3FDJA

The structure of a degv family protein from eubacterium eligens.
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
276
structure length
276
Chain Sequence
AMRLVADSACDIKELRGMVFKAVPLTISTDNEEFCDDGQLDIHRMLDILEKHKGRSYTACPGIDAWLEAFGDDDEIFVVTITAGMSGTYNSAMAARAVYLEEHPQAKVRVIDSKSTGPQMRIILEQLQQMIEEGKKFEEIDGAIDAYMQKTRLFCSLKSLHNLAQNGRVSKVVASAAEVLGISVIGTASSHGTLEAIGKCRGDKKLLVKLQALLDDAGYEGGKLRICHVENEALADKIADMIKQAYGTTDVCVYKAGGLCSYYAERGGIILSCETK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DegV family protein
publication title The structure of a DegV family protein from Eubacterium eligens.
rcsb
source organism Eubacterium eligens
molecule tags Structural genomics, unknown function
total genus 91
structure length 276
sequence length 276
ec nomenclature
pdb deposition date 2008-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02645 DegV Uncharacterised protein, DegV family COG1307
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.50 Mainly Beta Single Sheet Rubrerythrin, domain 2 degv family protein 3fdjA02
3.30.1180.10 Alpha Beta 2-Layer Sandwich Hypothetical Protein Tm841; Chain: A;domain 3 Hypothetical Protein Tm841; Chain: A;domain 3 3fdjA03
3.40.50.10440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Dihydroxyacetone kinase; domain 1 3fdjA01
3PL5A 1VPVA 3FYSA 1UOEA 4LRYA 3JR7A 4LRXA 4X9XA 3PNOA 2IU6A 2IU4A 1PZXA 1OI2A 3PNQA 3PNMA 3PNLA 1MGPA 3CT4A 2G7ZA 3LUPA 1UODA 1OI3A 3NYIA 2DT8A 3PNKA 3FDJA
chains in the Genus database with same CATH superfamily
4U8GA 5ULLA 1EVIA 4Q3KA 1UJ5A 4U6NA 5DSXA 2TECE 4X1IA 2C0QA 2I78A 5ALHA 1XVAA 3TOSA 2ZLBA 2GBLA 1RWVA 5AKGA 1M0SA 4L8WB 3B3GA 4G84A 3RFXA 4N1AA 1PJQA 4AUEA 1T36A 2G72A 3JZDA 3VOBA 1PW7A 5ADHA 1RZRD 5KPJA 2JF0A 1IWBB 1I2DA 3I9MA 2BEJA 1KBZA 1K27A 2FCAA 1U81A 2O8NA 3MQ2A 3QW4B 1ODSA 4MQBA 3VZQA 7REQA 5LOVF 1G7RA 3NOXA 4EUSA 4B3TB 2HADA 2AW5A 1ONPA 3WY9A 2O5EA 1YQ9A 3PDUA 1O97D 1ATZA 3ON5A 1HBJA 4ZOEA 3F9RA 3BXGA 3VUFA 1GA4A 3KAJA 1PRYA 3QVVA 4HNAA 3BXXA 2OO3A 4GIBA 5JNRA 1ZNXA 2DWOA 1J8DA 2QGZA 2JEOA 3I9V6 4FYYA 3FVWA 3CLSD 5AXCA 3LU1A 3W1EA 3LC2O 3FHCB 2Z30A 2Y4NA 4D8XA 2GO1A 4QJ4A 3LBHA 4M83A 5G02A 3U7EB 2O8FB 2PKXA 1VKOA 2VP3A 1BX0A 4HPXB 1RLMA 2RHBA 1E9RA 2WHXA 4X8HA 3ZCSA 4E15A 5E9JA 4LY3A 2J6HA 5FJIA 4K9DA 1RI3A 1YJ5A 4MUFA 4FS3A 3AHGA 1O0CA 1NQUA 2XRMA 3K0KA 3SMVA 4C6HA 3NPMA 4PQFA 2VHWA 4YIHA 3MBOA 2GKGA 4UOQA 4Z0NA 2ZR0A 2XUZA 2HCTA 1E6LA 3NFYA 4FKZA 1NBAA 4G26A 4H59A 5G4KB 3SM3A 2GA9A 3HFRA 5JPCA 1XO1A 3AW8A 2ZPAA 1GUDA 4JBYA 5EINA 2O19A 4X65B 4LVNA 5G53C 2ZT8A 1B73A 3FGNA 4AR6A 2WHYA 4C2UA 4RV4A 4HNRA 3THOA 5J4YA 2O3JA 4BN4A 1J8YF 1ZRSA 1IPFA 2EYQA 1JLSA 2PGIA 1WB5A 3HRHA 3M6AA 4IVRA 4QQ8A 1L3BA 1YB7A 1ZS9A 4ZZ2A 5LZ5A 1YA6A 4FVTA 4UCQA 2NZXA 2Z1NA 4ZO4A 5ES3A 1KDPA 4ID3A 4F04A 1QIFA 2D74A 1N9GB 3BWCA 3L7CA 5U4XA 1EP9A 1Y8QA 4WWHA 1R0SA 3KTFA 1SKMA 4ZVNA 4C0JA 1KR2A 2A5JA 2BGKA 2HA6A 1SXGA 2BN4A 5K3AA 1XVIA 1BGXT 2E49A 2ZRQA 3P4UA 4UOZA 5JJ5A 2OXCA 3DDHA 3UKJA 1IU6A 4J0FA 4B74A 2Q9AA 1O94A 2AR9A 4IQ0A 1XZJA 1EVQA 1AJEA 2DFNA 3BL8A 1ECLA 1VYUA 4CMIB 4AZVA 1USIA 3T5DA 4F3YA 1AOXA 2O8BB 2R87A 3WNZA 3OQMA 2Y1DA 4RMIA 4I2NA 3FJYA 1SBHA 4Y67A 4BO8A 2P3LA 2A9FA 1HG1A 1L5HB 2P1DA 1P33A 5LZ4A 1F3LA 1O95D 3OH8A 5K51A 4BQQA 5FX2A 1BU5A 3IIEA 2RJ3A 4B34A 3UF0A 3LCUA 3U7QB 1E18A 3P2MA 3KJXA 4NSNA 2VYNA 3QY0A 4FFDA 4HMPA 4WCVA 3L0IB 1KOJA 3PNKA 5IJ0B 3WMWA 4GE0A 5DM71 1NPYA 2DY0A 2R62A 2QN1A 4BVAA 2EFCB 1A5AB 1MABA 1N2HA 3JU3A 4MWTA 3H9CA 2QMZA 4PYJA 1K2VN 4MARA 5LPNA 3P0HA 4YDRA 2PZLA 1ZC3A 4URHA 1CY1A 4AJ4A 4ZIRA 1I8TA 1ESEA 4K05A 3GEIA 4AY5A 3OT4A 3PDWA 3I09A 1JE0A 3I9OA 3QEMB 3W78A 3OJCA 2WFLB 3RODA 4DAOA 2HA3A 4KIJA 5MGBA 4W5QA 1WHSA 2VSNA 1U7ZA 4RETA 4JBLA 1T9OA 5DO9A 4BJ1A 1KAOA 5MN4A 1IBLB 4XYGA 5CLFA 5FOXA 3OPVA 3HE3A 1E60A 4RK0A 1GRVA 1PWHA 4X8MA 4KLZA 5IJWA 1U0SY 3I5YA 3DA8A 2QXYA 4NH4A 3DV9A 5GJVC 2NXEA 1TK3A 3P9NA 3DMRA 4UBLA 1JWAB 1XTTA 1VI5A 3EXEA 2Y0DA 1GU0A 3G8DA 1E6KA 2QYSA 3I01M 4NX2A 5KNCD 1VGRA 3HCAA 3WWLA 1KVSA 2Z4SA 3LCCA 4FZJA 3SKXA 3UJ3X 1NQ5A 3H19A 4UBMA 2WVAA 3BCUA 4JL8A 2OHFA 2JIZD 1QJ4A 2VAPA 4YRQA 3KB8A 4OHMA 5DSTA 5AVWA 2R6ZA 4RCVA 2GVZC 3PVCA 3L8EA 4BUJA 4G1EB 1ISPA 3M6FA 4M0FA 1M6YA 1ZK3A 5DCYA 5A4KA 3ES9A 1XF1A 4IJMA 2P4UA 3Q0TA 1X9IA 4HUQB 4EGAA 2IOFA 2P4QA 2QP4A 4QHSA 2BLNA 1Y7HA 3D43A 1NU6A 5DM2A 2DQ4A 4NEHB 3WKAA 2J3MA 1DC7A 4UM8B 4LBYA 5K3FB 1VE7A 2RGNC 4QRIA 3ZGZA 5FRDA 2I4IA 4RSHA 4JI6B 3ONNA 1AKYA 1RLTA 3Q3HA 1MJNA 2EJWA 4MVCA 1GZ4A 5KYWB 2JLBA 5K0NA 1UANA 1A8QA 2OP1A 2IYPA 3FIJA 4LTDA 4C76A 1EM8A 3PNYA 1J7KA 1WMBA 1GFWA 2P9CA 3K1JA 4JD5A 4FNOA 1LVHA 2G1AA 5KS2A 2XUIA 3GRUA 4D6XA 2VA8A 5FJJA 4R1QA 4BMOB 4PR3A 3RG2A 4CN9A 4EQ6A 2DTEA 5KNBH 4XUGB 2VRBA 1W8DA 3I42A 1Q20A 3K05A 1SB9A 3M6MD 4IFBA 2IUUA 4AJLA 3IILA 4AW9A 2AN3A 4OJYA 5DP2A 2P2CA 5BSHA 3KSRA 1G2IA 1MX9A 1KZGB 5IJ9B 3A0RB 4F46A 1JJ7A 2E2WA 4LCEA 1KFJB 4RADA 4Y2SA 3ORSA 4YWMA 5JPIA 1J5PA 3O7MA 4UHEA 1D2AA 4X1OA 2MYNA 3WKDA 2GPTA 4Y52L 1BWQA 1GCOA 3GRVA 5DHRA 3RU2A 4ZI7F 4BFSA 1QV6A 5I9MA 1GG5A 4IDCA 1R18A 4MWCA 3DQPA 2C78A 5JWRA 4CYMA 3KEFA 4K9QA 4REOA 1TVEA 5F3WB 