 3DGEC 4G0ZA 2DRIA 2L18A 3UUGA 5KI6A 3RVPA 4LE1A 2H3HA 2FQWA 1R8JA 1JH9A 5TPWB 4JAVC 4PICA 4HNQA 2WJAA 2ZWMA 3HS3A 1Z15A 4MS3B 3FFXA 3DGFC 3UK0A 2JVIA 4N0QA 4EYGA 3HJFA 1I3CA 3KYJB 3L6UA 1JF8A 1L5YA 1U2QA 3RVKA 2FEPA 3MQ4A 1DCFA 2H0AA 4JB2A 4XLTA 1SXHA 5KQMA 3QLVC 2R4QA 1BVHA 2FMIA 4G86A 2FLKA 5HSGA 3NHMA 4NV3A 4QICA 1Z18A 3HCWA 3HEBA 2PUBA 3KCNA 3MM4A 5FWYB 2JCGA 1EAYA 1YIOA 1PUXA 2FMFA 4LE0A 2WWVD 3ROFA 5JS2A 5TPZD 4EVSA 5I4CA 3TX6A 4QYWA 1BDHA 1KRXA 3IPAA 4W5TA 3OQNA 3LUDA 2YHAA 3T38A 4ZMSA 2J48A 4JASB 3N0RA 4RKRA 3LUAA 5CHYA 1Z17A 3RVJA 3H5LA 3JTEA 1GCGA 1VPWA 1PHRA 4OTZA 5B3JC 4LDZA 4NCAA 3SY8A 3M9WA 5KQLA 4KREA 3NNSA 4JP1A 4RKQA 5EWJB 4XASA 3BILA 3CG0A 3HDVA 2IDMA 3SG0A 5DGCA 5TQJA 2JBAA 3OO0A 4RWEA 3SM9A 3H1EA 1C4WA 2PUGA 1U0SY 3E3MA 1BDIA 4FE4A 1RPJA 3H5OA 3A3KA 3K9CA 3LUCA 1F51E 3RVRA 4XXHA 4YLEA 4JB0A 1PNTA 2QR3A 1NXTA 5PNTA 3NBMA 3BBLA 3KHTA 4RK5A 2GKGA 3LFTA 4ETIA 1P6QA 4KFCA 1SXGA 2A9QA 4KV7A 4D74A 1MB3A 1PEAA 3FDFA 3MMNA 5TQ0B 5TPZA 2Q5CA 4Z0NA 4RK7A 1PNRA 3FFTA 2JRLA 1CYEA 2YHBA 3ILHA 5DTEA 1P2FA 4HYEA 2R47A 2V0NA 5CNMA 3CG4A 3KS9A 1FSPA 3EQZA 1JFSA 1QKKA 3I42A 3N75A 4IGAA 1DCKA 1JDPA 1L5ZA 1USIA 3TO5A 1ZAYA 4E7OA 1D5WA 4Z4EA 2ID9A 1ISSA 3EDCA 1EHCA 1FFSA 3JVIA 2CD7A 3BRSA 2FSPA 3IP6A 5KQPA 2CWDA 3H75A 4YP9A 4Q6BA 3HZHA 3IP7A 1YS7A 4NCBA 1GUBA 4KVFA 5CNIA 3UKJA 3TB6A 2HJ9A 3SNKA 1H9CA 4MR7A 1RXIA 2BGGA 1AB6A 1Z2EA 4YGXB 3QLVA 1FFWA 4N47A 3HM9A 1Z16A 3OLWA 5DCLA 5T7BA 5IC5A 1YTUA 5FBHA 4NICA 3BREA 3CLKA 4UHJA 4MS1A 2WRZA 5IEJA 3QELB 1LK0A 1M5TA 5DKFA 4L4UA 4G0OA 4MS4B 5KWSA 2PLNA 3KLOA 3H6GA 3O2SB 4JA2A 3EAFA 1OXBB 3K4HA 3GBVA 1MVOA 2GWRA 1ISRA 1E2BA 4RZSA 2JVJA 3FMVA 2PMCA 2QU7A 3O1HB 5EWLA 4UHKA 1E6KA 2WMYA 3GT7A 4WXEA 1TMYA 4RY0A 1ZESA 2QSJA 5GQSA 1MAVA 4YCSA 5IUNC 1DBWA 3LMKA 3LKVA 2MSWA 3F6CA 1D4ZA 3TMYA 3OMXA 4MPTA 4LDAA 2FTKE 2PL1A 3RVLA 1K68A 2A9PA 4MYRA 2ID7A 4XAQA 2QW1A 1NATA 3I5AA 4MR9B 2KYRA 3EODA 4RU1A 4G97A 4Z4FA 1YMUA 4XARA 5ABPA 4YWHA 2FMKA 1BAPA 4IILA 1MIHA 2WB4A 2L17A 3F6PA 3JS5A 5T3YA 5IULC 5DLEA 3VNAA 4KK3A 3CKMA 4CBVA 3H5TA 4EVQA 1JLKA 1URPA 1UDRA 1YK1A 5FWXB 4EYOA 1TM2A 4DADA 4Z4CA 3TD9A 3DLHA 4N03A 4Q6WA 4W5NA 3R0JA 1DZ3A 5F64A 1QQAA 3I09A 5TE9A 5C5CA 3Q15C 2QVGA 1ZH4A 3IPCA 5ED4A 4WT7A 4F12A 4MGEA 3C3MA 5C5EA 4W5RA 1LBIA 4KNYA 3A10A 2NT3A 1Z13A 3GYBA 4ZPJA 2FQXA 3OMWA 3IDOA 3SQNA 4IF4A 1JYFA 5TQ2A 1QMPA 4MR8A 1XHFA 4KZKA 4RXUA 4ZYLA 2PUFA 1CHNA 2E4VA 1JHZA 5EWMA 5JNRA 4G0QA 3JY6A 1E6LA 3C3KA 3EULA 4HNRA 5KC8A 1IIBA 1ZH2A 4DN6A 1DBPA 1NXXA 4WXMA 1CEYA 1T34A 4S04A 2E4ZA 1W9HA 1KRWA 1ABEA 3LUJA 4Z9BA 1TLFA 3RVNA 3RH0A 2A9RA 2VUIB 2MYNA 3H1GA 2ZAYA 4D6XA 2FMHA 3N6VA 3IP9A 3C97A 4TN5A 4F11A 2O20A 1JL3A 4P1ZA 4RK6A 1ABFA 1NXOA 5HQJA 4S05A 2PUDA 4Q7EA 3H1FA 2M98A 2IPMA 3O2QB 2A9OA 5EWLB 4GPAA 3JPYA 1KGSA 4PE5B 2AYXA 1SD5A 1KMIY 1P6UA 4RS3A 1DCMA 1TJYA 3MA0A 2IOYA 5JNSA 1APBA 2W42A 2GBPA 3GA5A 3RVOA 2NUBA 5TPWA 2TMYA 2QV0A 2MSKA 3NHZA 4MS3A 4RSMA 2FEWB 3CS3A 3H5VA 4RY9A 3GWGA 1YS6A 1B00A 4F8JA 1WETA 2XDYA 3Q7SA 3EQ2A 1JFTA 3DBIA 3N53A 2HQRA 3EJWA 4F06A 4F3TA 2I6FA 3CZ5A 4MQFA 3P9YA 4PYRA 3A0RB 2PUEA 3RVQA 1DRJA 3D8UA 3GL9A 4Z99A 3H6HA 4QPJC 1D1PA 3JVDA 3G85A 2FW0A 1F4VA 3T8YA 4O1HA 2PAFA 1NXSA 4B09A 1RNLA 1MB0A 3OQMA 1QP7A 1JYEA 3HVRA 3KSMA 2JK1A 5FBKA 2OENG 2F8SA 1ZN2A 2LUOA 1QPZA 5IEBA 5CNKA 1QNLA 2LPMA 4WUTA 3VNBA 4ETMA 2PE5A 1GLGA 3N0XA 3O75A 1NY5A 2VUHB 2FN8A 2CHEA 4YO7A 1ZDMA 2E4UA 1BA2A 2NT4A 4KPYA 7ABPA 4YS6A 1K66A 1EWKA 3OLYA 3B2NA 5BRJA 1JFVA 4N0PA 1LBHA 5B3JA 3CRNA 3HV2A 4H3HB 3QX9A 1VRVA 3DZDA 3GV0A 4EYKA 1GUDA 4Z4HA 3HK2A 4OG2A 2LP4Y 3NNDA 2IPNA 3ILYA 3OQOA 2F8TA 2JBAB 5BQ3A 4TLMB 1XHEA 2VYCA 4MRMA 4RDCA 1FFGA 2X7XA 3OO1A 2RJNA 1M5UA 5E3JA 2IYNA 1HEYA 3HUTA 3KG2A 3I45A 1ZITA 3LUFA 3OM1A 2FLWA 1DJMA 3FGZA 4EYQA 1W25A 1DRKA 2R48A 4OATA 1GCAA 1NTRA 3M6MD 3LUGA 5D2CA 2FEKA 3LUKA 3LOPA 1BDJA 3CU5A 1DBQA 4D6YA 4WWHA 5JS1A 4ZJPA 1ZGZA 3KKEA 4KMRA 4LE2A 4OBBA 1Z2DA 3MIZA 3HO1A 4OLAA 3O1JC 3CNBA 1U2PA 3MF4A 3HSYA 3URMA 2HPHA 2OQRA 4YV7A 4GNRA 3BRQA 4KQ9A 3W9SA 4RY8A 3S99A 3O21A 3QLTA 4EY3A 1QO0A 4IMIB 2JVKA 1DC8A 4FE7A 4PEVA 4IMJB 3QEMA 4M88A 3QX8A 1DG9A 3QLUC 4EGSA 1M2EA 4NQRA 2IPLA 1DP4A 4MQFB 3CFYA 1Y1LA 3O2JA 4G0YA 4P98A 4MR7B 1RZRD 3Q9SA 4G0PA 1Z26A 1QP0A 1NXVA 2IKSA 3GBPA 4OLBA 2LIVA 4H3KB 2WY2D 1DC7A 4N41A 2E4YA 1S8NA 3KJXA 1U8TA 3QELA 5KQGA 4MS1B 4TLLB 2N9UA 5IUJC 2M1ZA 2R25B 4G0XA 4H60A 4MAAA 2MYTA 3A0UA 4MS4A 4Y9TA 3HUUA 4LZLA 4DQDA 1SRRA 3DLBA 1NXPA 5HKOA 3LTEA 2HQBA 4RV5A 3N0WA 1FQWA 1EWTA 2B1JA 3JPWA 2HQOA 2PJUA 4JOQA 2P9HA 2FQYA 2HSGA 4MLCA 4FB4A 5IUKC 5BRAA 5JNUA 4EUKA 1A04A 1Z25A 4O1IA 4MQEA 3F73A 3C3WA 5IBQA 2RGYA 3CTPA 4HNSA 1USKA 3CZCA 1JBEA 4MRMB 4Z4IA 1ZGGA 4Z4GA 1VKRA 1E6MA 4W5QA 1NXWA 2FN9A 4PZ0A 1RZRA 2RDMA 5IX8A 4MR9A 5JNWA 4TMYA 4RK0A 1P8AA 3E61A 3RVMA 4RXMA 1EFAA 4KRFA 1U04A 1D1QA 3Q41A 1A2OA 4RXTA 1YVUA 4RK4A 2MYPA 4QYMA 4LRQA 3H5IA 2P4UA 3OLXA 2WJWA 2AYZA 3FFWA 2NZVG 2L19A 1LJLA 5FWXA 3T6KA 4G0MA 5CNJA 2VK2A 2FXIA 4LX8A 3ROTA 1PEYA 1XWWA 1ZHHA 3H5WA 5JNVA 2QVCA 5FWYA 3MYYA 3F7NA
