3FE5A

Crystal structure of 3-hydroxyanthranilate 3,4-dioxygenase from bovine kidney
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
283
structure length
280
Chain Sequence
ERPVRVKAWVEENRGSFLPPVNKLLHQKQLKIMFVGGPNTRKDYHIEEGEEVFYQLEGDMLLRVLERGKHRDVVIRQGEIFLLPAGVPHSPQRFANTVGLVIERRRLKTELDGLRYYVGDTTDVLFEKWFYEDLGTQLAPIIQEFFSSEQYRTGKPNPDQLLKEPPFPLSTRSVMEPMLEAWLDGHRKELQAGTPLSLFGDTYESQVMVHGQGSSEGLRRDVDVWLWQLEGSSVVTMEGQRLSLTLDDSLLVPAGTLYGWERGQGSVALSVTQDPACKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of bovine 3-hydroxyanthranilate 3,4-dioxygenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords 3-hydroxyanthranilate 3,4-dioxygenase
total genus 59
structure length 280
sequence length 283
ec nomenclature ec 1.13.11.6: 3-hydroxyanthranilate 3,4-dioxygenase.
pdb deposition date 2008-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fe5A00
2VPVA 4I0AA 3ST7A 2IXKA 3FJSA 5E16A 3BU7A 5EFUA 1DZTA 4Q0QA 2O8QA 3LA2A 3IIAA 4UBHA 5JSPA 4IEQA 1TQ5A 2CAVA 3KCCA 3IBMA 3FZ3A 1FI2A 1FT9A 2ATFA 4UXAA 1DGWA 1ZRCA 1CAUA 2HJIA 1OI6A 1X82A 3EBRA 4KWKA 1ZVFA 5JAXA 3EQEA 5I0RA 5JSOA 3D0JA 1OFNA 5T3NA 4WVZA 4X6RB 2C0ZA 3MDPA 5LEJA 3HQXA 2PYTA 1QWRA 4I0BA 4GULA 1CAXA 4PIYA 3E5UA 5EZWA 1ZRRA 3O14A 1O4TA 2MHFA 2BYVE 4P9GA 5LRSA 4NVPA 3H1WA 3RNSA 4LA3A 3JZVA 3LOIA 4XETA 3TNQA 1WA4A 3RDIA 1EP0A 4LLOA 5BY5A 3S0MA 2B8MA 2OPKA 1PM7A 1YFXA 1O5LA 3LWCA 2BGCA 3SCHA 3ROUA 1DZRA 5CADA 4MZUA 4XFFA 2ET1A 2Y0OA 4F8AA 4LUKA 1UCXA 3NJZA 4I02A 3DL3A 1Y3TA 2QJVA 3E5XA 1EY2A 2PA7A 4Q0VA 3H7YA 3U0ZA 1X8EA 3GYDA 2GU9A 3FWEA 2CGPA 1G6NA 3ZDSA 1YLLA 2UYBA 3KGZA 4PJYA 1EYBA 3ELNA 3KGLA 3H3ZA 2Q1ZB 2QDRA 4EWEA 2MPFA 1EPZA 1LKNA 5F1RA 3OGJA 3R6SA 3BCWA 2IXLA 3LA3A 2OZJA 4KU8A 1ZX5A 4XFAA 4CYDA 2Q0AA 4I09A 5C8WA 5CU1A 3I7DA 3SCFA 1H1MA 4YRDA 2K9ZA 2CV6A 1UIKA 4MGZE 1CX4A 4QGNA 4QMAA 4MGYE 3UKVA 5LEKA 1J3QA 3QOPA 4I01A 4MX3A 4X6QB 1XE7A 4Z82A 5K8SA 3KSCA 5FLIA 3U11A 2UY8A 4I3PA 5FQ0B 1X7NA 2FQPA 2EA7A 4XF0A 3NL1A 2HKXA 5FPZA 1GQGA 4ZU5A 4EV0A 5I0TA 4J1XA 4OLLA 1RL3A 1RC6A 2N7GA 2PAMA 2ZKLA 4XFGA 2ZCWA 4QM9A 1IPJA 5KBFA 1U12A 2B9UA 4IEUA 4FBFA 4WBBA 2XKOA 4FT8A 3ETQA 1ZZ7A 4JVAA 2GC3A 5BUVA 3DV8A 2BEOA 1HW5A 2IXCA 4BH9A 3MYXA 2B5HA 2P17A 2BNMA 4HSLA 1JUHA 2PHLA 5KHJA 1LR5A 2GAUA 1YWKA 2DCTA 3QACA 3OF1A 4PIXA 2IXJA 3CO2A 3OCPA 2MNGA 3I54A 3L2HA 2FMYA 4HLTA 1YFYA 2QCSB 1YHFA 5E1RA 3CLPA 4AQ6A 3LAGA 2PTMA 4XF4A 2OYZA 4UBGA 1NXMA 1WGPA 3UKNA 2F4PA 4HVOA 2K0GA 3KMHA 4QXKA 4O9EA 4IERA 4KWJA 4XFBA 2D5FA 4ZU7A 1NZCA 3I59A 5FCCA 3RYRA 1RUOA 4FAGA 1XRUA 4LA2A 1L3JA 4O9GA 5FLJA 4AVCA 1VJ2A 2IXHA 4META 3FE5A 3FFQA 4BHPA 1NE4A 3USSA 5I8TA 1O3SA 2UY9A 3NKTA 1SFNA 2D93A 3RYPA 3PVBB 4H7LA 2O1QA 3FX3A 3G7DA 4Q0SA 5JR7B 1RTVA 3H9AA 4IEVA 4L11A 3NVCA 1Q3EA 2XLGA 5BXXA 1ZZ9A 1O3QA 3HT2A 2PFWA 1CAUB 2GC2A 4HSJA 3RYKA 4Q0PA 4A2UA 3NW4A 4Z07A 3BPZA 5J48A 4D7SA 3S7EA 1IPKA 2XL7A 3VHRA 1ZREA 2OZ6A 2ETEA 2Z69A 1LB2A 3CF6E 3EJKA 4B29A 4MUVA 4JTNA 3N4MA 1Q5OA 1CAXB 1CAVA 3TNPB 1ZZ8A 3E5QA 4KWLA 4J1WA 1QXJA 3DKWA 1RGSA 1VR3A 4KL1A 2GH2A 4AXOA 3WW2A 4MH0E 1CAVB 3U10A 3M70A 1CGPA 2PHDA 4KU7A 1FXZA 1O7FA 4QGLA 4XFIA 5I91A 3WW1A 2XKPA 4LUMA 2XGXA 3D82A 4HZFA 2H6CA 1YFWA 1H1IA 2XLAA 3IWZA 1J59A 4D7TA 4ORFA 3E97A 2PAKA 1UW8A 1OMIA 3BALA 4IEXA 1QXRA 3MPBA 4YYOA 4AVBA 3OTFA 2PAEA 2EVXA 2Q4SA 4IEOA 3SMHA 3PNAA 1O3RA 3SHRA 4E2GA 2IC1A 1ZNPA 2KXLA 4IESA 2BNNA 3ES1A 1O5UA 3ES4A 4PIZA 5KHGA 1GQHA 4XEZA 4AVAA 2D40A 2PQQA 4YNIA 3SCGA 1YUDA 5HI0A 3H3UA 4EROA 3BB6A 2BNOA 4F7ZA 4HVQA 1QY4A 4MV2A 1RUNA 4FAHA 2EAAA 4E2QA 1XE8A 3H7JA 2OA2A 4JV4A 4RD7A 2V09A 4LULA 2QVSB 4YARA 5KHIA 3GBFA 4OFGA 5J7MA 4HN1A 3E6BA 4XF3A 4DINB 3I59B 1LRHA 5I0UA 5J3UA 4MGIE 1ZZBA 1O3TA 4BYYA 4R52A 3OD0A 2QNKA 2XL9A 4I2OA 3RPQA 4JTOA 4MGKE 4QGMA 5BV6A 3HT1A 1J3RA 1ZRFA 5FLHA 4E2SA 5I8YA 4Q29A 2D5HA 2XHKA 5CVRA 1J1LA 4XF1A 3E6CC 4WZCA 2GC1A 4IEYA 3ACLA 1SEFA 2Q30A 1CAWA 2GC0A 4L2NA 3EHKA 5KHKA 5FDBA 1X8MA 4XFCA 3S7IA 1I6XA 4R8HA 1YFUA 2VQAA 4N9HA 5I0SA 3M3IA 3DN7A 5JSRA 4IEPA 4LTAA 4K8FA 3MZHA 3H1MA 4XF9A 1Y9QA 1UIJA 4XFHA 5LRRA 3C3VA 5D1IA 4TLFA 4YSFA 2GZWA 4N9IA 3H8UA 3UKTA 2XLFA 3WW4A 3H50A 4AQ2A 1SQ4A 1UD1A 1CAWB 4Q0UA 1J58A 3IDBB 1NYWA 2E9QA 4HN0A 5FQ0A 4QX5A 3SXWA 3D0SA 3LA7A 4IEWA 1UPIA 3CL1A 2IXIA 5BPXA 3E6DA 3H1YA 1ZZCA 2CAUA 1OD5A 2H0VA 1J3PA 3CEWA 4HMZA 4ZU4A 1PMIA 5I8SA 4HBNA 5AVPA 5KHHA 1I5ZA 4EWAA 2Z2SB 4EWDA 3IDCB 4ONUA 5JCTA 2WC2A 1NE6A 1ZRDA 3LZZA 5FPXA 3PLQA 3B02A 2UYAA 3FHIB 4HVRA 3WW3A 3NSTA 1ZZ6A 3EO6A 4IETA 5C6CA 4QM8A 2ET7A 1Q43A 2WFPA 1V70A 1DGRA 4IEZA 1WLTA 2I45A 2VECA 3CJXA 5I93A 3RZZA 3HIFA 2H6BA 4BIFA 4LEJA 1VP6A
chains in the Genus database with same CATH superfamily