5JRZA 3EGWA 4OXNA 3ETLA 3TBKA 4MZXA 4NEQA 5J5VA 3T0IA 5E95A 4ENSA 4CV3A 5KNDA 1O96B 4XCQA 1JSRA 1L7OA 1P73A 2EDAA 2Q1TA 3PEUA 1J5EB 4YWLA 1MTZA 1R9JA 4WA7A 5HFAA 4PANA 4BMVA 2PL5A 2NT4A 5KYYA 5MFZA 4BECA 1BHQ1 4Q05A 5KZMB 5K05A 5EJMA 5J47A 2CDCA 1FQJA 4JL6A 2P1ZA 4Z6KA 2GDZA 1ZDMA 2HA7A 4C7OB 1Y7PA 1DC6A 4JC0A 3RHFA 5K5EA 1CVIA 1FW8A 1KJYA 2WHPB 4MEAA 4AZ0B 3SBXA 2PSFA 2PVXA 4XVHA 3PR2B 3E48A 4K0RA 5AVRA 3ZW9A 2EL9A 2WSBA 4GFDA 5G0TA 3BB1A 1CE8B 4EUKA 2CZQA 3RSFA 1YBAA 2NVOA 3WO1A 4HD8A 2DY1A 4B85A 3DMFA 2WNSA 1CDZA 3P45A 4MKHA 2VL6A 2WT8A 3T9EA 3FBWA 4EG4A 2FUG1 4GYWA 4LX8A 1SCQA 1WCIA 1GFSA 2X1LA 2FGJA 3DDSA 1YUMA 3M33A 4TZKA 3K15A 1PR9A 2IH5A 2OLEA 1PU2A 1FU8A 5AKYA 2OZEA 1PQUA 1PV2A 2J9FB 4HX2A 4MR7A 4LHYA 4A3GL 2GB4A 3QTTA 4BBJA 1E94E 3A14A 3PF8A 4UKDA 5BQPA 4DJEC 4C0KA 1BSVA 2BMAA 2GCNA 2O7SA 2XT6A 3EGDB 3KTAA 1MUUA 2C5AA 3QE4A 2WUWE 3OM1A 1XF9A 4RZXA 2NN3C 4Y6PA 3AI3A 5TMDA 3BWVA 4Y2HA 1QQTA 5A0VA 1ZO8A 2O48X 3TTYA 1BYUA 1B23P 2AK2A 1Z5ZA 3NBUA 1AUXA 1RPNA 4RSRA 4ZAWA 4LV5B 3CSUA 1PR2A 4HWKA 2Q3LA 4BGUA 1XAGA 3ZCRA 3ND7A 2LP4Y 3GOHA 4NBTA 5DLYA 4R68A 5EUCA 1R4MA 1ODCA 3FSGA 3ENQA 1T5LA 3BWMA 3G2PA 3GBSA 1ZU5A 2PPTA 3EG9A 3NV9A 2A0XA 3FNHA 4BMNA 3HXTA 4MA4A 3WRWA 1IVYA 2E5WA 3OZEA 3A1DA 1GZ6A 5CJJA 5KJFA 3CVVA 1R0FA 1K8YB 2JJ1D 4HWSA 4A3SA 3PF9A 4EHKA 2BRUC 3COJA 3KCNA 5ESDA 3U9TA 1JA1A 1T2DA 3NTQA 4FMDB 1VBKA 2YV3A 4M9SA 3A6DA 4LEIA 4V2UA 1RKVA 3KOYA 2HJRA 4FE4A 4BUZA 1WMSA 3KLBA 1Z4JA 1IXSB 4CIDA 1FK8A 4IZOA 2WT4A 3ZWYA 3JYNA 1N1MA 2H7CA 3CWZA 4UFNA 2QN7A 5FUWA 4JI0B 3BTUA 3C45A 1EP3B 5DNWA 1VZ2A 4JMPA 4ARCA 4OI0A 1IK6A 3VVMA 1WTAA 4CTJA 4CU2A 2YCBA 5JFTA 5L4LA 3LF2A 3BTSA 4R8KA 1EEHA 4ZN3B 3VJMA 2RC6A 4C3UA 1VHTA 2UYGA 2WKRA 4D9EA 3JD3A 1ODKA 5HZMA 3SNKA 1E6UA 1Q6ZA 4G01B 1RWBA 2RGCA 5E7MA 3HXLA 2IHVA 5ALLA 4JOSA 2PA0A 1J9EA 3SFVA 2FA9A 2E6UX 4RGBA 1BOFA 4EVRA 2PIDA 4MWBA 1KP9A 3GO4A 4LHEA 1F6BA 1TMOA 2G5PA 3OT5A 1TTQB 2ATXA 2D59A 1EE2A 3QKSB 3EE6A 2OAGA 5IYZF 4HEJA 3AEYA 4QD3A 1TVMA 2XWQA 1Q0PA 3M2TA 4E70A 1Q0UA 1PDVA 2M1XA 1CT9A 2WAMA 3V97A 4AKGA 1DRWA 3QLUC 5L3RA 4HEA1 3SC6A 3AUUA 2VHVA 4A03A 1KZ4A 2O8VA 2IXAA 1FFHA 3C1OA 4FQ5A 5FOSA 2GFQA 5KDDA 3HUEA 5M2QA 2H17A 4L5YA 4GLOA 5BSVA 1IJFA 1C1XA 5I8PA 1CZNA 1PEYA 3ABQB 1KVRA 3FKIL 1VJTA 1Z5VA 2EQBA 3RD5A 4CL0A 2P4EA 3NP7A 4XFJA 5E2IA 1QG6A 2JVKA 4XX0A 1XEXA 4ZGBA 2DBQA 5IAAA 1L7VC 4MP8A 4Z1MD 4GR5A 4NU6A 2C31A 4NLLA 5FUYA 3ESYA 1DJNA 3MGCA 4LXXA 5CB4F 4NJEA 4P32A 3JD2A 1TMKA 4NG4A 1CBUA 1Z5UA 2XGSA 3G2IA 2BZ0A 3QX9A 3S8EA 1EFRA 3HM9A 1EX1A 4DV5B 2GEDA 2YXLA 1HK7A 3VDXA 4O4JF 5C18A 3CKLA 1J8MF 2CWWA 1DFIA 1JBKA 1RT9A 4QXQA 2WWIA 4N8EA 2OOSA 3C3AA 3NC1C 4JKIA 3UQZA 4EZBA 3UJAA 1NW8A 1WU8A 3L06A 4PZZA 4CQMA 4GW3A 2VJLA 2IH2A 3PUJA 5FIUA 2XRFA 1MFZA 1DVRA 1ISHA 2QRUA 4UCFA 1E79A 2ZXFA 5AW7A 4BX0A 4DA8A 4Q7EA 1IXKA 1J9GA 5TQ2A 4DQ0A 1Q15A 4C0BA 2GCIA 1GL6A 4JSYA 3WWDA 1U5CA 2QKYA 4X1YB 3O8NA 4F5ZA 3IB6A 4DDVA 5AM1A 2PMBA 2CYAA 3GT0A 4MR9B 2ADFA 2PWBA 3O31A 2DGDA 2SKCA 3C6YA 3OOSA 5IT4A 5F3DA 4GEGA 4D9CA 3E05A 4XX1A 2VKQA 5TSDA 2Z2IA 2O2JA 2I1WA 5JC8A 2VTDA 4GMFA 2FSVC 2HGSA 3TIIA 2M4VA 1QP8A 3K6KA 3MJ4A 3NDBB 1GPNA 1GY8A 1E3MA 1IOVA 2C9ZA 3R1IA 4AL4A 4F6LA 4KVAA 1Y8AA 2XUAA 2J9UB 2B98A 2BBOA 3GUCA 4HUJA 5E6RA 4LJKA 4K81B 2PLNA 4BFYA 2NSJA 1G6Q1 3GFOA 5CUQA 5F78A 3RC3A 3ZHXA 3CPJB 4JOCA 4BO1A 1KAQA 1WZCA 2ZT6A 4L6CA 1I4DD 1QQ5A 1R0KA 3A1FA 3A6HA 1WV1A 4KXMA 2C2HA 4AJHA 1CRPA 1UC8A 1T6YA 2AJDA 2WJPA 3S2GA 3K9NA 4I08A 3KSDO 4UNSA 3GGDA 3DBLA 4IIUA 3S8MA 4KTVE 2A5YB 2XMGA 4EJ2A 4EZIA 1RWKA 1SZDA 5F33A 4UCWA 5JVH1 2EHDA 2G0TA 1JDBB 4GM1A 2GZMA 4RFSB 3GLGE 3AVYA 3V34A 1ZPDA 2HYIC 1WAMA 5HQ3B 1GDHA 3RAGA 2VWHA 2NZUG 3WBBA 5DX8A 4U9UA 2FRDA 1BS1A 3TQSA 1EUYA 1QDEA 3RWBA 5JV5A 3G6KA 3LY8A 4QU0A 1TDJA 3TSOA 4OYHA 1D4AA 2YS6A 3GIWA 3V1NA 4XM0A 4BNJA 5LXTB 4MYTA 3WGQA 1O9GA 3JQFA 5BSUA 1JUDA 2VH1A 3BMQA 3L1KA 1TTTA 3N0VA 3TF5A 5KNDH 4O3FA 1EDDA 4Q24A 2I7DA 3QX8A 1H6CA 5A62A 3O9ZA 1NR1A 3IE1A 4I1RA 4KQ2A 3TXYA 2J41A 2JGDB 1JZTA 3W04A 3OIUA 1Z29A 3A1TA 3Q5EA 1M8GA 3KJZA 3A11A 1SK8A 4KSYA 4CIYA 1NWCA 2X7JA 5EWJB 1OI4A 2M6PA 2JVJA 3Q6MA 4TYNA 5ITVA 1QBGA 2DRIA 2HHAA 4DFDA 4RTPA 5KO2A 5G1PA 2C5GA 3M82A 1VYVA 1YVPA 2DLNA 5SY9A 4PWYA 1V9SA 4Y0AA 3GJYA 2WWRA 4GI5A 5C81A 2C42A 3BE5A 4BMPB 4P0QB 1Y63A 2Y1FA 3AM1A 3MSUA 3DOCA 5JD4A 1U3CA 3SWWA 4B4KA 3FYUC 4C0HA 4ZANA 2Z1DA 1E7YA 2W8ZA 4PO3X 1EAYA 4QLOA 4EBBA 3TIXB 1I3KA 3GLGA 1FFGA 3CXUA 3K9QO 5JY1A 4H9GA 1AHNA 2BCGY 3QVKA 2CSXA 3NRJA 5JIBA 3RC7A 1IOWA 3D5EA 1T9GR 4KI7A 2ZSEA 4E46A 3GQBB 4WBNB 1QCZA 3H2JA 2GAJA 3KOZA 1QFSA 3UUEA 1E3DA 4ZGGA 3UMMA 4DCJA 1XCJA 2PGLA 3WQBA 2Q29A 4PR0A 1MNAA 4IHJA 3WP0A 4PPFA 1EFTA 5GZ3A 3W3AD 3IOYA 4GMKA 1ZIDA 2B2NA 2HFJA 3CFYA 3JQ6A 5JVDF 2O8DA 1M2VA 2OGTA 3H3JA 3PVSA 1R2QA 3BE6A 3ZY3A 1MAAA 4L8LA 2QTGA 4UM9B 1THZA 2FZLA 3EA0A 3HDGA 4IXWA 2JAXA 1FFWA 3K7EA 3K96A 2VHJA 1MEJA 1Y5IA 3GJ7A 4WKGA 2IYFA 1GT6A 3M83A 1E2HA 1X7WB 5BQFA 2GZ1A 1IN6A 5M5YL 4QAJA 1CY7A 3OZBA 4Y9UA 5DJ5A 3DW3X 1TW2A 4HLDA 4YT4A 4E21A 4UEQA 1IAQA 2IZ0A 2HBQA 3PI6A 3WA6A 4DLTA 3MWDB 4I5EA 3SZLA 3HBFA 4RDXA 2OORC 2JRCA 3QVGA 2C58A 4OOFA 