3FDJA

The structure of a degv family protein from eubacterium eligens.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
276
Chain Sequence
b'AMRLVADSACDIKELRGMVFKAVPLTISTDNEEFCDDGQLDIHRMLDILEKHKGRSYTACPGIDAWLEAFGDDDEIFVVTITAGMSGTYNSAMAARAVYLEEHPQAKVRVIDSKSTGPQMRIILEQLQQMIEEGKKFEEIDGAIDAYMQKTRLFCSLKSLHNLAQNGRVSKVVASAAEVLGISVIGTASSHGTLEAIGKCRGDKKLLVKLQALLDDAGYEGGKLRICHVENEALADKIADMIKQAYGTTDVCVYKAGGLCSYYAERGGIILSCETK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegV family protein
publication title The structure of a DegV family protein from Eubacterium eligens.
rcsb
source organism Eubacterium eligens
molecule tags Structural genomics, unknown function
total genus 91
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.50 Mainly Beta Single Sheet Rubrerythrin, domain 2 degv family protein 3fdjA02
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3fdjA03
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 3fdjA01
3PNMA 2DT8A 2G7ZA 4X9XA 3CT4A 1UOEA 1OI3A 3FDJA 1VPVA 2IU4A 3PNLA 3PNOA 3PNQA 1UODA 1PZXA 4LRYA 1OI2A 3NYIA 3PNKA 3FYSA 4LRXA 3PL5A 2IU6A 3JR7A 3LUPA 1MGPA
chains in the Genus database with same CATH superfamily
2JH3A 3SQMA 5I9IA 2C3UA 3KSRA 1S30A 1JHZA 4JEUA 4ZAYA 5K05A 2QD2A 2GO7A 1EG7A 4OFWA 1MAHA 2JVJA 4DCOA 1L9XA 4TL8A 4DAOA 5TT0A 1VDZA 2HGSA 4ATNA 4J1TA 3GY0A 4WLOA 4UCWA 1GQQA 1B0AA 3G8DA 4Z7OB 4C04A 2BMDA 2DHRA 1D0VA 3LUCA 3IBGA 2BM1A 1L5OA 1SCIA 2KS6A 3QJGA 3H84A 1Y4UA 1U3DA 2D1QA 2NG1A 1LBQA 2YHIB 3HJCA 1YZLA 3P94A 5L6LB 2R79A 2JRCA 4QM7A 2FPOA 3A3PA 2WWIA 2PGLA 1KI6B 3A25A 2Q6OA 1MB3A 4MEBA 1C14A 1ZYUA 4IQ0A 1MCZA 1CUSA 2Q29A 1XD2B 4FMDF 4DLLA 1U1GA 1ZLXA 2XQKA 1D6SA 3F97A 5DYYA 2BEWB 3EXHA 3OCZA 4AUEA 2FOIA 1ZESA 3PXDA 4PN7A 2NU7B 5CEFA 4RPIA 5FWNA 1K89A 1GUYA 1MFZA 1LS1A 3WOVA 4CF3A 3DE3X 3NVAA 4A5OA 4ZCRA 4UXIA 2JJ8A 3W7BA 4UASA 3MT9A 4MAAA 5I7HA 3Q1LA 4DQVA 2HLDD 4O4IF 1E9BA 3RG2A 2E7ZA 4AKTA 1FUIA 2C7OA 1Y5RA 4X97A 1M75A 4HD8A 1Q1QA 3UKJA 3C6YA 4EGSA 3MMPA 3RIEA 2Z5LA 5FNVF 3KJQA 3U4QA 3KYXA 2NMVA 1S2NA 1V47A 2I4TA 1ULBA 2C94A 2YN2A 2YVKA 2B0CA 3S1AA 3E22B 2WMOB 1YK5A 5AXBA 1WOYA 3VTAA 5I5GA 4BFLA 3K9FC 1VA4A 1L4FA 1O54A 4FBMA 2GPBA 5BN4B 1MG5A 3TBFA 2VQDA 1VGRA 3U4DA 4GEKA 1ZP6A 1FFHA 1L5FA 2ON6A 1NXXA 2FPPB 3KDSE 3AY7A 2PMWB 1XZKA 4QARA 5DIZA 4WKOA 4X71A 3AOEC 4WX2B 4PGMA 3FFWA 1G5RA 3GTOL 3I23A 3HJBA 1LDMA 4BQPA 1H8HD 5IS2A 4C0KA 1U7PA 1XDDA 1QF7A 1L7XA 3QE2A 1QUEA 1KKMA 1NY5A 1YMVA 2RGDA 4G1EB 3I9V1 5IXYA 4ZRNA 1SC3A 2J3QA 4ETNA 2VYCA 1U8AA 3OE5A 2V7BA 4KOEC 2A58A 3IAEA 4OVKA 4AD8A 1FYWA 4AKGA 4BUZA 1Q7TA 1QFSA 3KSBC 2XI4A 4HVTA 4KQKA 4FE4A 1IZ8A 2OO7A 2QF7A 1HXHA 2EJCA 2QTHA 2M6PA 1NT2A 2OQIA 3HZOA 2YRWA 4QQKA 3TKYA 3WICA 1T2EA 4MV3A 5CW2A 5BNTA 1CX9B 2YOHA 1TMGE 3SS8A 1SCNE 4UU8A 3G2MA 3VUFA 2V6FA 2OV4A 2FPLA 3ILXA 1J0AA 5DRYA 2ACEA 5HRCA 3OKAA 1T4GA 1XLTC 2ZROA 4U2KA 1S2MA 3VPAA 3STWA 1FTNA 1X7GA 4YYZA 1DEHA 4HDMA 4ZJUA 4ECAA 3LK6A 1OHHA 1QGUA 2XSZA 1DO2A 2YZ7A 3CG4A 3PGVA 2ACVA 1Z18A 5EIXA 4OXRA 2QROA 2ZSHA 4GRDA 3BDAA 5T4BA 3WJ1A 3RWMB 1DQRA 1KP3A 4M0EA 1JG2A 1L8OA 3C1UA 4KIGA 4MCHA 3RUCA 3FMVA 3ZE8A 3OJWA 3WK6A 1LVUA 5GV7A 5H4GA 1MABA 4Q4HB 2YYAA 5J2TB 4A8JA 2EP8A 3AXSA 5KZMB 1CQJB 1T4BA 1OH5A 1U4OA 5FOSA 3NFYA 1NV9A 2I2DA 4J0QA 4UUPA 4P4NA 5JDCC 4E3ZA 3ZJTA 2CXXA 1J6UA 5HCUA 1KQNA 3INTA 1N7HA 1TVCA 1FDUA 3BH0A 3AERB 5KYWA 5MHTA 1CSEE 5LR6A 1RP1A 1UOOA 5AI3A 1PZFA 3OLWA 1L2TA 3AT1A 3Q9UA 3ZZTA 5JS7A 1ZFNA 3EIHA 4LQLA 1R27A 1HDOA 1T5TA 5ALKA 2E9SA 5ER6A 3T7TA 3WZMA 1ZH6A 4DSNA 5C7OO 2A3RA 2WR8A 4OP3A 4KMMA 2GXSA 2EQ5A 2YWEA 2O48X 4EL0A 4ZQEA 3IVXA 5DHTA 1J4AA 5I5EA 3QKUA 3HP4A 4FINA 4ZOBA 1OWMA 3PX3A 2B1GA 4XGNA 3SX0A 1G4HA 4RD2A 1N78A 1C1DA 4KODA 4Q9KA 2LV8A 1P62B 1OYOA 4HLUA 5EC8A 4BFSA 4UDYX 4W1RA 4F04A 5EHZA 3BXZA 4ZK6A 1W1WA 3DLIA 4QBFA 3IIIA 4IS3A 2BDTA 1VMKA 5K0LA 4PF1A 3JAWA 4RHUA 4DV3B 2D7DA 2BFWA 2XVYA 2HQ1A 3GD5A 4CMHA 4KN9S 4JC8A 1U6IA 2BRUA 4JBNA 1TZMA 4CODB 1NVVQ 2GD0A 4LIPD 4OIMA 4DUGD 2Q1SA 3CNEA 2VHTA 1XA3A 2FQYA 1JJIA 5LLSA 3NHZA 1E62A 1YKGA 1LZLA 3ND7A 2JI3A 3KHKA 5AJHA 1I0LA 3EVAA 4CM3A 1JEYA 4Y2UA 3SDBA 2ONYA 4MTLA 4ND5A 2ORVA 3NTRA 3RF7A 4KPYA 2G28A 2O1EA 3M6XA 1GZ4A 2QYHA 1U2TA 3HS3A 4BO0A 1QZZA 2APJA 4G26A 5LUBA 1RSZA 3ZV7A 1HDZA 1TFRA 1YB1A 5C32A 1FB5A 1RWQA 2Z5GA 4ZANA 4A0FA 4KQIA 4LE1A 1N6PA 3PQCA 5EQFA 4QVGA 1HNWB 3F5DA 3A58B 1C8BA 1KWGA 2VJBA 1YJCA 3UT5A 3RU3A 5EGNA 4D74A 1AK9A 1PFVA 1WW8A 3G79A 3DBLA 4KJXA 3ORRA 2OZLB 1XZ8A 3MPUA 3KZMA 1FP2A 3NTUA 3AL0C 3JPYA 5A4FS 2XWSA 1P9RA 1H1LA 3JTMA 4IILA 5CNIA 5DCWA 1B93A 3OZSA 721PA 5KHOC 3ITKA 2P30A 5H1YA 4OEHA 3EWNA 4MWCA 5G3ZA 5ES3A 1SB8A 1U2RA 5IFLA 3E82A 1H5QA 1MHPA 1E8JA 2QDXA 1LFAA 3OKFA 4XQ9A 1P4GA 4B3GA 1DRJA 1I51A 4P3XA 3H1AA 4MQ4A 4WY2A 1X7WB 1P4AA 3NFPI 1MNAA 3K6KA 3BFVA 3C98A 3MT0A 4PYIA 4CG3A 4M9RA 3C14C 3PEVA 1SCBA 4KDFA 2ZI5A 5EESA 1VJCA 3EXIA 3VVBA 5HFJA 4MWOA 3V1YA 2ZIUB 5KVSA 2ZTLA 4RDIA 1ZKMA 3HXPA 3B1ZA 3PWZA 3RYCA 1XVVA 1XX6A 1WBJB 3OQOA 3RTDA 4P0PB 1RLIA 3WLPA 5JZMA 2VPQA 4BKQA 2W11A 1H93A 2O2IA 1QV6A 3KD2A 5I01A 2WSBA 1M2KA 1W5FA 4QU0A 