chains in the Genus database with same CATH superfamily
4FX2A 3QK7A 4D5GA 2FP4A 1L5WA 1JDNA 2W2KA 4GO1A 4TSKA 2DFLA 3P0IA 4KPEC 1XL1A 3GK3A 2BI7A 2JARA 3FD8A 2HL6A 2H85A 1Z83A 2NO9A 2X2OA 3CNNA 3DDNA 3IFSA 2DBZA 4PZEA 5LIRA 2HO5A 5KINB 4X63A 3UAZA 1HH4A 2ANBA 2ISQA 2IODA 2ZUDA 3DVRX 3LKBA 4JX8A 5DGHA 4EVRA 2WJHA 1MGPA 2D0OB 4J16A 3I76A 3IAS6 2OXFA 2ZSEA 3IMKA 3LM8A 2KW5A 2VHUA 3K5PA 3W5AA 2JDIA 3EMVA 1X9GA 2RHHA 5LQDA 5EQJB 8OHMA 1DL5A 3IQEA 1VL0A 2BCGY 2H92A 1IYZA 2NG1A 2QG9A 3G1WA 4IOMA 4O5OA 4NU0A 2I6XA 3K5WA 1ORTA 4BNGA 1O87A 3G49A 4UC0A 4OHXA 4TYPA 3OWHA 1ARZA 3W3AA 5F3DA 4ALMA 2FPSA 2WUWE 2ADMA 4O4HA 2YWDA 4QAQA 3GUCA 2J45A 1AH2A 3PFBA 3CLSD 1RKQA 4GYKA 4DADA 1TM7E 1W0KA 3AKCA 4MWTA 5FKJA 2GEKA 2XDWA 3D02A 3DOIA 3IIMA 1I1HA 3P1JA 5AM3A 2Y0PA 3BZWA 1SGWA 2FSGA 4PPNA 3VI4B 1SXJB 2DCMA 3ZD8A 1QFMA 3CPHA 1N2SA 4MP8A 3BS4A 1EDEA 1J25A 1CHDA 4JUDX 3RVDA 1UPAA 1YRWA 3WK8A 3M1LA 5IT4A 3NVKI 2AGVA 1EQ2A 3LHDA 4MV5A 4C4RA 1WKCA 1LF5A 3RVPA 2HV9A 5C4MA 1DKPA 1NM5C 1SNYA 1JH9A 4E2WA 2HW8A 1K4YA 1UBMS 4KGDA 1ULUA 3LIPA 4ZCSA 3W8RA 1ZVMA 4C2TA 2ZWMA 4NYJR 3ABZA 1C0KA 2B8JA 2H5IA 4ISCA 1SXJD 1DIRA 3PRKE 3U7QB 1FDRA 2J3LA 2JFNA 3RSSA 1ZVQA 1CPYA 4RFLA 1MKYA 4YMSA 1D04A 3IKMB 3N28A 4J6EA 2C99A 4DDKA 4DNFA 5BURA 3WBFA 1N5OX 3TQOA 1U2QA 2FEPA 5EOVA 5HPYB 1T1EA 1UXHA 3ST7A 4B2YA 1TUBB 1BFKA 1OIXA 2XDAA 1Y6ZA 3QTLA 1LV7A 1O77A 4JQOA 3EVAA 4Q0MA 3VSBA 2CUTA 1KNQA 1WW3A 3HP7A 5JS8A 1D09A 1IZ9A 1T9BA 1QK3A 1W4CA 1XV5A 2ORIA 3HEBA 3LQRA 1OX4A 1T5LA 3HCNA 4OHRA 5ALDA 2D6FA 2E21A 1ID1A 4U7GA 1ISJA 1SUAA 1OA1A 4BYGA 2JC3A 1KQGA 2DFPA 2W2QA 2WUGA 1SB9A 1JEQA 1V71A 3JAKB 1E7YA 3JTEA 1THTA 4OTZA 4PS0A 3N59A 3E4CA 4JJGA 4UDYX 1R4NA 5G4KA 4ETWA 4BMXA 1LSSA 1Q1BA 2ZUCA 3S6JA 3PF9A 2IW3A 5AVYA 3LT2A 1U5CA 1F1JA 4C0BA 3S44A 3RBXA 5IYZB 1SBIA 5KO2A 3UAWA 3JQGA 4W82A 5BVGA 3UAGA 3QEAZ 1EDBA 5TQJA 4K05A 4MWGA 2BFEA 3ZW7A 2P4SA 2YZGA 3ZZTA 1H0HA 2WJZB 1U4NA 1XMPA 3OLCX 3WIBA 5L4LA 4CG1A 4LMBA 5A7FA 1ZMOA 4OGKA 1P9RA 4RLQA 4CL2A 1UEJA 1Y5RA 3KR2A 1MO4A 2WZDA 4DA4A 4Q7MB 1NVTA 2AMJA 3OJOA 5EP3A 4K3UA 1P91A 4GBED 2GKGA 1H1LA 3HYNA 2A4KA 4OCZA 3Q5DA 1UOPA 1ZA2A 3X1XA 4KFCA 4JI0B 2F4NA 4M0EA 1E3WB 1TQ2A 1RIFA 2PKYX 3I4FA 1IN8A 5JPCA 3VJMA 2C2BA 1C1YA 1FUEA 2GM4A 2AN1A 3NIBA 5CDUA 1EXNA 1ZSVA 2WQZA 4CKCB 2RFLA 5L6MB 2I3BA 4H6VA 4UM8B 5K9ZA 5BSMA 2V0NA 1V39A 2WYIA 4E4YA 2FZEA 4KR3A 3SSMA 4BV2A 1FSPA 3EQZA 3HU3A 3JD1A 5LQUA 3K0FA 3ZJUA 1DO0A 4EJSC 1JFSA 4MCJA 2V6JA 1XMQB 1UWLA 1TM3E 1WS6A 2NU9B 4HNAB 1J20A 5CM8B 1QP8A 1BE8A 1UZLA 1YU9A 4TKVB 2VI5A 5LDDC 3EMKA 4BCDA 3EDCA 4FCWA 4YJ3A 3KC2A 3GUYA 1B76A 3E6AA 5FOWA 1FFSA 1M34B 2IPOA 5DEIA 4IF6A 1DAIA 4EA8A 1HDEA 4UOEA 1ODFA 3FOZA 2CEAA 4GOJA 4ND1A 2A7XA 3JWHA 4ERXA 5BN4A 5BW6B 2BFBB 1KO8A 3V8MA 4GD3Q 1O96A 3KPYA 4JBGA 2QRPA 4OA5A 3CNOA 4DLUA 4L9AA 5LP6B 3OWOA 2ONKA 3ND6A 1N2BA 3THWA 1KVTA 2PJZA 3T3GA 1T4CA 1PJZA 3BTSA 3ZE7A 3D1LA 3QW2A 1PDOA 5KJ6A 4ZVVA 2R11A 1P1HA 1SXJE 3HYTA 3O4IA 1T25A 5AI9A 3NM4A 5DMHA 4ZA2A 3WSVA 3HB7A 1YTUA 2Q1YA 3OZXA 1PVOA 1RVV1 2WF9A 5AVJA 2J3EA 2A59A 4RTRA 5CXQA 2WMNB 1OGYA 2C57A 3GPBA 2VNJA 3N2GA 3U7GA 1JS1X 1LPOA 1GDHA 3ROEA 5IKPA 1GFZA 5K3BA 1EFHA 1ZW1A 1AN9A 2CJYA 4FONA 1ZRHA 1Z68A 2I3AA 3HM2A 3GD7A 5KWSA 1I7PA 1K8QA 1MJHA 5DRTA 4K46A 1S9HA 4OB8A 3RBAA 3WA6A 1XDWA 4P36A 4MZDA 2ZBPA 5F2KA 2H29A 1IXKA 3GBVA 4FYPA 4M7PA 4AFNA 2OHIA 3A70A 4EG5A 3Q5EA 1RXWA 1JEDA 1C4OA 2DEUA 2H1RA 2P75A 2RBGA 4WQMA 3P9IA 1FMTA 2CNWA 3ZS8A 3LQ4A 4AJ9A 1DBWA 2VZ0A 4EF6A 3SI7A 5CVTA 2B8TA 2XSZA 3O92A 1T5DX 1MEOA 2PL1A 3LY7A 5IABA 2Q62A 5JAUA 1VL5A 1GQQA 1YFZA 3FPCA 4OL0A 3KXIA 5H83A 1JGTA 3T7DA 4MQ5A 1AHNA 3KKMA 4YLGA 4MYRA 4MTLA 1CG6A 4XAQA 5KUTA 2XXJA 1JEYA 5LWQA 1FMFA 4DLPA 4MI6A 3GI1A 1P9WA 1XB2A 3II6X 5DLPA 4XARA 5AQ1A 1A8PA 1NC1A 1NOKA 3V4ZA 2FG7C 4YRJA 3DDOA 4JYPA 4DCCA 3NETA 4AC9A 1QAOA 4RBNA 1X7YA 4X8OA 3E48A 4H0FA 5HWSA 1QZ3A 4LC1A 4FFRA 1EM8B 5E3HA 1U2DA 4FGLA 1V11A 2R84A 4NEQA 4KVZA 4QBGB 1FU8A 4X84A 1SBYA 3MWYW 5IBRA 3WRYC 1ORIA 4F2HA 5BXYA 3SSNA 1L3IA 2GCOB 1C3JA 4J1SA 4JHLA 4UDXX 5KJCA 1VZ3A 3O8QA 2VH2A 1BWPA 5TE9A 5ED0A 4HG2A 3JYOA 1U3DA 5ALTA 5AK5A 3L07A 1MR3F 3CQ9A 2IDZA 4KJXA 4KV9A 3WFZA 2OVFA 1XCLA 3AF5A 4LMRA 3SQNA 2W0MA 2DCUA 4BE9A 4F4CA 2XUFA 4OHPA 4A3SA 1QMPA 2SECE 4MR8A 3B3QA 4D26A 3OQ1A 1M74A 3AFHA 2D59A 3NFYA 2J5KA 4TYWA 1KA9H 3ND8A 3ANYB 2AXQA 2PR2A 3NATA 4Q05A 3RSFA 3X1MA 4LHVA 4DGSA 1RHUA 1WF6A 1WR8A 3UC9A 1MOPA 3F8SA 4C01A 1O9HA 2AFRA 3EC1A 1NKVA 4ZU1X 2CVQA 1AF4A 1SVMA 4RVCA 4WLUA 2IYPA 4Z9BA 4QOGA 3KQNA 2ODPA 3JQ8B 3CVYA 4BV8A 4H2DA 2DWUA 2WJVA 1FNMA 2ZBRA 4E5DA 5D1NA 2IXFA 1YGYA 5DW3A 1WCXA 1YI1A 4M4SA 1M34E 2JD2A 1O6GA 5ECWA 5BOVA 3TZCA 1JIVA 4ECAA 3K0CC 3QJ5A 5DH9A 1R0WA 