1T2VA 3DB1A 3K70D 5J58A 2OGSA 1EXNA 1YE5A 2ZGVA 1V11B 3RFFA 4XYMA 4F91B 2OVBA 3HACA 3U3RA 1Y7LA 3FPFA 1DFHA 2LD4A 3AKYA 4XJSA 1JQ3A 4D42A 2YVAA 2OPBA 5TVKA 2TSYB 3B51X 1O7JA 1QLJA 2FMXA 3GLKA 1RI5A 3QMMA 5J2UF 1YGYA 4I36A 2G4VA 1NRWA 2P4SA 3D2AA 5E2AA 2VHTA 3LQ2A 4I5IA 1ZIPA 2E1RA 2HJHA 5K45A 4YY3B 4K87A 5ALQA 4EUNA 1ABEA 4KQMA 4UHDA 1LLDA 3TLBA 2HL6A 5KTPA 4TYQA 1IW7D 3DNFA 4BBZA 1U3WA 3BZBA 3DZHA 4P7FA 2ACVA 2IRWA 4RENA 4RHUA 3PENA 3VZSA 2PCJA 4OG2A 1QTQA 4EHBA 3V80A 1T9GS 1V2GA 4NFHA 3MGKA 1ZR2A 3OJWA 4PHGA 1TEHA 4CF6A 3SJUA 5FH9A 3WIBA 2PUDA 3COSA 4NU0A 1OIXA 2DMRA 4F4FA 4RQTA 4WE3A 2C9CA 1S3FA 1RADA 1JR4A 3DMNA 3GXBA 3T1VA 3T7CA 3EC2A 5FTMA 2W4QA 1WD5A 4COOA 1W48A 3JATA 2B20A 1L0BA 4I55F 4LAFA 3LFHA 5DV9A 4A8JA 2ZBRA 3N8DA 2ZB7A 3NWEA 3SQLA 3IUJA 2CNWA 4JYPA 3R44A 4K6CA 3OJLA 3E7WA 3PXAA 4J9VA 4L15A 4W5RA 3ZZ0A 4FIZA 5T8KA 3VR3A 1S6YA 3SN6A 2O5CA 3FUCA 5A1JA 4V1CI 2QW8A 2E4YA 5C8DA 3C16C 2AKYA 2F8MA 3BJZA 3DTNA 2HDHA 4LCJA 4N8SA 1CHNA 3KUUA 3OLWA 2F3QA 4IV8A 3VKUA 5BR4A 2P2DA 2W43A 2Q3JA 1XU7A 3AI1A 4QUKA 3RTAA 2Q5OA 1R5BA 3I53A 3KT3A 2DX7A 4K1LA 4AHYA 1X7YB 3LVQE 3L8GA 4RD0A 4AIIA 1G20A 1LPPA 1RYEA 2YZNA 2WFZA 5HP4A 1ORVA 3WNVA 2XD9A 4KREA 2FR8C 3HVUA 1C1DA 1YZFA 1ZGGA 2IDZA 4EEXA 1TLFA 1I4TD 2HRRA 3O21A 1M67A 5CX1A 1JW9B 1U0TA 1VCIA 1VRVA 4HDNB 3ZNPA 2PQMA 1C2TA 4QEKA 3KELA 5EVJA 2DR2A 4CKWB 3IKVA 4JVSB 5DE3A 2ODWA 4UVEA 2GK6A 4RU1A 4WINA 3ZH2A 5CMLA 4YRMA 5KPDA 3RGWS 3NR2A 2ECKA 3WAJA 1RI1A 2G88A 3C85A 4PYNA 5HZGA 2P6NA 1LC3A 2ZUWA 1V1RA 1Z08A 4E5SA 4IR7A 3B3JA 4ZAFA 3TSCA 5IDVA 2M6SA 4M7OA 3EIUA 5IN5A 3N2LA 4NYIR 2Q6OA 1JNYA 5J2TF 3VBEA 1F9AA 2LBPA 3PXDA 4L5IA 4AZWA 4BGVA 1W36B 2AG5A 2C07A 1MDBA 3RO7A 5FWXA 3FWZA 1DL5A 3PUHA 3PTAA 1E9AA 2GJKA 1N77A 3C1UA 4RVDA 5ALKA 4D74A 3K30A 4R1PA 2IIVA 2XTNA 4DMKA 1TT5A 4EW2A 2QSUA 3K7AL 1QFXA 3DGEC 4L5JA 3G9UA 4BMXA 4BPRA 4CMEC 5HRCA 2CYCA 3P9YA 5M29A 3IEMA 3BS4A 1SUAA 1UMCA 1V8DA 4P2GA 3WRYA 1J9ZA 4ARUA 2JARA 3HA7A 4DEXA 4FN5A 1DPFA 2BSXA 2VSOA 1GQFA 3D81A 4DEYA 3K16A 3ZZUA 4EYSA 4ICIA 1FQKA 4DBZA 1YVEI 1V37A 2BFPA 2OFXA 3DFUA 2Z2YA 4GKBA 4PGHA 3ZLJA 4FEGA 1R88A 1JDSA 1BMFA 4OGFA 3HJWB 1IK4A 3I76A 4N0MA 4A73A 2PSSA 2ID7A 4BTLA 4DV6B 1ND6A 2WYIA 4QEZA 4NZ9A 4BFCA 1ZQ1A 3RJTA 1BG6A 1E1CB 5TS2A 2YWGA 4EFKA 5B64A 3ZCUA 4NVRA 3NHSA 4K9NA 4EJSC 1KQGA 1UZLA 3F73A 4XD7D 5CR9A 2R1VB 4JUCA 4NFYA 3PXGA 4YRSA 5CDSA 4YMVA 1QG0A 2VPTA 3HR7A 2AUSB 4ZGWA 3N7TA 5IJZA 5D5PA 4KKXB 4QOEA 1PJLA 1GXSB 4CJXA 3D2CA 3EASA 3FF1A 4LY6A 2ZATA 3EPHA 4FGUA 1M34A 3EUWA 2ZYUX 4J3NA 4F11A 2ACEA 1PLLA 3LBAA 2VYND 4Q39A 3WA7A 3PDJA 3GLSA 1Q11A 3CBGA 4DV3B 1QFJA 3HCPA 5FPQA 2P3OA 1NVKA 1FP6A 2AV6A 5G0VA 2GCOA 1BDIA 1B2OA 1BNCA 1D6NA 1OE0A 2R4UA 3JZIA 4ZHQB 4MMYB 3W5SA 2VS1A 3KOWA 4J1TA 4WZ6A 4BLVA 2BW0A 1W49A 3JYPA 1B00A 4A3LL 1MT0A 2QUBA 4Z9BA 1N1DA 2W90A 1E3WB 2WF6A 4A3EL 1JKMA 1LBHA 4FGJA 2AF4C 3ETHA 1J90A 1MA0A 1Y5NA 3D7SA 4FX5A 2PS9A 5ECGC 2ATIA 3TZCA 1DIAA 3K5WA 2HJ9A 4QU5A 3ACBA 2NVUA 1JDJA 1F48A 1OI7A 3AQ4A 3M1YA 1JL3A 2PX5A 3IDQA 1CUSA 1QUFA 1JQEA 1IM8A 4R84A 3JVUA 4UD6A 3BWDD 5JJKA 4C1BA 5DU2A 4LJ9A 1YJXA 3K9WA 3SR4A 2O05A 4IDEA 3I5UA 4KV9A 4HR7A 3A32A 3TR6A 4BKRA 4LI0A 1UOEA 4H7DA 1JFSA 3L7YA 2VLBA 4N8DA 1A4IA 4PC7A 4XASA 1XZDA 4ZAYA 1JJVA 3ZTTA 4AO6A 1N6LA 2GD6A 3R6LA 4IIJF 4QGHA 2MINB 4TL8A 1YGPA 2XGOA 3CMMA 3CZMA 2QRKA 3KHTA 3KXDA 3S2IA 3KSAC 1G18A 2JLUA 3DBRA 3TRFA 4B3CA 4DMUB 1FZQA 3G1UA 1Y9ZA 1UC9A 3WQSB 1UC5B 1V8OA 1JHVA 3HB1A 4FI3C 1JQ5A 1NMEA 1MOPA 4G23A 1AT1A 3OEYA 2VHUA 3PIIA 1PLKA 5AKKA 1TECE 1JLKA 5DM0A 2IYAA 1GU1A 4GF5A 2AMLA 1YS7A 5K0LA 4ZYTA 5T5QA 3ZD8A 1H4VB 1CSEE 3BK1A 4J94A 1J7JA 3FRHA 3GZNB 3RZDL 1QE0A 1UBKS 2V3WA 4L9AA 4R83A 4HNSA 4RM2A 1YONA 4RUKA 5CH5A 1PTJC 3RGGA 4K2AA 4AZ3A 4IXMA 2GCPA 5EKTA 2XGJA 3DO6A 1GGMA 3I4ML 3M34A 2AE2A 1O9BA 4WACA 4DUYB 3FD8A 1KMNA 3I45A 2IYEA 3MCWA 3P5SA 3Q72A 3TPCA 4DNFA 1RQXA 1UKCA 4EKGA 4JV5B 4V02A 1S2NA 5BORA 3M7IA 1XLTA 3ZHCA 3HBLA 1L1FA 5SY6A 1LV8A 2Q4TA 1M2KA 3E22A 3T1OA 4YCCA 3A2LA 1JJBA 2ETXA 4ENUA 3E03A 3GLFE 5AW3A 1GARA 3DR3A 4W9NC 2NYRA 2WNIA 2JA5L 3CTPA 1NPDA 3AB8A 4PC3A 3O4IA 1XSEA 2FV8A 3Q10A 5IVPA 2XUGA 1JR3E 2OV2A 3LDAA 1JXAA 1VIDA 3STVA 3I2GA 1P2VA 2CLCX 1TUGA 5FYQA 3RUAA 3RV4A 1XRJA 3I3OA 5BUQA 4MKFA 7MDHA 2FK8A 3NHYA 2OYRA 5DOZA 5KSOA 3BTOA 1OZHA 2NPOA 1FBTA 1Z37A 5AM2A 2E85A 4GP6A 1WZIA 2D3TA 4LDNA 3PEYA 3G6WA 4DJFC 3SJCA 2ODQA 5B1SA 3IVCA 3AM4A 5ALWA 5AKIA 3SIPA 3DAFA 3SLRA 3ZHUA 4BX8A 4JSRA 4Q1AA 4XPZA 1SVMA 4Y0NA 4E5YA 5A02A 1F8GA 5BR7A 2I6QA 3BWBA 2X5OA 3BQNB 3OU7A 1JAYA 3A4MA 5L4NA 3L5KA 1OWBA 2ROQA 4AC9A 4X62B 1RR6A 4ZMBA 4AS3A 4OJTA 3D6TB 1JRLA 4FLEA 1L4MA 2D7CA 1ISRA 3HBJA 1KVQA 2I2XB 5L6LB 2KQUA 2IIBA 2HZ7A 1JAIA 4IGKA 1SEPA 5TPZD 1EWYA 1X39A 2MSDB 4FFRA 3SHWA 3TVYA 3ENVA 1NNSA 3LIIA 4CEJB 3T61A 3W2HA 1XHFA 3HJHA 4TRJA 2GWRA 4DSNA 3VR4A 2JAQA 3GLFA 1V6AA 2EKPA 4F9GA 4TLAA 2AW3A 3B6EA 4AUMA 3DV0B 4CMJA 5GONA 2FU5C 2QAGA 3ABIA 4NJMB 4OHCA 5EL0A 2OXTA 5JEEA 2EJTA 1QHFA 1V5IA 2FKNA 3LXRA 4TX1A 4HAWA 3NCHA 3OPNA 2BSQA 4C01A 2YZ7A 4YMUA 3VTKA 5IX8A 1JLLA 1WPGA 2O0LA 3KKNA 4X7BA 2VK4A 2JIDA 3CRQA 4LRQA 1K3UB 2H1RA 3U9LA 