3FEKA

Crystal structure of the r132k:y134f:r111l:l121d:t54v mutant of cellular retinoic acid-binding protein ii at 1.51 angstrom resolution
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELIDTMTADDVVCTKVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title Crystal structures of apo cellular retinoic acid-binding protein II mutants: Structural integrity investigated through multiple site mutations
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 33
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3fekA00
4NLIA 3WXQA 4NNTA 2ANSA 2WQAE 1FENA 3TZSA 3TF6A 1SXXA 4QZTA 3EBWA 2R74A 4QGWA 1KZXA 1S2PA 4HPBA 3UEUA 1BM5A 2CBRA 3G7XA 3HK1A 1KT4A 3O2YA 3F9DA 4YDAA 1ZNGA 3B2LA 4A8ZA 1HMSA 4N7DA 1LIBA 1CJ5A 4ZJ0A 1ICNA 5H8TA 4XMFA 2Q39A 1LICA 2AKQA 3B2IA 5LJEA 3FENA 4YBUA 1AVGI 3I0AA 1YUPA 3ZUOA 5HTDA 1PBOA 4HPAA 5EDCA 3BS2A 5CE4A 3ELXA 4XMHA 5LKFA 2DM5A 4XMCA 3VG2A 4TKBA 2WEWA 1UZ2X 2AH7X 4ES7A 3DSZA 3FMZA 2NNQA 1T8VA 1DV9A 3SAOA 3L4RA 4R0BA 1YP6A 1QFTA 1SY1A 1U17A 2HYSA 3D97A 2LBVA 2RCQA 2K62A 2Q4NA 4IB6A 5HBSA 3U0DA 3NX2A 2ASNX 3VG6A 2RQ0A 2LKKA 2PY1A 1O8VA 3FA6A 1KGLA 1GT5A 3P6CA 4NYQA 3TGAA 4DQ4A 2YG2A 4I9RA 2NNEA 4AZRA 2FT9A 1E02A 2MO5A 3BSZE 3FW5A 2BLGA 5EZ2A 1DZJA 1ZNLA 1LIDA 1MDCA 1I04A 3C76X 5D48A 2L5PA 1AELA 2FS7A 4A60A 1CBIA 4HFOA 4I3BA 5HCCC 5LJHA 2FWVA 4ZHGA 1DZMA 1EW3A 1JZUA 3FEKA 5IO6A 1KQXA 4IB9A 3BLGA 1SXYA 1D2UA 4TKHA 4YGZA 5IO5A 2W2FA 4IMOA 1E5PA 1BWYA 1VPRA 5HZ6A 3NPOA 1MVGA 4QYPA 1ZNHA 2A3FX 1FEMA 2A13A 4ORWA 4MVLA 3OJYC 1BRQA 1G5WA 1EALA 2FTBA 2A2UA 3APXA 3DTQA 4CK4A 3D95A 3WJEA 4GNWA 4ZHCA 5DPQA 3P6FA 4HPCA 1KZWA 1D3SA 1JJXA 4IB8A 1JYDA 4EEJA 3PPTA 4GNYA 5LJGA 3TGCA 4GETA 4ZH6A 4ZGUA 3MVFA 5EEDA 1EPAA 3IFBA 1XCAA 3NADA 4UU3A 3CBSA 1U0XA 3WJBA 1OBPA 1IFBA 2AT5X 5KICA 4NYRA 4NLJA 5HWZA 4XMGA 4O9SA 2GTFX 5LJBA 4LZVA 4OS8A 4RUNA 2HZRA 3EMMA 3FW4A 4QGVA 1DFVA 1ZNEA 2FRSA 3BX7A 3T1DA 3FEPA 3JSQA 1ERXA 1OPAA 4ZR2A 3CQNA 2P8GA 3EYCA 5DG4A 4LZUA 4LKPA 1IW2A 4D6BA 3ZUIA 2CZTA 2NNDA 3P6GA 3FIQA 1IIUA 1O1VA 5FFHA 5C0NA 2WEXA 3STMX 3BU1A 1E06A 4IB7A 3UEWA 5B27A 1EPBA 1X89A 2A2GA 1X8UA 2POAA 2OVDA 3WJFA 2QM9A 2WUTA 2LFOA 2MM3A 1G85A 4EFGA 1QY1A 