2FUEA 5C2JB 1T5SA 2V0GA 3ADDA 3F4KA 1S3GA 3QVOA 3MIIA 3R0XA 2DSNA 4EAQA 3JSAA 3GJXC 1GRQA 3O4HA 1K2VN 1LA2A 4BGEA 4OJYA 3C6YA 2ZRKA 2ZAGA 4LVUA 1PS0A 4XWAA 1KJYA 4GLBA 4WOBA 1ZLYA 3K8OE 3GA5A 1G2IA 1PGNA 4MW9A 3W7AA 4F2DA 2F1JA 4WKNA 3V8VA 2JGJA 4Z2AA 1KJQA 2UUCB 1WULS 4G1UC 1ZD8A 3IQXA 3VU8A 3WMEA 4N7JA 4R7ZA 5EQTA 5A2GA 3F8WA 1F0KA 1SHZA 5CCXA 2ADOA 2Q21A 2WYWA 4KYVA 4LTMA 4NZZA 1GL7A 2PKRA 4NULA 1Y5LA 3F9RA 4XZ3A 4RKYA 4BJ5A 4UEKA 1GN9A 1I4EB 1GG8A 3IIIA 5K4AA 2XAUA 3T5MA 2BD0A 1ENZA 2VQ3A 2JLSA 3BGVA 3RAFC 4X97A 4HNTA 3Q7IA 5I4BA 4HDNA 4YCDA 2FUG1 4BNWA 1IK6A 3PC8C 4L5CA 1R64A 2W5UA 3O8BA 3QVSA 3RW9A 4B6PA 4JSYA 1BOOA 3TOCA 1P3DA 5ADVA 1AO3A 2W98A 2JAXA 4GX0A 2JEYA 5K0EA 2SKEA 1VJ1A 4QDUA 2D4AA 2GK7A 1BA3A 2FW0A 3INNA 2IX3A 5J3JA 1IK4A 1WOYA 2Q1XA 4L6IA 4DRXA 2PAFA 4B09A 1MB0A 3O93A 1QP7A 2Q3JA 4DNOA 2BFCA 2PLWA 5J2UB 2IU3A 2GOYA 1O94D 2WHQA 1D1TA 1ZJYA 3N8KA 5K3FA 5CNKA 5DE3A 4RD2A 5LN1A 5FA6A 2IHVA 1O6BA 4BNUA 5I45A 3ZOZA 4YUXA 3H0EA 2WC1A 2OCPA 3FYCA 5HF5A 4BB9A 1MRZA 3TFWA 1M33A 2IXTA 3SEZA 4EGJA 5K4GA 3VKVA 3DE3X 3VV2A 4DLXA 4OKIA 2BGKA 3CRNA 5K45A 1IJFA 1V37A 2WD7A 2YUIA 4UHBA 3NEAA 3T06B 1DIGA 5DNUA 1ATIA 4MQ6A 1BX1A 3RIGA 1E2NA 3AETB 1SIOA 2ECOA 2PUTA 2JIQA 1W4BA 1X1CA 3D8HA 1HEIA 3KE8A 4JSTA 5CA1A 1ZOPA 3RSHA 5ES4B 3U44B 1VIVA 3S81A 1Y8ZA 2YV2A 3HN7A 2AR7A 2W22A 2LVBA 4CF7A 1PL7A 1VHQA 3PX2A 5I47A 2VF2A 1WXDA 1G0NA 4Y2UA 1ZMTA 2PNFA 3EVBA 3FGZA 1GZUA 4JJEA 1W25A 4DCTA 3BMNA 4B3FX 4O0MA 1NTRA 2J7PA 2R96A 3AJAA 2ZBFA 4C06A 1WP4A 4J8PA 3T99A 4DF3A 3ADCA 1YSCA 3W90A 2IYFA 1QGYA 3MYRA 4U02A 3N0VA 4UBLA 5ER9A 5IJ0B 1GGJA 2ARKA 1X87A 5JAOA 1C3OB 4P81A 5A3JA 1ESMA 5C7YA 1NUUA 4KNWA 1ZGZA 3EIOA 4X1KB 2XE7A 2R44A 4MWOA 3F2VA 2G6TA 2PBZA 1LLUA 1L4EA 2ORWA 4M1MA 3Q3HA 3URMA 3VPBA 1N25A 1G9XA 2HPHA 2YICA 3PQDA 4NG4A 2QYHA 3BRQA 3EGWA 3L8ZA 3L84A 4KQ9A 1HLDA 3VDRA 3MMSA 5H9VA 1GZDA 4BMVA 2JI9A 5K05A 1N3BA 1FUKA 1YBAA 5EGSA 2H1CA 3M6AA 4NBVA 3AHDA 2L42A 1IXRC 4IMJB 1N6RA 3FPLA 1XT6A 3C7AA 1GLNA 1VMDA 3G2JA 1BMFD 1H8ED 1FRNA 1W2GA 2OHFA 2DFKB 4F92B 3CFYA 1Z5WA 2RCNA 2P6PA 1WCIB 4I8XA 1M8JA 1MB2A 3AUSA 1HDZA 2FWNA 2XT0A 1JW9B 3RJ9A 3THRA 1SC6A 3GVIA 5ICMA 1TUEA 2XR1A 2WB2A 5FDFA 2OPBA 3GP5A 1N9GA 3PZBA 4HLNA 1UZNA 4NMXB 2OLKA 5I9BA 4AWXA 5B3KA 3TB4A 1H69A 1K7YA 5F5XA 4NYJQ 3LOUA 1LSUA 5KQGA 1KJWA 4PC1A 3OPNA 3V46A 5AIBA 1AZTA 1HEUA 1NLUA 2P2CA 3IB3A 4NLLA 1JKJA 1PLKA 3I9OA 2RKWA 3JAWA 4IIJF 4PV7A 2MYTA 3QVLA 4UVDA 4BB0A 3L7CA 1U9CA 3W6UA 1SRRA 2J3IA 4DQDA 4Q47A 1P2BA 2FOIA 3BWMA 4LNHA 3G2IA 3QUBA 2LIPA 4RV5A 1T9CA 3IL2A 4ZT3A 2GFIA 3MNFA 4ME6A 1M2KA 5SZIA 5DXAA 4NU5A 4J03A 4QXQA 5A9RA 5CYPA 4YLYA 3N05A 3NBZC 2OKCA 3IMFA 4MQEA 2GD2A 1WD5A 3M6XA 2FEOA 5C7IO 2RGYA 3O4FA 5AKEA 2OL4A 1XJ0A 2CLKB 3ZHXA 4B6RA 2GFHA 4LPKA 1UQTA 3EGOA 2YY6A 2PR7A 5AUQA 3WQRA 2HWWA 1GAJA 4UMDA 1TTPB 1Y8AA 2GKSA 3ECCA 3O9VA 3KTAA 4IJMA 1F5NA 1WTAA 1BRTA 2HN9A 5AESA 5LR6A 5KNLA 2SCUA 1SU8A 4D4KA 2A86A 4K9SA 3VMFA 4L73A 4MKIA 1EK6A 3MCTA 1HOXA 4ALIA 4POOA 1CJMA 4O4IF 3CPEA 3DMPA 2AIRA 3EVEA 3ZV5A 1L4LA 1UBEA 5E7JA 3PTZA 4Z1MD 5KYXA 4CL0A 2EX0A 1TQHA 1CUYA 1PD0A 2GHIA 1C0IA 4WLVA 2FAXA 5AM5A 4C6TA 4EDFA 2GZ3A 5GINE 3COWA 3W6PA 5JNVA 1K75A 2AOTA 5FWYA 3BH7A 1OAOC 2R6AA 2AVNA 1E1YA 2OHOA 2QZJA 4WIAA 5L40A 3QOFA 1XVUA 1TJ4A 2H59A 3BEOA 5G1PA 4KRGA 4PTYA 1FZQA 1VLZA 3UGKA 1PQYA 4LV5B 1RXYA 3P5SA 4M7OA 5P8WA 4F4FA 1RTKA 3AY3A 3EIFA 2VJBA 2DKFA 1OLXB 3ZI4A 3W4IA 1MIOB 1K6MA 4QEDA 1OT3A 1WZCA 1UPUA 3EGCA 3UT5A 1VE6A 4ZVQA 2ZS7A 3RS0A 3LUPA 4OHCA 1E79A 1R8QA 4C2AA 2IYWA 4D3FA 3KP1A 4HFRA 1VE7A 4TGLA 2IBTA 1COZA 4NZ9A 1LD3A 1WXIA 5IS2A 4BWFB 4Q9KA 1PUIA 3T95A 2HM7A 5LSAA 2QVXX 3SSOA 2X3YA 1FA9A 3G3EA 1LW6E 4ZCQA 4UBNA 2XCOA 1W48A 3KLNA 4NE7A 1RM5A 4Q3AA 4BLTA 2O3RA 4ETNA 1F2UA 2QXYA 3KHKA 1HGXA 1ODCA 1IB6A 2PKXA 4IXMA 4U7HA 4EZBA 5J1SB 3I58A 3P4XA 4BQFA 1J1UA 5SZHB 1HOTA 3IAHA 1QBKC 3VO9A 3F1KA 3RRYA 1VL1A 4MJ3A 5FLEX 2A0UA 3LDHA 4LOAA 4BASA 1SB8A 2CHFA 3ZEAA 2JFOA 1MEJA 4GMHA 3K70B 4C4AA 3DEIA 3H97A 4K9NA 1V4NA 3V8RA 2HU8A 4BB6A 3GOQA 1G17A 2I2DA 4BXOA 1JDBB 2QP4A 3IUPA 2J30A 5EUMA 1JR3A 1BH6A 2LDBA 3DULA 2VT7A 3KPWA 5JPIA 4XIFA 5JY1A 1MUUA 3TLGA 2YINC 1P45A 3AJ9A 4PLPA 3V2UA 3K6JA 2OZLB 3AM3A 1N7IA 3NEYA 5E4JA 1TZKA 3KR0A 4GECA 1CUXA 5ANRB 3KYCA 2PD6A 3Q72A 4RSHA 1NVAA 2L69A 5I7SA 1R0KA 1NR7A 4QYXA 3P9XA 1RJWA 5D8DA 5DLYA 3SIWA 4B3DA 3AEUB 3G8BA 3LL7A 2HK8A 1X7WB 1PZGA 3G2MA 2B4TO 4TTRA 5CR9A 3DZKA 3UANA 4RTSA 1W85A 4JOBA 1QFYA 4JXXA 3VVCA 4K9PA 2FMIA 4K26A 2FLKA 1KC1A 5M3BA 2PY6A 1GT6A 1KSJA 4IHJF 4LBVA 4GOMD 5EZYA 3K2BA 2QAGA 1ODLA 3GRRA 5TSDA 5C9ZA 3HP4A 2IPXA 1WXGA 2RARA 2JNWA 2JCGA 3MM4A 4P3NA 2GXAA 1XTKA 4R9NA 3AUKA 1UBOS 4Y0VA 1R5OA 1FDOA 2GZ2A 3C87A 3ZX5A 3WBJA 2QTCA 3NIFB 1BDHA 2VIIA 1KRXA 1E1CA 1G6KA 3FAKA 4TXLA 5KOHB 5JD3A 1E58A 2M6SA 1B3BA 1HTWA 2GD6A 2C8JA 1IMJA 4K2AA 3GZNB 1JE1A 2H2DA 1TB4A 4URVR 3L6CA 