3V00A 4B47A 4C06A 4EHDA 2I34A 4MUIA 1OY1A 1PZEA 4KBFA 4MVYA 2QD1A 1NL3A 2CJWA 3C3CA 3JWIA 4KC0A 3DMTC 3CCFA 1SXJE 3MJCA 3G85A 5KJ1A 2OTCA 4OHZA 3IVGA 1J24A 3DM9B 4K28A 1AKVA 4F4IA 1JQJC 5FNVB 2BY4A 1BQ8A 4D4JA 1PAUA 1UDWA 1DOZA 4Y7NL 1WUTA 1CEQA 1CJCA 3KYVA 3AHDA 5D3QA 3KJQA 4EMUA 3EAQA 1XLWA 2Y68A 1QBKC 2ACWA 4H0FA 2IZ7A 3KSZO 3ZY2A 3USCS 3A6JA 4HNGA 3ZOKA 4C5AA 1V1JA 3MUFA 1PD0A 1OU0A 3OKAA 4L57A 4LX0A 4WCFA 5LQCA 1N6IA 1E0DA 1ZBQA 4QTTB 2RBGA 4GX2A 1QRTA 1XZ8A 1Y3AA 3H7IA 5D51S 4DR1B 2RARA 3LTEA 3U61B 2PD6A 4V196 3G5UA 3KUCA 2IHTA 1V1MA 4P7JA 4Y2QA 1OILA 1OVGA 2CXXA 2HIHA 5KX5A 5EXPA 3W34A 4DKJA 3MWEB 1SOAA 4E5KA 2GYVA 3VOAA 5C9ZA 2IYYA 1MO5A 1Z56C 1IQUA 3ITNA 2EQ5A 5JAHA 1NLUA 4ND7A 3EXAA 3LYAA 1YDHA 3F78A 4MGKR 1C3OB 2VVTA 3BTVA 1CU1A 4R7ZA 1OX5A 1VBFA 2K5UA 4BMSA 1IZ9A 4PFKA 3RREA 3WLOA 5KYVA 1UFKA 3GJ8A 3REFA 1T9AA 2XZDA 2CCGA 2GI4A 1QG4A 1YR3A 2AJBA 1UJ4A 3X1KA 3LY7A 1II0A 3RWOA 3LFUA 3QPVA 1ZD3A 4P7BA 5IUKC 3VH2A 1W9HA 4B2YA 3OO0A 5AUOB 3SVLA 2R1UA 3LSTA 1ULSA 2E55A 3N5KA 1IRIA 4IH4A 2DUUA 1R4NA 3WMXA 4DARA 5GJWC 5JFGA 1FFXA 1REQB 2CFCA 2ZR7A 1RAGA 3TUIC 1SKYE 4DNPA 1K92A 3LY9A 3KZCA 4LBVA 5EHZA 2XBMA 2B3TA 3Q7IA 4PZLA 4X3CA 3UPTA 2ODTX 3BL6A 1LPAB 1P3Y1 4BNHA 5CB0A 3CRZA 5IH3A 3CONA 4YCJA 3TKAA 4R8LA 3LG2A 2YN2A 1GN9A 2ACKA 3H97A 2FH5B 3A6EA 3O95A 4OF4A 4GSYA 1CIPA 3KDAA 4B8CD 4JUFA 3IJRA 1B71A 2IYOA 3LLMA 4KGVA 5A5FA 4UJ3A 1VGQA 3L0YA 4H1WA 2HIGA 3C4QA 2RC5A 2O23A 1CR0A 1HMPA 3ADCA 1RLOA 2QT9A 3R0IA 4V0RA 4P0PB 3OF3A 1M1NA 4IUCS 5IZ4A 4RE5A 3NHUA 3OCCA 3R8CA 2RJOA 4B4VA 4C04A 3U44B 2NTEA 1L4BA 2F3RA 1I6KA 3GDWA 2XVZA 4KFTA 4X90A 1J22A 2XE7A 2AUTA 1RM5A 2NZYA 3ZNNA 5GADl 2IVFA 4D3SA 3A06A 4ARVA 2H85A 3LKZA 2NU6B 2CJYA 1BCSA 2P6PA 2UUBB 5C37A 4ZU6X 4KRGA 3T1QA 1NP6A 4HGPA 1XGKA 3NPAA 2XMQA 4R5HA 4CN8A 3LPCA 2P5YA 4B6SA 4UTVA 4CQMD 4M1WA 4QPZA 3ER9A 2R8YA 4BZQA 3A70A 4H0CA 1V9LA 4LNAA 3O1LA 4OXIA 4LKOA 2ZAIA 2OLKA 4J6EA 2J3KA 2ZE7A 1ECPA 5K4AA 2GUGA 3NNNA 5DNUA 2O7RA 2E5LB 4E22A 2OSVA 3AUTA 1ESDA 4LJYA 5HF5A 5BWNA 5HRUA 4XM1A 5IXSA 3GJ0A 4F85A 4QTYA 3I39X 2PGJA 1UP7A 3H87A 4FOTA 2YZGA 3LPAA 4IFIA 3EGCA 1G9TA 3M2PA 1GQSA 5AH0A 1UMKA 3B0AB 3QKIA 1VYTA 4RSGA 5EE0A 5CA0A 4BMDA 3UB4A 3IKLA 3BHJA 1XXLA 1LPOA 4N3AA 4BX2A 4CTKA 2OBYA 3CE9A 3U3KA 4AJIA 4ZI5A 2RGGA 2OO7A 3O9MA 5PNTA 2HU5A 2Z5GA 2P9HA 2HX1A 3CSDA 3S2ZA 1EJ2A 1IG3A 3CW2A 1JIVA 3H11A 4UAVA 3D1JA 1RWMA 1ZLXA 2JFNA 2PH7A 1OV4A 2WF9A 3EY4A 3HN2A 4M0MA 4N6OA 4PG4A 2ZTLA 4RZIA 2M6KA 3SNHA 3EFOB 3VPXA 3KDPA 4CI0B 1C7FA 4R69A 1W19A 1BXKA 3KYDB 1P44A 4MP3A 5DBGA 4IO0A 1P7VA 5F1YA 1W47A 2JLSA 1O5TA 4YPVA 3WJ7A 3GEMA 3ZY6A 2SKEA 2QBYA 2CZCA 1GPWB 3AVPA 4L5CA 1EXMA 3DTYA 3L7IA 2F67A 4YBZA 1QQ6A 2ZUDA 4Y7CA 4UQLA 2A1IA 3W5UA 2NLOA 1QZ3A 4RIIA 3PFBA 3UWPA 3ICWA 3RKUA 2VUHB 4EECA 4YYEA 4EG1A 1OH8A 1V4NA 2EDCA 5C4GB 1JFVA 1L4FA 2EYUA 1O1YA 2H4ZA 3NRBA 2R7AA 4GZ3A 3D7LA 5LVAA 3V1UA 3TFQA 2OCYC 1ONOA 3PDIB 1WL8A 1GR0A 3KZKA 3L7DA 4F8JA 2RKOA 1EK2A 4Q9HA 1GGFA 3BIFA 4EG8A 5FWYA 2DU8A 3T4UA 1N1GA 1XCOA 4FTWA 4U4AA 1IZZA 1RWWA 2YQ4A 2X0RA 3F5SA 3BXZA 1FYDA 3H0EA 4WJLA 1VI2A 2OSBA 5IM4F 3NJRA 1JKJA 2RK4A 3H1TA 3JQ8A 1DFGA 2FN4A 2HF2A 1RTTA 4RY9A 3L8FA 1QVWA 4G36A 4AO8A 1J56A 1T2NA 1T5BA 1W0KA 4Q34A 3RBVA 2BWJA 3RS7A 1PK7A 1U65A 1VRWA 3FPBA 4CF4A 3BRWA 1YIOA 4P4GA 2XCSB 1T3LA 1DAIA 3ESAA 5JNTA 3D7NA 1JIQA 1P91A 1XTRA 2J48A 2P62A 3V42A 1EB9A 1MN6A 3E3NA 1HRDA 4IVNA 1CZUA 2QPTA 4FW9A 2VWPA 2CYBA 1VG0B 3FMPB 3AP1A 2IYUA 3PPXA 4WN9B 4D9NA 2YWXA 5D87A 1A0OA 3IE2A 2VBFA 1JHXA 4BVHA 3Q8KA 2XYPA 3KG2A 1E2GA 4EHLA 4EY5A 1AS2A 4N5IX 1ONBA 1PQYA 5BW6B 4UM5A 3RABA 2AKEA 3F6BX 3V2UA 3NALA 1E8NA 5KBYA 3O03A 3B78A 1MB9A 3QEKA 5AIAA 3J81A 2R8ZA 5B7PA 2GAAA 2FUCA 3QFSA 4C7XA 2UZ0A 2UZ3A 4JKYA 1HYGA 4YCBA 2AVDA 3HBAA 4MP6A 3IQEA 5GM2A 4D4GA 4Q4CA 2Z2KA 3FCOA 2HSGA 3E3LA 3GGSA 1KGSA 1IWPB 3AF0A 1K7SN 3TKLA 2FQQA 3T94A 1OV6A 3HGMA 5CCEA 5JD6A 4HN2A 3TOZA 2PO5A 4HB4A 3RHSA 3JR7A 1G0NA 3CLHA 4WNIA 4ZA2A 5EIOC 1XZMA 2OD2A 4F96A 1JYFA 1RMTA 3OIWA 4FGSA 4JUIA 4PYKA 3ZDXB 4X54A 1M0EA 2G1JA 2ZYHA 1T0BA 3CX8A 5BUCA 1GYRA 3EIHA 4M8NE 4DLNA 1IZ7A 2WC1A 1NXGA 4WV3A 4Y6LA 5HTOA 4FHEA 3UMYA 5GMOA 3TFOA 1NVFA 5TXGA 3NV7A 1SXQA 3TTUA 1DG3A 3I2IA 3D1VA 3NVAA 5K3EA 2QQ5A 3LOQA 4FWBA 1R8SA 3RFVA 4ERNA 4A5SA 1MT3A 4G5FA 4B75A 4K9KA 4R7TA 5TS3A 1BKSB 3IHKA 3DKIA 4WEOA 2DWUA 5HJ7A 4XWGA 2RHCA 3Q3EA 4CL3A 1FA9A 1BO6A 3CXRA 2BTQA 2AFVA 3IYLW 3X1DA 3HLTA 1F2UB 4P2BA 4HT3B 3DO8A 1XCGB 1YK0A 4L4YA 5AHKA 3UAWA 4TVSA 1XRRA 4WECA 3BXPA 4XGHA 5A9RA 3KL2A 1QHIA 2QZPA 1HPLA 1TFUA 4H1UA 2BC9A 4PSDA 3ZHSA 3QF4A 4C0QC 1Q21A 1GNRA 4PLZA 1ZM3A 1VJCA 5LC1A 2XDQA 3KBOA 1IHXA 1MHPA 3AEZA 3QXSA 3EWAA 2R7ZL 1K75A 1YJQA 3UWSA 3TSZA 3Q8MA 4GECA 4Q9NA 2J3DA 3B70A 3DCNA 1BJKA 2GAFA 4QICA 2I62A 2VHCA 4Q4AB 4RXTA 4X6YA 4ARZB 2DC1A 1M6WA 5KDOA 4FHGA 2A57A 4G9EA 1XQXA 2ZYIA 2VDLB 4BEJA 1Q16A 4LSZA 4O25A 3ZK9A 3D6UA 4E1AA 4Z4QA 4C6TA 3OU2A 3PT5A 5TR9A 4KQ9A 5BSMA 3N3AC 1YB2A 2EQAA 2F59A 1QONA 2I65A 4ZQHA 5ELMA 3R4CA 1YZVA 3VKGA 1L1QA 2P2GA 5AN9H 2QT0A 3D7RA 2P30A 4IOJA 1P7YA 1J8VA 1EFLA 2P78A 2E89A 1TM3E 3RZOL 2CVFA 4A2CA 4DXAA 5DVZA 1DKMA 2CVPA 