3SBDA 4N5HX 4AJ1A 2WZDA 1LVHA 3GFOA 3O4RA 4XGQA 3EFEA 3GBSA 3THWB 3B9RA 3OFVA 1QQ7A 2UUCB 4NH4A 4OBBA 2BCGY 2C4WA 1QHXA 1MO3A 4D3DA 1LX7A 1MG0A 1P7YA 4GT1A 1GRCA 2FYTA 5DP2A 2FMHA 4N3CA 5FA8A 2ANCA 5G4KA 5DXAA 1O3YA 2IOQA 3B2EA 4B87A 1R64A 1Z5OA 1A9XA 4I4TF 2E5WA 3CEMA 1JALA 3KTOA 1RM4A 4KQWA 3G6WA 3AY6A 3T7EA 1XWIA 2K7ZA 2ZIGA 3QE3A 1SAYA 2X0KA 2WWGA 3PC8A 3H17A 2E4AA 3GN2A 5EPUA 5GJVC 1RWXA 5DM4A 2I3ZA 1TIKA 1W30A 3STVA 3R20A 4F3RA 2A2ZA 3PFWO 2C4TA 3MOGA 3OHMA 3KFVA 2FY8A 1XA0A 2WJWA 4PWZA 1MVOA 3MGGA 5BN5A 5JNVA 1YSCA 3LQ2A 5AJXA 2OFFA 3LBHA 2J3IA 3SEZA 4N6NA 5L7WA 2YNMC 3A11A 3OESA 4KK3A 2VP5A 4H1WA 1TYDE 2CNKA 4AIRA 3U81A 3MQKB 3O7MA 3I6BA 3VNRA 1VSVA 1JJ7A 1XRMA 2JDIA 2PH7A 2V9CA 1U2DA 1W44A 2QEQA 1WU7A 2OV1A 1T3TA 3HJGA 3QKSA 4UZFA 5D3KA 5AW6A 2DETA 3RT1A 3S27A 2ZAYA 3IO5A 1Z8FA 3WRVA 3E18A 1U7UA 4RESA 5G41A 3ESRA 4J0GA 2QVCA 5DRTA 4CCWA 3V48A 4EHLA 2O1WA 2FN9A 3N8DA 4Z2YA 1HNZB 2JFPA 3R5SA 5FPTA 3ZOKA 3TQSA 3FHCB 4NMHA 1MB9A 1O6FA 1ZQ1A 4MDEA 2HU8A 4TMZA 3PQ2A 2IYQA 1FPMA 4KO2S 3CUWA 1CJCA 4KE9A 5FI5A 2YW9A 2V7WA 2EFCB 3ETJA 2LGJA 2Z8XA 4FUTA 3R4CA 4H0FA 1G2PA 5CAEB 1XKQA 4DCCA 2QP4A 4NU0A 2B1QA 4V39A 2BHTA 1GPMA 1PEAA 4TWRA 1FS4A 1SEVA 4R41A 3TK1A 1G66A 1L7RA 3MPOA 3UB3A 2ZIZA 4I8DA 4WXYB 1V7PC 3A28A 3WB2A 2J0QA 2COUA 3W8RA 3TMYA 2DWOA 3E6AA 2VA9A 1QYBA 4EI2A 1VL5A 1W2GA 2R7AA 2XB8A 4UUMA 4ZVOA 2OO3A 4QJ3A 3A27A 3I4LA 4J07A 1NFQA 1U65A 3IOEA 1QPGA 2L69A 3CLKA 3IIJA 4MUXA 5DNUA 5L95A 4P4SA 2BE7A 2J5RA 2OQRA 1CDDA 3NVMB 4MJXA 2VNKA 3NKLA 2GGSA 4J9VA 2ZT5A 1NVWQ 3H9GA 5HGXA 4GG1A 1VG8A 1F5SA 3T0FA 3GJ3A 2CXQA 4WZAB 3DEJA 4KWIA 3AVUA 4JV5B 3BF8A 2ZUBA 5AIAA 3WMRA 4BHTA 2HSWA 2PNJA 3DXYA 1LF5A 3JYQA 1PS9A 1X7XA 2HHLA 4HMOA 2ATCA 3UMGA 3VYRB 1PQYA 4C3UA 4PLGA 1DCMA 2ERXA 2QLFA 2VFAA 3EUWA 4BN4A 4LJ9A 1DWOA 1OWNA 3PUXA 4YDSA 5TJ9A 5DN9A 1YGPA 2Q5LA 1SEPA 1TT7A 2XQVA 3GRVA 3NYWA 5KB3A 4LXYA 2QTWB 1OAOA 3ABSB 3MERA 4X20B 2A86A 3R8FA 1E6EA 3WGUA 5B4VA 1OU0A 3F71A 3G5UA 2MYNA 5CLGA 4Z8YA 4CTOA 1YIAA 4ARSA 1Z4KA 4BYGA 3ZG6A 1ZG3A 2JA1A 1MOZA 1I3CA 3QVGA 4MINA 5TGTA 3WGJA 5KOJA 1HE4A 3KDAA 2M4YA 1UEJA 1SKYE 4NCHA 1HDXA 1LH0A 7REQA 3T8YA 1IG3A 5JW6A 4B6OA 2AMLA 3EGDA 4CCYA 1WF6A 4FYKA 1E79A 1E3QA 1QDEA 2YQ5A 3CUTA 4FN5A 1YOVB 5KTYA 2SKEA 4W5OA 4QTTB 5AVJA 1CFZA 1QS0B 3G9UA 3TZEA 3OZTA 5BT9A 2BJWA 4BMZA 3V3TA 2Q5HA 2FFHA 3R0IA 2NACA 2AZ4A 3HXTA 3KXIA 4L3VA 3L7LA 4AP5A 5C37A 5JC1A 1OYWA 2A5YB 1MX3A 3IT1A 2BSQA 2QW1A 3I58A 1PUXA 4QGHA 1RFGE 3PC6A 2XJUA 3PZAA 1BKYA 3ZI4A 5BSHA 3P2OA 3EA4A 1E2MA 3OOWA 1LSSA 4KR6A 2RB4A 2H1VA 4IXDA 4TS4A 4D1YA 1GV1A 3A0UA 2HIAA 2QM8A 5D8DA 4G67A 3DSRA 4BBJA 3LY7A 6NULA 3SKXA 2RAFA 3AVXA 3A37A 2XE7A 2C7BA 4HL6A 2QD5A 4Q9JA 5FNZA 2VKTA 2BKAA 1QZ3A 1T5OA 3M1YA 2YRFA 2ROQA 1UK9A 4IUYA 4LECA 4WINA 1TK3A 4XYLA 1NX9A 2A57A 4HAXA 3L93A 4JI7B 4RF5A 2NYDA 1E3TA 1PLJA 3VVLA 1GNRA 4GI3A 4O2LA 4Y2PA 3WNCA 5AI2A 2P9JA 3FWPA 2A1TR 2NUAA 2WG0A 3RT7A 1QRRA 2R66A 2EFYA 5A04A 3JWEA 1BHSA 3W7VA 1IZZA 2Q2VA 3RROA 1X19A 4E7PA 2HA5A 2A68D 5AXDA 4EPVA 5A3SA 3ROXA 2X1VA 3CKYA 4CR8A 4AF7A 3BRSA 4LYJA 3K9WA 2OGUA 4W9NA 4Q0MA 4K6OA 4I14A 2WJVA 2ZRQA 3G7SA 4OSEA 5ALSA 3N05A 1DJLA 3BXPA 3LQFA 4YRFA 4EO7A 1BX0A 3NNSA 4C29A 4U1RA 1G8JA 4RH3A 1N5IA 3FYHA 3PWTA 2PA3A 2Q6LA 2GLTA 4EA9A 3BK1A 4NPCA 4A3SA 1PJLA 4HFRA 3EEIA 3K2QA 3N6XA 2QN9A 3NYRA 5C3MA 3JTEA 2DERA 4JJKA 1NV8A 4GP9A 3HC7A 4BJ1A 5JQWA 1IQRA 5HK8A 1N9ZA 1XRLA 1D03A 3EVCA 3U44A 2ZR9A 3MHTA 4HNQA 2ZVJA 4D81A 3OQBA 3AKEA 4HCJA 1GPUA 2CLEB 4F85A 5LD2C 3H0GL 1KPIA 3AJ8A 2EY4E 4PBSA 5DGIA 2ZM6B 3I2FA 2QRVA 4BEJA 1K5PA 4XYBA 5FR2A 5FUWA 3NR2A 3X44A 1TYCA 2ST1A 3BPSA 3OY7A 4G63A 3DE2X 1FP4A 1WQ4A 4Y6LA 3NDIA 3Q3HA 4AQDA 1RE1A 2SNIE 3GPBA 4KPUA 2YS7A 2XJQA 3Q72A 2A1UA 4GI7A 5AHRA 5DZSA 4UM9D 1E3WA 4ER6A 4NR0A 2CEAA 4YXFA 1TPZA 1T8SA 3P20A 1GZ7A 4IQGA 4ZRDA 3VTKA 3WBFA 3S81A 4PICA 1CE8A 4ZQFA 4X1KA 1KZGB 2QBYA 1XVIA 1Y5IA 1JB9A 4OK5A 4P0TA 3C39A 3FMGA 3JD1A 1L7DA 3KYYA 3GUZA 4UCQA 4W5WA 4XFKA 1FBNA 5G1OA 4MW0A 3SC6A 1PQPA 4FP9A 4H7KA 4QHYA 5FWYA 1PVOA 5A5GA 2QP9X 5CX1A 3VHXA 1T1JA 5CLFA 2I6SA 4MA5A 3I0MA 1JUDA 1MIOA 6YASA 3LWBA 5K8TA 1I9CA 4EVIA 2HK7A 4JFAA 2ODBA 4KU4A 5K3FA 3TW0A 1YB2A 3ZWMA 2HPHA 3W6NA 2B2NA 4BVFA 2R8YA 3NBXX 3NRJA 1W88A 3RHFA 3FCOA 3W77A 1E1CB 4I6GA 4L85A 5GVSA 5EJGA 1L7PA 3CWQA 4N0EA 3HKEA 4FOTA 4HWGA 3MZ0A 3EGXB 3G7UA 4E03A 1V1MA 3HVHA 4LVUA 3V80A 1ZHFA 2NUPB 3BC1A 4TSKA 5GONA 3R5KA 4Q66C 2PUBA 1GG9A 3IRVA 2B36A 1G7CA 2C57A 2P41A 1HH4A 3CM0A 2FH5B 4GVPA 5WRFA 1B2LA 2YJGA 2VH1A 1OWBA 1ORTA 4MV7A 4YV7A 1UXJA 5IXSA 4FDLA 4AFNA 4WCFC 2PSEA 2R6JA 4F4DA 2FZCA 1JLHA 2XB4A 1OC4A 4HMPA 4HZUB 2B25A 1NONA 3UV7A 2VAWA 1JAHA 3IE2A 1L1QA 3JARA 4KXFB 3RE1A 4UOZA 3E9QA 2Q50A 3E1GA 3ZW8A 1XTRA 3O4HA 4L02A 1IEQA 3C4JA 4J4TA 4DEXA 1VZ2A 2IBSA 1UJNA 2COKA 3QHAA 4U4AA 3O0DA 3P9SA 4PY2A 3GFGA 5AYVA 3ZHUA 1GSAA 4D9IA 2O8EB 3REFA 4OAPA 5ITZB 1JLMA 2RK6A 3MELA 5HM6A 4JYAB 4M8LA 3EPJA 4O3FA 1JQJC 1K5DA 4OHUA 5E6UB 1GNPA 1FFGA 4KQCA 2M6KA 4GDFA 2HWUA 2C99A 3E2MA 4TXLA 1AVTA 4F7WA 1O5OA 2PM8A 4BATA 3BIFA 1CR6A 4NCNA 1IXRC 1TE2A 1B0ZA 3U19A 