2VUSA 3I1IA 3KOMA 1M54A 4KQHA 2JI4A 3T1OA 3L8YA 1B0UA 2C4WA 2XZLA 2J33A 4Q3BA 1KI6A 3QYFA 4U7JA 4CM8B 2AN5A 5KQLA 1I3MA 1U98A 1XZQA 3H42B 1R2QA 1RCUA 3IUQA 2PX0A 3OOHA 3ZWMA 3WNZA 2AI3A 4NX2A 3ZKAA 1WU7A 4DDUA 3GP3A 4Z6KA 2BEKA 2ZR9A 3KCQA 2FN4A 5HILA 1Q57A 4E51A 1I01A 3K1AB 3WX0A 4FJ1A 1RQRA 1H2AS 3K9CA 4NBSA 3ANXA 3TQTA 4MYSA 4XXHA 3WIDA 1V25A 4DV6B 1MNQA 8ATCA 1T24A 5AKYA 4O3FA 1W87A 4OJQA 5TIIA 4PVDA 4C07A 1RSZA 3HO8A 4M0DA 3S2GA 2JATA 2IA5A 2Y76A 2Z2JA 2VDVE 3DA8A 5ENZA 4DS3A 3WAKA 5FV7A 2BJWA 3PGVA 5I48A 3ILSA 2ZJ0A 2Z6AA 1WHTB 2ZATA 3R1IA 3WQBA 1V1MA 3FH0A 4TT8A 5COAA 5F7ZA 3C8HA 2R8XA 2R4UA 4W8OA 2FF5A 3T1YB 1Z5VA 1SQ5A 1TECE 2A5GA 3GCZA 3PDWA 1Q0UA 4JLJA 2X9QA 4Q1VA 2Y1DA 4M1QA 1HE3A 1NM5A 1Z8NA 2VRNA 1AKEA 1D5WA 1S2MA 3LG2A 4M9ZA 4MULA 4RPGA 3SHTA 3O4VA 2PSFA 1ZGJA 4FLMA 5H59A 2UYGA 3WR5A 4AZTA 4N7RA 3RUPA 2XCQA 3PPXA 3PJGA 3K72B 4H3SA 2WWTA 4Y30A 4PYJA 2Q5FA 1A5ZA 3FMOB 4HP8A 3IP7A 4Q6BA 1YS7A 3ZLBA 3OZSA 4ZOLF 3UKJA 1YBFA 4BFZA 1TT5B 2JJ8A 5JC8A 1V2HE 4X1IA 3DOJA 2JGLA 1NAHA 1FQKA 1QIIA 1V5EA 4HVCA 3K1TA 3DUFA 3V1TC 2NSJA 3IE2A 4EDHA 3EGDA 4GF5A 2G88A 2PL5A 4IDCA 2OP0A 1LXCA 4HQLA 4V2IA 3C3AA 2VZ8A 3GU3A 1PJRA 5B4UA 4KDFA 3U5ZB 3KUKA 1P4HA 3IPRA 4FOTA 1GRCA 1AU9A 4JU9A 1Y48E 3AB8A 4L4UA 1G3MA 2R9VA 4JI7B 1OT5A 5IM4F 2NQTA 2ZI4A 1Z8FA 2PX6A 5JHGB 3QU9A 1MVLA 1U1IA 2EZUA 1X13A 3LBAA 4AQDA 3ZWYA 3K05A 2PIDA 4RZSA 5T6MA 4UBIA 5AJZA 3FJ1A 2IELA 2WMYA 3GT7A 1JB1A 2VXCA 4LYDA 2Z1NA 1Z63A 2H2HA 4ILKA 2VBCA 4V3CA 5I5GA 5ITSA 2C96A 3EBLA 4TKZA 1XQ6A 3ZE2B 1XZHA 2JKZA 3GUVA 1BVRA 3KM0A 4IDFA 4U2EA 5DV9A 4IEIA 4YCSA 5B4VA 5AOCA 2WTNA 1Q1QA 3I34X 1ULSA 1ZSYA 2Q5IA 4NNOA 1UPTA 4YN3A 1DEKA 4H1WA 2KYRA 3CLVA 3F74A 3JZMA 4BQRA 1UIMA 4LY3A 4R98A 4RU1A 3Q1KA 1EEXB 1UCFA 4QPZA 3M3DA 5KWEA 1DBSA 2B2CA 5FO1A 4BNDB 3QKIA 3UOWA 3FW1A 2CJWA 3O9ZA 4XQ0A 4ZDWA 5JDIC 2PQ2A 3GARA 3SICE 1ZD1A 1M8FA 1KEEB 1P0FA 1RR6A 1ADBA 2L17A 2PMKA 2Y1EA 3BDIA 3PD0A 2VOJA 5T3YA 3GUUA 1JQDA 1YACA 4PLTA 5DBIA 3VOTA 2YFQA 3A3YA 5TRTA 4C43A 5KBYA 4KX5A 4ZYUA 1KOFA 4Q4AB 3OT1A 5CFLA 2QGFA 3ZHQA 4EJSA 2GN8A 1QH1A 3A4VA 1ZGCA 1V7PC 1TYDE 3K8YA 1Q74A 1J33A 2DUMA 4LJAA 5FR2A 3WYCA 4CKXA 5C5CA 2Z3VA 3Q15C 2QVGA 1PZHA 1EUCA 3HXKA 3OE5A 4W5RA 2HF7A 4M37A 4BNHA 2EL9A 4U6SA 4KNYA 4UQLA 4FHCA 4JJZA 3BIFA 3GYBA 1L8AA 3F5MA 2AOVA 3LNTA 3UAYA 4DIEA 1VA5A 3B9PA 1F9EA 4BO2A 5AUOB 5TQ2A 4KZKA 1AHIA 1I6MA 5JJBA 4DNPA 1MJGA 3N3BC 3HU2A 2RE8A 3F3MA 2YASA 3QYAA 3R5SA 4F6RA 3IJEB 1MW8X 1U7ZA 4B74A 4JI2B 3N86A 2Q29A 2HREA 1EFCA 4TUYF 3I5MA 1X1QA 2E4ZA 3FI9A 1SVNA 4L9SA 5J1TB 4HWOA 3T7RA 3VSCA 1NMSA 1VJGA 3Q1LA 4UUOA 5IAKA 2N3ZA 4E2FA 1IXYA 4GX5A 3ZU3A 3KKOA 1GAWA 4OGLA 1BQEA 1KDZA 2KS6A 3DXXA 3C97A 4F11A 1M83A 4EGFA 2WKPA 3UXHA 3HA2A 2HMYB 1G3QA 2BWJA 1ZXBA 2BY4A 3IELA 4MV4A 4JGBA 3LPNA 3I3SR 5F9HA 1T3TA 1EUQA 2B94A 2O2EA 2P30A 2Z5LA 4EITA 3V4RA 3P9NA 4JN6B 5LQCA 4TYMA 3WWCA 1D6SA 2MSCB 4R2WA 4CHTA 4F8EA 3LWZA 4FI3F 4PAGA 1G55A 3QQ5A 3AHHA 2IYTA 3OTIA 3KKKA 2A1UA 4PYQA 3GG2A 5TT0A 3UKDA 2LCFA 1NDUA 5CB0A 4TWIA 5JFOA 5K8IA 1MAAA 1TZ2A 3CIOA 2HV8A 5AUNB 1V7CA 3FMGA 3VR1A 2Z8XA 2HRBA 3NWPA 4ZCIA 4QC2A 1HDXA 3C6BA 1G8MA 3N8GA 1CJTC 2VJMB 4QJ4A 3WKBA 3G23A 2B20A 5K3CA 3P9YA 4MW0A 3FUWA 4EFKA 5CDFA 2PYIA 4FCVA 1T2AA 2FHPA 1VCOA 2FUG6 2Y1LA 3CRMA 3K0AB 3ZDRA 4DABA 2OR3A 2VDNB 2YJGA 2D4HA 2UAGA 5KPJA 1QH8B 1NRXA 2HWUA 3A1TA 4FUQA 3C48A 4YCJA 3UJ8A 3A1SA 3WRYA 2J4DA 5AVSA 4FDAA 3TDNA 4QOFA 4DY4A 3FOFC 2AFVA 2PGXA 1V5IA 1T36A 2BBOA 1PGOA 1XJQA 3L7MA 3U7JA 4EW6A 4NYIQ 4MZXA 3L1JA 4MHSA 4ZWNA 4AMYA 1D7AA 2CW5A 4QFDA 3PTAA 1SD1A 3GRPA 4WUTA 4JEUA 4CEHA 5JXIA 3QU7A 2NU7B 4G5OA 2WTBA 3D6FA 3VH1A 3WHLA 4DSUA 3EEQA 4ZT5A 2PQ0A 3L06A 3R75A 3DDWA 3BK7A 4OIFA 4IYRA 3VVMA 3L6DA 2OZKA 3WYDA 3ZCXA 3ER6A 4FU0A 4CZ2A 4EHAA 3B2NA 2BEVB 1I5OA 2C2XA 2GBLC 3CLUC 4LY9A 5AHKA 2PFSA 5SYMA 1O7JA 2J1LA 4WOKA 4DV7B 4UNRA 3T5TA 1NVGA 4X91A 4B4KA 4HB3A 2HQSA 1PD1A 2HMWA 3RHSA 3A04A 2W6NA 5F9FA 2UXDB 3GLRA 1FP1D 3GMTA 1CERA 3NPAA 1ZOIA 5KOIA 3IMGA 1W35A 3IEMA 3C1TA 3AHJA 1HEYA 1ZL2A 5GONA 4P4GA 4XPIB 1VL2A 3WDSA 1IPEA 1F8FA 3I45A 3KG2A 3IR7A 3P8ZA 3SXUB 3TLMA 1W5AA 2F9FA 3AUTA 4M22A 4PYLA 4EPTA 4Z2YA 4JC8A 1L9XA 1LRLA 1VIYA 3HTXA 3JYLA 3T7EA 3EZGA 3LF2A 4L2IB 3FN4A 3UK6A 3S2UA 2PTGA 2Y1CA 3AONB 3K0CA 1ORVA 1ZNQO 3NVDA 2H51A 4X1YA 3OOSA 4ZZ1A 2BF7A 3JQAD 1E64A 3IDSA 2DSTA 3HO1A 2O2CA 2CT8A 1Z0IA 3R7DA 4TV9F 5FHQA 3W9SA 1OLSB 3E84A 3SHOA 4XTRA 4ED9A 5KNCH 2FW1A 4RPJA 2ZR0A 3P45A 4LJYA 4CWAA 1QFZA 2O8VA 3N0TA 1SD2A 2I4RA 1UMBB 2PKQP 4RE6A 2FQ1A 2FSSA 1ORDA 4B3JA 4Y9UA 3I2IA 1DC8A 1ULHA 5HW0A 4MINA 4PEVA 1IZZA 4A6XA 2DPXA 1TRKA 3JV7A 4FSXA 3WS7A 1OXTA 1BGXT 4NQRA 2W37A 3VKUA 421PA 2JFGA 2PA3A 4X7MA 4XVUA 4GKJB 2JBHA 4WBXC 4XGQA 3PC8A 4M2LA 2VTBA 3E9YA 1I1QB 2RH4A 2JCVA 4F5YA 1YKFA 4RSGA 2HXYA 4MVJH 2DETA 1C81A 1J97A 2C88A 2OFOA 1HE5A 4TZKA 4KX3A 2ZT8A 3ZDBA 1WZUA 3LPCA 2CBZA 4MW5A 