3O1VA 2X8KA 3B7MA 2WNEA 1WD3A 5FYIA 3FLRA 1S4CA 3BU7A 4JX0A 5L73A 2HWE2 1DZTA 4S2DA 3IDEA 2O8QA 4CPBD 4UBHA 4RS5C 3KB5A 1HV0A 1Z78A 3NQHA 1TQ5A 1YI9A 3J7MA 3KCCA 4P9XA 5F2WA 2WAAA 3AKPA 4JQRA 1SHWB 1JYXA 3FHQA 1IGOA 1FMD1 1AXYA 1Q8QA 2MEV3 1XNCA 1H8VA 1UL9A 4OULA 1ZRCA 3O1OA 3MUZ1 4OUEA 1V6OA 2HJIA 3B01A 1X82A 4BQYA 3IPVA 3I49A 3MIFA 4KWKA 3GHNA 5JSOA 4GJZA 3CZJA 4PLOA 1OFNA 1OH3A 4WVZA 1CQ9A 2C0ZA 4FTBA 3ZFEC 1WW4A 2J1RA 3HQXA 2LS6A 1MS0A 3BGAA 2MEV2 2PYTA 4YM3A 2P6HA 1HXS1 4XAEA 4FFHA 3OGSA 4XUTA 1CAXA 4YWAA 5FZMA 5JMOA 1OD3A 4A44A 4XJZA 1NX9A 3HEIA 5FY7A 2R30A 1W03A 4J25A 3WHTA 3OOXA 4Z92B 4RA0A 5LRSA 3HD8B 5GKAC 3Q8EA 1RHI3 4CCMA 4LA3A 3PL0A 3VBRC 2VCMA 4JKLA 1YQ2A 3LOIA 4CA9A 3JU9A 2A75A 1JYCA 3RFRA 1EP0A 1LESA 4LLOA 1BLZA 1XE0A 1UX6A 2JG9B 1PNFA 1UZYA 5EWSA 1PK6B 4A4AA 1C8NA 4NPMA 1AJKA 1JHJA 1K5JA 1W39A 1YFXA 4FI9A 1R64A 5FZ6A 4DXRA 5CFCC 4AQSA 2XONA 2UWAA 1CPMA 3SCHA 2V72A 3UGGA 1BKZA 4PDWA 1DZRA 3SITA 4OUSA 1YC61 5DUWA 5APAA 2ZMKA 4GJYA 3KF5A 3VZMA 3X29B 2Y0OA 2ZHKA 4F8AA 3E1F1 1HRV2 4LUKA 4CVUA 4LBLA 1RUH1 1H2LA 2ZGSA 3NV3A 4DB5A 4AI2A 1DQ5A 3H7YA 2DBNA 2A6WA 2XQRA 4MO3M 4PI2A 4Y22A 5LATA 3WR0A 2ARCA 4ZZ8A 4MGQA 2GU9A 4JDNA 1K5MC 3INAA 4CP9B 3ZDSA 3G6JB 2UYBA 1C8M3 4YG6A 3KGZA 2ZX2A 3HPNA 3ORJA 3PMSA 2RS12 3JBG3 4ZONA 3O1SA 1DP0A 2QDRA 1SFPA 1GP6A 3P3NA 3S57A 4EWEA 2MPFA 4XCBA 3OGJA 1OQ1A 2DCYA 3VKLA 2RVAA 2AYHA 2E31A 2IXLA 1GSLA 1ND2B 2VQ0A 2VQTA 3LA3A 5HCFA 2OXBA 4JGZA 3JXSA 5BNQA 5DDJ2 3LOBA 2VXJA 4IE5A 1SG3A 1ZX5A 1W6PA 4XFAA 3WNOA 4CYDA 4COWA 1LOCA 4NRMA 3PIJA 4L9BA 2VZTA 4Y5TA 3ZR6A 5A32A 5DAPA 1DU3D 1YXWA 4OMDA 3VHNA 1H1MA 1V9U1 2W91A 4LXLA 3WDTA 1RUE3 1W6OA 3ON7A 1D7PM 4GA9A 5J09A 2RDQA 3UKVA 1UXXX 4MGYE 4CDWC 4HPKB 3QOPA 4GH4B 4MX3A 4DUWA 1UY1A 2WZR1 3KSCA 3U11A 2HH9A 1C57A 1RB8G 1A3KA 1NAEA 2XUMA 1W8WA 4CUBA 2FDIA 3MLJA 1R1A3 1V6NA 4OYUA 5FQ0B 2Z5WA 1NT0A 4Q4X1 4SLIA 5A7OA 2XJRA 5FPZA 3I2FA 1A6CA 2HWC2 2ZPXA 3RZKA 1RUE2 1QIQA 4WM8A 2Z42A 3EYPA 4RL7A 3DUIA 3PJQA 3PVOA 1QH6A 2RDNA 2Y26A 1QJFA 4J1XA 3T0DA 2FDJA 1BQPA 1OF4A 2D6PA 1IPSA 4K8RB 5ABJC 4IV3A 2ZGOA 1AR71 2OQ7A 4I0WB 1LOFA 4OHWA 2ZCWA 4AEMA 3NV1A 1IPJA 4QB6A 1VBA2 1SPPB 1DZQA 4GAZA 3LKJA 5SV8A 2VOTA 4IV3B 1UMHA 4IEUA 3VBSB 1LHOA 1CN1A 4FBFA 2HWE3 4WBBA 4U2AA 1PO22 1WCKA 1ZZ7A 2F17A 2GC3A 5BUVA 3DV8A 1N47A 4QT6A 1HW5A 4K6BA 2WNVC 3FFZA 3W59A 3ZYIB 2P17A 4K1ZA 1IG3A 3CU7A 4YW1A 1LU1A 4CCEA 5A3UA 1FMD2 3OBRA 3VB9A 3R0RA 3PUSA 1GANA 2D44A 2B4KA 3QACA 2UURA 2RJKA 5L9BA 4CUCA 3UV9A 3T09A 1QF3A 3ASIA 4HKLA 4E27A 3PDQA 5LASA 3KZ4C 3C8XA 4NHYA 2DURA 3I54A 2JD9A 1S2BA 3HBZA 1W9FA 3P3PA 4UWDA 2X05A 4AQ6A 1JN2P 2B7YA 3C2UA 4JGYC 3ZDVA 2FCVA 5FIXA 2OYZA 2HBUA 4B4QA 1C5IA 1U0AA 2P6CA 3ZPOA 3TEXA 5FJKA 3UKNA 1WGPA 4XAAA 2F4PA 1PGSA 2K0GA 4QXKA 4K1YA 1NG0A 1W9SA 4Y1YA 3A23A 4KWJA 4RR3B 4YGBA 5C4WC 1HQNA 3AP9A 5ACA3 1K5MB 3OYWA 2ZKNA 4QPGB 3RYRA 1R091 5EIYB 3WD5A 1FATA 1W90A 4LA2A 4A41A 1K3IA 1NXD1 2X5IA 4LHNA 1PX4A 2JDZA 4CE8A 4CUAA 4QX3A 4JGYA 4YG0A 1RUF2 1KEXA 4CUGA 4JAAA 3ZYJB 4RSUA 1XNBA 2GNTA 3I3BA 3KV9A 4NAOA 2XDVA 3DPRC 2RE9A 5L19A 1JZ7A 5DZFA 1UYXA 3AMHA 4YM0A 3RYPA 5EXOA 3H8OA 2YHJA 1ULGA 2J1VA 4WVVA 1BZWA 1US3A 4XMIA 4YVSB 1TZOA 3ZYHA 3POIA 3O5SA 1WMFA 1N1SA 4K40A 4CEWA 5HCBA 3NNMA 1LOBA 4L11A 4QPWA 1VRH3 2XLGA 5CEHA 2PHFA 5EP9A 1ENQA 4PDWB 1AYM2 2F4LA 4M3CE 4XBNA 3AK0A 2QQUA 2VTXA 4B1MA 1O3QA 5FZ1A 2VD7A 4M4RA 1CVNA 1GP5A 2EIEA 5BNOA 4O7XA 2QZ3A 1EV12 1W99A 2HEYF 3NW4A 4Q0PA 1G9FA 4QKFA 3BPSA 4D0QA 3QD6A 1KITA 3CBNA 2WYSA 4AI8A 5ABJA 3WQ0A 3MW4A 2KD7A 3T30A 3VBOB 2R0HA 1YYNA 1APNA 1AR61 4BMEA 1UAIA 2Z69A 3WUCA 2ZZQA 3P5BA 4N53C 3ZXLA 3APBA 3EJKA 4B29A 4YVWB 5FZOB 1XNKA 1S2KA 4CEYC 2FDKA 3ZR5A 2NN8A 1CAXB 1CAVA 3AL5A 2JKBA 1I3HA 3IMNA 4P9WA 3FN9A 5FFOC 2E53A 5A7SA 5CFCB 2DF7A 4ISQA 1DQ1A 2YC2A 4S2HA 3DKWA 2BTVC 4CU8A 5T5LA 2DFBA 5JOZA 4IUGA 3RWNA 5IK5A 2VMDA 2GALA 3U10A 2QFEA 4WZFA 4Y22B 2OIIA 1JBCA 4QD2A 1QNYA 2KM2A 1FXZA 1UY4A 3C7GA 1D2SA 1QJZA 1VRBA 3PTYA 4NAMA 4N90A 1AR72 2YDEA 2ARAA 1BVP1 4HKWA 5GALA 5AFEA 2XGXA 4HZFA 4DEVA 2D6MA 4CP0A 1YFWA 1Q8VA 2P5BA 5LW9A 1RUE1 3N9MA 3E97A 5LA9A 3VD5A 1W28A 3VHOA 2PQSA 3TEWA 1SDDB 3UESA 1ND2C 4BLJA 1WMDA 5F5CA 5IT6A 2Q4SA 3CIHA 2L9LA 5FMCA 5FV3A 1O3RA 3SHRA 2PLV1 1GZWB 1O6UA 1HDKA 2QKDA 2VZOA 2KXLA 2BDRA 4DUVA 3I2KA 1VE0A 1IZ3A 2BNNA 2ZGNA 3T08A 3ES1A 2ADEA 2RS31 1O5UA 2HWB1 3ES4A 3WCSA 1E5HA 4PIZA 4URTA 5KHGA 1WLWA 4TZDA 4CDQC 1H0BA 1LTEA 1QOSA 1W8ZA 3GBGA 4XEZA 5GZEA 4CDUC 3KT7A 3WZ1A 2RMU1 5HI0A 3H3UA 4IE0A 1J83A 2HYXA 2P34A 3BOWA 3TN91 1D0HA 2BNOA 4AEKA 3AKSA 4QXBA 4BPZA 4EROA 5JPNB 4HVQA 4CEWC 4FAHA 4A45A 3KS7A 1A8MA 3ACIA 1YQ5A 4XILA 1JYWA 3GZUC 3OUHA 4RD7A 1MEC3 3Q8BA 2VTXJ 3IB3A 1OPOA 2W94A 3UL2A 3T1LA 2I2SA 4WVMA 3UGHA 2BQPA 4HK8A 5BNPB 2Y6KA 4HN1A 3E6BA 5A3PA 4O65A 2R7EB 1M06G 4YG3A 3MW2A 1WW6A 3A7QA 1QJX3 3FMGA 4G4FA 1COV2 1XNAA 3LFMA 4LHLA 4MGIE 5KXDA 4EYUA 2VVDA 1TME1 3CMGA 3HNMA 4QGMA 4XQDA 4URAA 2WKKA 5K0UC 3W5NA 1UKRA 1C8M2 3GHMA 3VN4A 4ZPIA 3LDBA 5FLHA 2JDAA 2YYOA 3JB4C 4MLOA 3JUUA 4Q29A 2WWUA 3WDUA 1UF2C 3AMPA 4YW6A 3ETPA 1W2UA 2P3YA 2X5IC 4H2AA 5LCWL 1COV3 3I2GA 3VGIA 2GC1A 2WQ8A 3JCIA 5T50A 4EE2A 1RUF3 4DY3A 2WT2A 1CAWA 2C24A 4HL0A 1OOPC 1W06A 4MHUA 2VCBA 2WO3A 4IV1B 3MUY1 1POV1 1CD3G 2VAUA 3VBHB 3WNXA 4NN0A 1REFA 2EXJA 2GNMA 4XFCA 3S7IA 1OF3A 3KQRA 3H42B 4R8HA 3RGBA 3MGUA 1FNYA 3OPTA 3OYWB 5DUVA 2ILMA 5I0SA 4PT6A 1VRH2 4QB2A 1AYM3 3UNPA 4AOCA 1LOEA 3K77A 2YMZA 3F2ZA 1UIJA 3BTAA 4XFHA 1O4ZA 4E4HA 5LRRA 2DVDA 1RVF1 2UWCA 2JB4A 5JZGC 1H4HA 1WCQA 