3SOZA 4L74A 4B7ZA 3KD3A 4CEHA 5D84A 3H9QA 4C89A 5TPZD 2VHYA 5IEJA 2AIRA 5IJ9B 2QUBA 3WA7A 1VKZA 4GOJA 2CWWA 1Z2OX 4W8OA 5BOSA 1MRNA 3GELA 1XJWA 3HUUA 5LQKA 1OGJA 5CM9C 1IVSA 3QVTA 1DNPA 1PSZA 2X77A 5DOVA 4WWHA 4CLOB 3U7FB 3OPYA 4OGWA 3OJEA 1F9AA 2XECA 4L0CA 2H7XA 3KE8A 2QTZA 4RJKA 4QDZA 2ZAMA 4H3VA 4FXPA 2M32A 3BH6A 1VZHA 2V5AA 4JUFA 4TMTA 3PR3A 1C1XB 1N9KA 4N9WA 4ZTBA 3OE4A 2PUGA 1VLJA 2CJYA 3I52A 4ARIA 2C0PA 2JI8A 4JLSA 1YUXA 1DINA 4NAVA 4WKBA 4BNMA 4MS3A 3ZD7A 1NI4A 1SOVA 3VSDA 4DT1A 1W0KA 4RIHA 1B71A 2DY0A 1M1UA 1UIMA 5BV2P 3W4JA 2CXTA 5I6DA 1YRYE 4B4WA 4RTOA 1CPYA 3DZIA 2KW5A 3FG9A 3JQRA 1ZIOA 2FR0A 3RYGA 4ZN1B 1HUQA 3Q40A 3KKLA 4FMCF 3UKOA 4Q34A 3AJDA 4AJ9A 3F5QA 3WB9A 1EDBA 2DFVA 4GZ6A 3PGXA 4XGRA 3QI2A 1H1TA 3K0FA 5HR5A 5CFZA 4RULA 3KM0A 5A3JA 3L06A 3VR2D 3W8DA 1U3FA 1J8VA 1QZTA 1Y1RA 4FCVA 2Y1CA 3IPXA 3CR7A 2WT4A 4GPAA 4ZAFA 1U6JA 4YXWD 3SQWA 1H9CA 5H4HA 2JIZD 1KK1A 1OREA 3LF1A 1FNSA 1H0RA 3KOMA 3T1OA 2AHRA 3DUFB 4L5CA 1V45E 4U9HS 1NQVA 2O2ZA 3LRXA 4GMDA 4HFJA 3UCFA 4HSEA 2EATA 4B2PA 3Q9SA 3VOAA 2ENWA 4R98A 5DNWA 2DH6A 3BFXA 4XXHA 3UQYS 1QU2A 3I1YA 4U0JA 1OOEA 4J0HA 1CYEA 2XNDD 1DIRA 2ZYAA 2R1VB 4UM8B 3IV7A 4NMWA 1ZL2A 5EIFA 3GA7A 3WHLA 4CNBA 3RPEA 5HZKA 1H4VB 3K1AA 4UUOA 5HUQA 1I1QB 1U0SY 3HM9A 1V8ZA 5DASA 2EZUA 4Q05A 1V4VA 3I09A 1TKCA 2ZI7A 1DOAA 3WMGA 2AEJA 4OLFA 3F9IA 4BP1A 5DNYB 4PO9A 3OQ1A 2IBTA 2M6OA 4IDFA 4AJLA 3ER9A 4IEIA 4A4DA 1ZUD1 1H2XA 5KKCA 5AKYA 1C4XA 3UA4A 2D1SA 1BS2A 2DX7A 4NK4A 4EELA 4F1JA 4WI1A 5JASA 4LF5B 4IMRA 3NP9A 4FNGA 2QJOA 1EFRA 1FOEB 2N46A 3BJIC 2PZBA 3KE9A 1MQ8B 4RGBA 1XEFA 4WNYA 4J94A 5KSZA 4BQNA 2QRLA 1PVVA 1KJIA 3BX1A 4HJRA 3DOHA 4RSMA 4GOMD 5JSZB 1PD0A 4YLEA 1IUKA 3K53A 4YQZA 3MAJA 2LD4A 2SBTA 3L0CA 3QYJA 1G7SA 2VPPA 2V8BA 4AL4A 2VUSA 2AHOA 1A4IA 1EVKA 1A8QA 1XFDA 221PA 1GPWB 2AWOA 2Q9AA 3FKSD 4UTOA 5FBHA 3VO1A 4DQXA 5K0CA 3ANNA 4J90A 5CT4A 1JR2A 1MA3A 2V59A 3I39X 4BX2A 2W42A 2AG6A 1QNLA 2D1FA 2W0SA 1W85A 3FNHA 4CG2A 4I19A 4NBKA 4XOIA 4OGLA 1P0FA 3EH2A 1K27A 2AN9A 4AW9A 1H2EA 5KOHB 1P2GA 2QT1A 4LRSB 4WNAA 1BQ4A 2PVCA 3GJSA 5IRCD 3L7IA 4XTCS 4V196 4AMBA 1BN6A 1FFDA 3LHIA 1M10A 4RH1A 4N0MA 1T2CA 2ORED 4R84A 4BVKA 1PR9A 1MO5A 2W6JD 3PEYA 2HMUA 1FFEA 4F4HA 1KQGA 1FA9A 3BJEA 5LOVB 3P2KA 3WB1A 1KKLA 3RAFC 2IUFA 3QMWA 5ULLA 4I8IA 2GF9A 2AXPA 3AEZA 3H13A 4OBEA 4RIFA 1RB9A 2CW5A 3VKUA 2BGWA 3MVEA 1RWOA 3EY4A 2GI4A 4OUDB 1KC1A 1CADA 1H9BA 1QIGA 1KE1A 3W9BA 3FSEA 4I1SA 4IMIB 2X0FA 1QCYA 2FQXA 5C18A 5AK4A 2KMLA 3LSYA 5FORA 8ATCA 3JVUA 1TGVA 5F98A 3SZGA 1ODHA 1N2BA 4OKNA 3EBOA 2QORA 1NFFA 5DX8A 1YR8A 1E18A 1QZUA 1SBCA 5FXMA 4A0GA 5LWHA 3DVSX 1CQIB 1NLZA 3FCYA 4ZDIA 1R0WA 2WFZA 2RGRA 4KRFA 4QLAA 4UPVA 4G0MA 4PN3A 3BD7A 2I5PO 2QRPA 4JSTA 3T1QA 1Z36A 3EOZA 1OLXA 1E6WA 2HSJA 1O94D 1ZR4A 3NH6A 5K3CA 5AM3A 1M7HA 5F4BA 3QE4A 2B8JA 2HCRA 2W2OA 5G0UA 1GRQA 2WF6A 3AF3A 5EEGA 3WP1B 1WCML 4ER5A 3VAZA 2Y93A 2NYVA 2PBLA 1BAPA 4L4YA 4WLUA 2QVBA 3OAAA 2GM3A 3QMPA 2NYAA 4A6XA 3ESAA 3DBOB 3RZTA 4LMPA 3AF2A 1XZLA 3TGLA 5MFZA 2Q1TA 3RBZA 1T26A 4F3NA 1JB1A 3DTTA 4JJ6A 1PSDA 3AR6A 1KEKA 2IY7A 1R0FA 2A84A 1KSGA 3EFHA 3PXXA 5K20A 3S2IA 2ZDHA 4RPKA 1M33A 3CZQA 3ZYZA 1R4NB 1IYZA 2CMFA 4YUVA 3WIDA 5K03A 3BL6A 3AOGA 4GD3Q 3A05A 4HI0E 4URUR 1FTYA 2HZ7A 1OW3B 1X42A 5FFFA 3STYA 2J41A 2VRCD 1G18A 3I73A 2J0VA 3RSHA 1EUDB 1FRQA 4P7GA 1W35A 3R75A 3SR0A 1BQ3A 3CSDA 2HH9A 3B6KA 4LC1A 3PIDA 2P8JA 3JWPA 1EK2A 1YJBA 3SGLA 1IB6A 5GOZA 2FRDA 2GN9A 1ZUHA 3WISA 2JBAB 3CF0A 1T6ZA 1QGED 5IBPA 3D3QA 3GTLL 3ZD9A 2KN9A 3H6HA 3KJIA 4U5XA 621PA 3L4BA 3UV6A 4IYJA 3UK0A 2FSUA 2JIDA 3Q4GA 4B8YA 1QMPA 2MWMA 4R8LA 3RRNA 4CKBA 2GCOB 2FWJA 2XT9A 1WMSA 2RFKB 3ILVA 3UHPA 1M1XB 5DBIA 2X5KO 2ZBQA 3V5NA 3TECE 2Q1WA 1RXUA 1XN4A 4BASA 1ZR2A 1XI2A 2QTBA 2IXAA 1EH5A 1XAGA 3A7EA 1RCTE 2UZAA 5T6MA 1TNDA 1U9IC 1IQ0A 1UZAA 2M6LA 4YMLA 1GLGA 3RYIA 3PIRA 3QPAA 3UAYA 3ETEA 3IV6A 2AE2A 5C53B 2RKWA 2P9GA 1UOPA 4BQOA 2FQ1A 2YQ4A 3G9XA 3BIJA 4MJ3A 3D6VA 4IOMA 2CFTA 2GF0A 5K4HA 1H0KA 1KFJB 2HWKA 1OBHA 3BMOA 3ENQA 3NU1A 3HOYL 2YZ2A 4B2IA 4DMFA 3RREA 5C51B 1FX1A 4WBSA 4DMLA 2E4XA 2SKCA 1EWRA 2OHHA 1DXHA 2WHEA 1JILA 1EK1A 1VB3A 3AHJA 2FRVA 3QYPA 4QEDA 4R5MA 3UIEA 3QVVA 3VYVA 5KREA 4H7FA 4IMPA 1LZKA 2W71A 4HZGA 1FUKA 4Z1MD 1QVAA 3VR4D 4FHEA 1Y63A 3T5TA 1Z26A 2COEA 2VT3A 5CUQA 3FLMA 4MKFA 1L7OA 1KQFA 3RSZA 4BV9A 4CTKA 4FEAA 3I4NL 2H4XA 2I22A 1CS0B 3EULA 4J1TC 5C4MA 3PQ5A 5CEJA 1J5PA 3CRRA 3G9QA 3OIVA 4OA5A 4OHPA 1RDGA 1S2DA 5CVCA 2D2FA 3IOBA 1QK3A 2VT6A 4NABA 4PCLA 3RYFB 4ASUD 1OT3A 3DTNA 5B64A 4CDMA 4P83A 4F12A 4MO9A 5EAIA 1AQJA 2BAGA 5F5NA 4B8ZA 3TR0A 5C5DA 5JE8A 5KNCD 1HLGA 3C45A 1CG6A 1X80B 1EK0A 2VAVA 2RD2A 3D7KA 1HFKA 3LT2A 2VJLA 3EXHC 3OO0A 3VU1A 1LKMA 5SYAA 5K5EA 1UWLA 2K5UA 2G9RA 2PE5A 2RHGB 3QVKA 1KYIA 5EP4A 4LW8A 4CMBA 5L6MB 3DKRA 4W63A 4BMOB 3JWGA 3MTAA 1RC8A 3QEJA 1N75A 2CNDA 3OIFA 4ZIRB 1UKCA 1WHSB 2B5VA 3HDQA 3HWSA 3OLXA 4M0KA 4OQ4A 3UQZA 2IZ6A 5EXEA 3ZKAA 3A6LA 1E20A 4X62B 4QDKA 1U8EA 3LPMA 3ZCRA 5JVDA 3ME5A 2W70A 2OBLA 5I3CA 2BMEA 3J81k 1Z0DA 3EVDA 3EIWA 2VJQA 1MNQA 3L0PA 3O3NB 2J9UB 1IUPA 4CFYA 3NHMA 3C6KA 4CZ2A 