1FE3A 5KHPA 1JJJA 3U9PC 5HZQA 4YCEA 2Q2MA 2EU7X 4I3DA 4ORRA 2L67A 1R0UA 4Y0PA 3S26A 3CBCA 1CBRA 4TLJA 4GKCA 2R73A 1N0SA 1B8EA 3EBKA 1TOWA 1QQSA 2ACPX 3NQ9A 4YFQA 4GH7A 1GT3A 1GGLA 4TNNA 3WJDA 2N93A 4BVMA 4QGXA 2HMBA 3AKMA 3MBTA 4IBAA 4M6SA 3O19A 1OPBA 3PH5A 1I4UA 3KQ0A 2AMMX 2G78A 3FR2A 4KIIA 3U03A 3BU9A 1SY0A 1L6MA 1SXWA 1SY2A 4YFPA 4IMNA 1XKIA 3IA8A 1B56A 3CR6A 5EDBA 1NP1A 2XKLA 3B2JA 5HCDC 4ZCBA 5B29A 1YWAA 1LKEA 1X8PA 2AT6X 3FA9A 1UREA 3STNA 4ZHDA 2JU3A 1QY0A 2CM4A 3KFGA 1JYJA 4IAXA 2RA6A 5F58A 3FR4A 1FELA 4HPDA 5D8JA 3KFHA 4QYNA 1T68X 3UEXA 2ALLX 3VG7A 3ZQ3A 1A18A 1A57A 1I05A 3FELA 1HMTA 4TKJA 5HA0A 5HZ5A 1ICMA 3FA8A 1PEEA 5F6ZA 1LNMA 3B2HA 5FENA 1RBPA 4WBKA 4TJZA 3PP6A 1KT3A 2WQ9A 1S44A 3C78X 4OMXA 1SXUA 2F73A 4ZHHA 2L9CA 1SA8A 1DC9A 4Y0RA 2Q2PA 3WVMA 1X8QA 4ARHA 2OFMX 1DF3A 1EQDA 1DZKA 4AZQA 3HWGA 1HBPA 3B2KA 4ALOA 3KFFA 4YGHA 4YBPA 1AB0A 1YP7A 1U18A 4OS3A 5KIDA 3F8AA 3HWFA 3APVA 3P6DA 2NP1A 5H9KA 4XMDA 1AQBA 5F1EA 5LJDA 4BOEA 4N7CA 3KFIA 1G7NA 1PMPA 2HNXA 2X46A 1GX8A 3D96A 5H9LA 1CBSA 5HZ9A 4AZMA 5LJKA 4YGGA 3NQ3A 4YDBA 3VG3A 3Q6LA 1G74A 3NX1A 5BVSA 3RSWA 2AL0X 4WFUA 2JOZA 1X8OA 2OVAA 1Z24A 4YCHA 3I17A 1E00A 1VYGA 2LB6A 1LFOA 1X8NA 3P6EA 5BVTA 2JU7A 2FLJA 3K3LA 3P6HA 1ML7A 4AZNA 4ZHFA 2GC9A 1HMRA 1QG5A 3NR3A 1RLBE 1CBQA 3CWKA 1LF7A 2FR2A 1OEJA 4QZUA 1NP4A 3STKA 2WWPA 2W2BA 1FDQA 3HWDA 3WJGA 4AW8A 1KXOA 2CZUA 2JU8A 5LJCA 5K06A 5EEEA 5HZ8A 1KQWA 1VYFA 3NP1A 4TQ2A 5JR8A 2QO5A 1GT1A 3FLLA 5L8NA 2W2AA 3CQRA 4MVIA 1JV4A 1GXAA 1A3YA 4QAEA 2Q9SA 2RCTA 2OZQA 3EM0A 1ACDA 3PH6A 4YFRA 4AYHA 1TVQA 2CM9A 2RD7C 3AKNA 1GKAA 1HN2A 4YH0A 2KTDA 3BY0A 1OEEA 1B4MA 3RZYA 1IKJA 3WJCA 4ALBA 1TOUA 1P6PA 4XMEA 1GT4A 2FR3A 2G7BA 1A2DA 3VG5A 2WR6A 4AZPA 1YIVA 1OBQA 2KT4B 2R56A 1ZRYA 2L68A 4I3CA 5F6BA 2X45A 2QO4A 3C77X 5L8OA 1X71A 2JN3A 5D47A 1TXLA 4OS0A 1BSOA 3KZAA 3JS1A 2CBSA 5L8IA 2A0AA 3TGBA 1QFVA 1GM6A 5BVQA 5HTEA 2OFRX 3FA7A 4GRJA 5HA1A 2FS6A 2ACOA 4Y0QA 1T0VA 1GX9A 1BJ7A 4OMWA 3QKGA 1LIEA 1LPJA 1NGLA 2E4JA 4Y0SA 1KOIA 1BRPA 4A1YA 3PECA 3BRNA 1OBUA 1YWBA 5H9NA 4A1HA 1KT6A 4ZFXA 4RUUA 3BX8A 5EPQA 1BSQA 2O62A 1FTPA 4YKOA 1EIOA 3PEDA 1SY3A 4MVKA 5AQ6A 3O22A 4IAWA 1QWDA 4YKMA 