3A22A 2WA4A 4YSFA 4LIUA 5L9VA 2XLFA 3POBA 4UW4A 3OUJA 2JG9C 1MQTC 4QX0A 5IVJA 1POQA 4CP1A 1OSGA 1OC1A 2YPJA 4W6XA 1UMZA 1W9YA 1KS5A 1LNSA 2W39A 2BVVA 2ZX1A 4HN0A 3AM2A 1LODA 4QX5A 1BBT2 2VBDA 3WEZA 3LA7A 4IEWA 1Y9GA 2IXIA 1MS1A 3O12A 4FFFA 2JB8A 2GN7A 2XWBB 4UF0B 1LEDA 2WN2A 2YBKA 4LBQB 2H0VA 3WV6A 3N9QA 4QDQA 3VD9A 2QQPA 1PO23 4HMZA 1JZ4A 4XUOA 1PMIA 3N7LA 2W92A 4IE7A 4UOJA 2D3SA 1I5ZA 4BE3A 2Z2SB 4EWDA 1FOD2 3IDCB 2RR12 5BNPA 1ULOA 2WBKA 2Y60A 1H30A 2HEVF 3DXTA 4DO0A 1X9TA 2BPA2 1YJLA 3PLQA 4XBQA 5FZ0A 3PUAA 3U4XA 4KGQA 1C28A 3AYAA 3WW3A 2QQVA 3NSTA 3T0BA 3RZLA 3EO6A 1E5IA 3NO8A 5C6CA 2WFF1 3MV11 4P02B 2WZPP 4EN0A 5GLUA 2WFPA 2PLV3 3NV4A 1JH5A 1W2NA 5T52A 4JHZA 3TRSB 4IEZA 1PM4A 1QHDA 1WLTA 4MSVA 4QHOA 3BI3A 2QQMA 2JKXA 5I93A 2R16A 1PZ7A 3HIFA 2H6BA 3T4HB 4QGNA 2JE8A 2WINB 1QJEA 4QQLA 1ZBA1 2GDFA 5C5UA 2VPVA 2IXKA 2ZEYA 1DFQA 2ZEXA 3GCWA 3MF9A 4NJ4A 2GNDA 3ZFEA 5FO9B 3IZOA 5DAQA 3LCPA 4COUA 3IIAA 2PLV2 1GWKA 3OY8A 2OUJA 3IBMA 3PVNA 1R081 5EYYA 1QEXA 3K51A 1LJ7A 3QLQA 2ATFA 4RS5A 4E4DX 3GZTB 2HWF1 5A32B 4XZUG 3Q8AA 1JTZX 5A7QA 4BWOA 4GD4A 1LU2A 1DQ6A 4C1WA 3ECQA 3VKOA 1X36A 1N1YA 4CP2A 1CAUA 2BW8A 3PVEA 5LBCA 5L36A 1H2KA 1RXFA 3EBRA 2Q1FA 3W20A 1MEC2 2LUWA 1ZVFA 5DG2A 3EQEA 4TLGA 4UW5A 3V56A 5JXGA 5EHDA 1PZ9A 3SH4A 1JYIA 2JDYA 3JBG1 1QQP3 5T3NA 3P1IA 4X6RB 3WNNA 4AVSA 1MS9A 1QGLA 2ZGQA 1XPWA 2FZ1A 2ZGTA 3NJYA 4JZRA 2AZ5A 5C8CB 3OD4A 1QWRA 5A3WA 5IVBA 2UU8A 4XURA 4XDOA 4I0BA 3SEEA 1YQ8A 1UOGA 2YUEA 5EZWA 4H3WA 5FP3A 2EIGA 4E9KA 5FZGA 1XYPA 1NCRB 4PHZA 2MHFA 3SISA 1PGW2 4R9DA 5GZDA 5LZ6A 1HRV3 3VV1A 1PZ8A 1S55A 1GWLA 4XW3A 3CJIA 2RJLA 2HLEA 3TNQA 1W6MA 1WA4A 3RDIA 1DGRN 1K5MA 4XOGA 5DQ0A 4LR4A 4G9SB 3OBZA 2OPKA 5C71A 4W4ZA 4NIGA 2PXJA 4QQOA 2B45X 2A73B 1CX1A 4DZGA 5CADA 3KWVA 4FPJA 1TE1B 4XFFA 5FY8A 1IQDC 1OFSA 3RRDA 1XSRA 1NCQC 1HB3A 1KDKA 2BWCA 3LPFA 3E5XA 3PUIA 4HOOA 4Q0VA 5F7UA 3WG2A 2D43A 1AYM1 3J8F1 4QX8A 1KQRA 2R062 1AR73 2A3YA 1LENA 3ZN4A 2XUEA 4CXWA 4Y26A 2CGPA 1QQP1 2VCAA 5K4LA 4TYSA 2ZMNA 3T4VA 1EYBA 4LT5A 1AZDA 4CDWA 2CL2A 2Q1ZB 1V6IA 1VBE3 1AR91 1AVBA 1IKPA 3U1XA 5ACA1 1LKNA 4ASMB 3CDZB 5F1RA 1YEWA 3R6SA 2WLQA 1GYKA 5FPLA 4P9YA 4YLZA 1BK0A 1D0GA 2FMDA 3MFCA 2ADDA 4LHKA 1R1A2 4ZXKA 3PTRB 4EN9B 5C8WA 1SBDA 2E26A 5LK5A 1UN1A 2VG9A 5FZLA 1MS3A 5KWRA 1ODMA 5CNAA 3MIDA 3LIHA 5BNOB 3IIIA 1CX4A 1X9PA 4MGZE 4YM2A 2JDUA 4QMAA 1GP4A 3D6EA 2P4EA 4I01A 5K8SA 4Z82A 5IUQA 4JKMA 4CSWA 5FLIA 3A0KA 5LWBA 1PVC3 3AZVA 3HWJA 2RR13 1PO12 1ACCA 4I3PA 1MS8A 4YW4A 4NIDA 3IAQA 4YW3A 4DXSA 2EA7A 4XC9A 4XF0A 3NL1A 2W47A 2ZGKA 3AP7A 4CCOA 1V6KA 1W0PA 3WQ1A 4XUQA 4FOVA 1GQGA 1WMEA 3DGTA 2G9FA 4IW3A 3BTYA 4ZU5A 5A3LA 2CNAA 1W6OB 1WZXA 1PVC2 5EV7A 5FYHA 3JD72 2BJSA 5K9YA 1EV11 3FLTA 1HRI3 3EMRA 4NROA 2BZDA 2PAMA 2AREA 3JQXA 1BVVA 2ZXQA 4Y4RA 2WYFA 1W3VA 4XFGA 4QM9A 1EAH1 3PU8A 2WT0A 5FOJB 3OGVA 4QB1A 5CB7A 3K4AA 1LHUA 2W87A 4QHBA 4Y1VA 5IVFA 5FZ9A 4FT8A 1SPPA 4AI0A 4JVAA 3QH6A 2XJPA 1CZVA 1FX5A 3ZYFA 2IXCA 4ZS3A 3WP4A 4OI0A 3LGRA 3MYXA 1POV0 5C3QA 1GQPA 2FCUA 3J7HA 3LEKA 3WVJA 5FPUA 1NA1B 4BM8A 3LEIA 3KV6A 1A8DA 2GAUA 1LR5A 2VUCA 4GQ7A 4Y5SA 2IXJA 3RG0A 1VB2A 4A42A 4Y33A 3OCPA 4KQ7A 4Z2WA 4OQ9A 2Y33A 5ACA2 2MNGA 3P6BA 3AXEA 2CWMA 1UYZA 4HLTA 5C70A 2QCSB 5EJ1B 5E1RA 1HLCA 1REDA 2VMCA 3WQBA 4XF4A 1NQDA 4R9CA 5FZCA 1QQP2 2PELA 4GWMA 2JJ6A 1YCIA 5IFPA 4GWIA 4LO5B 4M3CB 1G9DA 1OLQA 4K9SA 1NXMA 4AQTA 3AYEA 3NRUA 4N43C 1NOVA 3KMHA 4JRLA 4R9AA 3ZIWA 2R071 5GLWA 4IERA 4XFBA 1VAKA 2BU9A 5G05L 3I59A 3I8TA 3AZZA 2BRTA 2K2SA 4K7JA 2TBVA 4O61A 2JEMA 4HKOA 5JUVA 2ZTNA 4NHLA 1RUOA 2VE1A 2XXZA 5C4WA 5HCHA 5FLJA 3ILNA 1W8OA 2W0XA 4META 3FFQA 3HOBA 4BHPA 4UAPA 3AB0A 2B42B 5G04L 1ND3C 5F37A 3R05A 3USSA 5J37A 4IV1A 2PHXA 1BK1A 1RYYA 1QJY3 1BBT3 2JX9A 3KV5A 4NHMA 2VNOA 4MGTA 1ND3A 4B4PA 5FO7B 3AZXA 5JXIA 3NKTA 2RS52 2C26A 2D93A 3OB8A 1MZFA 4PLNA 3PVBB 1N1TA 1TNRA 5A70A 1STMA 1S0EA 3K2OA 4L97A 1RTVA 1XQNA 3H9AA 4OZXA 5FY5A 4IEVA 1WLCA 4YZ4A 5A3TA 1QMJA 1JZ2A 5FZAA 1JI6A 2VW2A 3ZX7A 4GH4A 1FOD3 1VBA1 2WO7A 2GMPA 3SKJE 1L7LA 4SBVA 5LA1A 1CAUB 1W3XA 4HSJA 5FMOS 5IAXA 1HRV1 2W68A 4LOSA 5C9AC 3RZMA 2C9AA 4Z07A 4A2UA 3BPZA 2OQ6A 5J48A 1GZTA 1SLLA 4D7SA 1AXZA 1OLRA 5CBLA 5DG1A 1AR92 1IPKA 2XL7A 2VUAA 1CJPA 1GZ9A 3CF6E 2ZHNA 4JTNA 4IL7A 5JPMB 1LEMA 1Q5OA 5A3NA 3GGLA 1IS4A 4KBBA 3R4DB 3J8F2 5L7OA 4CEYA 2DU0A 5AC93 4QX7A 1OUXA 4J1WA 3RJ2X 1O8PA 1SCRA 3UGFA 4PQQA 5L7OC 4HG6B 4AXOA 2ID4A 4EQVA 4FO9A 1JYTA 5IK4A 2VR4A 5H9SA 5A1FA 3AJYA 1S0GA 1ALYA 1W6QA 2MEV1 4GB31 5DUXA 5A7PA 4CCNA 4E8DA 5KXCA 3KQ4B 1O91A 1PO13 3FUOA 3HNBM 5FKCA 3AP4A 4XFIA 2TUNA 5DDJ1 4Z8BA 3VBOA 1DGLA 2DCKA 2WR9A 3BN6A 3WW1A 4AF9A 4DRRA 5A6YA 2DUQA 5E89A 2A6YA 1H1IA 4LE4A 2XLAA 3IWZA 3HBKA 1I1EA 1A34A 5E88A 1YO8A 2V4VA 5IAVA 5HPOA 1R1ZA 1J84A 2G4IA 1KD7A 1OMIA 2E33A 1Y4WA 3BALA 2A6VA 5FAXA 3WG3A 2BERA 3ZKUA 2BV4A 3JD73 4LBQA 4YYOA 2GP5A 2QDNA 4AVBA 4ZHNA 4W50A 1CZTA 2EVXA 2K46A 4M4PA 1U5YA 2DVFA 3AFKA 4H7MA 1VBC2 4UFIA 3WUDA 1G86A 2DV9A 5FTTC 2E7AA 2ZGLA 2IC1A 1JYVA 4ZXEA 2WDBA 1EUUA 4UFJA 5IK8A 1AUYA 3RI9A 5J3UA 1SMVA 3LPGA 4UI9L 2FHRA 4BQ3A 1UY0A 5JOXA 5H9RA 1QJX2 