2HJWA 3UFBA 2RGNA 3LXRA 4OQPA 4JXKA 1C3XA 3DZHA 3UHJA 5EWLB 4AYXA 3Q9LA 1T10A 1U1DA 2HWYA 2XOEA 5EJ8A 1Y1SA 1ZJZA 4G6ZA 2AOVA 3RTCA 5BW6B 4LE0A 1I2MA 1CLUA 1D5CA 3DG9A 3UANA 3DP9A 3N58A 5JR3A 5K0JA 2QN8A 3QU2A 3LO8A 4CL8A 1F3OA 5TEWA 1TZJA 4F6RB 5AVZA 5DLDA 2FE4A 2CYBA 4PLCA 2NVUB 4LDZA 3GGCA 4MIOA 4V1CB 4JQCA 4QYMA 4LTDA 1Z0JA 5D1HA 2XUQA 2GTIA 1I2CA 1SUAA 1R0YA 4K8OA 4WNIA 3UAWA 4D0SA 2AXEA 3GRRA 4LMAA 1U9YA 5EE5B 4FKMA 4Y1GA 1UANA 1NUTA 4IGAA 3JXEA 1NI3A 2R4QA 5FEUA 2Y1GA 3R6TA 2I91A 5GONF 3Q87B 4P35A 1NF9A 4BBRL 4Q48A 1KP2A 3WY9A 5KINB 1SFRA 1UJ4A 1VE1A 3N39C 3ROZA 3WMEA 3BG5A 1M2OB 4C9BA 1QWOA 2DECA 1Z3CA 4NBWA 2FWBA 3CPJB 3A0RB 4BCBA 1ZCAA 3GZNB 3HN7A 4PAMA 4QPZA 5ADWA 3MRSA 3C3EA 4W5QA 1NJ6A 2WMDA 1SUSA 2H1WA 4MULA 2C9BA 1M2WA 5HIJA 3DZKA 4AZVA 1JI0A 5FNVB 1BRMA 1P4SA 3AEUA 2DH5A 3BGVA 2FZGA 1WUIS 3PJDA 1WBBA 3T0GA 3UYLA 2FPGB 2Q21A 3H97A 3R6GA 5EG5A 2J4DA 4BZXA 4PRZA 2NZYA 3KQPA 2Y1OA 3QELB 4GBJA 4TT3D 1P1FA 3DOJA 2FFQA 5IYZB 1YIDA 2X2FA 1OSNA 3LXXA 2DFDA 2E2IL 2V3CC 1EFPB 1RYEA 2H54A 4DHEA 3UPTA 3P9XA 1JIXA 2WTAA 5IVHA 1K86A 2FW7A 3PIP1 2HK6A 2P1DA 1FHMA 3BN3A 5FYDA 4F4CA 4TS1A 1YJ8A 2O2YA 4GBGA 5SZIA 5LBTA 4A8JC 1WMAA 2BM8A 3WWEA 1GA1A 4MITA 4R2KA 2H2AA 5CA1A 1LTQA 3L77A 2XGGA 3CH6A 5E1BA 3S1QL 1H8ED 3Q7RA 3JASB 4DC1A 1BQ9A 2Z9DA 4EMTA 2PXXA 3GQBB 5F2OA 3PHBE 3HO1A 4BZQA 1A0OA 4W6QA 4UFNA 3TVDA 1I3NA 4ZTZB 2XWPA 3FOWA 4RVDA 4ZO7A 2PZGA 2YWJA 3VI4B 3ZVLA 1FS5A 4HPXB 1J8YF 5F12A 3VU3A 3OT1A 4CFSA 3DFMA 2QSZA 4N0DA 4M0DA 2BFBA 3S0JA 2JLBA 1OVGA 3B36A 5BUSA 1Z34A 2E3JA 4QREA 3R3WA 1ZRHA 2CUZA 4TKUA 5DMHA 1EXMA 1XQXA 2WPDA 2PKWA 4HLUC 3SAJA 3HA5A 3RCBA 4DEVA 1V16A 5ALEA 3MRTA 2IE0A 2ADOA 2AJLI 2BZ1A 1DV2A 2OYCA 3VTZA 4DAEA 3U60B 3K9CA 4G4SP 4NU6A 4U2EA 3KOXA 3ZDEA 1LBTA 1P4RA 1Z0ZA 2TYSB 1MPTA 4GX1A 2VZEA 3Q1KA 4A91A 4NEGA 1A2KC 2Q46A 3TW6A 2XCRB 1QE3A 1ICEA 3D5TA 4WTOA 4BO1A 2CLLB 3CE6A 4MMZB 5AUNB 2Y2UA 4JR1A 3ZLUA 1VHQA 5AKJA 4ABTA 1RRCA 4P7FA 1IU5A 1FDRA 1SBTA 3E5NA 3NUZA 4UTNA 1W0JD 2LR0A 1TMKA 3Q6IA 5EMKA 3PUJA 3PLAE 3ZBTA 1CJSA 3AW8A 3B20A 3LLSA 2BFEA 5A6SB 3TL2A 5ESXA 5KNDD 2HOQA 5L7TA 3LBNA 3HKDB 3D9QX 3DAOA 1M6VA 3W6UA 4GVXA 3MXTA 4KEAA 3ZCTA 2X41A 1VYHA 2GHQA 4C4RA 3RHSA 1SELA 1VLMA 4MUMA 5EZ5A 4KYUA 5J43A 1IXYA 5IJ0A 2IXDA 5J5VA 3BQMB 4JT8A 3OZRA 4FDTA 2A78A 5KSPA 4KUEA 5ADVA 1XIVA 2OXCA 3LTEA 2PXCA 4PLFA 3M5WA 2RGXA 3WJ2A 2PSSA 1C0KA 2HSGA 3QOYA 5F64A 2AA3A 2VAPA 1IZ0A 1GUBA 3D6MA 3O3CA 1S6YA 5DHRA 4KNYA 5CW1A 2BFCA 4KI7A 4EFMA 1V7ZA 2TMKA 5H81A 3F8WA 3I5AA 1L5LA 3ZCQA 3A1NA 4YJHA 4NX2A 5AI5A 3LPEB 2CB9A 1G6OA 3DBRB 4A23A 1V4BA 3VAAA 5E0KB 5GJCA 1VI5A 4KXLA 4Y0AA 4FT4A 2CVQA 3VNQA 2M6RA 4QFCA 2KWIA 2C9MA 5HMMA 1YDFA 4LDQA 2Y3IA 3VOTA 4QYIB 2EF1A 1C8KA 4B2LA 2IZ0A 1EX1A 1GAJA 1ZY2A 3HKCA 2QS9A 4OQMA 4C2BA 1LTLA 1RMYA 2P3SA 3W6ZA 4B3FX 5L3SA 1UKBA 2P79A 4M1OA 5JVG1 4CI9A 2JFVA 2WSMA 4UQOA 2AG0A 2O8DB 3V97A 1JAIA 1ZW1A 4YCNA 2FSHA 4C5AA 2MSKA 2DUJA 2ZT6A 2JHPA 3H75A 1QHFA 2PZMA 2QL7A 1IM8A 4LBYA 3IH5A 2R62A 4OY3A 3RASA 2HJ9A 3ID6C 4RXTA 3F73A 1M1NA 1NXVA 2YIJA 1UJMA 3A1CA 3HUTA 4YJKA 3AEXA 4BFCA 2N1MA 1WCIB 3EDYA 2UVPA 1RVDA 4LYAA 4DY4A 4GOND 4GWGA 3NPMA 3TFWA 3AJ9A 1IHPA 1XZBA 4PYRA 2P6MA 5L4SA 3W5CA 2ZUEA 7ADHA 2C98A 4V2IA 1EM8B 1OLUA 2PUCA 5EWJB 4I3FA 4EYSA 4NCXA 4M0FA 5BSFA 4RDXA 5BQ3A 3HBFA 3RSOA 4WZBA 2H08A 1MV5A 4UY81 2O0KA 4V38A 4JUCA 4CGYA 1G5PA 3LQRA 3SS2A 1AK2A 3NANA 2GZAA 1BQ8A 1GZHB 4N40A 3G8YA 4WCDA 2GZHA 2JNWA 3FDXA 4Q4LA 4F7DA 6REQB 3SNHA 1UFOA 3I45A 4FWTA 1SCUB 5EHXA 4CL0A 3DJFA 1LC3A 5IP9L 3PC8C 2PL5A 3SKVA 1YBMA 4S0XA 3WIOA 3Q7PA 4Y2QA 3RRXA 1XJ5A 1BFKA 4Q19A 1LDYA 1G20A 1Z45A 2CDCA 2ZULA 3FROA 4YIKA 4OHRA 3UK7A 1HE5A 2PQMA 3C4QA 3GVIA 5D51S 4Y1EA 5DTEA 2JA5L 4YCCA 1ISRA 3KELA 2IX3A 1PLKA 2DG2A 2YXLA 1V1JA 4DDUA 4A3GL 1QG6A 3V1KA 2FX2A 1M0TA 3HOWL 3LQ4A 3K2EA 3I6QA 3BDVA 4C0WA 1PKXA 4EATA 3ZVKA 1UKVY 2VYVA 2IIBA 2J3HA 2PYAA 3A70A 2PTGA 4FOPA 4ALMA 4CVNA 4S04A 2DGDA 4HGOA 1XROA 2G9ZA 3T1TA 1FX0A 3MEQA 5A5FA 1WMBA 3OFJA 1OD6A 1R0BA 3KXLA 4RMIA 1U2DC 3AK4A 5ALLA 3HCOA 4AP6A 3O26A 3BMCB 2HWXA 4OU4A 4RCVA 4U9IS 4YAOA 5CA0A 3RS0A 4C4YA 5BN1A 1NRXA 4XIJA 1M2NA 2B20A 1RJ9B 2IHYA 3LW8A 3O92A 4FGSA 4HNHA 2X0DA 3NG1A 1A04A 1EVLA 1WS6A 3NHWA 2BTQB 3UJPA 4BY7L 2C0CA 3CZPA 5B3JA 2H17A 1TD9A 1K83L 5LZ8A 1X9IA 3RS2A 5E4FA 3ZLBA 4HYQA 5HHTA 4B3CA 1N92A 1H0SA 2C4HA 3ONEA 1YZGA 5K8IA 2O3SA 1N6NA 1HQYE 2NUTB 4H7HA 4ME3A 3CNHA 5L40A 2MINA 4OJMX 4GL2A 4HDRA 2ZS8A 4JBGA 4NDZA 1J5EB 1REQA 2ZITA 1WW2A 3TQQA 1H4QA 1LW6E 4L9SA 3KZKA 4MQ6A 5TB5A 5CBKA 3NI2A 1RABA 1RRVA 2PQ6A 4L3WA 5DTJA 1NP7A 2DKOA 1LSOA 3V42A 1U1FA 1UDCA 4XM1A 2RHBA 4KR3A 1KNXA 1ZJJA 2VLIA 3DHEA 2Y0DA 4MUEA 4UD6A 4US0R 4JYMA 1XKTA 2LCQA 4TROA 2PEZA 4YTEA 3LU1A 3PQFA 2DKNA 2P2SA 3RK4A 3IDOA 4E32A 5TMPA 4G5SA 5FDFA 3DM9B 1CNMA 1XZAA 3ETDA 1XMSA 3I4ML 4HAIA 4R16A 3IDAA 1J49A 4TVKA 5C4JL 2Q2WA 1SH7A 3P4YA 1H2ZA 4J0FA 5TT1A 3U16A 1EZ4A 2EGGA 4HAVA 4KL8S 3R5FA 5AH0A 1H2YA 2PXHA 5E95A 3F4BA 5SYMA 3TI7A 1CQZA 1JGTA 5JWHA 5KAMA 1WUYA 3EK2A 5D6NA 3NM6B 3O1HB 2GK3A 2E4WA 1SHKA 2DHEA 5FOXA 4BVLA 5EJ9A 1XCOA 3GLGB 