5GJCA 3OOWA 1BFDA 1VE3A 3ACCA 2FE4A 3GQVA 5DEOA 4NBKA 3BB4A 3FKSD 3RASA 2C2ZA 4GIBA 4MCAA 4F5ZA 4H77A 1IZ8A 2R25B 3PXXA 3Q9NA 4RF4A 1G5RA 4MAAA 3FRHA 1YR2A 4M1SA 4DCMA 4WZAA 1RM3A 1EQUA 1W5EA 1G4HA 2BMJA 1LDGA 2JCXA 2QMYA 3AINA 3GDOA 4JOCA 5H4HA 2HQBA 2Q7OE 4HNUA 4IIJB 3SDSA 1XZDA 1R3UA 3JPWA 5A5FA 4NESA 1HT0A 1UFVA 2WFZA 4NR0A 5ALFA 5HFJA 5JNUA 1SZDA 3E53A 3ZU4A 3W4JA 4DIOA 3GLIA 4IDBA 4YAOA 4XD7D 1DJQA 1T4DA 2VYND 2WKRA 4YV0A 3L0IB 2AFHB 1DNPA 4I8IA 4K9QA 5BYBA 3UNXA 3EB9A 2RMKA 3UMFA 3HVIA 4QE3A 4KO1S 4Z4IA 1VKRA 3EUFA 4C1NA 2ZETA 1D2GA 5ALKA 5I9IA 1YA8A 1RKVA 2V6BA 1KVSA 2P6OA 2ZTLA 1G20B 4PZ0A 4Z86A 1MC5A 5DYGA 3ROQA 5IX8A 3U5TA 4UUMA 4B3SB 5C5IA 3INTA 1U04A 5F77A 3EGIA 4E4TA 2YV4A 4ARBA 1XPRA 2JF0A 4K9MA 3KJZA 4MVYA 1ACLA 2AD1A 4D6PA 1Q15A 5L7TA 1P2UA 3V8EA 4QQ8A 4JBIA 3IOBA 3A6EA 1IQ0A 3G82C 2ATIA 3VH2A 1RRCA 3NTXA 4DUPA 3GD5A 4K5QA 4DG9A 3SF8A 1F38A 1JG6A 4RO0A 2P4UA 1PI3A 2C5LA 4F38A 2VDRB 2ZRGA 3BMQA 3EBOA 2AE1A 1OMOA 1YCGA 3MWEB 1A9TA 4O4IB 1NIJA 1KYTA 3OCYA 1ODSA 3B2QA 2FXIA 3NXSA 1T9HA 3H5WA 3WHIA 3IB6A 1IJBA 1TGYA 4DIUA 5E6SA 1N36B 4S0XA 4AJHA 1WW8A 2Q3FA 1E2KA 721PA 3IX7A 1M2WA 2ZRHA 1ISPA 4LXUA 1VKZA 2DR2A 4YDHB 3Q4GA 3SD7A 4H6PA 4CIWA 1SBNE 2LBPA 3VJKA 3UJNA 1XTBA 2C9DA 5IXSA 4MARA 1HDRA 1LJUA 2F8LA 1TAQA 1ZJ5A 2AUMA 3CNLA 1KKLA 1U5BB 3B1VA 2C7GA 2XMQA 3FTQA 5JXJA 4TWZA 2WJIA 5IZCC 1A0OA 1VPDA 3KB2A 2XRFA 4C4ZA 3E9ZA 1VSVA 1BMTA 4E5SA 1OKKA 5CDYA 5E7QA 5A5GA 4MMXB 2CXTA 2FETA 4KH1A 3ZCQA 4DPLA 3DSRA 4EJ6A 4ZZ3A 5M34A 5ERYA 4NOMA 2AE2A 3M7IA 1A9OA 9ABPA 2F3UA 4CODB 2QJFA 3OOEA 4U7PB 1CY1A 3D5QA 2BDUA 5DB4A 2EG5A 1W19A 1U94A 4K6MA 4BNZA 4BEJA 4H0CA 4LFCB 4IL5A 1AB5A 3CUKA 3NAQA 2C7QA 2O59A 4J0EA 1CR6A 4MI1A 4C7VA 4EI7A 1KE1A 4PX5A 3HXLA 4EY4A 3R7WB 3WFJA 1T0IA 3QHQA 3VDXA 1DG1G 4W5WA 1RLOA 4A03A 1ULAA 3R3HA 2DBYA 3W2GA 3GNTA 2IS1A 4I1SA 1VLJA 3LX6A 1WL8A 4TXHA 1AQUA 4FYKA 3VAAA 5LU8A 2FRVA 2FW7A 4G0ZA 4MWCA 4EEXA 2HIHA 3HFSA 3LBIA 4PHHA 2LE0A 3AM4A 4UVEA 4WDRA 4LPSA 1C41A 2NXJA 2RGCA 1TF2A 4X71A 1PX0A 2R8RA 5AKLA 4QM7A 3CLTD 3IBGA 4QA9A 5JZ9A 2H3EA 4QYIA 2JFBA 4MVJI 1W88A 3DDSA 3BQ9A 3OF2A 4I7EA 1K63A 4YRLA 4YAIA 1Z6PA 4KW7A 4Q4LA 3UMBA 3H17A 4GI2A 3TPFA 1SUPA 3LGSA 3KAJA 4Y6LA 1LLFA 4CN9A 4GKKB 3PXUA 1JHRA 1QIGA 2R6DA 5C3UA 4UHCA 3VR2A 4O6VA 5DI3B 3NT4A 3HDJA 2QTGA 3ONVA 2J6IA 3AF3A 4MRPA 2P1DA 2R4QA 4N40A 4DDWA 4Z1OA 1FLAA 3D7SA 2F7SA 5KYNA 3CE6A 5F3WB 3A7EA 4YRRA 2NVUB 4AX8A 1NT2A 4H6XA 1DMSA 4YXWD 1B14A 2FEXA 3P9RA 4WLFA 3WE7A 1U9ZA 4C0JA 2AFHE 2CL6X 1R6AA 2LRHA 3UBMA 4P3PA 2ZJ8A 2YNMC 3EDMA 3SZMA 4DMUB 3AYXB 4DTCA 1TUGA 4ACAA 1OAOA 3C4QA 3DCNA 3EW7A 5HKBA 3KEFA 3ED1A 1CQIB 1K9VF 1TA4A 3HN6A 4JYZA 1G20E 5L8VA 2JD1A 2R1TA 1E60A 3QG1A 5B3JC 5A3QA 5DISB 1CUZA 3Q40A 3PRJA 3RADC 5KWVA 2FN3A 3E3OA 3IQHX 2PMBA 1E2IA 1QANA 3M9WA 2UUPA 3DAPA 2BGJA 4UUBA 4B2IA 5JMWA 3MTDA 4Z0HO 1FFAA 4OHFA 5JI2E 2AEMA 2Q4BA 4B3BA 4FWIB 1AKVA 1NW5A 4GLJA 4X93A 4R0MA 1O8CA 3ABIA 5C18A 3CZRA 2FK7A 4LIPD 2X4IA 1O4VA 1VB3A 1VGQA 4DKJA 4ENPA 5SY6A 1G9TA 2HK6A 4U2BA 1S8AA 3RBZA 1XZ8A 2VP2A 1MB3A 3FCXA 1D03A 3FDFA 4XGRA 3LKZA 1G19A 4DANA 1CYEA 4ZAVA 2Q49A 4PN7A 5KPDA 2HUNA 4W99A 4RL6A 2Q6OA 3ORFA 5J59A 2ZBGA 1VJ0A 4WEQA 5C37A 4DUZB 1E4VA 4CV1A 2F48A 3BIOA 2A3RA 4IIBA 3B7WA 2EFYA 1Q5PA 4WKBA 1CF9A 1L4BA 1ONPA 1UXOA 3D6VA 4QNMA 5B1EA 4TTPA 2J4FA 2P2NA 5D3MB 4QQRA 2I7CA 2VDKB 3G02A 1JDPA 2YOGA 3AH8A 3TLXA 2Z43A 2BMWA 1BXZA 3CN9A 3TRDA 4QVKA 3ZNNA 4CCWA 5FORA 1NBAA 4E7OA 3UXYA 3VDMA 1AKRA 5KTMA 4ND5A 2FV8A 4BFUA 2OGWA 3WLFA 4EFNA 5FAXA 2O8EA 3B53X 1W4ZA 1MO5A 3TH5A 1BTOA 4AT1A 2C7BA 3ZDXB 4LFBB 5KSWB 5EZ5A 2X5JO 2GK3A 2CB0A 4MUEA 2IS4A 3AXSA 1NQOA 3AU9A 2NSYA 3GLFA 4ZOLB 1VHDA 1XTQA 5HQ3B 4QXRA 1Y4DE 4YJGB 4WFIA 3UJHA 4HLQB 3O73A 4F9FA 3NM6B 1RHMA 1ANKA 1N5LA 1XYVA 2QS9A 2IP1A 2QZSA 4YRPA 3EVNA 1FUYB 2HRQA 1XAJA 2AX3A 4DAEA 4ZKDA 2JLCA 5E4YA 3V1NA 1SCNE 4ZYVA 5JS6A 2ASVA 1KRHA 1NP6A 3EXAA 1V9LA 4BX2A 3GRAA 4MS4B 4R81A 2WHPA 3MJSA 3NC0C 3E4DA 3H5AA 3K70C 1I1NA 1I4TD 2EAUA 2HBQA 3WL7A 4JA2A 2PMEA 2WILA 2COEA 5GMOA 1UBHS 3WKDA 3OZUA 3ZK8A 5IHPA 3GX1A 2JIZD 5EUCA 1HKUA 2PRJA 3B6MA 4KVGA 5CGQB 5LM3A 2JVJA 3VSDA 3DEKA 2AEFA 4V1CI 2Z08A 3KD3A 3FOEC 1U81A 1J5PA 4QX6A 1SZCA 3LKVA 1CZKA 3F6CA 4YUAA 4NF2A 2IKQA 5K0NA 3WGIA 1GR1A 1RPAA 4XYGA 1I33A 5LXTA 2WJGA 3PENA 2WVJA 3GEGA 5FBVB 1MAHA 4JVOA 2Q4DA 2QP9X 4GE3A 5EP4A 4EI2A 1JSXA 1CRLA 1UDAA 1T1GA 4FFLA 2VXBA 2ZPAA 3RS2A 2FNAA 3MINA 3NOVA 4DDVA 5AVVA 5A9SA 1JJVA 2KI5A 3RC3A 4QG7A 3GLGB 3OQHA 4N54A 5U4XA 1RRKA 1M76A 5FLKA 4CLOB 3DFIA 2DFTA 4V2UA 1SXPA 3DLTA 5LUAA 1TQDA 1AK9A 1H1DA 4LDPA 5DTJA 2O3UA 1QAMA 4KIFA 3T35A 4B48A 3P4YA 3QHAA 1IM2A 4EYOA 1JTVA 2G67A 4AJNA 4E1VA 3JWPA 1CBUA 3G9XA 3TD9A 1KI9A 3CBQA 3LXXA 5FOQA 1KK1A 1KQNA 1E0KA 3CINA 1SCJA 1EZZA 3F3SA 5F64A 1NZJA 2QRHA 4DMRA 2VTVA 4YRDA 2YJZA 3IPCA 1HORA 4PRKA 4MGEA 3ZWKA 4D9JA 4PXSA 1TT7A 3CRVA 3M6IA 1MNAA 