2J1AA 4TSVA 1Q56A 1K12A 2PQQA 3B3QE 3FBMA 5C7GA 5HCAA 3GCXA 2ZOEB 3ACFA 5CFCA 4RHV1 5HXVA 3GDBA 5T5JA 3LDKA 2EIDA 4LBKA 1JYNA 1XNTA 1OUSA 1PMHX 2VZSA 2EAAA 2HWF2 1ZRDA 4QKNA 4P00B 1G8WA 1VIWB 1W8TA 3GZAA 3UT0A 4E2QA 1XE8A 2OA2A 4JV4A 5FZ7A 3THDA 1AX1A 2X29A 2P3IA 1RUJ1 1SDWA 2V09A 4AFMA 5EJ3A 4YARA 1W0NA 4M01A 5J1XA 2XVKA 1RMU2 1KRIA 3WG1A 1GBGA 1NA1C 5I0UA 1LRHA 3UK9A 5AC91 1TG7A 1KGYA 1JOPA 5F3EA 1F5FA 1MQTB 2ZZJA 3BODA 4R52A 5FKBA 2EALA 3KV4A 3ZVXA 2YFZA 1OPMA 2QNKA 4QPIC 4BQWA 3O7OA 4I2OA 1F8VA 1RMU1 2CWSA 1FPN3 2QUOA 1S0CA 5BV6A 3HT1A 4PI0A 1J3RA 1ZRFA 1XOYA 2YY1A 5FZ4A 2WFF2 4A6OA 1EUTA 5FYSA 1GU3A 2ZJCA 2XBO3 3J26N 1RUI3 2D5HA 4LBJA 5JMCA 3V0AA 5CVRA 5EYXA 5C3OA 1EPWA 1XJAA 4Y20A 4YM1A 5IVCA 1Q8OA 5GZFA 2VVFA 5CA6A 1Z7S1 4LO6B 1OA3A 3MV01 4RHV2 3ZYGA 4QQ2A 4V2WA 2Q30A 2NYYA 2Y8KA 5FP8A 3VZKA 4L2NA 2D7FA 2YB7A 1FPN2 5C5TA 2XQXA 1W2AX 2AR6A 2DTWA 2ZX3A 5KHKA 3VZJA 5FDBA 1LHWA 4D6RA 4COZA 4L92A 4NHKA 3ZM8A 1RUC1 1POV3 3A0NA 4GXLA 4XJ9A 1QJU3 1YNAA 1YFUA 4AFDA 2VM9A 2WQ4A 1VBC1 3M3IA 5JSRA 1AYN3 4Q4V2 4LNVA 4XTPA 4ZY9A 1W0OA 3H1MA 5CYYA 3FL7A 3MF6A 1BBT1 2ZX0A 4NIHA 3KHCA 4Z1VA 4WM7C 3V65A 3ZFGC 1Z7S2 4CDUA 4LE3A 4MYEA 4RGKA 1AL21 2V5DA 2VZQA 4Q8LA 3VBHA 1UKGA 2GZWA 4L8QA 1QJU2 4F83A 4XZPA 3WW4A 1BHGA 1F15A 2E51A 1AR93 4NUBA 1FV2A 3T2TA 4OI4A 4UFLA 1CAWB 2QQIA 3ZMNA 1J58A 5FPAA 3LSEA 4N53A 5ANNA 2E9QA 4GWJA 4W8JA 4P08A 3TN92 2VC9A 2XOMA 5FYTA 3K75B 3AJZA 4GB32 2IVIB 1AX0A 1P8JA 3MI8A 3OSDA 2DYCA 3CL1A 1Z7S3 3IM0A 3N9NA 3PURA 4CCLA 1H9WA 1SCSA 2DVAA 1TMF3 3LSDA 5FXVA 1TEIA 1ZZCA 2W3JA 3H1YA 5B2GB 5AC92 2ZA9A 3VD4A 3WF4A 4WM7A 1OD5A 3HQUA 3K3OA 3NJVA 4FQ4A 1J3PA 5C3SA 2ZABA 4NHXA 3URFA 2WWSA 4ZU4A 2JXAA 3TN93 4HBNA 5AVPA 4EWAA 3GZEA 2Z4FA 4ONUA 3UETA 4Y1UA 1ND2A 1S0IA 3ZXKA 2VZPA 4QX1A 2BP6A 1TMF2 2XJQA 4BQ5A 1JU3A 3LZZA 3VBUC 1AJOA 4LJHA 4TN7A 4FPOB 4QDRA 1SLBA 2VOVA 4HXCA 4DPNA 3WX5A 1HB1A 4XBLA 4AI9A 4HVRA 1ASJ2 1ZZ6A 2B9VA 2C4XA 2YG0A 3AX4A 3MIGA 4AI1A 4B4RA 3DYOA 1KS4A 1SACA 1GNYA 3ZKYA 2R1BA 5HV0A 1V70A 1DGRA 4XUNA 2G1MA 1H4GA 1OOPB 2W1UA 3AYCA 3KCYA 1X50A 5FZ8A 2A5ZA 2VQUA 2WRAA 5DPNA 4CEYB 1ST8A 1AR82 1WMXA 2WLPA 5FZDA 2E32A 3WDYA 4EZ4A 2W2IA 4BXFA 2LROA 2E7TA 1T6BX 3U75A 4OHYA 3SH3A 1LECA 1RUC3 4J6GA 2RG4A 1JMUB 3FC0A 5KXEA 4Q0QA 4Q4W3 1QOOA 5JSPA 3V0BB 4CDQA 4GKXA 1YRZA 4TWTA 5CZKA 3FUQA 3AYDA 3FZ3A 1FI2A 3FLPA 1YQCA 1VMHA 1UPSA 2DUPA 4QAWA 4UXAA 4P14A 5T5PA 4IXLA 1QJY2 4JRAA 2C9KA 3POEA 2ORXA 2CHHA 2Q8OA 2HWF3 1UU4A 3ZXAC 3RS6A 3POJA 4EJRA 1RUI1 1UY3A 3B94A 1GR3A 3CJIB 1O8SA 2JE9A 3D0JA 1B35C 2RDRA 4FVVA 4IQPA 4CDWB 2R072 1L7QA 1Q8PA 2VNRA 3NNGA 5JOYA 3I2OA 2OPWA 3MDPA 3ZN5A 3K4DA 1W6QB 5LEJA 2BBVA 1I9RA 2OUHA 3AMNA 4BMBA 5C8CC 3S5QA 1OA2A 4GULA 2P3JA 4TXWA 4B7KA 5FOBB 1NLQA 1ZRRA 2WN3A 5C8CA 1ULPA 1VLNA 4XXPA 5D8AA 2FBEA 4YFWA 1D4M3 2JDNA 4YVWA 5FZOA 2Q5TA 4P9GA 5A7WB 1RUJ3 1H6YA 1N3PA 2WFF3 4NVPA 3WDWA 3H1WA 2WNOA 2XBO2 2ZX4A 1F5JA 4Q2FA 1AF9A 3AKRA 2NPIA 1GWMA 1K45A 5C4WB 4NWVA 3PHMA 2QQWA 1WW5A 1WKYA 3ATGA 3B69A 2R063 4FP3A 2ZHMA 4NE9A 1DQ2A 5BY5A 3USUA 1FV3A 4XUPA 3S0MA 2HYKA 4MXWA 1MS4A 2B8MA 3RQ0A 1HRI1 1J1TA 1SLTA 1PM7A 2KR2A 1O5LA 3AZWA 3C7HA 3QH7A 3C7FA 2BGCA 3J8F3 4IGPA 4XQWA 4CCCA 5CISA 4CDXB 1SBEA 2IVJA 4NOTA 3RZHA 1VBE2 2Y6JA 3WLUA 4IV3C 4MZUA 4INDA 3DECA 4AEDB 1MZ5A 1AR63 1IKQA 4XACA 5FK7A 4MVTA 5GZGA 3HN1A 1Y3TA 4LMFA 4JKKA 4MG2A 2DUOA 5IFTA 3U0ZA 1X8EA 3GYDA 4MGSA 5DAVA 3JD71 2E6VA 4AHXA 1PVC1 3VKNA 3FWEA 4XJ8A 1VBD3 5JXHA 5FZ3A 2BOIA 1B35B 4AAXA 2DDUA 2R041 4OMCA 2PMWB 3VZNA 3TEYA 4PLMA 1RUD1 2YGMA 4LK7A 5A1AA 1AR62 5K0UA 5GLTA 1ODNA 1DQ0A 2VMHA 1GV9A 5F5IA 1ENSA 1UY2A 1PIV1 1LGBA 1B09A 1CJDA 1F35A 3BCWA 1PO11 3N9LA 3NMBA 5FRAA 5LB6A 3T2PA 2EXHA 4KU8A 5F8PA 3TBDA 4GMP1 1QXPA 2Q0AA 4I09A 5F5AA 1W6NA 4QPGA 3ZSJA 2VULA 3O0WA 2DU1A 1U5XA 3BTZA 4K21A 3I7DA 2RV9A 4LO4B 5FXZA 5C3RA 1UZWA 1UIKA 1VBE1 2VVEA 5ERLA 3H0OA 4ZZ5A 2WUHA 3ZFEB 3B9CA 1C4RA 1PK6C 1FYUA 3L2YA 5FWJA 2ES3A 4B7EA 2ENRA 1HRI2 4X6QB 1XE7A 4EN6B 3BTXA 1C1FA 4YW2A 1GKBA 5I0DA 3VZLA 3CZUA 4R9BA 5AFBA 4CXXA 2D3RA 2UY8A 1RUF1 2PN5A 4NRPA 1MVQA 1OOPA 2BVBA 2W1SA 4A6SA 2XBO1 5FY9A 2HKXA 2Z79A 5FYCA 4C0BA 1MR5A 2NMNA 3N36A 4A3ZA 2ZEWA 1RMU3 5LBFA 3FHAA 4AZZA 4OLLA 4GWNA 2R061 1MQTA 1RL3A 4M0HA 2Y0IA 3ZXDA 1RC6A 1A78A 2ZKLA 2A7AA 5FYBA 1S1AA 2Q8CA 2VTFA 4BK5A 4C91A 1AR83 4D7YA 3N35A 2LW8A 1DDLA 1HQWA 3N3HA 4RFRB 1Q8SA 5GJ6A 2CSGA 3D8CA 4RR3A 4NO4A 2XKOA 3ETQA 4C90A 1RUI2 4AFAA 1DBNA 5KXBA 4BH9A 2B5HA 3KLSA 3WDXA 2BNMA 1QJY1 5CG8A 4HSLA 1JUHA 4X8PA 4LOTA 3VHPA 4IGOA 1HV1A 4RHV3 1YWKA 2JG8C 2J22A 4KG8A 1YQ6A 1AHSA 3UJQA 1G9CA 1RUG1 1HQLA 2X09A 4Q4Y1 3PJYA 4YGEA 4QKBA 4XHBA 1XB9A 5BNNA 2OT7A 3TAYA 3WXPA 1JHNA 2FMYA 4G3YC 4RN5A 1YHFA 3LDRA 4GALA 3UYJA 2IFWA 2HWB3 5FBJA 2BGOA 3WG4A 2PTMA 1O59A 5A33A 2QBXA 3AP6A 4UBGA 3JQWA 2DCZA 3NNJA 2GN3A 2WNUA 3ZSLA 1H6XA 5JZGA 5FZBA 4DMIA 3HNYM 2RDSA 2RS53 1M4WA 1RJ7A 2I74A 2FD8A 2QQKA 2QTWB 3VBSA 1NZCA 2WABA 2WAOA 3USUB 1NZIA 1V6LA 2JG9A 5FCCA 3OPWA 4LKDA 4OCTA 3VBFB 1RIRA 1RINA 1JODA 5DAWA 1XRUA 4NIIA 5E8AA 1L3JA 4AVCA 4GH4C 1HN0A 2VMFA 4R4ZA 4DIQA 3HN3A 4AGGA 