4EPTA 2I33A 5ADUS 3T9FA 1BD3A 2ZAYA 3KJFA 3HA2A 5EMLA 5IDWA 1RM0A 3U80A 4MVJG 1VXOA 3TQIA 3QHAA 1ESCA 3LPLA 1XJCA 4F2HA 4XDGA 1Q1QA 2CNWD 5AVJA 1GKLA 3TLAA 1PT8A 3RVLA 1Y4DE 1DRJA 1NI3A 1SCBA 4Z51A 2ZANA 5A5VA 2QAJA 4L0QA 3M49A 4GOJA 1LWOA 3G49A 1UQUA 5TARA 2REOA 3EB9A 3K09C 3D8RA 1DAGA 2EJBA 4FHCA 4F8EA 1NLMA 2PR7A 5KTSA 1POXA 2QZ9A 4LWQA 2JVIA 4KL8S 1RXYA 2W2TA 3ZPXA 1IJEA 5F7JA 3HOXL 4G6ZA 2PHZA 4HDKA 4BBPA 4H4DA 2IYXA 3WO0A 3CHYA 1LKOA 3MWGA 4KXFB 3RAFC 3CZCA 1PUJA 2QTHA 3UAVA 1N5MA 3W5AA 2YHBA 3DC2A 1CRLA 5GOTA 3MBIA 3U7FB 1P6UA 1P0MA 3NKVA 3PDHA 2ISCA 3NWOA 5A4FS 3VYWA 3HJCA 1IM2A 4UARA 2QLTA 4KMSA 3OE7A 2C7GA 4LIPD 1Y6QA 3AOEC 1X1AA 3B9PA 6REQB 3CCBA 1JEYB 3C6MA 1XX6A 2RGNA 1W5AA 4IGIA 1CUXA 4Z4FA 1N6OA 5JO0A 3WSTA 1EUCA 4P4LA 1NXSA 1NBWB 3U60B 4XSHA 1ZCZA 4UUOA 5AQEA 5JMTA 2AL7A 1QWOA 3HCEA 2DTXA 1AV7A 4GKAA 3OE5A 3OZAA 3NVDA 4MKGA 4EGJA 3RADC 4QOHA 1H4TA 4U2EA 4F6CA 1K8XB 3ZJYA 1EBBA 3AF6A 3ONVA 3S1SA 4JI8B 3L43A 4X6LA 3VYUB 3S2FA 2VHXA 2PBRA 4L8GA 4WNCA 2W2VA 4PIVA 4KR0A 2EBHX 4X20A 1RP1A 2VHZA 2ZTSA 1JDNA 4HX9A 2Q1YA 3KPUA 4HWPA 5ENZA 3NM4A 2XX3A 5K8LA 4HPWA 2HDNB 3MTIA 5IVKA 3CVJA 4XD2A 5EI5A 3FAZA 2J3HA 5AK3A 3D6VA 1YVUA 4NU5A 3D4OA 1VG8A 2Z8YM 1DARA 1H85A 1UAYA 3B52X 1GTMA 1M6EX 1Q57A 1ZN2A 2Y9MB 1PT7A 4A3ML 3GGJA 3QFHA 1Z6XA 2LV8A 2QD5A 4KK3A 4JI3B 5BN1A 4PAOA 4G0XA 4R81A 2WVHA 3WJ1A 4OQ4A 2CV1A 1CY6A 4DUPA 1OUMA 3VPSA 4BNFA 1TUIA 3ZIDA 4B3MB 3DR5A 1RLUA 1ND5A 4JBGA 4WERA 2CJPA 4H3SA 3UT5B 1RI2A 2Q5LA 3GEHA 3EEFA 3LPDA 4PFSA 3U1VA 1Q0ZA 1BMFD 1POWA 1NUSA 4QYSA 2V8BA 1IMOA 1M73E 2X5NA 1YQXA 1JG2A 3Q4GA 4K6OA 4U63A 4XGRA 1C3EA 3VKFA 4I4LA 1EK0A 1PT5A 1L4YA 2ZREA 4BEVA 1XCBA 3BJEA 1AKEA 4BMCA 4OMDA 3RVQA 1XV5A 3DDUA 3NAZA 3OZGA 1V41E 2GM4A 1HFKA 3F8TA 5LQUA 1HQKA 4G0WA 1SQ6A 2XUOA 1RXEA 3CWQA 3DTTA 3OM9A 2J32A 2WTEA 3MWLA 4BFVA 4BO9A 2VG8A 2IYTA 4WKBA 1YQWA 4HWGA 1R5OA 1ZVJA 1Z2CA 4X92A 3V1MA 1XC7A 1H8HA 3A7DA 4WGGA 2ALJA 2R97A 1YRBA 1VG1A 4GX1A 4II7A 4NOJA 3U7RA 3ZTWA 4KFCA 4YQEA 1S2ZA 4CDNA 3OPYI 4L7VA 1B42A 3HKZP 1EQUA 1JXQA 2H9YA 2KN9A 1D5CA 2I6FA 2ORED 3JTEA 3RF6A 1MEEA 2EAUA 3K35A 3NLLA 1WXQA 4BMYA 1XD2A 2K2QB 3LX8A 2C5EA 5JADA 3AINA 5JZVA 1A9ZA 1F2TA 1P5ZB 2VDQB 1ZCAA 1ZOPA 3QNMA 2H2GA 5C5IA 1SU8A 3NZEA 3U1BA 1XDWA 3RYHB 3O4JA 1SC4A 4GQBA 2JFVA 1E1QA 1HL7A 1WNTA 4ZV4A 5KU1A 2I4OA 3QEJA 3I4LA 1KOGA 2IIQA 1T4CB 1SC1A 2ODBA 3PRHA 5EQFA 1PO7A 2KBEA 5FPSA 3RZ6A 2HI0A 3RSOA 3B08B 4BQEA 3UN1A 4LFBB 4MYUA 4DG8A 1F60A 3KL4A 1KMIY 1WB4A 2GERA 2GXUA 2HGZA 2Z5FA 3N75A 4PLHA 5JS6A 4BLQA 1UFVA 4EYQA 3MCTA 3AEUB 2YWFA 4DL9A 3OQ6A 3ILSA 4A92A 3AR7A 3MCZA 2PTGA 5EE9A 3HG7A 5AR1A 4JXXA 5JJIA 3HVKA 3BRSA 4DCGA 3B1XA 4UBNA 4EW1A 2BRUA 3ANLA 3UK6A 2HJWA 1Z68A 3CNHA 2CKDA 4JBXA 2OZVA 3ASYA 3IV6A 2FB9A 3WFJA 1CJBA 2VXYA 1II9A 1QGYA 4MA0A 3GJZA 3OM8A 4TM7A 2QD4A 4EMBA 3H2YA 4FBLA 2FPWA 2QVYX 2GFIA 4DYDA 1VHQA 3B48A 1YRLA 3DWGA 4QATA 4HDRB 4M98A 2M9MA 2OCLA 1KF0A 4CTMA 1U9IC 3W1WA 4DCOA 1Z07A 3ZU6A 1BRMA 2XZLA 1BXRB 4BASA 5HDQA 1B8VA 4NTZA 5GIPE 2UYYA 1ZMOA 3B85A 2DTDA 4G0NA 5EYPB 4B7AA 4Z5XA 9LDBA 3FRIA 3FVVA 1EA5A 1TJ4A 2YNMA 4N18A 1LEHA 1PNVA 1E7MA 2ORWA 2PL9A 1DEXA 2IXBA 2TMKA 2XMBA 3R7WB 4KXVA 5AJXA 4LG1A 3MZ0A 3OEEA 3OPXA 4FFMA 2CW5A 3GNLA 1L4HA 2W6NA 3QKWA 4BE4A 3N07A 2H1WA 3S7TA 3P9XA 2ZB2A 4CUJA 1T9KA 2CNNA 1A27A 4NFSA 2J7PA 3T7IA 5LD2B 4QECA 4H18A 4QDTA 3ZE8A 3HPRA 2WM9B 2SNIE 4K8OA 1E2PA 2G0NA 5HZKA 2GQ0A 3F97A 5D8DA 2OUKA 3Q9UA 5KVAA 3C7DB 2CKAA 1B1CA 2X9LA 3CF6R 2PFGA 4P9NA 5TPWA 3MBKA 4HP8A 4YQYA 1NUTA 2XUPA 4RPCA 3MB5A 5EPOA 3KQQA 3LH5A 4BFWA 3E0QA 4L02A 3C7CB 3INTA 4WPGA 3W3AH 1EQ2A 1P75A 1OYYA 4JLOA 1CRZA 2HUNA 5FOQA 3AYXB 4FD3A 4GP7A 1WW8A 3QWAA 4WDQA 3EPKA 1PHRA 1KXZA 1H9BA 1JQAA 2O50A 2OGZA 3WWYA 1CUWA 1H3FA 1CQXA 1OAOC 2PZFA 2AN4A 1RZVA 2ZT5A 4HAIA 4JFAA 3BICA 1O03A 3AL3A 3GEGA 3LLCA 1L8OA 3REGA 5WRFA 1NNEA 2FPUA 2X5JO 1SHUX 3K9HA 2V7BA 2A9KA 3DE4X 2FEWB 1Z4OA 3DZGA 2Y9PB 1JN0A 2GN9A 3O6VA 2ZUBA 4TMXA 4BQFA 4EQZA 4Z2AA 1JFTA 3ZDEA 2EKBA 4G4IA 2V6JA 3UPUA 2XUKA 5EZQA 4WZBE 2RHDA 1C9DB 1NVVR 4Q1DA 3UFXB 3RYIA 1BFKA 4MS4B 5TGTA 3VR4D 2Y05A 1OGYA 3MTAA 4Y6SA 3BJMA 1ZRMA 3KCQA 2ZAOA 3NYRA 3IQFA 4JJ8A 4M49A 4PZEA 1UKZA 5EZYA 4DSOA 1JAHA 1S2MA 5JQGB 3KPYA 2XQJA 4RSMA 4PE5B 1C0EA 4J7UA 1S2GA 1XEWX 4PO1A 1B0ZA 2BP7B 2Z3RB 1W87A 3VPGA 4HN9A 5CPFA 1UIMA 4KDEA 5A0TA 2WVGA 1EBFA 2RHWA 2DCMA 1GPLA 4O0MA 4OSPA 4C3HL 1T34A 5A5DA 1KDOA 1PSZA 2XCOA 3K72B 2FZKA 4KAJA 3ENWA 3EOBI 4ZXPA 1NULA 2HF9A 4GR9A 1X3SA 4KQWA 1DQNA 4PU0A 4MW0A 1Q83A 2IUEA 4KQJA 3VAYA 3BWEA 1RWDA 3ZGYA 1H8EA 2YYYA 1DO8A 4MVWA 3FFWA 1RJ9A 3P9IA 1AK1A 4MWEA 1CQJB 3G88A 3UVEA 4AY2A 2OCIA 3TGPA 3DWIA 1UT6A 4HVLA 5HIAA 2E4VA 2PLAA 1OFGA 1PWZA 2JAUA 2XA9A 1H2XA 4WZBA 3C3WA 4ALKA 4J9UE 4QYIA 4D80A 5L6MB 5F2NA 3SQNA 1GNTA 5F98A 3TVTA 4MCAA 3U4QB 3CNNA 5HTKA 2WJ6A 3FPHA 2X6TA 2OM2A 1QYRA 4FMBB 3NU1A 2ZRKA 1R4ZA 3AJEA 3OHSX 4J16C 4GWKA 5T57A 3ZY4A 1VSQA 2M2IA 4YJ2B 4GX5A 4NV1A 4TVMA 2W2QA 3JQ9C 4BO7A 1F2DA 2GYYA 4LYGA 1RXUA 1HNNA 3KXPA 2B0CA 2HWUA 4GLLA 1I1QB 1LW6E 1YNOA 4YJDA 1HFWA 4GM4A 3N2KB 2YVKA 4GP9A 3L4KA 3JWGA 1TEVA 2HJVA 4OOEA 2WWXA 2X1VA 4YAGA 1IY1A 