1MZPA 5LQDA 1LY1A 4BRWA 1XA4A 4Y0VA 3BBPA 2VYNA 1DO0A 1NC1A 1V4NA 2TMYA 3DT8A 3HL0A 4GX5A 2X42A 2VKQA 4JVNA 4B33A 2CZQA 1YS1X 2XODA 5B12A 1OAOC 1CYDA 3E3OA 1CP2A 1K0FA 1YUNA 1TK9A 1ATIA 1M1YA 4ZKDA 1TX4B 4KWHA 3JQAB 4M9CA 2I6QA 5IZCA 4YN3A 5KTRA 1CNFA 1IATA 1DQPA 5ALVA 4E08A 3QFRA 2UUOA 3E27A 4H6XA 1FXSA 4NS1A 3OJCA 4EJ6A 3AVTA 5G0SA 4ZHSA 1JHQA 1D8AA 1NP3A 2P91A 4L51A 3L1UA 4MYUA 3TZKA 2WICA 5HZHA 2O8CA 5HCNA 1XU9A 3LOUA 5L7YA 4WLNA 3O2JA 3VPDA 4HRXA 2XGSA 5T67A 5AJUA 2JPDA 5CK4A 2VSQA 2NXCA 1OB2A 4NSNA 1HZJA 2JA2A 2OD2A 1V8BA 1PYOA 4EFDA 1NJ8A 3L5KA 1RHUA 5FBKA 1OT5A 1NJFA 3FDZB 2Q3HA 4RKFA 1P3DA 3HXMA 3CW2A 3LUBA 1C9NA 3DYBA 5DXJA 1Z83A 3Q3JB 4GKJB 1Z68A 1Y9JA 3AESB 2VXCA 4OHMA 3RVDA 5TIIA 1E4OA 4L8VA 1PFYA 3KB2A 4I2VA 2YJTD 4KVZA 2ZVPX 1D8TA 4YUXA 5HILA 5SICE 4ECEA 3CUKA 4KFSA 3QKRB 4NL4H 2C92A 2CK3D 5FUVA 3VGJA 1E5QA 3KV1A 1KZHA 3LTNC 1N25A 3G82C 3GWGA 2HRZA 1WXXA 1YACA 1YIOA 2JI7A 3JRWA 3OZWA 2P78A 2Z8ZA 5EXXA 521PA 2GA8A 5B58C 3QJ5A 2ZM5A 4F5EA 4KIWA 1LLCA 3EIOA 4ZAZA 1A71A 2Z95A 4I1OA 4GU5A 2R11A 5JVDF 3HZRA 2B92A 2ONJA 2BOVA 2EZ9A 2OHXA 1I6HL 4MKGA 4W9NC 4QEZA 4ZQHA 3KUKA 5FL3A 1BDMA 3MWYW 1SK8A 1UDRA 2C3MA 4O1MA 3D1LA 1K98A 2QMYA 3EXEA 3HCRA 4YEDA 3UGKA 4IRMA 3OWXA 4Y18A 1P33A 1ID1A 3I3OA 4B6FA 1OX5A 5B2EA 3TRIA 2YWXA 4TXMA 3KIPA 2JLZA 2WW8A 4IGFA 2QN6A 3DM5A 3R5XA 2QW0X 3R3JA 4WZAE 4E2ZA 2J4FA 3H2IA 5HQ3A 1GAQA 3HVKA 1M2FA 4QTUB 4N49A 3UUWA 1ZRNA 3P0IA 2ZB8A 4BXOB 3CNQS 1IBLB 1AGXA 4QHTA 4DVGA 4ZOLA 3RVLA 2QU7A 3U6BA 1T9OA 1KEUA 3PENA 4RPCA 4ZVLA 1KJJA 3CSUA 1WHTB 4LHVA 3L8HA 4TV8A 1ADYA 3L7YA 5K09A 1XNHA 1BKDR 4IDCA 4RBNA 1XEWX 3C3BA 3K70B 3H5AA 4BCDA 2JFGA 1PJRA 4TKMA 2Q3DA 1EDZA 2I9PA 3CPHA 2HBQA 4ENUA 3EG9B 3ZHXA 1V3VA 1EM6A 2FTKE 3IBYA 4X00A 3IXMA 3HU1A 2OXFA 2Q5JA 3GLVA 4LNHA 2XQGA 3N0WA 1JHPA 3COPA 4PSKA 3QG1A 1CZNA 4C7OA 1QR2A 2VDJA 4P31A 2J6BA 3W5IA 2VDWA 4GZ3A 1WZ2A 2HK9A 4KVFA 3AVYA 4V0RA 3EZLA 1UPUA 2FPRA 2PJDA 3FPJA 3ORYA 4KIFA 3K71B 1A1VA 2I7CA 4LYDA 1LSJA 3L6BA 3GGJA 4WUVA 1GRVA 1CRQA 1ONNA 4HNSA 1QE0A 3MMZA 3ZGYA 5I4BA 3IEXA 3M6UA 3A1VA 3CLVA 2XW6A 1VG0B 3W90A 2A7QA 3IALA 1ACMA 1FP7A 3R40A 2O4CA 3HFRA 4W7HA 5JMWA 1LVGA 3AFIA 1KAGA 1FDIA 2GN4A 4EABA 1RKXA 2IXFA 1ECPA 2CNNA 4MI3A 4LF8B 1NVFA 2FOXA 1YR1A 2H2FA 3M1AA 5FTMA 1IVNA 3I9FA 4HQ0A 5T3YA 4D56A 4FGZA 4O5AA 3GRKA 3K0CA 1F12A 4CLEA 1F4LA 3O38A 1CLEA 3ZUGA 1C0EA 3LDFA 3H9JA 4REOA 3OZIA 2E4YA 3PQ4A 3WO0A 5CA1F 3B38A 2V6GA 2H65A 1R8SA 1W8DA 1Z6YA 4LHSA 1ZGHA 1MJGA 1WSBA 3Q3VA 2OO5A 4RHEA 3ZJUA 1W6UA 2IDJA 1NG1A 5KOIA 2GAJA 1FP6A 2UYYA 4YJFA 1TAGA 2P9FA 2WKPA 3PE3A 3TIIA 4L95C 5HNKA 3BWMA 3QA3E 1YJXA 2YV1A 4QJ5A 3LC0A 1V3QE 4CQMA 5I4IA 4LYEA 3G8BA 4DABA 2NVXL 1PW5A 3RBXA 1G21B 5IBQA 1WV0A 1XPRA 3CJQA 4JK3A 5KWVA 4NZYA 3FTPA 3LPLA 4FCWA 3QWAA 3LW7A 4G97A 2HTFA 4QDXA 3A2NA 2WMYA 4AULA 3JYLA 4CEIB 1IDN1 3AV0B 4E5DA 3VZCA 1V8FA 2PH1A 3OIDA 3G2LA 3QPUA 5RXNA 2I87A 3ACDA 2C88A 1GLNA 2HJVA 1A9OA 2NZWA 3I05A 3PDWA 4L6IA 1C7ZA 2LBPA 1QGUB 5BYJA 3I76A 2YHSA 3JYHA 4F2PA 1QGDA 3L4KA 3I42A 1XMPA 3NC0C 5CB4A 2WM9B 5TPWA 2HIHA 2RC5A 2VHZA 4K6MA 1IU9A 1KJ8A 4LYYA 3DB1A 5ER9A 3CF6R 1D1SA 2XLCA 4Y30A 2RHHA 2IZ1A 1EVEA 2IOFK 1NBIA 3OECA 3N87A 4EH1A 2NT4A 3R2JA 1Z4PX 1AB6A 3UMYA 4YHHB 3NIWA 2OOKA 1U0LA 2GHIA 1SHLA 1KAHA 1NMYA 1QH9A 2FSIA 1UFKA 1KJYA 1OI3A 2PV7A 3CXUA 3G1WA 3OFSA 4IGIA 4D0RA 1IK6A 1VJRA 4H77A 5KYWB 2Q99A 4YROA 3SVZA 4J03A 1CUHA 5JXHA 5FLYA 2VG8A 4WFKA 3EW9A 3TCXB 4AU1A 3GLIB 1A88A 3N53A 4IDNA 3VNBA 3RS7A 2ATXA 1U0RA 1A5ZA 5CBPB 2P6RA 3ZH9B 3UA3A 1LWOA 1NRJB 3H4TA 5LSAA 3X0DA 3VA7A 3BIWA 1E8MA 1MN6A 4FDAA 1DIOB 4LZZA 4NBUA 3AR4A 3W5UA 3W0LB 13PKA 1RAEA 2DE0X 4JSYA 1SK9A 3RNLA 3ER8A 4G65A 2XX3A 2EJBA 1B16A 2PJZA 2QG9A 4KUHA 4OOEA 4Q3CA 4QICA 3UMCA 1TRKA 4OLAA 3CG0A 5E38A 1F5NA 5JV5A 1TEHA 1YB5A 3URMA 4YUZA 2GJSA 4V0MA 3ABIA 3EA5A 1SFOL 3RLFA 3S2EA 4DLXA 3P8BA 4ZGBA 4UBLA 3FFBA 2I54A 1JYSA 2BFPA 1XTQA 5FAXA 2VC2B 1UBLS 2IKQA 2CN1A 1IAQA 3R7WA 2Q9CA 2C6AA 2EKLA 1F8FA 3QPCA 4LZAA 2CZGA 1JEYB 3FMOB 1JMYA 2Q3EA 3OI7A 3DLCA 1I01A 4OD0A 2GK7A 1U7WA 1GT91 1SU4A 2RGWA 3O95A 1ZJYA 4IFIA 3BD9A 4E21A 3UEOA 1SHUX 3WLEA 3FOAA 3ZW9A 3JU3A 2FAXA 2Z3RB 2XOXA 3A3KA 3CQ9A 2UYCA 3W5AA 4K9DA 2DT5A 4BQFA 3S2FA 3DF9A 4DXHA 2W2PA 4WKCA 5C44L 4MUJA 4ZYXA 2RAUA 3QXJA 1F60A 2ZAIA 4KG7A 4UUAA 1T8RA 2RK4A 4D8WA 3ZBQA 4HK4A 3R9KA 1UZLA 3GRCA 1UMDB 3FPCA 4XARA 3UT5B 1Q6YA 2XV1A 1QHHB 5DHFA 2O06A 3TOSA 4CTNA 2RHTA 5JCJD 2F55A 1T4DA 2RBKA 2Q0SA 4P3PA 4ZCPA 3U4GA 3MC1A 4LTNA 4TZTA 1FJGB 3U4CA 1UZUA 1G9SA 1R0SA 2OLEA 2NU9B 3GPCA 4TN5A 4R2MA 1L7EA 3CCFA 4ABYA 5IKMA 2GJ8A 4K6FA 5JBQA 4MV6A 3TM5A 4KDEA 2PKYX 3HGMA 1CVRA 4DMHA 3WYNA 5K2OA 3FRJA 4TM7A 3DL4A 4X61A 5KYXB 2DMRA 3CZ9A 5ENZA 2QHXA 3PNSA 4GVLA 3STHA 2X2EA 2FFJA 2VLBA 1B14A 3N76A 3PNLA 1U4SA 3L0SA 1SR8A 1Z4MA 1Y98A 1Z22A 3AVOA 2BMJA 3NUQA 4IFBA 1U5CA 4PGAA 4BECA 2MS3A 3KXPA 3SFTA 3NS7A 3A9VA 5JSKA 3QZUA 2H1FA 3QF7A 5U4XA 1L5GB 3P9RA 3DEIA 3I72A 3Q3EA 1EINA 1LBHA 3NT2A 4A3ML 1Y82A 3V2HA 3WX0A 4JP1A 2G36A 2Z57A 8ABPA 1S3IA 4KYIB 2O6LA 3OCXA 4YRNA 3OJOA 4HDOB 2Z3QB 1SRRA 1ZIYA 2H9IA 3HCEA 