1ZBA3 5T5OA 3U37A 1NE4A 4Q4X2 3AKQA 5GLVA 5A7WA 2A6XA 2FCTA 2D3PA 5I8TA 1O3SA 2OKXA 1ZA4A 1IOAA 3I2HA 1R082 2V5YA 4RYDA 3RMXA 1CR7A 4KI5M 2UY9A 4X8NA 4AE2A 1XXNA 2WZR2 4OUMA 3VKMA 1E5RA 3WF3A 4H7LA 3W5MA 2J1EA 1FOD1 2YPDA 3FX3A 1XYOA 5FBZA 3TYJA 3PUQA 3M4FA 3HR9A 2EICA 1V9U2 4RQPC 3R4UA 4D6QA 5DMYA 4LO7A 3WHUA 5BXXA 3L9JT 1ZZ9A 3M3OA 2XB6C 4CXYA 3WCRA 3ZXEA 1JU4A 4KH9A 2GC2A 2EIBA 5KC5A 4WV8A 1VBD2 1OH4A 1RHI1 2O0OA 1UX7A 1XU2A 2QZ2A 1AX2A 4DXZA 5FP9A 2W95A 3DPRB 1RUH3 5F6KA 1W6NB 1AL22 3K46A 4OHZA 5FUNA 3S7EA 3WOGA 3VHRA 1ZREA 2CU5A 2YXSA 4WVMB 3Q8FA 1G9AA 5F9TA 2ZMLA 4U36A 1LB2A 1PGW1 3RI8A 4AVTA 5FZFA 4YGCA 1ONAA 1DYKA 3LEMA 3AZYA 4XPVA 5DUUA 3VDDC 3N4MA 2WA3A 1RUG2 4IE4A 2JDPA 2JDHA 4FPFA 2DVGA 1JOJA 2HWD1 5IJRA 3LFIA 1NLRA 3TNPB 1ZZ8A 2VBBA 5KR7A 4YVSA 3VDCA 1AL23 1RUC2 1RGSA 4HFSA 4C0HA 2P37A 4KL1A 4ZS2A 3W9AA 1DIWA 4Q4W2 4C1XA 5L7OB 5IVVA 3AL6A 1CWPA 4M00A 2EF6A 1CAVB 2R49A 4N7UA 1I5PA 1RVF3 2PHDA 1CGPA 4UFKA 5LBEA 5KC6A 3T2QA 3ZFGB 5FPBA 1VBC3 5FYUA 4C8DA 4A7YA 1KJRA 5DZGA 2NQYA 2NMOA 3GF6A 2WT1A 4NR1A 1HXS3 5I91A 2XKPA 2PHWA 3POSA 3DF0A 5T55A 4CDXA 2H6CA 3J7NA 1DHKB 3VBRA 3ILRA 4PF5A 4EN8B 5FJHA 5ABJB 1QU0A 1J59A 3ACGA 3WNLA 1RVF2 4Y5Z0 1UW8A 3C7EA 4Q1PA 4FOYA 1QXRA 3MPBA 3DEMA 2OS2A 4B3NA 2YBSA 1LHNA 4Q5OA 4M3CA 4BOWA 4IEOA 2AGSA 5CKQA 3IDAA 3O1TA 2D6NA 4W65A 3SMHA 5M0TA 3W58A 3PNAA 3CKHA 4KG0A 1JZ8A 3NV2A 1NQJA 3SEPA 1ZNPA 3CQOA 4IESA 1NCQA 1E5SA 4RR3C 2B39A 5FK8A 1RUJ2 5FXWA 4IV1C 5H9PA 5J98B 3VDDB 2Q8EA 4CTEA 2IWGB 2DTYA 4XIOA 5BNOC 3ZXFA 4FSJA 2GP3A 1OHFA 4NPRA 1VAVA 4JC1A 3SCGA 2J1UA 1YUDA 4M0NA 3J9SA 2JIJA 3BB6A 3ZMOA 2QE3A 2YC4A 1QY4A 2YU1A 1QJX1 3I4IA 2HEWF 4MV2A 4OI2A 1RUNA 1K42A 3PUHA 1ZA7A 5FXXA 3ZYRA 4CPBA 4ARYA 1LULA 4LULA 1DG6A 2QVSB 2JIGA 4DFSA 1W8FA 1H2MA 3GBFA 4K20A 5FREA 5J7MA 3BIEA 3POYA 3O0XA 5LA0A 1EAH3 1ZBE3 2VW1A 1TME2 4JCKA 4FPLA 4OQ8A 3CHXA 1US2A 3M3EA 2E63A 4LBQD 2WO2A 1ZRIA 4XJWA 1ZZBA 2W46A 2VU9A 2Y38A 4L99A 5CKMA 3THCA 2ZAAA 3MIHA 4BYYA 3H8RA 1O3TA 5FYYA 1UZVA 3OGGA 4CCKA 3RPQA 3CNAA 2CGNA 2J42A 2WZEA 3AVRA 2VOWA 3I2DA 1IS3A 1GZCA 5FO8B 4DUXA 1LGCA 1OT5A 4E2SA 4FTSA 3WF0A 2A71A 4CEWB 4DRVA 5BNNB 5I8YA 1XU1A 2XHNA 2R32A 1ULDA 2XHKA 4FXGB 2VXRA 1J1LA 4QKDA 3E6CC 1AYN2 3QCWA 1KJLA 3HVDA 4Q4V3 3VBOC 1W04A 3TB0A 3M8LA 4IEYA 1UZ0A 5C3PA 1SEFA 2RMU2 1DYPA 2Q1MA 2WO1A 2VMEA 5K7PA 4N8MA 1TNFA 5JI7A 1VMFA 3IAPA 5FPVA 5A6ZA 5F6LB 4B1LA 2JD4A 3RMYA 3WP5A 5HV4A 2NM1A 3DYPA 4BB3A 2WZR3 2RS32 4LO8A 1VRH1 4K3UA 4PDWC 3O1UA 4CP9A 2CY6A 1BMV2 4YZ2A 3DCQA 1FAYA 1I6XA 4CZSA 4FPHA 1UOBA 4P5YA 5F2SA 2BUKA 2WWJA 4QU2A 1V9U3 1QDCA 4N9HA 2WSUA 5FUIA 1UU5A 1W6PB 4DNYA 4XQ4A 4K8FA 1GOHA 4CU7A 2VZUA 4GB33 2XG3A 1H1AA 4N7IA 3OBTA 4OHVA 4AFBA 4FCAA 3T1MA 1Y9QA 4A3XA 1QNWA 5JR2A 2ZEZA 4PBPA 4FQZA 1ENXA 1F4AA 4FFIA 1GNZA 1E57A 3C3VA 4WM8C 4WM7B 4XJAA 4WM8B 2DVBA 2VZ1A 3U4SA 4TLFA 2VUDA 3SNMA 2JG8B 2WNVA 1NKGA 3UKTA 1DQ4A 2V73A 2W1WA 3H50A 3KVBA 5FUPA 2Q8DA 1IS5A 3VBHC 4OVEA 3WY6A 2VBPA 2Y6FA 1G7YA 3U14A 3VD7A 4BQ1A 2RJ2A 3NWKA 2W5FA 2AUYA 2XMLA 3LIGA 2DFCA 1AL0G 1HN1A 2CYFA 5FR3A 4HT1T 3OG2A 3D0SA 1UPIA 1CONA 4FOWA 1ZBE1 3E6DA 1COV1 1OQDA 1SZBA 3AMQA 3VL9A 3BVCA 1ASJ3 1S0DA 2CAUA 1IHMA 4N43B 3R4SA 2PHUA 3CEWA 2EXIA 1U5IA 2JE7A 1VMJA 4DS0A 3OBAA 5I8SA 1RITA 4MXWB 5KHHA 3S6PA 4PBOA 1BCXA 2A70A 2B46X 2CTVA 2YFUA 4JGZC 3ENRA 1AR81 3WP6A 1WW7A 2EAKA 5H9QA 4BXSV 3ZLIA 5J96B 2FDFA 2VH9A 4ARXA 2WS93 2WC2A 1NE6A 3EB7A 2JWPA 2QQNA 4YW5A 5FZEA 2VMGA 2YZ4A 1TVGA 2BGPA 4KGGA 4QX2A 4XXAA 5FY4A 5K0UB 4CDXC 5CAZA 3B02A 1JOBA 2UYAA 5B4NA 1N3QA 5C9AA 1W8NA 4FPKA 4PF1A 2QQOA 3HAGA 4QHZA 1SBFA 2HWB2 1ASJ1 4IETA 5F3CA 1V6JA 2ET7A 5DAXA 3ZYPA 1Q43A 4BQ2A 1VBB2 3M7AA 3MPPG 5F3IA 3KT4A 4XCAA 2VECA 1Y7BA 3CJXA 1H8TB 2XJTA 1VPHA 1WA6X 5HXMA 2KA3A 4JDOA 2AC1A 3I3EA 3BIWE 4FXKB 4D8MA 4CU9A 1VP6A 3J7LA 4XTMA 1OLMA 3WDVA 4I0AA 3ST7A 3IPVB 3FJSA 5E16A 5EFUA 4ET7A 5CKNA 1BXHA 4QU1A 4HANA 3VUOA 3LA2A 1NLSA 2R073 3FBYA 4IEQA 3ZFFC 5HBAA 1BMV1 2CAVA 5CIRA 1JUIA 3D4KA 2D97A 1FT9A 5LY2A 3DPRA 4DEQA 3TWIA 4QPYA 1UNBA 2D6OX 2G9ZA 2O14A 1W6MB 2RM22 1DGWA 4B8EA 4CCDA 3GJBA 1CESA 4LKSA 1D4M2 3VBRB 2IFRA 4YW7A 1S0BA 1OI6A 4NRQA 5D8AB 5JAXA 5I0RA 1DLLA 1REEA 4MOAA 5FY1A 4XIKA 1V0AA 2J1TA 1EAH2 2LALA 3ZFGA 5AVAA 1TME3 2ARXA 4A7ZA 4AR2A 2HWD3 2AACA 3ZFFB 5IW0A 3ZFFA 3WP3A 3GBWA 1WUVA 2QQLA 3OUIA 4S2GA 1OURA 4QPIA 4RFT0 4PIYA 3E5UA 5LA2A 2D98A 4FPYA 3ITQA 1NCQB 3THPA 3O14A 1JS9A 1O4TA 3MW3A 2BYVE 2G19A 5D21A 5FP4A 5IVYA 3VL8A 4I3GA 4AHYA 4BISA 3WF1A 3RNSA 1OVPA 3JZVA 1NY71 1VAMA 1DF0A 1IG0A 1WCDJ 4XETA 2HWD2 3OGRA 1CIYA 4BZ4A 2P3KA 3SC7X 2VO5A 1FPN1 5A1LA 1ULCA 3LD8A 1F9KA 5IVEA 3OY8B 2ERFA 5FZKA 2ARBA 3LWCA 2W08A 3ZSKA 3ROUA 4RS5B 4ATFA 1PO21 1W9TA 2RS33 3B93A 1PNGA 3V0BA 2WQZC 1HJFA 2FDGA 4ES9A 4AYUA 1RHI2 1OKOA 2ET1A 4BIOA 4AEDC 1UCXA 1V00A 3NJZA 4I02A 2P1BA 3WNPA 4LITA 3DL3A 2V4AA 3KVAA 2QJVA 3LQCA 1EY2A 2PA7A 2WJSA 3B5LB 1R1A1 3IN9A 4LBOA 4Y24A 1G9BA 4AFCA 5JDBA 4Q1RA 3T0AA 5A6QA 4V1PA 3O1PA 3RWKX 1G6NA 3MHZA 1YLLA 4QQPA 4CU6A 5DXDA 4EN7B 4PJYA 1UYPA 3N7MA 4FFGA 3ELNA 4AWDA 1LGNA 1U5ZA 1JW6A 3H3ZA 3KGLA 3POWA 2XR4A 