3BXEA 4FWIB 5ERYA 3S1AB 1I13A 2QTLA 2JLZA 1K0UA 3NHKA 3CUSA 1X2BA 4U2CA 5FLML 3NQ41 4URYR 1FP2A 4C5BA 4FHDA 3IBTA 3U40A 1F4PA 3GX1A 1DJMA 3GFGA 3LT1A 3PWKA 4AYTA 5F9FA 2OBXA 1EDEA 1G2PA 2W5UA 4YAWA 5EHXA 3L4SO 4Y2XA 2CK3A 5BOVA 5TJHA 3WSVA 3VVBA 1HE8B 1QTNA 2VJMA 2ZM5A 1B14A 5SZIA 3OMLA 1Y0BA 2CL7X 5AXAA 3GFRA 1T9ZA 4L16A 2XADA 5HVNA 1USWA 2L19A 2QR2A 1CNMA 1XYYA 3HU5A 4J2TA 2R5NA 1PL7A 2R5FA 4P86A 4PS1A 4N4AA 2NADA 3TW8B 4D0SA 2IZ6A 1W94A 4M8IA 5B4VA 2WDPA 4YNBA 4QG7A 1XTUA 1XZCA 2OCDA 2PEZA 4OXYA 1P7ZA 2WTUA 1UMDA 2Y6UA 5BSRA 3U5TA 1ENPA 2BEWB 2O3QA 1RYMA 2D1SA 4KXQA 1KP3A 1V7QA 2BFFB 1DBQA 5EJFA 3HOZL 1Q84A 4B4OA 2QT1A 5C0OE 4HTFB 1NOJA 2G70A 3ORYA 3TQFA 2YIDA 4NOLA 2RBKA 5JXIA 1MOSA 3QXXA 5JMOA 4ZO9A 4OAPA 4YMTA 4PZAA 1NNUA 2DETA 4MIEA 3WWCA 3RS9A 1I4EB 2NOAA 1PNQA 3TLZA 4MAAA 1SOWA 1UM9B 1ZL2A 5DT2A 5ECWA 3WL6A 4D8VA 4G8JA 3HKCB 1F0PA 2QW1A 2PO7A 4UDXX 3SKYA 5FTLA 3C6BA 3PLRA 3H2IA 4CT0A 1G291 5CA1B 3HU1A 1AUOA 4L78A 5TJ9A 2EATA 4OX9Y 3F5QA 3G0HA 4ZCRA 4FQ8A 1VLLA 2CVQA 4K9SA 2OZPA 2NUAA 4HS9A 3JYHA 4UE3S 1ZY2A 4AJEA 1K6MA 1OLOA 2YBEA 3CRMA 4KAXA 4ZEOA 3S4YA 1W29A 1WZNA 5BOSA 4CLRA 5ALNA 2I6UA 2C04A 4I4CA 4ZDJA 4F2DA 3IMKA 2XSZD 3CURA 2G5GX 2BHLA 1EB8A 2NO4A 3DKKA 4I4TB 4P3NA 4F7WA 4PCLA 3ZYCA 4M3NA 5LL6P 5K2ME 1GCUA 3HUFA 1AQNA 3QEAZ 1EM6A 3A4NA 3PC4A 2PL1A 2R96A 3D3QA 1JLHA 1L5ZA 4DR2B 4E11A 2VDWB 1J2UA 2IVZA 4YAOA 5CFNA 2AFIE 4C14A 3Q7QA 3RC2A 2WZBA 1II8A 1D6JA 4IDNA 2QTNA 3RJ9A 4C4PA 1KA9H 3C5HA 1QZXA 2E2IL 4JEIA 1GRQA 3NEJA 1Z06A 3SXUB 1IJKA 5ETJA 4EJFA 4MV1A 4QKQA 5B1YA 5CFRA 2ZJAA 2OFFA 1B41A 1SUFA 2WYUA 3JD4A 3DKRA 2J33A 4I6JA 4MYDA 3VR6A 1P7PA 4KW7A 2R1ZA 1KJIA 4IHJF 2EZUA 3F49S 4RIHA 4RVSA 2V6IA 1MFPA 5FFNA 3X1JA 4QOJA 1JDBC 3BM5A 4OYRA 2MMGA 4X60A 2H2HA 4BY7L 1IDOA 3Q1LA 2IHBA 3KEMA 4EX6A 2XT9A 2R9VA 2FLWA 4IWXA 1E0AA 3UAZA 4KMMA 3UB2A 4ZJZA 4LRTB 4DRYA 2D1YA 3BGDA 1MB2A 3X1XA 5AK6A 3L4BC 3L4JA 2IPAB 4ADSG 3GCXA 3EK2A 1W0KD 2ZVQX 4CIVA 1QVZA 1SOVA 1RMQA 3BRWD 1I80A 1ZNQO 1Z2DA 3U39A 3UJ9A 5KEIA 4NRDA 1CY8A 1FYXA 4U2FA 2AFIA 4Z4EA 3DCYA 1VL2A 4IDAA 4PSAA 4OX9B 1FDIA 3F3MA 4OMFG 3F98A 4AG5A 2QX8A 3LUHA 5EJGA 1JU9A 1EFAA 4PQYA 4RV5A 1CETA 4OP3A 5C52B 1A7AA 2CDRA 5L45A 2BPOA 3IDSA 3VNQA 1JB1A 5FXMA 1GKKA 3WRXA 4LOJA 4B7ZA 3K1AA 1VGVA 4CKZA 2IS4A 1FTYA 4DLAA 2FR8A 1XZNA 4GOXA 3QBDA 1QH1B 1YACA 3MTQA 3HJTA 2D2VA 3EZYA 4AFNA 1HOXA 1FSSA 3MMZA 1N3IA 2NYAA 1AE1A 3T99A 3WGZA 4DR4B 2H3EA 4H7JA 3TN7A 1IPHA 2HT6A 3VAZA 4QNRA 3KB2A 1XL1A 4MAMA 2XECA 3HBNA 4NFLA 3WLSA 2I67A 4H3KB 2P9EA 2Z98A 4G1FA 5EHIA 3BD9A 3SCZA 4X64B 4KQFA 1H6DA 3GA5A 3R5HA 5I9LA 4AD8A 5IHPA 2GNOA 5FD8A 1NJSA 5JAQA 2DQKA 3ZEAA 2C9MA 3PTLA 4PBSA 2ZSBA 1ST3A 1XKQA 3BWXA 1OB2A 1WSAA 1Z33A 4R3WA 4DCVA 1LBSA 3LRTA 5DM4A 2QTWB 4CQLB 1XIVA 2Q7XA 3DVRX 1NJ8A 4MQ5A 4CVNA 1AO0A 1NGSA 1ZICA 3TRHA 4LXIA 4GGOA 1CDOA 3ORFA 4NS4A 1C3LA 1PEDA 2IU4A 2X76A 3IB3A 3ZTYA 3P8ZA 3DAHA 4DLKA 2XITA 3FLMA 1FFSA 3CO5A 3RRXA 1WXFA 4BJHB 1TO2E 1TTHA 4CMEA 4E4RA 4LYAA 4XFDA 1Y1TA 1E9EA 3ZE6A 1N5KA 2L0ZA 3OTWA 4DLWA 1FRVA 2EGHA 3DOFA 3HEMA 3RJMA 3TW0A 2F1HA 3KETA 4M4SA 4FWTA 2OZLB 1BKDR 2L18A 4GPZA 5AVTA 2JHPA 1X1RA 1Q1NA 3ADKA 3CX6A 4Y7DA 4Z0HO 5CG1A 2Z0MA 2ORYA 3MPOA 4DBLE 1UP4A 2NVWA 4I3HA 4BU1A 3TH5A 1U8FO 5JMPA 4DA4A 1GL9B 4L28A 3FZYA 4C05A 1P5JA 1OH7A 4YO8A 3AR2A 1A9XB 3R0ZA 5IBRA 2WA2A 2V7WA 3K2EA 5L51A 3MAJA 1Q7BA 4I6EA 2JA6L 1ZVQA 2XYRA 3ILYA 3TTTA 1DELA 1XXHB 2F48A 3DW1X 4EJSA 2DUWA 2B30A 5EN4A 3CG0A 3WLNA 1IBKB 1JSXA 2R7KA 3PHJA 2IITA 2RI0A 3BD7A 4M0UA 2BM9A 4WK2B 3VPDA 4NCXA 5SZKB 2FSHA 4JY7A 1GGNA 2Z6AA 3TR5A 2H8GA 1HT0A 2LIPA 5EZ5A 3T7SA 1FVOA 3N2ZB 1RRGA 3H6HA 2FE1A 4Z7QB 3TOCA 1F0KA 3LSYA 4LVOA 2VP6A 1TL7C 2B4AA 2DVMA 2EG5A 2DZDA 4RLQA 3SSMA 1CUZA 4CKBA 2ZRNA 3AP2A 5CURA 4ILKA 1IZ0A 1DUIA 1U94A 5CITA 5LLDA 2VEOA 2C3PA 2YJGA 2CLDX 3L0SA 3PZBA 3V46A 4ME3A 3VKHA 2Q3FA 1AS3A 2JHGA 3VQTA 2CR8A 3O8DA 2VTBA 3OX2A 4KOEC 4WZZA 5LU9A 1QYIA 2C9BA 3GVHA 2W98A 3Q6IA 1IB0A 5JSHA 1G2OA 2V58A 3MT9A 4OATA 4DRXA 1C80A 3BHNA 3ASVA 3VI4B 1DTWB 2ZJZA 2A92A 4GNRA 4DCNA 1GU7A 1SVKA 1C30A 4OAOA 3P27A 4MQFB 1B2JA 2P11A 1XNJA 3GCGA 1SY7A 4DOMA 3L9WA 4ALIA 3U3DA 4YHBA 2CXHA 2C7PA 4GL2A 3VU1A 3EXFB 3WR5A 1J21A 4KDRA 4CIAA 1GYPA 2JJ2A 2LR0A 3CUWA 4MVJA 4WVLA 5T3YA 4ZOLB 4ILEA 5ITWA 3DV2A 2G07A 4Q4LA 3VR5A 4FD2A 2SKDA 4QLAA 3CUUA 2P9JA 1VKHA 3R2JA 2QE7D 2PGAA 3HA5A 3VOSA 3LW8A 5SYNA 1OIVA 1MIOA 2QU8A 4A0FA 4KRFA 3DTVA 1QGED 5KMGA 3QFRA 1GCIA 3AI2A 4DGSA 1EEXB 2F17A 1Z6PA 3IIKA 5KYNA 1SIOA 4DCSA 1L9XA 2I55A 2XDAA 2ZFUA 1W85A 4IV0A 1YZGA 1G41A 2FPGA 3MPUA 4W63A 3ZWBA 4FKMA 4GVXA 3I8OA 1WSWA 4KLNA 2I2BA 1O5OA 1SGWA 4JLNA 1XZEA 5ENVA 2QQGA 2J9ZB 1ZCBA 4ITRC 1CJVC 3O38A 3ABZA 2DBZA 5LA6A 5TMPA 5ALRA 5KKAA 4PAWA 3JARB 5ALIA 1I2AA 3EQ7A 4HTAA 1RC0A 3ANNA 4IRXA 4ZAXA 1NYRA 3WLTA 1QTRA 1J07A 4P92A 3D8BA 2J4FA 3GPIA 3H84A 4YP6A 1VZIA 3DT8A 1AQLA 2DR0A 2EERA 3FHOA 3NCTA 5DTEA 4LS3A 1JPVA 5MGNA 1NOIA 1R8YA 1GPDG 1YQUA 2NO0A 5DGHA 2IYRA 3RSSA 1X42A 3IRVA 1H4SA 1A95A 4JR1A 1YTLA 3QX3A 3CYFA 3ZKAA 1TWCL 4ID9A 4B6OA 5K8CA 5JAPA 3PLAE 1N8NA 2CCJA 3HJFA 3NKLA 3KWFA 1B74A 1W36C 1CAAA 2VUML 1S9HA 4KLCA 1V3VA 