1Q0HA 2QXUA 3RC1A 1ZD3A 1QO0D 5CA0F 4WXHA 3IA2A 3T0IA 1N5OX 1JLKA 1NPYA 1RWPA 3OUTA 3PKJA 4BBSL 1DELA 4F3TA 4RA6B 2IHTA 4D8XA 1FW8A 4P32A 2JAPA 3KR1A 4A16A 2OV2A 1K9SA 2V6IA 2OFXA 4HV4A 5BMOA 1MP0A 5JZOA 5AKGA 4C3VA 1KMHB 1NW3A 2A5JA 2X6QA 4GXNA 5T3UA 4HGRA 2YCBA 3RGWS 5BVHA 5J3JA 5JDIA 1HKUA 1SQGA 3ICEA 2I55A 5ELMA 3QPWA 4BAZA 2O7RA 4JKYA 2XMZA 3AR9A 2PL3A 2BFDA 2IZOA 4ENWA 4RX1A 1R9TL 3RUPA 5DGTA 1YOBA 2X3FA 4BVEA 2QRUA 5BN5B 3GPLA 2JIOA 1XCMA 2FK8A 1O08A 2IYNA 2JANA 4HDNB 4L4SA 4WVFA 1DEOA 2FMXA 2XOKA 4L15A 3RSQA 4AB1A 5K8JB 2XJRA 4PU0A 5ALJA 4ZAGA 1BS9A 1P7CA 3DCIA 4G5QA 4LJ8A 1VBNA 3TLMA 1JLLB 1ODJA 1U28A 2WKQA 4YRPA 3L1HA 4S24A 3TD6A 2WUEA 5I7VA 2WYIA 4HC4A 3W5JA 4LISA 4O2AB 1B2JA 2W2LD 3EZFA 4S1VA 4OHCA 4V0KA 2X5XA 1XEXA 4IUCS 2OLKA 1UJ6A 2BFFA 1G5IA 2YXDA 3MRVA 4HS4A 4TLCA 4F3CA 1VQ1A 4KPEC 2PUAA 1NQOA 1NVBA 2G6TA 4OTZA 3TSCA 1JBEA 1EA5A 3GDWA 3A6EA 2C5AA 4H7IA 2G5GX 4IIJB 4EF5A 4YP0A 1IN6A 4W7SA 1IHXA 2Q4DA 4LNUB 3ZU5A 2INGX 1JVBA 2ECFA 2V7XA 5ECGC 4DJEC 4EY8A 1FNDA 2HRDA 4BQRA 2HFJA 2WYHA 2FEKA 2GR9A 2UDPA 1JMKC 4KXMA 1FY2A 3EVGA 1Y1QA 2C9OA 4EO9A 4I55A 3BGSA 5I7OA 3ZHZA 1EFTA 3KVVA 4ZCMA 5AW9A 3VJRA 2CL5A 2QYSA 4G5HA 3LWPB 1XCPA 1CJVC 2Q1YA 5LNK6 2GZSA 2Y0SP 2FRDC 1BOFA 3H11A 4KOAA 1ORIA 3GP5A 1CY1A 1DT3A 3ZLJA 4WERA 4UHDA 2VF2A 1DX6A 1T5BA 3CX8A 4JQOA 4K6KA 3R0JA 1KYTA 2ATVA 1MAUA 3AGQA 1VCOA 1OFHA 3FWHA 4QPCA 5GQSA 1RHMA 4AZ3B 4B09A 1TF7A 3ZDDA 4LTMA 1PZMA 4XCXA 5L4NA 2DRIA 4DXAA 4FX5A 1XFAA 3FNIA 4HNGA 4RVHA 5LP6A 3GJ0A 1SBYA 2EBWA 1CUBA 2OCIA 5JCPA 1XELA 1D4FA 5KYYA 5KTMA 2V65A 3GEGA 1UT6A 3NW9A 3VR6A 4C4ZA 3LNTA 5B3KA 3P0HA 4UMDA 3S15L 1RRMA 3U9SA 1N6KA 2XADA 3CO5A 1X1TA 2VEOA 4E5VA 5ICCA 1IBMB 2CSXA 4NATA 1PFUA 2JLYA 3E9ZA 4KQEA 4B46A 5BW4A 5A62A 4AR4A 4E5UA 2OR3A 4J7XA 5CLLA 4D2IA 4LRUA 2C96A 5DM60 1U8FO 5KYYB 3DWIA 3LCRA 4J3FA 5T64A 1V6CA 4PGGA 1KEZA 3J7TA 4RENA 3V8MA 3RZ6A 1J21A 2X0JA 4URWR 1BWQA 4XA8A 2HI0A 5JXIA 5AI9A 3W5BA 1PZGA 5DCLA 1GZUA 2VF7A 2IYEA 4QQFA 4DLUA 4PX3A 1VDMA 4EYGA 2XYGA 4FFNA 4GX0A 2PYZA 3ANXA 2YVQA 3PQ7A 3QITA 4HGYA 7REQB 3G88A 4L76A 4BFTA 4NP6A 5AVWA 4EGFA 5IT0A 1SNYA 1JKIA 2HHAA 4QIWP 1IRXA 2C5LA 2CC2A 2VWHA 4MIKA 2YWHA 4M1TA 4WVLA 1WMEA 3C3PA 3CVVA 1N3IA 1F14A 3K15A 1HFEL 1JKMA 1NULA 1PV2A 3I9MA 4FKZA 3NHAA 4O8CA 2JAOA 3GOQA 3VOSA 3ZX4A 2D1RA 2XTMA 5C8YB 5JRJA 1IN1A 2K7FA 5K45A 3EWIA 2R97A 4OH1A 4R9VA 5AP9A 3RSCA 4L6AA 5JWRA 3N2GA 1T2NA 1I4WA 4NZPA 5REQA 5TVGA 3R0VA 1O03A 4FQ8A 4MVJH 3T3MB 3M1IA 1G9XA 4ITVA 4FYYA 4TVSA 4J0JA 1W25A 2AFHE 1YCFA 2Y92A 3CUSA 3FGPA 4TM8A 5GJWC 5A9SA 1DDIA 2NQ8A 2EX0A 4V2UA 4ZOLF 5IWCA 4X60A 3K7AL 2UZ3A 1CQXA 1Q3TA 4NMXB 2OXTA 3ED5A 3NX4A 4HNAB 3VR5A 1UM9B 1DC3A 1W94A 1T1SA 3JQ8B 3WMWA 2PDAA 4RTQA 1RWMA 4TV8F 3BILA 3BHNA 1R5JA 3LKBA 4JLAA 2PAAA 2IYAA 3W3AA 2FPWA 3DO5A 2VUML 3KEOA 3P9IA 1VHLA 4OHFA 5F77A 4LYGA 4ZEXA 4URVR 1B23P 3E3LA 5ALFA 3UK2A 1GDTA 2IOYA 2KBEA 3NV9A 5ESDA 2LKDA 1S4MA 4MOWA 4BWGA 2Z3VA 1IULA 2HREA 4W1QA 3FOFC 1NSFA 5KTOA 2D4AA 3S44A 3O75A 4O1IA 5ALGA 5F9HA 1SMWA 4WJZA 1S2GA 5AKXA 3U2QA 4F4UA 2DQ4A 2ZBGA 5CGQB 5LBUA 2UVDA 3WQQA 5K8UA 4XI9A 1FSGA 3K6SA 4DF3A 2V97A 1XQVA 1DO8A 1E0KA 5TC4A 1L5NA 5JISA 2O1XA 3AHGA 3TOVA 1Z2CA 4CKZA 5EY5B 3JD0A 1A97A 1BRTA 3F5MA 2AF3C 1DX4A 1TZ2A 4IICA 1JWBB 2CCKA 2AFIB 2WMNB 2YWCA 3VI3B 1Q5PA 2XCTB 4Q21A 4Q4AB 5JFGA 4KN5A 1QANA 1EBFA 4N6OA 4DC0A 3HAXC 1NUQA 2P0EA 2BH9A 2HIMA 1XYVA 4ZO4A 4CV2A 2P62A 2OFPA 4MW9A 1JZSA 1T34A 2QJFA 3P7MA 2XMCA 4PFQA 1BSVA 1IJBA 1GGEA 1Q50A 1R3DA 3GGDA 4JI3B 4EMBA 2GFQA 4DCPA 1HL3A 2O8BB 3BIOA 1GPAA 4KPUB 3ULKA 1J22A 2C0QA 4M83A 1QDUA 2ZRKA 2VPXA 5DBFA 1MO6A 5GZ1A 4BJHB 3P27A 1Y5MA 1T3SA 2CJWB 3KL2A 1TKRA 4D8VA 1D1QA 3ZBUA 1AKUA 4MCIA 1WU8A 1TJ3A 4CKCA 3K3PA 3GEIA 3WDLA 5KNBD 3OKPA 2HCFA 1MOQA 3ZK7A 1GPKA 2J6HA 4EYEA 3ICPA 2XWJI 3JALA 3LWDA 4IHJB 5AUOB 1DG1G 3UJNA 1PHRA 2I2WA 5HWSA 1AQ6A 2JJ2A 1TWHL 2B83A 4LGMA 4N5NA 3VHXB 4BBAA 4R81A 4HSGA 3PXBA 4F5WA 2FV8A 2NP7A 3V9AA 1V1RB 4H4CA 1ISSA 4TN1A 4ZDKA 4QGSA 1OH7A 2XZDA 3MA0A 4YWHA 4RANA 4BJ5A 4ZXPA 3OZFA 2Y1LA 1FVFA 4DW8A 1OMOA 3AF0A 4ND4A 1SOUA 3QSGA 5J4YA 1XZCA 3Q7QA 5CB4F 1A4UA 1W88B 4Z0NA 3VV2A 1SHJA 2QRQA 3L04A 2OA0A 1D04A 2VCEA 5M3ML 1UPAA 1XTBA 3SDZA 4CKWA 3CNLA 5TLSA 1OXTA 4TSFD 4WRRA 1A5AB 5MN5A 3CRW1 2P6PA 5GGYA 3NGXA 5LMNB 1XTPA 2HLPA 2JARA 3V1TC 4HRAA 3CVJA 3H5LA 3PLNA 2XEXA 1DKPA 2Y0EA 3KZ1E 4LSWA 5J5AA 2B7LA 2A9KA 4O5OA 4HYYA 3TTXA 4C7JA 3SVLA 1HF3A 1HTBA 1U0HC 1VXRA 5HSGA 3K96A 1T15A 1T35A 2QQEA 1EFCA 3VHQA 2IVZA 4GZ5A 4HAUA 1E2KA 3FNRA 4AWAA 2I7DA 1X14A 5H68A 1SC9A 3K4PA 3ZY2A 3PDUA 5KWEA 3GV0A 5K4AA 5JS2A 2J9FB 3KJXA 1PNQA 3ZU4A 5DB4A 4RGVA 1DEXA 2YY6A 4ZOCA 5IVPA 5M34A 9MHTA 4WL0A 3VOBA 3LECA 4QPPA 1HV8A 2FMIA 4AR3A 2PIAA 4I66A 4EPXA 5AW2A 4DUZB 1SXQA 2Y27A 1R50A 1GA6A 1UINA 3RVMA 4DPKA 1OTXA 1EUCA 3ADPA 5C8DA 1RZ3A 1N2IA 1OA1A 2XNKA 1QH1B 3EVFA 3VU0A 1S3GA 1NI5A 3P9CA 1Y5LA 1R66A 2HB6A 5KJ1A 4ZPJA 2EL9A 1T5LA 3FSGD 3K8OE 4HLQB 1NLMA 2OBFA 4JUAA 3ED1A 1NURA 1ZI8A 3UJHA 1Q6ZA 3HA3A 1TCBA 3HP7A 3LZDA 4HN4B 4LY0A 3JVEA 2ID7A 2GCPA 3ZKWA 2FZVA 4TZKA 5MGBA 4D80A 3JQGB 