1UYYA 1T2XA 1EPZA 1Z0HA 1UO9A 3KF3A 4FTEA 1BEV1 3OEBA 4JGYB 3KT1A 3U07A 2OZJA 1JZ3A 2HBTA 4P9IA 1DYOA 2VCCA 2X5IB 3NJXA 5JWPA 2ORZA 3I3MA 4YZ3A 1URXA 2VGDA 2R6QA 3VLBB 5CU1A 5JOWA 5FY0A 2C5DA 1OVSA 5SV5A 3SCFA 3ZN6A 3NAPA 4YRDA 2K9ZA 5EJZB 4CDQB 2CV6A 4XYXA 2UWBA 2AEYA 2WIIB 3N7KA 1UU6A 4Q4W1 1UXZA 3ZOIA 5A33B 4I30A 4IDZA 5IATA 5JIAA 5LEKA 1J3QA 2YGLA 2WNUB 2D6LX 1UWWA 2DCJA 4Q27A 4Q4Y3 5FP7A 1SLAA 1WCSA 2VNGA 4AHZA 1HB2A 4LIVA 4GIQA 4UW6A 3M3QA 5IHRA 1W8UA 3I2IA 3N9PA 4LKEA 4QXCA 3LEGA 4P9JA 4D3WA 1SFYA 2VZ3A 1X7NA 1GICA 2FQPA 3ILFA 4FP2A 4L0PA 2R1DA 2WNVB 3AKTA 3I2JA 3J4UH 2NLRA 4GZ9A 3AP5A 3I3DA 4HPKA 3NNLA 3HMYA 5CFDA 4EV0A 4Q4Y2 1HJGA 3AXDA 5I0TA 1JZ5A 1WCUA 2ZGMA 4KMQA 3RJRA 3WINE 2O8OA 3ZN6B 2N7GA 1VBD1 1F2NA 4CDUB 5GM0A 5KBFA 2I07B 2X10A 1U12A 2B9UA 4R4XA 1X33A 5FWEA 1MEC1 3TOJA 3OPZA 3D5OA 3K48A 1MPXA 2ZHLA 4LBMA 4XHXA 4RGGA 4AW7A 1LAJA 4FPGA 2BEOA 5IWFA 2HWC1 2GMMA 4BJ0A 1C3HA 1N3OA 3LB9A 2PHLA 3GXUA 1W2OA 5KHJA 3S5AA 1Y9MA 1H2NA 2ZS6B 1V6MA 4Y1ZA 3WNKA 2DCTA 3H8XA 3OF1A 4PIXA 4ASKA 3CO2A 4BLIA 1W2TA 4DY5A 3V0AB 2OW4A 3ABZA 1QH7A 3BOPA 1YIFA 4LBNA 1MZ6A 1OBNA 1SLIA 3L2HA 4LQRA 4AGVA 3VBUA 5J36A 1YFYA 3ZYBA 3CLPA 3W21A 1GUIA 3LAGA 4ISRA 1ZBA2 2IZWA 5F5QA 4FOQA 4LORA 1JXNA 2VUJA 4Q4X3 5A3MA 2A1XA 2VNVA 3NAPB 1HX6A 4HVOA 1FMD3 1R083 1SLCA 3Q8CA 2D6KA 2QQJA 5B4XA 4O9EA 3N9OA 4P5HA 4Y1XA 1F4HA 2D5FA 2WL1A 2NZ9A 5D8AC 4ZU7A 4BA6A 1MACA 5LBBA 4RQPB 3SLIA 2TNFA 1KXGA 1RUD3 4LLFA 4FAGA 4O9GA 4BQXA 5F39A 1VJ2A 2IXHA 4KBZA 1PHMA 1XSQA 1S0JA 2RS11 3FE5A 4HONA 4Y4YA 5F3GA 5F32A 2RS51 4LK6A 1WBFA 4YZ5A 1UOFA 4F3JA 4NMIA 2C1FA 3GM8A 4AK3A 3PU3A 1PIV2 4D6SA 4D69A 2IUWA 4UYBA 1NY72 1SFNA 1W8HA 1WWYA 3ZXJA 4GKYA 1RUD2 1RUH2 2O1QA 3BUCA 4XJUA 2HWE1 3G7DA 4Q0SA 3UJOA 1BEV3 1WD4A 2OVUA 5JR7B 2R042 1T6GC 1UQXA 2PHTA 3ZSEA 2YC0A 4AEDA 1CPNA 3NVCA 1RXGA 5DZEA 1Q3EA 1OXCA 4BU2A 2JECA 4UT5A 4WVWA 5ISLA 1WLDA 4MADA 5FYVA 3WQ7A 1RUG3 3F95A 2AENA 3TEZA 3WSOA 3Q9OA 3IKWA 4ITCA 2LRPA 2Y34A 2PFWA 3HT2A 4LPLA 5E6HA 1QDOA 2RHPA 4Z2AA 1MS5A 5T54A 3RYKA 4MXVA 2WSVA 5JLVA 1C1LA 5DABA 2A3XA 4E4ZA 3SH5A 1HKDA 3ZIXA 3OEAA 1BEV2 5FMBA 2XJVA 3NAPC 4YPJA 3ZSMA 3ZXGA 2A6ZA 4AVVA 5C33A 1D4M1 1HIXA 2ETEA 2OZ6A 1PK6A 3ME2A 4OZOA 1VBB3 3A4UA 3AFGA 3I3QA 2JICA 3CJIC 3LE0A 3PIGA 4MUVA 1LOGA 2CDOA 4KNCA 4XDPA 4DOUA 1HXS2 2J7MA 2YROA 3MO4A 4QPIB 4YGDA 1MZEA 2Y6LA 4QPGC 1GOGA 5FZHA 3K3NA 4BK4A 3E5QA 1EV13 1OKQA 2WNUC 2WZ8A 1QXJA 1B35A 2ZBJA 1VR3A 2W52A 2BFUS 4KWLA 3THTA 4BDVB 4ES8A 2GH2A 4ASLA 3WW2A 1HB4A 4MH0E 1UMIA 1IQAA 2GH8A 2LTNA 1W9WA 5CFDC 3M70A 1ZM1A 4MHRA 3VBSC 2BOJA 4D94A 4XE9A 4KU7A 4DXTA 4EZHA 2VZRA 1GMMA 1O7FA 4QGLA 2C6SA 3LF7A 5FYMA 3POFA 4V2VA 4YVWC 3VDAA 1L7RA 1AXKA 2LM3A 3B9IA 1BJQA 2CDPA 2CGOA 3MBWA 3PMEA 4LUMA 1R093 3KCXA 3D82A 1WBLA 3MIEA 4JHTA 4FPEA 4KWUA 4P9LA 3KM5A 4RGAA 5JVVA 3I97A 3NKGA 1C8M1 4ORFA 4D7TA 4NIAA 3RVHA 2PAKA 2JDKA 5FMDA 4NPLA 2NP0A 3HQRA 4IEXA 2ZGRA 1XBFA 1CIWA 3H3LA 5EQUA 3VKFC 4AL9A 3ACHA 3EXUA 1BYHA 1FNZA 2E7QA 2XH6A 3ALQA 5DDJ3 5LY1A 3OTFA 2PAEA 3WNMA 2ZGPA 3VD3A 1N1VA 2VOKA 2FDHA 3S30A 4E4SA 2XVGA 1KDMA 1YI7A 2AEZA 2XVLA 4E2GA 1CZSA 2XJUA 4QQHA 1XNDA 2W1QA 4ATEA 3BYWA 2YBPA 4E8CA 2YU2A 3ZO0B 1UOJA 2BWAA 2Y6GA 4N53B 5A7NA 1PGL2 1PVXA 5GLZA 1IS6A 1ZBE2 2W9XA 3T2OA 3O0VA 1GQHA 4COYA 1S2EA 4AVAA 3IMMA 2D40A 1XC6A 1PX3A 2VOXA 4YNIA 3M1HA 4UFHA 5LK7B 4CRQA 4LKFA 5EPAA 1ULEA 3HJRA 3GJAA 1ND3B 4H14A 4F7ZA 1JZ6A 2BFUL 1KFUL 2RM21 4QDSA 1ENRA 2ZACA 5C9AB 4Q8KA 5BNNC 2PHRA 4AEJA 2X53S 3MLKA 3H7JA 3MLLA 2HWC3 2EXKA 4PCRA 1C5HA 4PQ9A 5A3OA 5BNPC 5KHIA 2VJXA 1OA4A 4OFGA 1D2QA 4XF3A 1GOFA 1TMF1 4OI1A 3AMMA 4DINB 2H0BA 4YZ1A 4YVSC 3I59B 4UF0A 2Y64A 2RMU3 3VDBA 3OD0A 2XL9A 1Y43B 4AI3A 2WS91 4JTOA 4MGKE 4XABA 5FZIA 2R0FA 3K4ZA 3N7JA 5IK7A 4UFMA 1NUKA 1VBB1 1LOAA 3VBUB 3RZGA 4QWNA 3C7OA 3M3CA 4GMP0 1VB4A 2XJSA 3MFAA 4XMAA 3SKVA 2XWJB 5JIUA 1H8TA 3M2MA 4XF1A 3O1MA 4WZCA 4YFZA 3KHBA 4GMP3 3QBQA 3AC0A 4S2FA 1OLME 3ACLA 1H8TC 4FPCA 3IT8A 2GC0A 4OHXA 4NWWA 1YIPA 1AYN1 1PIV3 2F6BA 4HK9A 4AAPA 3EHKA 2JG8A 3ZPYA 1GNHA 1QJU1 1X8MA 5ANQA 4Q26A 3VBFC 1PMJX 2A3WA 2GMEA 4XDQA 2R043 1XYNA 1QKQA 2VQAA 3KD4A 3VBFA 3DXUA 4RQPA 1ULFA 4QXHA 3JB8A 2VMIA 3DN7A 4DQAA 1S0FA 4IEPA 4LTAA 4Y3OA 5L9RA 3GALA 3NNFA 3MZHA 1GLHA 2VY0A 4XF9A 4Q4V1 4UW3A 1ZYBA 2SBAA 1H9PA 2DBIA 4M3CF 2TEPA 3OJBA 3MICA 5JZGB 3POGA 2SLIA 1DGWX 4N43A 5BYNA 4AHWA 5D1IA 4AGRA 3T3YA 2RS13 3JBG2 1D4VB 3H8UA 4N9IA 4Y20B 5A80A 3BU0A 5D2AA 4AQ2A 1SQ4A 1UD1A 3BKZA 4ZKTB 4Q0UA 5FYZA 4A7KA 3RZJA 1LCLA 3IDBB 1NYWA 5FMOL 5CG9A 2ZAHA 5A6XA 5FQ0A 2WS92 3VZOA 3SXWA 4H55A 1DCSA 5BPXA 3D3AA 1NA1A 3DYMA 2VW0A 1OQEA 4HETA 2OX0A 2P2KA 3MIBA 4W6WA 1MVEA 3B00A 3SQOA 1GFF2 2YV8A 1RJ8A 1VALA 3AVSA 2GNBA 2DWRA 2GSYA 4AG4A 4BCUA 2VZVA 3U78A 3WT3A 1F31A 1YJKA 3V64A 3O1RA 4JGZB 2FZ2A 2XPJA 4BQ4A 3GNEA 4COVA 5JCTA 1KFXL 1W05A 4IGQA 5JXJA 3MEPA 5TSWA 5FPXA 1O4YA 4XVHA 4JDMA 1R092 2J1SA 1QOTA 2AH2A 2JENA 3FHIB 2Y6HA 1NCRA 5CFDB 4JQTA 2VL4A 1PGL1 3A21A 1LHVA 1UZZA 4LHSA 2ZGUA 3DKQA 4QM8A 4W6YA 1NCRC 3WF2A 5IYYA 2RM23 2I45A 1DLCA 4IE6A 2G9GA 2BBAA 5GZCA 5DN2A 4TTGA 1GZWA 2JDMA 2RR11 1LOFC 3RZZA 4BIFA 4LEJA 4CCJA 1VBA3 3RSJA 5JI9A 3VDDA
