The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
276
|
structure length |
276
|
Chain Sequence |
AMRLVADSACDIKELRGMVFKAVPLTISTDNEEFCDDGQLDIHRMLDILEKHKGRSYTACPGIDAWLEAFGDDDEIFVVTITAGMSGTYNSAMAARAVYLEEHPQAKVRVIDSKSTGPQMRIILEQLQQMIEEGKKFEEIDGAIDAYMQKTRLFCSLKSLHNLAQNGRVSKVVASAAEVLGISVIGTASSHGTLEAIGKCRGDKKLLVKLQALLDDAGYEGGKLRICHVENEALADKIADMIKQAYGTTDVCVYKAGGLCSYYAERGGIILSCETK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
DegV family protein
|
| publication title |
The structure of a DegV family protein from Eubacterium eligens.
rcsb |
| source organism |
Eubacterium eligens
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
91
|
| structure length |
276
|
| sequence length |
276
|
| ec nomenclature | |
| pdb deposition date | 2008-11-25 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02645 | DegV | Uncharacterised protein, DegV family COG1307 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | Rubrerythrin, domain 2 | degv family protein | ||
| Alpha Beta | 2-Layer Sandwich | Hypothetical Protein Tm841; Chain: A;domain 3 | Hypothetical Protein Tm841; Chain: A;domain 3 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Dihydroxyacetone kinase; domain 1 |