1DG3A 5AM5A 4WFN1 3EC7A 3G2PA 4DN6A 4ZI2A 5INTA 2Q4TA 3OVMA 2X1HA 1GCOA 4N3NA 4S35A 4KSYA 4D43A 4OXNA 4ID3A 1U0NA 1YZKA 4FFBA 3WKDA 1QH0A 2B37A 2I7XA 4WNCA 1UZNA 2V7QD 4CUKA 1USUA 2GLUA 1H0HA 1XB2A 4LCJA 3WXBA 3FGNA 4FCCA 2YXEA 1G3IA 1IJEA 1LW7A 1TZBA 2EFEB 4WOCA 3P32A 4MS3B 1FSSA 2REQB 3AETB 3L07A 2AMYA 1OLSB 1BMTA 1CUFA 1US8B 1Y89A 1VPTA 3GLHA 4NJMB 1YE5A 1R6AA 1C3OB 2Q5OA 3EEQA 3NWPA 3O4VA 3OX3A 3SX4A 5ISMA 4A15A 3CURA 3ZQKA 1AGPA 2D2XA 4AS1A 5ARCA 3FW1A 2YWGA 1R0LA 4HX5A 3WWNB 4NTZA 4EITA 2PU5A 4NQRA 2IHBA 3HN6A 4X1IA 4N47A 1PNVA 1UBUS 4QT0A 4HTFB 4KQFA 4TWJA 4UKDA 1JFTA 3EH1A 4N82A 3L0YA 5JS6A 4IDBA 3LI2A 3UC5A 4J16C 5K6AC 1O2DA 3TBHA 2Y6UA 3BZWA 4ZU1X 4FYWA 4G0WA 1WXGA 1SBHA 1GU1A 4J0IA 3QENA 2NZVG 3NZEA 1KY3A 4R1MA 5HJEA 3QLTA 3HCPA 4F46A 4HEJA 1V43A 6Q21A 4D4KA 1GL3A 2AQHA 1GL9B 3DR5A 4I50B 2EWVA 3IDSA 2F7SA 3W2EA 2YH2A 3DL2A 4FHFA 4GLFA 2XCSB 4Z3KA 4DKJA 1I80A 5IK2A 3HEMA 1JVNA 5H3HA 4LHWA 1VKRA 2FX3A 1NWHA 3L8FA 4P36A 1YVUA 1K5HA 1HR0B 1YNSA 2GKSA 2IUSA 4X45A 3QTTA 4IIHA 2FW9A 4UMEA 4PZZA 1P5JA 1VPWA 1EPUA 1JYBA 4A3BL 3IVAA 4RQAA 4XGIA 3M70A 2E4VA 4LJ5A 2GQ0A 4JUIA 1PJSA 2BKXA 3VJKA 3IUSA 4KRGA 3OF5A 1L8AA 4NESA 4G8BA 2HDNB 2VUIB 3S2DL 1O9GA 2CFOA 3C5WP 5FL7D 3UCXA 3BTUA 4LSMA 3PKZA 2AEFA 5T8KA 3U3DA 3Q8KA 1NBMA 3DMYA 3O94A 4XYGA 3ZXIA 4DZTA 2R7KA 2ZTSA 5GAJA 2V3BB 3U4HA 5AXCA 4P5EA 4J7CA 1XJQA 1XU7A 2HO5A 4YFVA 5LYYA 1GGNA 1JHVA 1F06A 4IVQA 2YHIA 3U3KA 2X13A 1B43A 1QR6A 1YVRA 3H2KA 3I92A 4HQKA 4DLSA 5BYAA 2WZQA 1KI6A 3AFNA 4RA9B 3T52A 3PZBA 3FTQA 3T3IA 1XD2A 1YUMA 2XAAA 2ZB4A 2ZRDA 4MKIA 4RCYA 1Y9EA 3SE7A 3W5HA 2BEWA 5K1ZA 1ZK3A 3U3ZA 4G0UA 1QYVA 4WXRA 5FQOA 1VP9A 4QGFA 1QGOA 1MO4A 2NU7A 1KWKA 1MXFA 4UW9A 1YA4A 2I99A 1KH1A 2WWYA 1PI3A 3HOUL 1EUYA 3VNVA 1CETA 4J6EA 1C2YA 4OUKX 2GD2A 1B74A 1ODLA 4ZT7A 2A0UA 4XOUA 1V2GA 2OAGA 4WNAB 1FFBA 1RDFA 1H6CA 2C3OA 5LA6B 3E3AA 9GPBA 4TKLA 3P45A 1VE6A 1ACJA 3LUJA 4OJYA 3FNBA 3VPBA 421PA 4BNKA 5BWCA 3IU3I 1SD5A 5AW7A 4DQDA 4YV0A 4XD7D 3RRBA 4OI1A 4AG3A 3PUVA 4JELA 1K0UA 5AI0A 5IN5A 3M4ZA 3N86A 5B3JC 1RYQA 1BVUA 4KLCA 5I47A 4UBOA 3QTLA 3E22A 5K8CA 3IAAA 3NV7A 1UBNA 3HACA 1GA4A 2J5KA 5BN4A 3JWIA 4QWMA 1Y9ZA 3S29A 3D0KA 1DQNA 2YWFA 3FYDA 1JXAA 4G0XA 2EW8A 3HV2A 5ESWA 2IEBA 1VCXA 1SUPA 3BJZA 4GLBA 1KO8A 1OXXK 1EI9A 2E18A 4EA8A 4L0MA 1N7JA 1SY7A 3BULA 4KFTA 4FYVA 2IU0A 1RQGA 4I55F 5LUAA 3OQNA 1C9KA 2WIAA 4NAHA 3ADBA 4EMUA 5PGMA 4YMIA 4CT4B 1KZ1A 4ZYTA 2P5UA 3OFNA 2R9VA 1ONPA 4ON9A 5LDDC 2G67A 1XRJA 3H5VA 5KDOA 2OMEA 1ZOLA 1R0KA 7AT1A 2P0YA 4CMAA 4H0CA 4UDNA 3FRHA 5CXQA 1OFVA 3WGHA 1J8MF 3TAHA 2QMHA 1A8SA 1RMQA 1S24A 2OKGA 1KRWA 4LXUA 1FLNA 3WAKA 4FYPA 5AFSA 4KIUA 2VTBA 3CEPB 5LP6F 5DLQC 4Y0NA 2XEDA 3DVAB 4DV2B 3WQSB 2HU2A 2JZOA 3LVRE 5GZ6A 2Z2JA 1ABEA 1I6KA 3G0CA 3OJXA 2H92A 3BD6A 2JGDB 3EG5A 3PCTA 3DA8A 2ZYVX 4WEQA 4Z0HO 4C06A 5L9AA 4HQFA 4GOKA 3CLUC 4QRHA 3HXLA 2V74B 2R0QC 4ZU6X 2QUHA 3CJTA 3O8NA 1HC7A 4RLSA 5AQ1A 3I53A 5JD6A 5E4YA 4EY5A 2VI5A 2W93A 5E6SA 4Z1OA 5BY2A 1GSOA 1UJBA 1CF2O 1Q7EA 3WLNA 2NUBA 3T94A 5IZCC 5CDHA 2QV0A 1F1BA 2CHVA 1KYWA 2CDNA 4MUKA 3T5PA 4BNNA 1NPTO 2RKOA 3M6MD 1XVLA 4Q4HA 4RVGA 5J2TA 2D54A 3C3DA 1CQJA 2PGJA 3IE0A 3V4SA 3FVQA 1P0CA 1SQ6A 4DKXA 2CY0A 4U2FA 2GBLA 1ZK4A 2I4LA 4Q16A 4KP7A 1BFYA 2C84A 4N7RA 5A0TA 4L75A 1N5KA 5IUKC 1GCAA 1MW9X 2PGNA 3AB7A 1N2EA 3AERA 1K75A 1QOQB 4HUJA 3O83A 1QJ4A 2IY9A 3NXKA 3AUXA 3IUMA 4Q7QA 4OAQA 4DNQA 1F6WA 2VHCA 3EHDA 5D5PA 3AUSA 3DHWC 4DL9A 1RI1A 3Q11A 4WADA 1U02A 3D3NA 3IKTA 1FVOA 1NN1A 1Q1BA 2I66A 2GUWA 1BOOA 1JHXA 3D6HA 1IEWA 3M4JA 3N5CA 4G1VA 3OBBA 2P9QA 1VZ3A 4MPDA 4TXJA 1I9GA 1MLDA 1E9RA 4HWOA 2P40A 4HHEA 3SEQA 1P73A 3FWZA 1QLWA 2PZ8A 3A9CA 3EZ9A 3IAM6 4MQMA 1SKQA 1AQYA 1Z12A 4N1AA 3SN6A 3CRZA 3QVLA 1O97D 2P35A 3KQWA 4K9QA 3U3OA 4PC6A 2YHAA 3UH0A 4EHFA 1FQOA 1SU6A 1WR8A 4WESB 1PR6A 2ZJ5A 4FHDA 3BJMA 3PE6A 4JOCA 3C3XA 3VMMA 2WWHA 3B3GA 3GLFA 1I5EA 3VH3A 2RHMA 2GAOA 1JDUA 1GPLA 3QE0A 2BHSA 1QX4A 1HKHA 1JSLA 2RBEA 4ENQA 3H3JA 5DT9A 5C8VA 5I45A 4JXXA 3T1HB 2EW2A 3HWWA 3O8OB 1DC6A 1AQNA 1H4SA 1RE0A 1X15A 4JR2A 4UTXA 5LZ4A 3IQDB 5HG0A 3W05A 1LX6A 1FXUA 3L1VA 4NPHA 2B9VA 2HU7A 4K6CA 3JZMA 2QNIA 3BE6A 1K97A 1YB7A 3OPXA 3ZE6A 5EMMA 4RE5A 1UBCA 4JBIA 5C1BA 4CXMA 1JH9A 5EZQA 4KZPA 2W2KA 3SG0A 2VEDA 3PNMA 4JJIA 3R0QA 1Q84A 4ZKEA 3I0ZA 5EFZA 5DEOA 2YV3A 2OCDA 2R6DA 2HAEA 2NZUG 4DCUA 3A9RA 4UOEA 3BXGA 2IPMA 4F8JA 1ZVQA 2OZVA 4ZJYA 3HKBA 4KWEA 5BUCA 2JLQA 2QM0A 1I2ZA 4K26A 1N0VC 1XC7A 1ZN7A 4B4OA 1KGSA 2J31A 2GEDA 2OZLA 4NEHB 3SE0A 3T3DA 5JEDA 2J6IA 3UUFA 2JLXA 2ZQZA 1Z7YA 1BGWA 1ZXLA 3QEOA 4J7AA 4PC7A 3MSCA 5SZJA 1EGHA 4MKXA 3WZ2A 3USES 2ZYWX 5HDQA 3ZWQA 2XTJA 3NHPA 1LPSA 4D8YA 3TI9A 3VC3A 4EUKA 5FO1A 1PR0A 3V33A 3VRHA 1X7WA 2XVMA 2ZPUA 4L9RA 3IUYA 2AYXA 2BPOA 2QLLA 3LGXA 3LPCA 3VMFA 5AUPB 3WADA 2JASA 3P97A 3PP8A 4KDRA 1TMYA 1Q19A 4WMLA 4IIYA 3LFUA 1PR2A 1MOSA 1UFVA 4MQEB 4ZHQB 4PSUA 3EPLA 1NXPA 3KC2A 2PS3A 3KTFA 2HT1A 1SUBA 1P17A 4E7OA 1TLTA 3EPHA 1S8AA 3BRCA 3A4VA 1R4AA 1TTPB 2GBGA 5B1IA 4TMVA 5I7FA 1GDHA 3IBFA 4KNWA 2KKDA 1Q21A 2QMZA 2XUZA 3TCNA 1AGYA 2O54A 1EJ6A 5IULC 1YBFA 3H18A 