chains in the Genus database with same CATH topology
2X8KA 3B7MA 2WNEA 1WD3A 3FLRA 3BU7A 5L73A 2HWE2 1DZTA 4S2DA 3IDEA 2O8QA 4UBHA 4RS5C 3KB5A 1HV0A 1Z78A 4P9XA 1TQ5A 1YI9A 3KCCA 3AKPA 4JQRA 1IGOA 1FMD1 1AXYA 1Q8QA 2MEV3 1XNCA 1H8VA 1UL9A 4OULA 1ZRCA 1V6OA 2HJIA 3B01A 1X82A 3IPVA 3MIFA 4KWKA 3GHNA 5JSOA 4PLOA 1OFNA 4WVZA 1CQ9A 2C0ZA 4FTBA 3ZFEC 1WW4A 3HQXA 1MS0A 2MEV2 2PYTA 4YM3A 1HXS1 1CAXA 4XJZA 2R30A 3WHTA 4Z92B 4RA0A 5LRSA 3HD8B 5GKAC 1RHI3 4LA3A 3VBRC 3LOIA 3JU9A 2A75A 1JYCA 1EP0A 1LESA 4LLOA 1UX6A 2JG9B 1PNFA 1UZYA 5EWSA 1PK6B 1C8NA 1AJKA 1W39A 5CFCC 1YFXA 4AQSA 3SCHA 2UWAA 1CPMA 1BKZA 4PDWA 1DZRA 3SITA 4OUSA 5DUWA 2ZMKA 3VZMA 3X29B 2Y0OA 2ZHKA 4F8AA 1HRV2 4LUKA 4LBLA 1RUH1 1H2LA 2ZGSA 3NV3A 4DB5A 4AI2A 1DQ5A 3H7YA 4Y22A 2A6WA 3WR0A 2GU9A 4JDNA 1K5MC 3INAA 3ZDSA 3G6JB 2UYBA 1C8M3 4YG6A 3KGZA 2ZX2A 3PMSA 2RS12 3JBG3 2QDRA 3P3NA 4EWEA 2MPFA 3OGJA 1OQ1A 2DCYA 3VKLA 2AYHA 2IXLA 1GSLA 1ND2B 2VQ0A 3LA3A 5HCFA 5BNQA 4JGZA 3LOBA 5DDJ2 1ZX5A 1W6PA 4XFAA 4CYDA 4COWA 1LOCA 4L9BA 5A32A 1DU3D 1YXWA 3VHNA 1H1MA 1V9U1 3WDTA 1RUE3 1W6OA 4GA9A 5J09A 3UKVA 4MGYE 4CDWC 4HPKB 3QOPA 4GH4B 4MX3A 2WZR1 3KSCA 3U11A 1C57A 1RB8G 1A3KA 2XUMA 3MLJA 1R1A3 1V6NA 5FQ0B 2Z5WA 4Q4X1 4SLIA 2XJRA 5FPZA 1A6CA 2HWC2 2ZPXA 1RUE2 4WM8A 2Z42A 4RL7A 3DUIA 3PJQA 3PVOA 1QH6A 2Y26A 4J1XA 1BQPA 2D6PA 5ABJC 4IV3A 2ZGOA 1AR71 4I0WB 1LOFA 4OHWA 2ZCWA 4AEMA 3NV1A 1IPJA 1VBA2 1DZQA 3LKJA 5SV8A 4IV3B 4IEUA 3VBSB 1LHOA 1CN1A 4FBFA 2HWE3 4WBBA 4U2AA 1PO22 1WCKA 1ZZ7A 2GC3A 5BUVA 3DV8A 1N47A 4QT6A 1HW5A 4K6BA 2WNVC 3FFZA 3W59A 3ZYIB 2P17A 4K1ZA 3CU7A 4YW1A 1LU1A 1FMD2 3OBRA 3R0RA 1GANA 2D44A 3QACA 2UURA 2RJKA 3UV9A 1QF3A 3ASIA 4HKLA 4E27A 3KZ4C 2DURA 3I54A 1S2BA 3HBZA 3P3PA 4AQ6A 1JN2P 2B7YA 3C2UA 4JGYC 2OYZA 4B4QA 1C5IA 1U0AA 3UKNA 1WGPA 2F4PA 1PGSA 2K0GA 4QXKA 4K1YA 1NG0A 4Y1YA 4YGBA 4KWJA 4RR3B 5C4WC 1HQNA 3AP9A 5ACA3 1K5MB 3OYWA 2ZKNA 4QPGB 3RYRA 1R091 3WD5A 1FATA 4LA2A 1NXD1 2X5IA 4LHNA 2JDZA 4JGYA 4YG0A 1RUF2 4JAAA 3ZYJB 4RSUA 1XNBA 2GNTA 5L19A 3DPRC 2RE9A 5DZFA 3AMHA 4YM0A 3RYPA 5EXOA 2YHJA 1ULGA 4WVVA 1BZWA 4XMIA 4YVSB 3O5SA 1WMFA 1N1SA 4K40A 4CEWA 5HCBA 1LOBA 4L11A 1VRH3 2XLGA 2PHFA 1ENQA 4PDWB 1AYM2 4XBNA 4M3CE 3AK0A 1O3QA 1CVNA 5BNOA 2QZ3A 1EV12 2HEYF 4Q0PA 3NW4A 1G9FA 3QD6A 1KITA 4AI8A 5ABJA 3WQ0A 3MW4A 3VBOB 2R0HA 1YYNA 1APNA 1AR61 4BMEA 1UAIA 2Z69A 3WUCA 2ZZQA 4N53C 3ZXLA 3APBA 3EJKA 4B29A 4YVWB 1XNKA 1S2KA 4CEYC 2NN8A 1CAXB 1CAVA 2JKBA 1I3HA 3IMNA 4P9WA 5FFOC 2E53A 5CFCB 2DF7A 4ISQA 1DQ1A 4S2HA 3DKWA 2BTVC 5T5LA 2DFBA 5JOZA 3RWNA 5IK5A 2GALA 3U10A 2QFEA 4WZFA 4Y22B 2OIIA 1JBCA 4QD2A 1QNYA 2KM2A 1FXZA 1D2SA 1QJZA 3PTYA 4N90A 1AR72 2YDEA 1BVP1 4HKWA 5GALA 5AFEA 2XGXA 4HZFA 2D6MA 4CP0A 1YFWA 1Q8VA 1RUE1 3E97A 3VHOA 1ND2C 4BLJA 1WMDA 5IT6A 2Q4SA 1O3RA 3SHRA 2PLV1 1GZWB 1HDKA 2QKDA 2KXLA 1IZ3A 2BNNA 2ZGNA 3ES1A 2RS31 1O5UA 2HWB1 3ES4A 3WCSA 4PIZA 4URTA 5KHGA 1WLWA 4TZDA 4CDQC 1H0BA 1LTEA 1QOSA 4XEZA 3GBGA 5GZEA 4CDUC 3KT7A 3WZ1A 2RMU1 5HI0A 3H3UA 3BOWA 2P34A 3TN91 4AEKA 1D0HA 2BNOA 4BPZA 3AKSA 4EROA 5JPNB 4HVQA 4CEWC 4FAHA 3KS7A 1A8MA 4XILA 3GZUC 4RD7A 1MEC3 1OPOA 3UL2A 3T1LA 2I2SA 4WVMA 2BQPA 4HK8A 5BNPB 4HN1A 3E6BA 1M06G 4YG3A 3MW2A 1WW6A 3FMGA 1QJX3 4G4FA 1COV2 4MGIE 4LHLA 5KXDA 2VVDA 1TME1 4QGMA 4XQDA 2WKKA 5K0UC 1UKRA 1C8M2 3GHMA 3VN4A 5FLHA 2YYOA 3JB4C 4MLOA 3JUUA 4Q29A 3WDUA 3AMPA 1UF2C 1W2UA 2X5IC 1COV3 3VGIA 2GC1A 3JCIA 5T50A 1RUF3 4DY3A 2WT2A 1CAWA 4HL0A 1OOPC 4IV1B 1POV1 1CD3G 3VBHB 3WNXA 4NN0A 1REFA 2EXJA 2GNMA 4XFCA 3S7IA 3KQRA 4R8HA 3MGUA 1FNYA 5DUVA 3OYWB 2ILMA 5I0SA 1VRH2 1AYM3 1LOEA 2YMZA 1UIJA 3BTAA 4XFHA 1O4ZA 5LRRA 2DVDA 1RVF1 2UWCA 5JZGC 1H4HA 2WA4A 4YSFA 2XLFA 4UW4A 2JG9C 1MQTC 4CP1A 1OSGA 2YPJA 4W6XA 1UMZA 1KS5A 2W39A 2BVVA 2ZX1A 4HN0A 3AM2A 1LODA 4QX5A 1BBT2 3LA7A 4IEWA 2IXIA 1MS1A 3O12A 2GN7A 2XWBB 3WV6A 1LEDA 4LBQB 2QQPA 2H0VA 1PO23 4HMZA 1PMIA 3N7LA 2D3SA 1I5ZA 4BE3A 2Z2SB 4EWDA 1FOD2 3IDCB 2RR12 5BNPA 1H30A 2HEVF 2BPA2 1YJLA 3PLQA 4XBQA 3U4XA 4KGQA 1C28A 3AYAA 3WW3A 3NSTA 3EO6A 3NO8A 5C6CA 2WFF1 2WZPP 4EN0A 5GLUA 2WFPA 2PLV3 3NV4A 1JH5A 5T52A 3TRSB 4IEZA 1WLTA 1QHDA 4MSVA 5I93A 2R16A 1PZ7A 3HIFA 2H6BA 4QGNA 2WINB 4QQLA 1ZBA1 2GDFA 2VPVA 2IXKA 1DFQA 3MF9A 2GNDA 3ZFEA 5FO9B 3LCPA 4COUA 3IIAA 2PLV2 3OY8A 2OUJA 3IBMA 3PVNA 1R081 5EYYA 3K51A 1LJ7A 3QLQA 2ATFA 4RS5A 4E4DX 3GZTB 2HWF1 5A32B 1JTZX 4BWOA 1LU2A 1DQ6A 4C1WA 3ECQA 3VKOA 1X36A 1N1YA 4CP2A 1CAUA 2BW8A 3PVEA 5L36A 1H2KA 3EBRA 1MEC2 2LUWA 1ZVFA 5DG2A 3EQEA 4UW5A 3V56A 1PZ9A 3SH4A 1JYIA 3JBG1 1QQP3 5T3NA 4X6RB 4AVSA 1MS9A 1QGLA 2ZGQA 2FZ1A 2ZGTA 5C8CB 2AZ5A 3OD4A 1QWRA 2UU8A 4I0BA 2YUEA 5EZWA 4H3WA 2EIGA 4E9KA 1XYPA 1NCRB 2MHFA 3SISA 1PGW2 4R9DA 5GZDA 1HRV3 3VV1A 1PZ8A 1S55A 4XW3A 3CJIA 2RJLA 3TNQA 1W6MA 1WA4A 3RDIA 1DGRN 1K5MA 4XOGA 4LR4A 4G9SB 2OPKA 4QQOA 2B45X 2A73B 4DZGA 5CADA 4FPJA 1TE1B 4XFFA 1OFSA 3RRDA 1NCQC 1KDKA 2BWCA 3E5XA 4Q0VA 3WG2A 2D43A 1AYM1 3J8F1 1KQRA 2R062 1AR73 2A3YA 1LENA 3ZN4A 4Y26A 2CGPA 1QQP1 4TYSA 2ZMNA 1EYBA 4LT5A 1AZDA 4CDWA 2CL2A 2Q1ZB 1V6IA 1VBE3 1AR91 