4EA6A 1OX6A 3EVZA 4EB0A 4E2XA 2HU2A 1Y81A 3CC8A 2OPHA 2VC2B 1J23A 1USGA 4KSBA 1H5NA 3EQ9A 4CM1A 4ER3A 1CY0A 3OZ7A 5AOBA 1Q17A 1PBNA 5EIAA 4WXEA 4G5GA 2VZ0A 2NXWA 3HUUA 1LKMA 2FZ4A 4OJKA 3PA8A 1V2HE 4PZ9A 2G25A 4QT0A 2QTMA 3LQQA 5BVHA 2AF3C 2UZAA 2I2WA 3WGHA 4PFJA 4KACA 1Y8ZA 1R74A 3E1SA 1C1HA 2AEFA 1Z28A 2C20A 2Z2XA 3K9GA 2Q2OA 4GRAA 1XTPA 4IXNA 3EIFA 3BRCA 4LZOA 3HADA 4PRKA 1FHHA 3GWZA 3B12A 5B6IA 3AFOA 3TZEA 4DDWA 2I8CA 2AB0A 2YFYA 3UJBA 4B8YA 3Q9NA 1GPAA 1QP7A 2HMWA 1SXJB 2VBGA 1EPUA 3ZGOA 2JEZA 3B6KA 3NNDA 1TTPB 3JS5A 5FO1A 3UWMA 1BU8A 4MDEA 1B13A 2CNLA 1P1FA 4CT5A 5L9AA 1BWRA 1Y1VL 3KVNA 1UBJS 3HKEA 2V7QA 5IBQA 4M0EA 3RUEA 3AM3A 4G41A 3FOAA 3K20A 5KQLA 1RHJA 5HIMA 2DUNA 1A1VA 2IQIA 1BN6A 3NYWA 3PC8C 1SXHA 1S2LA 1W4RA 2HRCA 2P9FA 3AL2A 1OREA 4I50B 1SA0B 1SPBS 4ZKDA 2I03A 2DB3A 4YP0A 2L82A 3AV3A 1H1DA 2FPRA 3OJ0A 4IMJB 4AXBA 4YMGA 1YB5A 4HLNA 5E8RA 4MV4A 3KQUA 3VI3B 4F2PA 2WYVA 1I4LD 2W71A 1MENA 1MAHA 1X15A 4NZMA 3TMAA 1C1YA 5AJYA 3JYLA 3ERCA 3FMGA 4BAZA 2OAQ1 1QDLB 5FFMA 4RTJA 2KB0A 1I32A 4CWAA 1B0AA 1U2TA 1SUEA 3MEQA 2B36A 2IC5A 3MW8A 3CIOA 5CVEA 1YL5A 4F12A 5A05A 1DV1A 2YHAA 4RKEA 4ANFA 5BVGA 1IIBA 2QEQA 3LUGA 5D00A 3WQHA 5B4UA 4OA8A 3EF1A 4H6PA 1JSZA 3DMTA 4MQ4A 5ILOA 1WMDA 121PA 2Q3MA 4TT3A 2E21A 5A2GA 1YFJA 1YO6A 4UMEA 4Y2PA 4H17A 1LRLA 3AY6A 2J09A 3PIP1 3T5MA 2XHZA 2VNSA 4JZKA 4UZFA 4BO5A 3J80A 1T5IA 4IZIA 1Z6QA 1B15A 2QM8A 1E66A 2CUTA 2XOEA 3B9RA 4LHSA 4CEIA 1UEJA 1ZHFA 1Z16A 4U3JA 4JB3A 3BGSA 2JANA 4KIUA 2Z6VA 1SVSA 5AI2A 3NIBA 4K9OA 1ZZEA 3WP1B 3E7FA 4MRMA 1G3RA 5I6DA 3DFZA 3I6BA 2A9PA 1JVSA 1CS0B 5CH8A 5DBOA 5FPKA 1DUVG 1DZIA 4CXMA 4JUBA 1JHMA 2VRCD 3M4NA 4YVFA 4LVCA 5C2JB 2KKDA 1MRSA 2E4UA 5F4ZA 2JI7A 3KR2A 4JYCA 3OICA 1KZ7B 4HN4B 4UU8A 3SYLA 5I7VA 2P5UA 1QPBA 4YCNA 2PH5A 2NUTA 4KPEC 2GD1O 1EE9A 3HKDB 3FSRA 1HXHA 3TIFA 3UMJA 1LSSA 2BHSA 4RAQA 4BRUA 4FMCF 3ZD7A 2CMHA 1GITA 1I9CA 3DE7X 3G2HA 3W8FA 2PJDA 1FEZA 3IDZA 1M9NA 4EG6A 4EBFA 5DW3A 3IVXA 5ER6A 3ELDA 2W2LA 2XRZA 3FYSA 2JCVA 1LXCA 3O90A 4ODIA 3F7OA 1X2EA 1B0PA 2YNMD 3DBHB 4JROA 4P4TA 5GONF 7GPBA 4GS7D 1L4GA 1C7RA 3F5DA 1QOPB 2QX4A 3EVFA 1AGYA 1CULC 3JSAA 3OT1B 1HZJA 3OEED 1GWNA 2J3LA 5FTNA 5B12A 1V4VA 3OLQA 3L1HA 4G89A 3TTWA 4KPYA 1S5PA 1U0EA 4NECA 5IYCL 1Q12A 5D5HA 5C31A 3D4BA 4H7HA 1H66A 3F3YA 2J7PD 2IGBA 3WYAA 1FC0A 3AY3A 5F7OA 3RK0A 3D8UA 3P0JA 4XWYA 3CH5A 4LDRA 3IU3I 2IODA 2GZRA 1BH6A 3TI9A 2OHXA 3U4GA 2JA8L 2NAPA 3O1JC 4W1SA 1UOQA 4FDVA 2GGSA 3PWZA 1DWPA 2Y2VA 3IXMA 3W3ZB 4B43A 5EUQB 2OMEA 2DFKB 4C88A 3K71B 2ZZMA 3QOYA 3HXKA 2CDBA 3PPVA 1CP2A 1UOPA 2FN8A 2VDUE 4AYBP 3NI2A 2NACA 3C1TA 1JALA 3O91A 1NONA 3EIOA 3F1LA 4EB6A 1P2TA 2H4WA 3U2QA 4Z7NB 4XR4A 2Y2UA 3GFQA 5DHPA 2CL6X 2Q5FA 3S29A 1JIJA 4E07A 3T1YB 1E4YA 1BJTA 5JCXA 1O6ZA 4YMLA 1L3IA 2C7QA 1HDIA 1XG5A 3N0XA 2FVXA 1TKCA 2J4CA 2PWPA 2X0JA 5E7QA 4CZ2A 5CBPA 1WPXA 1B6SA 1YRYE 1R0CA 2OG1A 4C7OA 2BHRA 4H31A 3QHQA 4JITA 4Z8YA 1FYWA 4F3KA 5KX5F 1XDDA 2IPLA 1GTZA 3C5VA 3R7BA 4I7EA 4MB6A 2ZVJA 2BFBB 4NCHA 3V9PA 4LFCB 1KMHB 2GEKA 1EIZA 3MB8A 5FF9A 1HYQA 2F4NA 2N1BA 3FKQA 3GJ4A 4JQSA 5EJ9A 4MLCA 3WAGA 4TTSA 1JHQA 1WXXA 1Z7WA 2CVZA 4TWRA 2J08A 1SBZA 4HDMB 3VO1A 3ZEIA 4A7PA 3S1ML 1QNFA 4F6RB 1JHDA 3IP8A 3LQKA 2NVXL 2NUPB 5DK6A 3RF7A 1T8SA 4K9FA 1KETA 2JAOA 2FUKA 4KPUA 2PFKA 2TYSB 5DIZA 1OXTA 1P19A 3EUAA 1PT9A 4PYOA 3VXKA 1WUJS 5BV1A 1E6WA 3RS5A 3CB4A 3QUQA 4M1QA 3ZXUB 2D54A 3FZEA 1OGJA 5JI2E 1VSBA 2MYTA 2WFMA 3L77A 4WFQA 5GOZA 4P5PA 1BW9A 1LKZA 1X7XB 4KXXA 4F86A 5JROA 4D25A 1DT3A 2IW1A 3BDIA 3TX2A 1EFKA 1GKUB 3CGGA 3PJEA 2LPMA 3OSZA 3QYFA 4TSFA 2BUBA 3AT1A 3K0BA 1XRNA 4EYGA 1QF7A 1NFRA 3ADPA 1AKMA 4XCXA 4HLQB 1O6FA 4IDGA 1VIMA 4IZ6A 2A33A 3DL7A 4CMKA 1URPA 4RC9A 3JQ7B 3UBMA 1QR2A 1E3IA 3T7DA 5IG2A 5JPDA 1PI3A 5JD5A 3VKVA 6Q21A 1R7RA 2P3QA 3G8AA 1JB9A 5HM6A 1XHEA 3KWMA 2HPAA 4Q0MA 3AHIA 1JYSA 2YWHA 2XXAB 3UG7A 3PC6A 2IYLD 4RD1A 1X38A 3WGYA 2G1PA 1SCUB 5IXJA 4XPIA 4D3XA 4XYEA 1CX9B 3IJ5A 3D0OA 4CM8B 4W9MC 4UVHA 2A30A 3HDVA 3NDRA 1TIBA 2DT8A 1FFAA 1BE1A 2I0FA 2WWGA 4KH0A 1E9BA 1NJFA 4PAGA 3L0ZA 2B1QA 2UDPA 4MKZA 2RGRA 3NT5A 1E1YA 4KXNA 2D5BA 1M2EA 3BD8A 3L6RA 4MOWA 4O4LA 4D81A 1UWKA 3RYCA 3ANSA 2QYHA 3BMNA 4OXQA 4KKVA 2X6RA 3OZXA 3V5NA 5LMNB 3PPWA 3AQIA 2I66A 1Z6YA 4IF4A 4P4UA 4AO7A 2I6XA 4P1ZA 4LYHA 3TBFA 2VJNA 1FDRA 2PMFA 3IURA 4Q9JA 4JC5A 3E9EA 5AKXA 4OLBA 5B1HA 5ALVA 2AYZA 1M66A 3JVIA 3M4XA 3NX4A 4KO1S 4UMFA 1P4SA 3T06B 2LW7A 1KWGA 1FS6A 4OXXA 4C3IL 2FFHA 3MOSA 4TTVA 1VPDA 1HGXA 3O5AA 4LJ8A 3W9UA 1Q7CA 1CB7A 3RK4A 3RV3A 1OLUB 2NIPA 2WUFA 4AJ1A 2BFEA 5H3HA 4G4JA 3H6KA 5CA0F 3AEKA 4V2IA 1U0OC 3SZ3A 5JOQA 5KWEA 4BB5A 4B3XA 1CUIA 2CK3D 1XUOA 4YAIA 3CJRA 3TRKA 1NVXQ 1EFUA 4UUQA 3P9RA 3PPYA 3EZXA 2G76A 3RT9A 2ECQA 3CNEA 4BAUA 1LVUA 2BFDB 4U5QA 3GVXA 1RXWA 2A1UA 4ZFNA 2H52A 5DYWA 2C83A 3SMQA 8ABPA 1ZUNB 2YJNA 4LXUA 3HCBA 4D98A 2QSJA 3X1WA 4M7WA 4XOIA 4KEAA 3OFND 3VTAA 1FU4A 1R16A 2DBYA 1Z3IX 1YTUA 1FSPA 2H5EA 1TA9A 3VNUA 1NI5A 2Z8XA 3EMVA 1UP6A 3QRWA 2ISQA 4J0IA 4NZNA 3V4PB 1GRNA 1UBRS 1VOTA 3FWHA 4CRWB 3LPNA 5IKMA 5JUWA 3CVXA 1ZN8A 3P1JA 4L0CA 4ES6A 3SQWA 2FDXA 5HKOA 3SDSA 3UIEA 4TS4A 2JA2A 3HNRA 4ZXFA 4D9KA 