5HMLA 2I8CA 3OMWA 2QJRA 4CF4A 1NW9B 1W29A 3FDZB 3EVGA 1T1JA 5FLYA 1FDIA 1NJFA 1HQKA 3L0PA 1KAQA 5KWIA 4RQTA 2HJRA 4XGKA 3R9IA 3UUWA 4EAAA 4RKEA 1WMSA 1HDIA 2NACA 4QEZA 3E2PA 3HZOA 4XWTA 2PUJA 2QW0X 4PBRA 4B0OA 4BRWA 5BUQA 5ITZB 4OX9B 4WINA 4TS9A 3ABOB 4YRSA 3S7TA 3ZCTA 3KZKA 4DN6A 4WXMA 3QVXA 3QGMA 4RQBA 2G9VA 3A1UA 1EBBA 1G41A 1RJDA 1QHGA 3TBFA 1KRWA 4URXR 1PV4A 2QRVA 3DKVA 3ZHSA 1E7WA 4PBSA 4TUYB 2VJDA 1P7CA 5EEGA 4BTEA 4Q3DA 5D86A 1LQUA 3H1GA 3SBOA 4NWIA 4BN5A 1O97C 1XAGA 1H2FA 3LHIA 4MAFA 3ND9A 2OYRA 2O20A 2NZ8A 2Q41A 3HHPA 3OHPA 4U9HS 2PUDA 3STXA 4LNUB 1DIAA 3LRXA 2O7VA 1BOFA 4Q9NA 1R6XA 3DHWC 2AMLA 3TW0A 3K9LA 4CKBA 1BVYF 3PGA1 2P9TA 1AK1A 5HKKD 3BDVA 5EWLB 3ESYA 1BO6A 4D98A 2FZGA 5AT1A 1RYBA 1OF1A 1KP9A 1WPRA 2IOYA 1UWCA 2V8BA 3AY6A 3MA0A 3L8EA 4P22A 4QNRA 2NUBA 4QWMA 5IP5A 1UOEA 5AD1A 2QD2A 2BW0A 3DEZA 4ZEWA 1M73E 3OE7A 5DBEX 2XF2A 2GARA 3U7QA 3AF1A 2XGJA 2DUUA 3B7PA 1C1XB 3MBIA 5CH8A 4JUFA 1YS6A 4B75A 2YRXA 4PG7A 3BM5A 1A8IA 5F1YA 3V6LA 5TQVA 4UMFA 1GRRA 3BWCA 2E85A 4Y6OA 3ET4A 4ZD6A 3SC4A 4DMGA 4EY7A 4LZPA 2ZJZA 3O94A 4D3XA 5KNCA 3OCUA 5CP8A 1I0LA 5IMBA 4CT5A 3RRMA 3NQ41 4R6XA 5JDIA 3T1TA 2FCRA 1B6RA 2R8PA 4OFBA 4J2TA 3GGPA 3WIVA 4ZEXA 4C4PA 1SVIA 4BDTA 4ZYWA 4ZVLA 1Y8QB 3DHYA 1EINA 2F59A 2PPLA 3EF0A 1TFUA 5LZ2A 1J9ZA 3AXTA 3CNQS 4LXIA 4O4JA 2B69A 1JFRA 1JAIA 2X86A 4FD3A 4LSZA 4D02A 1HDOA 2W71A 2VDUE 3DMYA 4M0PA 3QQPA 4XCXA 1GGFA 1QNLA 2OXIA 4GMXA 3ROMA 4GXRA 3R5TA 1O9GA 2CLCX 3DYVA 1TF7A 5EIHA 1J8MF 3FVTA 3GF4A 3Q8KA 2VJQA 7ABPA 5EIWA 5H80A 3UA4A 2EHDA 4IJUA 2EQ5A 2FPOA 4MRAA 3GLGE 1JSLA 1XF1A 4B3GA 3E2IA 3AL3A 3KLMX 4KO2S 1W6UA 2W0SA 3JQDA 3ZN2A 5ECDA 1F14A 4M49A 5B3AA 5LQKA 4P7GA 1GA4A 2EW1A 1O3YA 3TZEA 2XIQA 4LJKA 2PBLA 1BHQ1 2PT9A 1G1AA 1Q84A 2GXSA 2O8DB 2JI7A 1PW7A 2NVOA 3TG8A 1FNDA 3MCAA 1Q7BA 4M55A 2W2PA 4ATNA 2C4UA 5JV5A 4A15A 1UXGA 3QV2A 1H5NA 4YMLA 3IHLA 3TXXA 1AE1A 1CKEA 4HADA 1W8IA 3TXYA 3FCOA 3WZMA 1Q1GA 3YASA 2G36A 1VLLA 1X1RA 1A5SB 1SCQA 1F3OA 1YQXA 4IXWA 4V0LA 5B1DA 4CKCA 4I5GA 2CDRA 2CDNA 2YS7A 4HWPA 4QL3A 4UVIA 3GEPA 4BZQA 3UOGA 4ZJPA 5BOSB 5JEEA 3R6GA 4KMRA 2ST1A 4LE2A 4Q3CA 4PQYA 1LI4A 1VLVA 2D1YA 1ZICA 4HWSA 3HYCA 2NU9A 2OQRA 3AWDA 1LS1A 3AR6A 1B16A 3QBEA 1FLNA 1UKAA 2RB4A 2XJ4A 3KT3A 3PPIA 3R4VA 4NSNA 4AUKA 1Y3FE 3QLTA 1UM9A 3C16C 2G8NA 1I6KA 3GT3A 4TSFD 4FS3A 4P33A 1G5TA 4NABA 1CDOA 3OG9A 1X1TA 3LRPA 4IIEA 4MRVA 1RHRA 2ZIGA 3O26A 5HNKA 2WVGA 2HXGA 2IPLA 1Z6AA 2PHZA 2XVZA 4L50A 2V7TA 2XD9A 1D4OA 2QENA 5F2EA 3F7MA 2PZEA 2Z95A 3K15A 3O2JA 3ZQUA 4DNXA 3CJTA 3K16A 3VM6A 3VBEA 4CTKA 1W4AA 2W2MA 2AZDA 5CT5A 2G06A 1B93A 2KBFA 3BWVA 5K0FA 3ZHCA 2IYQA 2WY2D 4BFCA 1OW3B 4DG8A 4MKRA 1ESZA 5K6AC 5KTKA 1X94A 1T6NA 2DHQA 4NK5A 4PPQA 4FWBA 1WHSB 4MEJA 4YAFA 3CUTA 4Y9TA 3D2LA 1G5FA 3JQRA 5D51S 1PGQA 2XUPA 1VZ2A 4G8BA 2ZJYA 2CN1A 4JBLA 3UY4A 4X92A 4YMWA 2EFDB 1BQ4A 1D9XA 2GBLA 3Q5GA 4YI5A 1SUSA 3AHIA 4B35A 1PQ4A 4F1JA 1P5RA 2A14A 3F67A 4S2UA 2H2IA 5F1KA 4D46A 4IEFB 5MGBA 3CTPA 1CUBA 2H1HA 1P0QA 4UM5A 4L5IA 3U9TA 4IG4A 5IDXA 4PIMA 1PDWA 2AQKA 1ZGGA 3H65A 3JYHA 1T13A 2ODWA 2HSEA 4JU8A 4MUKA 4B2PA 1S2GA 4ESVA 3TAXA 1TIPA 2IE0A 1Z0AA 3SYLA 4EJ0A 1P7VA 4ND4A 3RVMA 3E61A 3EG5A 5EMKA 3Q41A 2CLHB 2RHOA 2ZE7A 4N5IX 1A2OA 1X8XA 2FFHA 4HAWA 1EA5A 2XYVA 1MJGM 5B55A 2R86A 1W44A 4ZT6A 3RUAA 3HYRA 3ROPA 2RD2A 1LLQA 3C14C 3KUCA 4G1BA 1AQ6A 3ZXYA 3RK1A 3B1JA 3UJ3X 1C9KA 1MRNA 5EXTA 1QIJA 1ODTC 2NZVG 5EMNA 2OO3A 5U4QA 4MLPA 4JIGA 1HRDA 2GCOA 4KH0A 5AVWA 5F7OA 2I2AA 5HGXA 4X8LA 4L9WA 4O2BF 2D3TA 2WU3A 3ES9A 4C4TA 3PJRA 3FM9A 5E0OA 5K7SA 1CS0B 3KDPA 3R6DA 2O8CB 2Z09A 5ICSA 1WM1A 2NZUG 4LF6B 4GGMX 3IS3A 5CLGA 1VLQA 2WD9A 1O57A 3RPEA 2FW8A 3VZPA 3E8SA 2ILVA 3OLVA 1AXEA 4RD4A 1O08A 3AIOA 3QEMB 3RVSA 5I3CA 1LEHA 2NUTB 2W6ZA 2H5LA 1U3TA 3RJMA 4AKTA 1N6KA 4IEEA 4UBJA 2P4QA 3WIEA 5B2FA 3VKGA 1R8SA 1U8ZA 3PFCA 3FNIA 3LQ1A 4D41A 1A9SA 4BKMA 2JBWA 2ONZA 4UD6A 1CY0A 3WGLA 5FL3A 1E8NA 1ZH8A 2W4IA 5D5PA 3RWOA 3RTEA 4EFDA 3D4OA 3Q8LA 3A37A 3DMHA 3OEED 1FDUA 4MJ7A 1MB4A 4IXDA 4CIBA 3GN1A 3KEGA 1JX6A 3JRXA 3H99A 2X0DA 5K6TA 2W7TA 3WGTA 3COYA 1GM5A 4YAGA 3EPJA 5LYJA 1Q83A 1DTEA 2BBWA 3DONA 2GTIA 4IV8A 1UDXA 1YCFA 1T5TA 2PMFA 2YWJA 3CUYA 5EE9A 5T4HA 4EK9A 4ESOA 3ZJTA 1NBMD 1K8XB 4PY2A 1WBDA 4I5FA 4QUHA 4KOEC 4GNKA 4EMUA 2D06A 3T0GA 1FNBA 1VMEA 2A0YA 4MUYA 3RTAA 1GKUB 3H4VA 1HSZA 3OZVA 3PGXA 1QOZA 1RT9A 1T8YA 2ATEA 5K6RA 1QU2A 3NCHA 4I81A 2PUCA 2CJPA 3J7AC 4EHNA 2W2OA 1S2OA 2DBRA 4RH0A 4XPZA 5DOVA 3Q85A 5AI5A 4EEKA 2D62A 3W5SA 2DRIA 3MXTA 3BIXA 3L43A 1WDTA 4GP7A 3KEQA 4TKLA 1SIBE 3CH7A 4ZOBA 1R8JA 4B79A 5AW8A 3O84A 5KSYA 1Z35A 4M1YA 1M6VB 2NXNA 5BUZA 2FPMA 3LYLA 1Z15A 5KX5F 4RDXA 4LKRA 2OAGA 5DULA 3WLAA 2WWYA 1PT7A 1IJEA 1YMQA 4TQGA 5LBUA 4ZYTA 1G63A 2ZDQA 1Q0RA 4HN2A 5ALPA 4CMAA 4JUCA 1DS6A 4I6GA 3UWSA 1QTRA 2YRWA 3QI7A 4PYKA 3SE0A 1W2HA 5AOVA 1GARA 4ZTBA 2FLVA 2PRSA 1PKXA 4OQMA 3IPLA 4GPTA 3DE4X 