1AVBA 1IKPA 5ACA1 1LKNA 4ASMB 5F1RA 3R6SA 2WLQA 1GYKA 4P9YA 4YLZA 2FMDA 1D0GA 3MFCA 4LHKA 1R1A2 4ZXKA 4EN9B 5C8WA 1SBDA 5LK5A 1UN1A 2VG9A 1MS3A 5KWRA 5CNAA 3MIDA 5BNOB 4MGZE 1CX4A 4YM2A 4QMAA 3D6EA 4I01A 5K8SA 4Z82A 5IUQA 5FLIA 3A0KA 1PVC3 3AZVA 3HWJA 2RR13 1PO12 4I3PA 1MS8A 4YW4A 4YW3A 2EA7A 4XF0A 3NL1A 2ZGKA 3AP7A 1V6KA 1W0PA 3WQ1A 4FOVA 1GQGA 1WMEA 3DGTA 2G9FA 4ZU5A 5A3LA 2CNAA 1W6OB 1PVC2 5EV7A 3JD72 5K9YA 1EV11 3FLTA 1HRI3 2PAMA 2AREA 3JQXA 1BVVA 4XFGA 4QM9A 1EAH1 2WT0A 5FOJB 5CB7A 1LHUA 4Y1VA 4QHBA 4FT8A 4AI0A 4JVAA 3QH6A 2XJPA 1FX5A 2IXCA 3WP4A 4OI0A 3LGRA 3MYXA 1POV0 3WVJA 1NA1B 4BM8A 1A8DA 1LR5A 2GAUA 4GQ7A 2IXJA 3RG0A 1VB2A 3OCPA 4KQ7A 4Z2WA 5ACA2 2MNGA 3AXEA 2CWMA 4HLTA 2QCSB 5E1RA 1HLCA 1REDA 4XF4A 1NQDA 4R9CA 1QQP2 2PELA 4GWMA 2JJ6A 1YCIA 4LO5B 4M3CB 1G9DA 1OLQA 4K9SA 1NXMA 4AQTA 3AYEA 4N43C 1NOVA 3KMHA 4JRLA 4R9AA 3ZIWA 2R071 5GLWA 4IERA 4XFBA 1VAKA 3I59A 3I8TA 3AZZA 2K2SA 4K7JA 2TBVA 2JEMA 4HKOA 2ZTNA 4NHLA 1RUOA 5C4WA 5FLJA 3ILNA 2W0XA 4META 3FFQA 4BHPA 3AB0A 2B42B 1ND3C 3R05A 3USSA 5J37A 4IV1A 2PHXA 1BK1A 1QJY3 1BBT3 2JX9A 4NHMA 2VNOA 1ND3A 4B4PA 5FO7B 3AZXA 3NKTA 2RS52 2D93A 4PLNA 1MZFA 3PVBB 1N1TA 1TNRA 4L97A 1S0EA 1RTVA 1XQNA 3H9AA 4OZXA 4IEVA 1WLCA 4YZ4A 1QMJA 2VW2A 3ZX7A 4GH4A 1FOD3 1VBA1 2GMPA 4SBVA 1CAUB 4HSJA 5FMOS 1HRV1 2W68A 5C9AC 2C9AA 4Z07A 4A2UA 3BPZA 5J48A 1SLLA 4D7SA 1AXZA 1OLRA 5CBLA 5DG1A 1AR92 1IPKA 2XL7A 2VUAA 1CJPA 1GZ9A 3CF6E 2ZHNA 4JTNA 4IL7A 5JPMB 1LEMA 1Q5OA 4KBBA 1IS4A 3R4DB 3J8F2 5L7OA 4CEYA 2DU0A 5AC93 4J1WA 3RJ2X 1SCRA 5L7OC 4AXOA 4FO9A 5IK4A 5H9SA 3AJYA 1S0GA 1ALYA 1W6QA 2MEV1 4GB31 5DUXA 5KXCA 1O91A 1PO13 3FUOA 3AP4A 4XFIA 2TUNA 5DDJ1 4Z8BA 3VBOA 1DGLA 2DCKA 3WW1A 4AF9A 4DRRA 2DUQA 5E89A 2A6YA 1H1IA 4LE4A 2XLAA 3IWZA 1I1EA 5E88A 1YO8A 1R1ZA 1KD7A 1OMIA 2G4IA 3BALA 5FAXA 3WG3A 2A6VA 3JD73 4LBQA 4YYOA 4AVBA 2QDNA 2EVXA 1U5YA 2DVFA 3AFKA 4H7MA 1VBC2 3WUDA 1G86A 2DV9A 5FTTC 2E7AA 2ZGLA 2IC1A 5IK8A 1AUYA 3RI9A 1SMVA 2FHRA 5JOXA 5H9RA 1QJX2 4TSVA 1Q56A 3B3QE 2PQQA 3FBMA 5HCAA 2ZOEB 5CFCA 4RHV1 5HXVA 5T5JA 4LBKA 2EAAA 2HWF2 1G8WA 1VIWB 3GZAA 4E2QA 1XE8A 2OA2A 4JV4A 1AX1A 2X29A 2V09A 1RUJ1 1SDWA 2P3IA 4AFMA 5EJ3A 4YARA 4M01A 2XVKA 1RMU2 1KRIA 3WG1A 1GBGA 1NA1C 5I0UA 1LRHA 3UK9A 5AC91 1MQTB 1F5FA 2ZZJA 3BODA 4R52A 2EALA 3ZVXA 1F8VA 1OPMA 2QNKA 4QPIC 4I2OA 3O7OA 1RMU1 2CWSA 1FPN3 2QUOA 1S0CA 5BV6A 3HT1A 1J3RA 1ZRFA 2YY1A 2WFF2 2ZJCA 2XBO3 3J26N 1RUI3 2D5HA 4LBJA 5JMCA 3V0AA 5CVRA 5EYXA 1EPWA 4YM1A 4Y20A 1Q8OA 5GZFA 2VVFA 5CA6A 1Z7S1 4LO6B 1OA3A 4RHV2 3ZYGA 4QQ2A 2Q30A 2NYYA 3VZKA 4L2NA 2D7FA 1FPN2 2ZX3A 2DTWA 2AR6A 5KHKA 3VZJA 5FDBA 1LHWA 4COZA 4L92A 4NHKA 1RUC1 1POV3 3A0NA 4GXLA 4XJ9A 1QJU3 1YNAA 1YFUA 4AFDA 2WQ4A 1VBC1 3M3IA 5JSRA 1AYN3 4Q4V2 4LNVA 4XTPA 1W0OA 3H1MA 3MF6A 1BBT1 2ZX0A 4Z1VA 4WM7C 3V65A 3ZFGC 1Z7S2 4CDUA 4LE3A 4MYEA 1AL21 4Q8LA 3VBHA 1UKGA 2GZWA 4L8QA 1QJU2 4F83A 4XZPA 3WW4A 2E51A 1AR93 3T2TA 1FV2A 4OI4A 1CAWB 3ZMNA 1J58A 3LSEA 4N53A 2E9QA 3TN92 3AJZA 4GB32 3MI8A 1AX0A 2DYCA 3CL1A 1Z7S3 3IM0A 1H9WA 1SCSA 2DVAA 1TMF3 3LSDA 1TEIA 1ZZCA 3H1YA 5B2GB 5AC92 2ZA9A 4WM7A 1OD5A 4FQ4A 1J3PA 2ZABA 3URFA 2WWSA 4ZU4A 2JXAA 3TN93 4HBNA 5AVPA 4EWAA 4ONUA 4Y1UA 1ND2A 1S0IA 3ZXKA 1TMF2 2XJQA 3LZZA 3VBUC 1AJOA 4FPOB 1SLBA 2VOVA 4DPNA 3WX5A 4XBLA 4HVRA 1ASJ2 1ZZ6A 3AX4A 3MIGA 4AI1A 4B4RA 1KS4A 1SACA 2R1BA 1V70A 1DGRA 1H4GA 1OOPB 3AYCA 3KCYA 1X50A 2A5ZA 4CEYB 2WLPA 1AR82 3WDYA 2E7TA 4OHYA 3SH3A 1LECA 1RUC3 4J6GA 5KXEA 3FC0A 4Q0QA 4Q4W3 1QOOA 5JSPA 3V0BB 4CDQA 4GKXA 1YRZA 4TWTA 3FUQA 3AYDA 3FZ3A 1FI2A 3FLPA 4UXAA 1UPSA 2DUPA 4P14A 5T5PA 4IXLA 1QJY2 4JRAA 2Q8OA 2HWF3 1UU4A 3ZXAC 3RS6A 4EJRA 1RUI1 3B94A 1GR3A 3CJIB 2JE9A 3D0JA 1B35C 4FVVA 4IQPA 4CDWB 2R072 2VNRA 1Q8PA 5JOYA 3MDPA 3ZN5A 5LEJA 2BBVA 1W6QB 1I9RA 2OUHA 3AMNA 4BMBA 5C8CC 1OA2A 4GULA 2P3JA 4B7KA 5FOBB 1ZRRA 5C8CA 4XXPA 1VLNA 5D8AA 2FBEA 4YFWA 1D4M3 4YVWA 2Q5TA 4P9GA 1RUJ3 1N3PA 2WFF3 4NVPA 3WDWA 3H1WA 2XBO2 2ZX4A 1F5JA 4Q2FA 1AF9A 3AKRA 2NPIA 5C4WB 4NWVA 3PHMA 3ATGA 1WW5A 3B69A 4FP3A 2R063 2ZHMA 1DQ2A 5BY5A 3USUA 1FV3A 3S0MA 2HYKA 4MXWA 1MS4A 2B8MA 3RQ0A 1HRI1 1J1TA 1SLTA 1PM7A 3AZWA 1O5LA 3QH7A 4XQWA 2BGCA 3J8F3 4CDXB 1SBEA 4NOTA 1VBE2 3WLUA 4IV3C 4MZUA 4INDA 4AEDB 1MZ5A 1AR63 1IKQA 4MVTA 5GZGA 3HN1A 1Y3TA 2DUOA 3U0ZA 1X8EA 3GYDA 3JD71 2E6VA 4AHXA 1PVC1 3VKNA 3FWEA 4XJ8A 1VBD3 1B35B 2R041 3VZNA 4PLMA 1RUD1 2YGMA 1AR62 5K0UA 5GLTA 1DQ0A 2VMHA 1GV9A 1ENSA 1PIV1 1LGBA 1B09A 1CJDA 3BCWA 5FRAA 1PO11 2EXHA 4KU8A 3TBDA 4GMP1 1QXPA 2Q0AA 4I09A 1W6NA 4QPGA 3ZSJA 2VULA 3O0WA 2DU1A 1U5XA 4K21A 3I7DA 4LO4B 1UIKA 1VBE1 2VVEA 3H0OA 3ZFEB 3B9CA 1C4RA 1PK6C 1FYUA 3L2YA 2ES3A 4B7EA 2ENRA 1HRI2 4X6QB 1XE7A 4EN6B 1C1FA 4YW2A 1GKBA 3VZLA 4R9BA 5AFBA 2D3RA 2UY8A 1RUF1 2PN5A 1MVQA 1OOPA 2BVBA 2XBO1 2HKXA 2Z79A 4C0BA 1MR5A 2NMNA 3N36A 1RMU3 4OLLA 4GWNA 2R061 1MQTA 1RL3A 4M0HA 2Y0IA 3ZXDA 1RC6A 1A78A 2ZKLA 2A7AA 1S1AA 4C91A 1AR83 4D7YA 3N35A 1DDLA 1HQWA 3N3HA 1Q8SA 5GJ6A 3D8CA 4RR3A 4NO4A 2XKOA 3ETQA 4C90A 1RUI2 4AFAA 1DBNA 5KXBA 4BH9A 2B5HA 3KLSA 3WDXA 2BNMA 1QJY1 5CG8A 4HSLA 1JUHA 4X8PA 3VHPA 4RHV3 1HV1A 1YWKA