2ZBFA 1A2QA 2VOEA 4PIMA 4Y2YA 2KWIA 5CVJA 1HNZB 2J3IA 1XYGA 1LI7A 3QBJA 2XKBA 3DPIA 3IIMA 3JRXA 5JCPA 3S99A 2OT3B 4J8PA 3UXMA 2BEVB 3RBXA 3WL8A 1W0JD 3EDCA 5IEJA 1QO0A 1IN5A 5EWLB 2QL0A 5ES4B 4HLCA 3U6KA 2MYPA 1Z35A 3OPYA 4JX8A 3MJSA 1U02A 4NPHA 1CRQA 1Q7RA 3GTOL 1AQ6A 4M46A 4DWWA 3QMVA 4DUZB 3NDPA 2BGTA 4CW7A 2DPYA 2EW2A 4FT2A 4J29A 2EEPA 1PGQA 2HQOA 1MP0A 3PD0A 5J1SB 5A3RA 3W7AA 4F71A 4JQYA 3BCSA 5AM3A 3W9BA 2J0UA 3MJVA 4AHZA 1G8JA 4A3DL 5HCIA 3SZGA 3AO0B 5AW2A 1TVKB 2X5XA 4UQOA 4OBBA 5DEOA 1AZTA 1FSZA 3DPSA 2HSZA 1WR8A 3LAWA 2F3SA 1O6GA 5DX0A 4U7TB 3IXQA 4HYQA 2DBRA 5IS2A 2DHRA 2PV7A 4HZGA 4AJ2A 5DM60 2B35A 2MR5A 3GF4A 1KRXA 2OQIA 4PHTA 2Y1CA 4MA5A 4C4AA 2OBMA 4Q16A 4FNGA 3EPRA 1TNDA 4LRXA 1LC0A 1I7DA 4COKA 4BMZA 4WL0A 2XEXA 1F38A 4S24A 3WNQA 3IOMA 3VR6D 5KTOA 2G9NA 1T1IA 3MM4A 3JQAA 1OPXA 4UJ5A 5DBFA 3DZJA 5HG0A 4AULA 4YP1A 1YC5A 4OMCA 4RXMA 4ZO7A 1BS2A 2O3SA 2X1MA 2ZJBA 3V4FA 4RF3A 5DNCA 1QRUA 2VSYA 1ICIA 2A9OA 2AG0A 3ADOA 5F9MA 3DT9A 1Z0ZA 2FMFA 3A9CA 3R3YA 3ROXA 5TT1A 2PYDA 2R66A 1I3NA 2P2YA 3TLGA 1SCIA 1U3GA 1Z47A 2YIJA 2CNOA 1N1EA 3Q7RA 4LFAB 3HY4A 3BCRA 3DEHA 4CT4B 1TUBB 3IVMA 3K2IA 3K0FA 5I7UA 4OB8A 5K3SA 1DTEA 4JI5B 5K8TA 2K2DA 3G59A 4CR8A 4OHWA 4OQZA 3UPDA 4XYLA 1KEEB 3HGQA 3L0DA 1E8JA 3HCRA 3RTCA 2BFNA 3JZFA 1R3DA 5TT0A 3WWPA 4EG3A 4DRZA 3K09A 1Y33E 2FPMA 3AUSA 4BVLA 5C5CA 1H22A 2OHGA 3O4VA 2FSFA 1T2FA 4RF4A 2CDNA 3TKYA 3UNXA 5HFJA 4MWSA 4HWRA 3OEHA 4PZ0A 5KNLA 1DCFA 1C7JA 1XJ0A 1P45A 3F2VA 1NSYA 1AMNA 3D02A 3EIWA 2XTAA 3E81A 4LW8A 1UXKA 5CIQA 3WOVA 4ZVMA 3ESXA 5CXQA 1KMQA 1W8IA 2IYNA 1VLZA 5CNKA 5H59A 2AGVA 1J2TA 1IQPA 3CZ4A 5DPMA 4PC2A 1T4BA 4U7HA 4U9IS 4D8YA 3BORA 5IPFA 1PYGA 4KJZA 1AIPA 2PZJA 4KDFA 3IQXA 4LTMA 1B1AA 3ITEA 1NLYA 1VA4A 4FLMA 4MUGA 5ITZB 1L3CA 4LSGA 1Z4MA 2PX3A 3AOEA 1SC3A 1MB3A 3GAMA 4QNMA 2F64A 5FR2A 1T3HA 1YHNA 1ZHHA 2HNAA 4H35A 1MC4A 4FFSA 3IMFA 1DXOA 4WOJA 4A5OA 4PYRA 4X85A 5KYUB 2QRHA 4FFBB 5D3KA 1HZZC 4QBKA 1CYEA 4KGDA 2X9GA 3VX3A 4ZHSA 3A9SA 1A9PA 3LO5A 3OETA 1XDBA 3KHSA 4KSCA 5E9WA 3WMGA 4A2PA 5KIAA 4IINA 3N86A 2O8FA 3L1IA 3IFSA 4ZK2A 5HUHA 4DS3A 4Q7MB 3TLJA 1ZZGA 2DPMA 1E6EA 1NZJA 5CG2A 4MUXA 1KMMA 4DPKA 2I1LA 1QKJA 2H4HA 1UT8A 2QAIA 3M3HA 1F8XA 3TBHA 7AT1A 1VBNA 2YINC 2XCLA 2YU9L 3GG9A 1P1RA 1W2GA 2JNWA 1HR0B 1LSUA 5AI4A 4MNTA 4DA6A 1OFTA 5FOVA 1HM5A 2AOVA 4HWTA 3VYSB 3ZWWA 1PWEA 1M33A 1E2IA 2WA1A 5G4KA 4DT1B 1U9CA 4HEA6 2EFDB 1E5QA 3KAQA 4EG5A 1CPYA 3CZ9A 3P9PA 5TF4A 1G8FA 1ID8A 1Z36A 2V7XA 1Y6ZA 5KVQA 1NHGA 1SVIA 1IVNA 1HC7A 4TTQA 2EP7A 2ZBGA 1TA4A 5J4VA 3FTQA 4QYWA 3EF3A 2Q99A 1N9GA 1HE5A 1XQYA 1R9MA 3WHKA 2DSNA 4Y8VA 3OMWA 3UMBA 2DLDA 1EVJA 1TWHL 2FZEA 2Q4DA 4L0MA 4IIYA 1L1RA 4MK4A 1M10A 2BL4A 4I3GA 4DQDA 1F8YA 2GBPA 1O9HA 2OL4A 1BGVA 3KJHA 3BH7A 5JWHA 4C5CA 4ENPA 1ZGCA 3OQNA 1KK0A 3F46A 4JT8A 3WB2A 3DE3X 3IPCA 2O14A 3EDOA 3PE3A 5A0FA 4HJXA 4L6IA 1F1JA 3SLKA 4CMIA 4EDFA 4CCYB 2AIRA 3ICPA 5F3RA 4YIKA 1DX4A 2O8BA 1JDTA 1P62B 4KQ1A 4RNCA 3R74A 4AROA 3TZKA 1B6RA 1D9ZA 4ZODA 1JEAA 1APBA 4XFKA 1NT4A 4B5KA 2I7TA 3W4JA 3LUKA 5H9VA 2B4QA 2PNJA 1GDDA 4B31A 1L5HA 3MPSA 5C1OA 5DHQA 4AKTA 1A7JA 3IEUA 4U6SA 4F2GA 2DT5A 2IXDA 4G1CA 4MS3B 3TMKA 4LRYA 3U7QA 1CYDA 1TF7A 1XZPA 2HJSA 4MKRA 1SBIA 3WBFA 1PGJA 5IJ0A 4UE6A 5C3EL 1I51A 3T3NA 4PCVA 5B1EA 4QIHA 3ZDDA 1Z92B 4DC0A 4MTCA 1GTL1 1ISSA 3FMIA 1NTRA 3VDRA 4EA8A 4GO1A 1WU7A 2BDUA 4NZZA 3QEMA 2JHCA 2WK1A 3RWMB 2WFLA 3LZDA 1UODA 3GUYA 3HY6A 4G1BA 3EEQA 1H0HA 1QV7A 1SO8A 4P3OA 4D9IA 4N65A 5JY6A 1D03A 1K89A 2AJTA 2R2AA 2AE1A 4JP2A 4L74A 4X66B 3TCNA 2JJ2D 1V8FA 3ZLBA 4B3RB 3B1VA 5AM4A 2XPCA 1M74A 2RCYA 4MVJD 1G8GA 4HY3A 3QWBA 4DA7A 3VR5D 4TWAA 1LPNA 1QH9A 1TWGL 4CBVA 3WISA 1A7UA 3C39A 1SMUA 5E6UB 1OVMA 3AJ8A 4ME6A 5K4HA 1CR2A 2PUGA 5M5XL 3KQSA 3DVQX 4FYWA 2ZYAA 4L76A 2GZDA 1E7RA 2C7RA 5I47A 2QYOA 4PG7A 1EHIA 2CFIA 2WM2A 5IAOA 5KQSA 4BBRL 1P61B 1XMVA 3FPGA 3MTBA 2WJZB 4HUQA 3EW9A 1I3CA 4EVSA 1WHTB 1QUEA 5DHTA 3AUXA 1U9IA 2RGYA 3V32A 1FUKA 2Q6KA 3AUYA 2GD2A 3HN7A 1M2GA 3RTBA 5K3FA 3V9AA 3LF1A 4O6VA 4RTRA 5TNXA 5JDCA 3T35A 1ORHA 4A6PA 3FN4A 3LOPA 3FJOA 2VUTA 5KYWA 5CIWA 1L5MA 3LWRB 4Z4HA 4Q7KA 3E7XA 3QIAA 3CBQA 3IMCA 2LZ0A 1T5DX 3H3XA 3LKBA 4LRWA 1JEJA 2G40A 5COBA 1ZJWA 2EGUA 4TXHA 1SAYA 1WUKS 4JDPA 5FA5A 2X8AA 2ZIZA 4IDOA 4NE2A 2R68A 3DM5A 2ZJ5A 3M89A 1GGKA 1IROA 1OWNA 1SHLA 3HU3A 1E2JA 4LC0A 3OX3A 4WT7A 2ZXUA 1QVAA 3KYXA 1Z7GA 4HRVA 2JCBA 4KGXA 5IJ9A 4R51A 2PH3A 1VKNA 2ATEA 2QPLA 3EZNA 4HAUA 3I01A 4FOLA 3IAM6 3E58A 1KKMA 4B3IA 1JZQA 2LTAA 1T6NA 3LC7O 5M3BA 1TJNA 3KQLA 1IDN1 4WZAE 1QH8B 1VCMA 3DL0A 2QRQA 3ANYB 2F8LA 2XGGA 2XWSA 3ZNOA 4OQDA 2R00C 3OX4A 2C4KA 3A3YA 2ZSAA 3AJAA 3PC7A 3BYZA 4FSXA 4D45A 4F0JA 1W34A 5ICCA 1GPKA 3G8YA 4ERXA 1C4OA 2IXGA 3MAAC 4NHOA 2QXTA 4W6ZA 1OAOA 1BKYA 2G9QA 1B7GO 1FBNA 2K6GA 3MFYA 4V0LA 5EVCA 4RZUA 1O96A 3HDQA 3FOZA 2B8EA 4NV0A 2IEYA 3B9QA 4WY5A 3T38A 1UK9A 1I2BA 4L08A 3S16L 1JQKA 4TYPA 1GNPA 4YRDA 1U4OA 2PDAA 3GH3A 4EPWA 2CVOA 4HLUA 5AJZA 3UYLA 1QM5A 3T5GA 2KHZA 4GYKA 1HT2E 2PLRA 2QZSA 3FYUB 4DTCA 3H9BA 3LXUX 3V7WA 1KHHA 4AG3A 1KYXA 2FEKA 2FE4A 2I3DA 4G37A 4E5PA 1IH8A 2XCQA 1V16B 2H2IA 2OHOA 4R16A 4Y9TA 3ZCXA 5FWXB