4M1EA 3JZFA 4DSTA 3GT7A 1T3GA 3THWA 3OQ6A 1R4MB 4FJ1A 2WKWA 3VKVA 4R9NA 1K7FB 2P9TA 2WM3A 4O3MA 5FUBA 3K0CC 2DFTA 2PT9A 2HPAA 2V0NA 1MB0A 3D0RA 1J1ZA 3RADC 2BYTA 2XJVA 3IJPA 1HM5A 2J85A 1II8B 1TCAA 1U5BB 3NB0A 3A6ZA 3E81A 3NEAA 4KXYA 4O25A 1XMXA 4FS3A 4PAQA 3TDMA 4KHPB 1NVKA 4FOOA 1UMBA 2OO5C 3L0ZA 4WAUA 1MX9A 3GA5A 2I33A 4IIEA 2CSUA 2HMTA 4A93L 2NPFA 1GAEO 1YI8A 5CYGA 1F0PA 1E9VA 1EXWA 5HUHA 1Z0IA 3KALA 4D9CA 5BXYA 4MROA 3NVDA 3VZRA 3EVZA 3HPRA 2C83A 3SHVA 3IP7A 5CLIA 2JZCA 3UHOA 1FYFA 1ODIA 2ZIWB 4G8DA 5ALHA 2HFKA 2IRWA 4GI2A 5DWDA 3HB5X 3WR5A 5IMSA 1Q57A 4FR2A 4PLWA 5E1DA 4A3LL 3PHLA 4IWYA 2FDRA 4QZVA 4I1PA 2DJ5A 3NNDA 2UXBB 2RGYA 1PJQA 3B3JA 3GCGA 3CF4A 3SIXA 3VPGA 4NG5A 4JJGA 2AQKA 5IMBA 3TF5A 1LWNA 2XJSA 1DQYA 3QVOA 3RD5A 3G2QA 4B40A 4FDVA 5EIWA 5JZ9A 1ZVJA 1C7RA 4B4KA 4ILEA 3IKLA 2PWYA 4CBVA 1I3OA 1TU0A 3L0IB 5FT9A 3UHFA 2ECPA 1VE9A 2DJIA 3FDIA 2C07A 2OCXA 1BWPA 2GXUA 2VHXA 4P08A 1XL0A 5AHOA 4BGEA 2X9NA 3AM4A 1W5SA 4FB5A 1E2EA 3DEHA 4NY1A 5EE9A 2RONA 1H7VA 1WMFA 3BICA 1GGKA 2NV0A 3UGJA 2KSQA 3HU3A 3Q88A 4HNVA 3TL3A 5ES4B 1VMIA 4A3DL 3N2NA 3WIVA 1QHNA 1XKLA 1DC7A 1P1RA 2N9UA 4FGKA 1JKJB 3K9HA 4GBMA 4ZZ3A 3GDFA 3IVGA 4GMXA 1IOVA 4F2GA 2XBMA 1A9QA 4QUIA 1J8DA 3O21A 4II3A 1GFZA 1OXVA 3W4IA 4EPYA 4JI4B 3P5BA 4UDXX 1HDIA 3U31A 4PLHA 4KCGA 3U61B 5IY0A 2PNFA 3BB1A 5E4JA 2XF2A 2ZTMA 4BMCA 3PI7A 5CAEA 1ZD4A 1C7JA 5J23A 4Z9BA 3ESZA 3GLKA 3K30A 2XUIA 1OHHD 1JDBB 2XSZD 3IGFA 3OT1B 2PVXA 4ESEA 5G1PA 1VFNA 1HDGO 3L84A 1XP5A 1CUZA 3LWZA 1Q15A 2DF8A 1R0GA 4H7EA 4JGIA 4QOIA 4GMKA 3ZUPA 1W5TA 5LZ9A 3NVKI 2VK1A 4ZRMA 2HLHA 1L4YA 5DHSA 2IK8A 3G5MA 5TV2A 3RIXA 3WYBA 5FHRA 4ARUA 1ZCFA 3OLQA 5DNEA 2F1JA 1V16B 3IR7A 3FKJA 3MW8A 2IYRA 4ZYLA 2PFSA 1UBTS 5D3MB 4JMLA 2Z6AA 2B5ID 2AC7A 3QNMA 4XDGA 3TQTA 2CV2A 4O4JB 4ZZIA 4PLYA 1WUKS 2NQTA 3LK7A 5JU6A 3UAXA 4BNVA 1TO2E 4MP6A 2BLLA 4LOLA 3KCQA 5A4IS 4R8MA 4WZAA 4KITB 3L5OA 3D6UA 3Q7EA 2EWWA 3VDXA 3NT4A 2VXOA 1WA5A 2G5PA 3FMPB 1PQUA 4NS4A 4RK4A 3OCWA 3LOQA 4BVGA 5AJVB 1OYVA 2WJ4A 3DTVB 3ZIDA 2VP3A 5JOQA 4ARBA 1KIFA 3WGTA 2ISCA 1GPBA 4GOXA 1GADO 1M6VB 2W2MA 5C35A 4X20A 4IJWA 5DN6A 3LYLA 3ONFA 4YJ3B 2IQ5A 3WRXA 1JHDA 5BYBA 4D8UA 3OEEA 5IP5A 4A26A 5IJ0B 3U1BA 1UPFA 1ZN2A 2J8ZA 5C3UA 2NAFA 5HXAA 2B8TA 1YL5A 4F9FA 2JCVA 1J0DA 3RUIA 5L51A 1F2TB 2VQ6A 4DNPA 3GYBA 2EKDA 1YOVA 1N6OA 4DUYB 1GDDA 5CDSA 4RO0A 3KS9A 1KSFX 1LLFA 2WWVD 1QNFA 1ZM7A 4GECA 1M0EA 3GROA 2X5NA 1CY6A 1QX3A 2G83A 3KAKA 3MOIA 4YJHB 5KTPA 2GCEA 3KT0A 4X95A 2OK8A 2CCJA 2WJJA 2ZVDA 5IDYA 4LMRA 4D0LB 2Z9BA 1MJ5A 3FFTA 3F6SA 3TNDA 3IJRA 1OWLA 2AZTA 3NTXA 2G1PA 3HDTA 2AZDA 1UUFA 3HKCB 4JX9A 3BK2A 3T9CA 4OB6A 4R40A 3C2QA 1NZJA 1E7MA 1Y1WL 2WTXA 4P3OA 4DFDA 3HE3A 4XCQA 3WLIA 4I4LA 1QF6A 2B21A 1CEEA 3EMBA 3DOOA 1IY8A 2ZXUA 1RXCA 3PPXA 4G41A 2K6GA 2AT1A 1QBKC 1K1EA 4YYEA 2W4MA 4BBZA 4AZ0A 2F9FA 4Q01A 3DE6X 4TUYB 3VYUB 3PTZA 2BBSA 2JFHA 1OUMA 2PWPA 5K0EA 2IP4A 3PPYA 4AS2A 4CQLB 1KMNA 1ZDMA 2UVPB 3H2YA 5F5LA 3LY9A 1A5SB 2XYVA 1V3UA 1T24A 2FPKA 2OXRA 4R9UC 5ECDA 2JHFA 1BJRE 8OHMA 5FWXB 1GWNA 3OPNA 5GADc 2I1LA 2OV3A 2C5FA 2R8BA 2UYGA 3AF1A 1U8TA 2XYHA 4ZVQA 2JGKA 1W59A 4LGCA 4N0QA 5CVJA 3UUGA 1NKVA 3WJAA 4EQ6B 5JADA 1IZYA 1KQOA 1RFLA 3GFQA 3GMSA 4TLMB 5JT1A 2GM5A 1EUQA 4GQBA 3C15C 1ADFA 5DYIA 4QM6A 4U00A 3O8CA 5B37A 2XMRA 1Z3IX 4WKGA 1AV6A 3HY3A 4J75A 1J0EA 2PT7A 3SYKA 1BE8A 2YZGA 1GNSA 2I6FA 5LQRA 1YULA 1Z2DA 3I8SA 3NEYA 1YV1A 2JHCA 3QLVC 4FNOA 2PU7A 3IERA 4IRUB 4NZOA 4KQMA 4PG6A 3EOAI 3L8ZA 2IUYA 4MW2A 5JDIC 1SCQA 1T2DA 3H1GA 3PVZA 4RVSA 2X0EA 5CJJA 3TINA 1AQUA 2YRXA 3KZCA 5IUNC 1LXCA 2P0AA 2PUJA 3KYVA 4EHNA 3OZDA 4LVOA 4PS1A 3SEAA 4J9UE 4KGXA 5BSTA 3FHLA 5F78A 3WRWA 2O2XA 3IV9A 1IOWA 3IBCA 3RIGA 3LBYA 1YASA 3D8SA 2CNLA 3VKGA 3KVRA 1S9DA 4H18A 3HSYA 1U28C 1V7CA 1JPJA 2GKOA 2QD4A 1FX0B 4LBVA 1AS0A 4L9WA 4XR9A 3JS5A 4WGGA 3U17A 1JEDA 2GD6A 4GAEA 2WQ7A 3TLJA 2PZEA 3QU4A 5JNSA 4E30A 1MORA 4XWYA 2ZJZA 4FFLA 4P3YA 1VHWA 3H6KA 2CDBA 5GTDA 2WIFA 3T7JA 5AVSA 4QRIA 2H4WA 1KP9A 3CN7A 3SZOA 2B8EA 4DB2A 2QZPA 4Z7QB 1GKLA 5M29A 1Q77A 1M0SA 2CLCX 1KDZA 2QX8A 4W5NA 3G0IA 3CGGA 1HDEA 3OOHA 4HDRB 2ZCVA 3ITNA 1GRNA 4WKPA 5CPBA 2WNSA 3FJOA 2CXUA 3KUXA 2AH5A 3AUAA 3LQYA 2ID8A 4OP1A 5EXSA 5AW5A 1USKA 4XAQA 1E9SA 2ASEA 2CXRA 3D64A 4Q39A 3HADA 1E1CA 3KZOA 2WNHA 3OEWA 5H80A 4FX2A 1BA3A 5H9VA 2A69D 2W9XA 2QTNA 3H2JA 2NLOA 2JDID 1J9EA 3A7DA 2NVTL 2P4EA 2NUPA 5J2TF 2WABA 2H06A 1PAUA 2NIPA 3T95A 5I51A 5K8LA 2EERA 5ERYA 4JB8A 4UATA 2C2OA 1ZU5A 1ZGGA 1UZMA 4JZKA 5BSRA 1Q91A 3L92A 4AXBA 4IJ5A 1N34B 3EF1A 4IDOA 1EDOA 4YR7A 5LQCA 1G60A 5LP6C 5H9WA 5DI3B 1AMNA 1SKMA 2WHRA 1J00A 2DBRA 4OLJA 2ECQA 5CXXA 2JH8A 3LOPA 1C81A 2FDCA 1WXWA 2OESA 6RXNA 3PXUA 1PL6A 1VL0A 5HRUA 2G8LA 1RHQA 4NI5A 5IYDL 1VIAA 2DLNA 2CFIA 1N2ZA 2DPXA 1E2DA 1KTVA 4QU5A 4TMFA 2DR2A 4M53A 1Q12A 2ZZKA 4HMQA 1LU9A 2QVLA 4JLJA 5JYEA 3WLJA 1D2AA 4F38A 1KL7A 2VN8A 4JLPA 3QXSA 1FW6A 3PNKA 2HBYA 2OM2A 3R3HA 2BHRA 1DS6A 1TTHA 4INZA 3OMLA 4OCZA 2ONZA 3SNKA 2NT3A 5BSWA 1XLTA 4EG6A 3G85A 4K9LA 5E3JA 5E6UA 1YQXA 1VBFA 4X6UA 5F3WB 2PWZA 1DUSA 2XIQA 2YJ3A 5FO0A 1JLRA 4C7KA 2QRGA 5IJZA