2CHVA 2DH5A 3ANNA 1CUAA 1OBCA 2ASEA 4QTXA 4LE0A 1X9HA 3OOJA 4Q66C 2B25A 5M2QA 2JFQA 1DKQA 5A0TA 4DV5B 1E63A 3ZU2A 4W5TA 4Q1BA 4DE5A 3RYCA 3L7IA 1ONSA 4GOXA 2DQSA 4JASB 4FNGA 1FS5A 1ECGA 4N12A 4CM4A 5LNK1 5CHYA 1KIFA 2B5OA 3DLCA 4MGIR 1PHRA 3TZBA 4TMXA 5L3RA 2ZRBA 4DVJA 1U65A 4R8SA 3AUAA 2IX9A 1U7XA 2IIVA 2XWPA 3KJNA 1HFKA 1CY8A 2GA9A 2PA0A 1X9IA 3BD8A 4JP1A 621PA 1KXJA 2CFCA 4YB8A 4B3IA 5IZCA 2O8BB 1FXSA 2CXQA 3FAZA 3QXXA 4IIYA 4OD0A 5JVDB 2XQIA 3WMRA 1GKYA 3SM9A 4PO1A 2HJHA 3DZIA 4JWTA 5G40A 3NALA 4QDZA 2QTNA 4O4HF 4WKCA 1KJZA 2J0QA 1AX9A 3DP7A 1R0LA 3ND7A 4FFSA 4L4ZA 1I30A 3UUEA 1Q7EA 4BO6A 3BBLA 4DB2A 1RPTA 3NHSA 3QFSA 4PR0A 2BGMA 3QBDA 4KDCA 4ODIA 1FXUA 1EDDA 3A4IA 5AK3A 1SOMA 3CXRA 3MUFA 4R1PA 1RE1A 1ZWLA 2QUJA 1BFUA 1S2NA 1YIDA 3B6JA 2HQ1A 3IRVA 1G291 3C0KA 4WZBA 3PQ3A 1JQBA 4BO8A 1P1KA 5IJ0A 3PDCA 2N75A 1Q92A 3ZUPA 1CP3A 1C3OA 1K3UB 5H02A 4DIBA 4C7OB 4JD5A 3NEPX 3JWIA 1CZHA 2PSSA 2RKBA 4TMZA 1V96A 5ALXA 1S2IA 4RZ3A 3PNPA 2REQB 4EHDA 1EGQA 4XUDA 3IXQA 2SKDA 1MO6A 1NBME 3HKEB 1ZN7A 3DBLA 1E9VA 4R5HA 1HFJA 5I7AA 2QM7A 4OQDA 4R01A 1XCBA 3ZHOA 1QJ4A 1U9JA 4RTLA 1IWBB 2C5HA 6LDHA 4OSOA 5E6RB 1VLMA 3E7WA 3GFQA 4OXYA 3RD5A 4BLUA 4C89A 4X64B 1OTYA 1UIRA 3ZCSA 4H7DA 1QK4A 3RFVA 1QGDA 3RG8A 3KLBA 4A0QA 4XUGB 2CNNA 1LRKA 1T43A 1F3LA 2VJAA 3C98A 2R7AA 3OIGA 4JP5A 4OAQA 4P32A 4DKXA 1PZXA 3G2KA 3U7RA 2BZ0A 2C03A 3R23A 5DCLA 2E9SA 2HEGA 1A4IA 3JTMA 4BP1A 5JAIA 4KXXA 1R10A 2QI9F 4Q02A 2ABWA 4MA0A 5I7UA 2X0NA 5K0BA 1G18A 4JQZA 2YFYA 1PFKA 2K5UA 2YNMA 4GUDA 1E4EB 1WKVA 2D2FA 3ICCA 3QPBA 4P3XA 1UAGA 5AVQA 1LPMA 1RQPA 1ODKA 4P3YA 2NVBA 3KLOA 5TNXA 3W9UA 5JAZA 1CUUA 2FMTA 5AQEA 1YZQA 2APJA 1VMKA 2CMFA 4B3TB 4LRYA 1YE8A 1Z39A 2WYHA 3ISVA 1NP7A 5DXJA 3IUBA 4UTXA 3IDFA 1GRVA 3CGGA 4OVKA 4RNCA 1U6JA 4P0QB 4LWPA 2HA6A 2GAAA 3KQMA 5AM2A 3KSAC 1Z0KA 4KXMA 1XLVA 4FYMA 3PIRA 4CR6A 4D9FA 1JIKA 1JBQA 2F6RA 2WHYA 3NC4A 4YP0A 1DXHA 3B60A 4WN3A 121PA 4RD0A 5IN5A 4EPXA 3EHDA 3TIVA 3C3YA 4B5KA 5LMCA 2F3PA 2YMLA 3SXPA 1ZCBA 4BZXA 1MFPA 1PTJC 1Z36A 2O3JA 3TTXA 1RI1A 2G3YA 1ULTA 3EC2A 1NMXA 2NUPA 4Z4FA 2XMDA 2Y67A 1RLUA 3S8MA 1GL3A 4IP0A 4YWHA 3KKZA 3THXA 2ZI6A 4NAHA 4U0JA 4G8CA 4W9NC 3T4PA 1R0RE 2KHZA 1UK9A 3UICA 1VBMA 3LCVB 4R8MA 1KQ3A 3ICVA 3ZGOA 1JG1A 4C21A 1CUDA 3V1KA 2FRXA 1UDRA 3ZS9A 1TO6A 1COWA 1DIHA 4AM8A 2IOQA 1XCMA 1INLA 1DRUA 1FOEB 3QM1A 3QU4A 4JX9A 1SH7A 2WTXA 4LYFA 4O8ZA 4OQPA 3S2ZA 3IUYA 1DJLA 4RLFA 2QJWA 4RVUA 4Q15A 4YONB 5KU1A 1V7QA 4D56A 2OCAA 5ER6A 1QOQB 2BFFA 5AM0A 1EWRA 4Z7OB 2X15A 2ES4A 4JBWA 3TQHA 4J43A 4OXRA 5CURA 1J8VA 5K0SA 3IDOA 1FVHA 1Z62A 2WIGA 3VOBA 1OWNA 2FPWA 4HWGA 4QXPA 2Q99A 3SYKA 3TCNA 3ZK9A 1ZKMA 4AZWA 2Q9UA 2QTZA 3FGPA 4I8DA 1JIXA 3F2IA 3KZXA 2VNSA 1K5HA 3ANTA 3QKWA 4U39A 4X60A 4ZV9A 1OFIA 1XDSA 1ZSNA 2XLBA 5KHOC 1E20A 4Y7DA 3C3KA 5KC8A 3GVXA 1IIBA 1KPHA 4YRQA 1UOOA 5DGXA 1II9A 4LI0A 1NXXA 2EFCB 2X8WA 5E6UA 5H7XA 2ZSBA 1CUSA 1KEKA 2DWCA 3NVAA 2ENUA 3CJQA 4Q5IA 3R3UA 2G08A 3NOQA 3GJ3A 5HJ2A 2W48A 2IGBA 3S5UA 1AVTA 1F48A 1IBKB 3HSSA 1MOZA 2D2EA 2FMHA 2XCTB 3D0RA 1UAAA 5EY5B 1ZXXA 1JL3A 1LK7A 1Y4ZA 4GHWA 4RNDB 1XX6A 2J6CA 1GLVA 5HQJA 5KTTA 4IVNA 5IVIA 3DOFA 3K9WA 2M98A 2IXAA 4L4RA 3OPYA 2J0SA 2I1VB 1H8HD 4WK4B 1L1EA 3DWEX 4MITA 5IH3A 4GPAA 1XWIA 9ATCA 1PYDA 1SO8A 4EHFA 3RSGA 4NBTA 1P6UA 1EFRD 1Q1ZA 3DBRB 3SGLA 5JNSA 2H2GA 2RBEA 4DEYA 4MRSA 3ON5A 2EWVA 4XM1A 5U9CA 3NHZA 3LSTA 4IIFA 3DYIA 4QDTA 7AT1A 1DV2A 1OI2A 3I83A 2FEWB 1BQ3A 3NHRA 4RF5A 1T3HA 5HJEA 2Q9CA 4INZA 3GWGA 1LC3A 2IQIA 3PCTA 4MHOA 2HCRA 5BQFA 4MO2A 3PNVA 4MIYA 3EWNA 4RMJA 1X7WA 2NU6A 2DMRA 2I8LA 3EPPA 3N53A 4TT3D 4XJXA 3VQTA 3EJWA 2C7OA 3RU7A 1BC5A 5E7IA 3T6KA 3WDMA 1RP7A 1OH7A 1NLMA 3G59A 1JLHA 3WNCA 4ARSA 3H8WA 2VDQB 1U0BB 1YHYA 4FNOA 4UPEA 1NPYA 1EFLA 2WKWA 2VJCA 4CFSA 5LZ7A 3EJ6A 3JWEA 4LZOA 3EXIA 1Z34A 1OZFA 4NARA 4E22A 5AW6A 2WOOA 2NZWA 4N82A 4AY3A 3QVGB 1ZHOA 1CRPA 3UGTA 1QKIA 2CMGA 3O6VA 3O9MA 4UW9A 2YJNA 4FOLA 3CUVA 3VHRA 3S3TA 2JLZA 3ZWDA 1G2OA 1RRMA 1MPXA 3ENZA 3Q8XB 4EENA 2WW8A 1K66A 3OI7A 3M5DA 4BWYA 4CM8A 2CV2A 1QRRA 2G8LA 4HXEB 2Q6KA 4JP2A 3E5NA 4QU5A 5DT9A 3WLRA 1POWA 1UPXA 4IVQA 3UV3A 3IEVA 1MV5A 1KDYA 3QX9A 3HY4A 4EBBA 2Z2KA 2BHRA 2HUPA 10MHA 3LECA 4ZEVA 1XR3A 2JBAB 3K1AA 4WERA 3OQOA 1XHEA 2HYDA 2HU2A 1GZ7A 1WSBA 3EA0A 2C58A 2PWPA 3L0DA 5JDCC 1QGED 1XFDA 3EA5A 2P9EA 4OFWA 2BGRA 1T2CA 1T2FA 2A0KA 4DV2B 3H2SA 2ZWIA 3CEPB 3F7OA 1VSTA 3BXPA 1LBTA 1HK7A 3WYGA 1NW7A 3DEFA 4RH1A 4OATA 3V6MA 3UAXA 1GCAA 1PNQA 5J5VA 3CRZA 5BV7A 4JYMA 3T9EA 1WHTA 4DWOA 4PW0A 1AS3A 1RQ2A 2EJCA 5JO9A 1XQWA 1C9NA 1DOZA 2CCKA 4IQGA 2C5GA 3EXEA 4HSEA 4HMQA 2VHWA 2X9NA 3A1VA 4JOSA 1KSGA 3G5LA 1W1WA 4ZAZA 4YMVA 3OIWA 1MTZA 4HMOA 2ZVDA 3X44A 3H2IA 1A71A 1HE1C 3OF5A 3GT4A 1U8UA 1KI7A 3S99A 5IVKA 1Z37A 3FWHA 1Y81A 3E1GA 3LJKA 5GAJA 2J0UA 3GXOA 4DQKA 5FBRB 2QBYB 3GMSA 1N5MA 1Y1KE 1J8YF 2QD5A 1O5OA 2VBFA 3FWKA 3HR8A 2J5QA 3BRCA 3NWBA 4LGCA 5CVUA 2WU4A 4XX0B 4ZVRA 5LIPA 3QX8A 1RJEA 2QP3A 4OMDA 1VYVA 3DNMA 2YY5A 2PT5A 3AUJB 4L02A 1II8A 5FLXA 1WY5A 2XB6A 4PM4A 1DP4A 4F97A 1P3JA 1TT5A 4B4UA 3FRIA 3QY9A 5T4FA 3NMUF 3LHKA 1BWSA 3JX9A 5IK2D 2OHJA 2IHZA 1JHAA 2A6PA 5KYWB 1B8PA 4QEKA 3IA2A 3G0CA 1R4MB 3LK6A 3SX4A 2ROQA 3AR8A 3VSEA 3W5IA 1H9BA 4WEOA 2G17A 3ACDA 3EVFA 4LMAA 5A71A 1W0JD 5ESWA 1XDBA 4M1ZA 3JQ7A 3SZRA 1T0UA 1YVRA 3OA2A 2JZCA 1HMPA 1QV6A 2BUCA 2OCLA 4K81B 3NBXX 1CQWA 1MABB 3ANMA 2DGDA 5FNZA 1Q0PA 4KO4S 2AI2A 4Y9RA 3KOYA 3U4AA 4CTOA 5FULA 4R0VA 3OESA 4B6FA 2W6PA 3E22A 5A0FA 3QG5A 2B1JA 3QTTA 4IFBA 3NONA 4OB7A 2HQOA 1UPFA 2V7PA 4F5DA 4FB4A 1RAHA 3LX8A 1LNSA 3GJYA 4GWKA 3WGJA 5HIMA 4QJBA 1RACA 1Q0SA 2J85A 5FEUA 3ADBA 1QRUA 3QUCA 1GPNA 3QZUA 3WB1A 4R9SA 4K6HA 2JGDB 3IKLA 4S1NA 3NV7A 1XAIA 4PO8A 3LH5A 4I9HA 1E6MA 3FNBA 3KJFA 4B9EA 1NXWA 1OASA 4CL3A 4AZ3B 3ULKA 2H1IA 1XTPA 4RHEA 3G8DA 4RK0A 1ETHA 1P7PA 3ZV7A 3GRKA 1KI1A 1JKXA 4QHSA 4YYZA 2EJUA 2QN9A 4KQFA 2QPAA 4BNDA 1C4KA 1RWPA 5LMNB 5KJEA 4X1OA 1YT5A 221PA 3IKJA 5D5HA 2WLTA 3AUYA 1ATZA 1Z5GA 2X14A 2O05A 3NO4A 1EH5A 1R74A 3CLSC 4BGDA 4CCYA 5LA6F 3ZHBA 5IKMA 1DAGA 4CI9A 3BXXA 4EO7A 1HMYA 4PC2A 4J0GA 1BHSA 4HK4A 1MX9A 5ECGC 4IDGA 3OP1A 4B71A 1Y4SA 2EVWX 5F23A 5L3SB 3OIYA 2YXPX 1TO1E 1XZEA 5AOBA 4EIWA 1P4SA 4NFHA 4DILA 4DXAA 3ZWQA 2DQZA 4A8JC 3Q7RA 4O2BB 3DLIA 4NH0A 1XXLA 3X1KA 3HC7A 4LA4A 1KYVA 3HKDB 1GNSA 1IUNA 1JV2B 4FDMA 1TVMA 1DTWB 2ZYRA 4C3UA 2O4CA 3CUEF 4XWYA 3AY0A 4I1UA 3P2MA 1YMVA 2E4WA 2P9FA 3G2NA 3LW8A 3SAJA 4CKWB 5BR1A 1IZ7A 4HI0E 2B9EA 1XHLA 3WGYA 4JWKA 3O0DA 1W96A 4LF9B 1HG1A 1UDBA 2HRDA 1XU7A 2GZDA 1KP3A 3M0EA 4XEHA 3W8FA 1SR8A 3NNNA 1AQIA 5F7XA 5JNTA 2J3MA 4DHEA 1NQWA 1ZI8A 4Y2XA 4JVLA 4IHKA 4S3MA 3ZDFA 5BYKA 1XP5A 1E5QA 2GEDA 2XQKA 3ISJA 5D3KA 3IHKA 4AKIA 1EMDA 4C3VA 4D45A 5K6AA 4KN9S 2XGOA 1RBMA 1RYHA 1SK9A 1WOMA 3PP8A 3GG9A 1N3YA 1N32B 5MF6A 1GVHA 2OD9A 4BE4A 5C46F 7GPBA 2LR0A 3TI9A 1CZUA 1KXZA 1KGDA 1NF9A 4LHEA 5FHRA 4CHGA 5AKGA 4ZJZA 5KYYA 1CULC 2AQ8A 2MSLA 2A84A 3TOXA 3STUA 4BZPA 1J0DA 2OC9A 3WK7A 1O6FA 2COUA 1NAIA 3UXMA 3T52A 3THYA 3M4YA 2Y92A 4D79A 4DCNA 4N7BA 1Z9BA 3E23A 4LVNA 4NE9A 4OHKA 3A36A 4KPFC 1B8UA 3ZE8A 3VC7A 4LE1A 2H3HA 1NFRA 1IH8A 4HDMB 4HGYA 3ZLVA 4H4DA 3I0MA 1BJRE 4BO3A 5FAKA 4MQ4A 1UFOA 3I92A 4MVJM 4RS4A 1Y7HA 5JCJA 4DJTA 1VG8A 2OV1A 3DGFC 2LXNA 2W58A 4GSYA 3B5IA 3R3YA 4N0QA 4X62B 3T9BA 3B12A 1I3CA 2IEIA 2VJMA 1L5YA 2EKPA 4PCAA 1H2YA 1L5HB 1DQPA 3AF4A 3DMDA 3JD3A 5JYBA 4X3CA 3E2MA 2GPWA 2OXRA 2QVBA 2WFLB 1DWQA 3A6LA 4XDZA 3RJZA 3QLVC 1UFQA 2QGZA 4NH4A 3W77A 3WGNA 5AI0A 5TS3A 3SQOA 3TMAA 6REQB 5HSGA 1QH8A 1IDN1 1FZTA 4XYEA 3WJ2A 3LYAA 4A73A 3TSOA 5ADUS 3VU3A 1QIFA 2AZ4A 2VJPA 3Q7QA 3QPUA 4J7AA 4J0CA 3VOSA 4BO9A 2PS0A 3N5CA 1RBZA 2X0JA 1X38A 1W2WB 2P4HX 3VBCA 4IAOA 2FP4B 4YCCA 2W2KB 3H18A 1R1DA 4ZVSA 3LUDA 4DA8A 1F6BA 4H3VA 4XIYA 4KIWA 3D4LA 4KIJA 2ZJ4A 3DE6X 3L8CA 3BB1A 3FCYA 2G0TA 4E3WA 2IE8A 2AI1A 1VHJA 1XZNA 2QX7A 2ETXA 4BNIA 1W59A 4GBGA 4YV1A 1ODJA 1H9AA 3GIDA 3T7JA 3VXKA 5LNK6 3EIWA 2JGKA 3H7IA 4G36A 3NNSA 4KP7A 4MWEA 1O58A 4MVWA 3NDJA 4KDRA 3SG0A 5LU9A 2XEXA 5CFOA 3P7MA 3GRZA 3FUXA 2WYUA 4QXMA 3H1EA 2PXXA 2FZLA 4B4DA 5TMBA 3EFBA 4CKYA 4E14A 3ACBA 1KK3A 1X6VA 2YWCA 4XPIA 3FXAA 3VPXA 3KX2A 2VQEB 4KL8S 3SXUA 3E27A 3VR6H 4ZIRB 3MGKA 1EVZA 1Z45A 4O4HB 1ZUNA 3S2SA 2D5LA 3FTFA 2VHZA 2IS6A 3CCBA 2JDID 4D74A 2Y6UA 4Y6RA 3I6ZA 4W7IA 2O2XA 4ND3A 3PIDA 1OY1A 2VHVA 2IL1A 1NYTA 4L2IA 5HK8A 5TPZA 2P91A 3K6KA 2JPDA 2XW6A 3H8JA 4PLZA 4CKZA 2ZTUA 2B7CA 1YRYE 3D3EA 2IVZA 2OQ2A 2W8ZA 3HGMA 4HYEA 4ZCRA 3ZC3A 4BQIA 1CX9B 1VSQA 3CG4A 1PLJA 3JALB 4E0BA 1K4KA 4TS4A 4F6CA 2XCUA 1UC9A 3GAZA 4O02B 3ESCA 8ADHA 4YWJA 3NHBA 2M1XA 4FT4A 4HEQA 1EBUA 1NXQA 4FOSA 1NRIA 4HGPA 1W0KD 3L8DA 2EBWA 3TZ6A 2N42A 2YJ3A 2JZNA 2ZYHA 2JANA 2ODNA 1CNFA 3WWPA 1J7JA 4F72A 3CE9A 4URHA 3C7DB 1C8VB 5FJJA 4N8SA 4PINA 3LKDA 3GMDA 1E1DA 3HGTA 4D97A 4P86A 4QREA 2QRNA 2BOVA 1L1FA 2QN8A 4C87A 1P5HA 1Z8HA 1KI2A 5AJXA 2C9CA 1ZIOA 3TB6A 2YOFA 1V47A 2IQ5A 4HJXA 4YP5A 1E2UA 3QXCA 2LZ0A 4ALKA 5I51A 4KAXA 3C39A 1Z2EA 2E7ZA 2H4JA 2I1QA 4PAOA 3T1QA 4NU6A 2VAVA 2YW9A 4JC0A 4P2GA 3GW8A 1HF3A 5B4TA 1KKUA 1OX4B 1FU7A 3TNJA 5IC5A 1W5FA 5BXQC 3RTCA 4DZZA 3C3JA 4X45A 1W5BA 2AJTA 4B31A 1TTQB 3DHVA 4Q34A 5IEJA 5T57A 1DO2A 1FQOA 4BQOA 3BFKA 2BEWA 4H7PA 4MV0A 2QUIA 4C2BA 5JLJA 2QTRA 3VZDA 5K0TA 1RU3A 3FYSA 4HC4A 2WG0A 5FTMA 2ZB8A 1JEQB 3AR3A 3PUJA 2ZYTX 3ZDDA 4IIJA 2OOKA 1WNTA 1NR5A 3D8SA 4C7JA 1R4NB 1ZJ4A 3PC2A 3ZYCA 3BWYA 3KU1A 1MVOA 2FWRA 3I1YA 2PS1A 4G85A 3D3NA 5AKKA 5FQNA 1XCGB 3PU6A 1IE3A 5SY4A 3I8SA 3T4EA 4BMDA 2IWRA 4COKA 3KLPX 2HPZA 2ZIAA 1ZESA 5IUNC 3OX3A 4TLDA 4EOGA 5KOJA 4E5YA 3R9XA 1VHLA 1NVVR 1YQWA 3GCDA 4J1QA 4HKTA 4NONA 3TMYA 3IO5A 4LDAA 1WX1A 5DP2A 4TZ0A 1HYQA 3K1JA 2Y0CA 4REQA 2GYVA 3KEMA 3T3DA 5CBPA 4IGEA 4L8GA 1Z2PX 1O0BA 5D3ZA 1H1LB 3DTVA 4OJTA 4BGVA 4ZQEA 2VWPA 4OGGA 1NBWB 3SYNA 1ZD2P