3WBGA 4NP1A 1ADLA 1MX7A 4YMYA 1GKAB 1IFCA 5FAZA 1KT7A 4ORUA 2QOSC 1IKEA 2AT0X 4ODDA 1PM1X 2LBAA 3APUA 5HAEA 2AT8X 1BBPA 2WSJA 4NNSA 5H9AA 4BQUA 1EUOA 1ERBA 1YWDA 2K23A 1YWCA 1I06A 5D45A 1O1UA 4GE1A 1QABE 3HWEA 1BSYA 1HQPA 1LIFA 1MX8A 3ELZA 4ORXA 1S7DA 3GAQA 5IO7A 1ZNDA 3APWA 3CMPA 1CRBA 1H91A 4ORYA 3BDRA 4UU2A 4EDEA 1EIIA 2QO6A 1BLRA 1JBHA 1BEBA 1ZNKA 1EXSA 2AT3X 1HBQA 4EXZA 1B0OA 2GJ5A 4D6AA 2XSTA 3FR5A 1DZPA 1KT5A 4M7MA 1QY2A 4WFVA 2OVEA 4AZOA 1TW4A 4LKTA 4DQ3A 4PSQA 1OEKA 1ALBA 2MJIA 1MUPA 5D4AA 4ZH9A 4ORSA 3VG4A 5HCEC 4K19A 2IFBA 4I9SA 3UEVA 2HZQA 5LKEA 5F7GA 2G79A 2HLVA
chains in the Genus database with same CATH superfamily
4MISA 3VE1A 4NLIA 3WXQA 2ZAGA 4NNTA 2ANSA 1VWAB 2WQAE 1FENA 2AF5A 1I9HA 1NQNA 3AUMO 3MX7A 3TF6A 3HOEA 1SXXA 4O4XA 5B3MO 4C5PA 4CSBA 4QZTA 1HXZA 3EBWA 1AVDA 2R74A 4QGWA 2RTOB 1KZXA 1S2PA 4HPBA 3UEUA 1BM5A 3JQOA 4KC8A 2CBRA 3G7XA 2QOMA 3HK1A 1KT4A 1VWOB 4GD9A 4NV7A 2KD2A 3O2YA 2RTKA 1SWDA 3F9DA 4YDAA 1ZNGA 3B2LA 4A8ZA 2Y3FA 1HMSA 4N7DA 3RE5A 2RTCB 3RE6A 1LIBA 3SLJA 4CPIA 4QQ1A 1SRJA 1CJ5A 5FQ7E 4ZJ0A 1ICNA 2OY1O 5H8TA 1WUBA 4U3QA 4BCSA 4XMFA 2Q39A 1LICA 1SWBA 2IZJA 2AKQA 2OY7A 1GX3A 3B2IA 4O49A 3WZQA 5LJEA 3FENA 4BX7B 4YBUA 1AVGI 1SWUA 3I0AA 1YUPA 3ZUOA 5HTDA 1JQPA 1PBOA 4HPAA 5EDCA 2RTQB 3BS2A 3SZJA 5CE4A 3ELXA 4XMHA 3SLOA 2X8FA 5LKFA 3U0DA 2DM5A 5B11O 4XMCA 3VG2A 4U8UO 2FHLA 4TKBA 2WEWA 1UZ2X 2IZBA 4O3XB 2AH7X 4ES7A 2BHVA 3DSZA 1SWPA 1T8VA 2NNQA 3FMZA 1WBIA 1DV9A 3SAOA 3L4RA 4R0BA 1YP6A 4O3ZA 1EI5A 1QFTA 1SY1A 1U17A 2HYSA 3D97A 2LBVA 2RCQA 2K62A 2Q4NA 4IB6A 5AJBA 5HBSA 3VGWA 2MF6A 3NX2A 2ASNX 4BBOA 3VG6A 4COTA 2RQ0A 2LKKA 2PY1A 1O8VA 2IZFB 3FA6A 1KGLA 2OF9A 1GT5A 3P6CA 4NYQA 3TGAA 1LCWA 2YG2A 4O3WA 4DQ4A 2FHNX 3VPJE 2RTAA 4I9RA 2NNEA 1LDOA 5FQ6E 2FT9A 4AZRA 1N4JA 1SLEB 1E02A 2MO5A 3BSZE 3FW5A 3OBLA 2BLGA 4CDCA 3WYPA 2MWHA 3X00A 5EZ2A 4O4UA 4Z6JA 3KVNA 1DZJA 1ZNLA 2KTSA 2X8TA 1LIDA 1MDCA 1I04A 1Y53X 3C76X 5D48A 2L5PA 5AJCA 1AELA 2FS7A 4A60A 1CBIA 5CSEA 4GDAA 2VFCA 5IRWA 4HFOA 4I3BA 5HCCC 5LJHA 2FWVA 4ZHGA 1DZMA 1EW3A 1JZUA 4DCBA 3FEKA 5IO6A 3S60A 1KQXA 4IB9A 3FYFA 4OELA 3RWXA 3BLGA 3VHHA 1SXYA 1D2UA 4TKHA 1KL4A 4YGZA 5IO5A 2W2FA 1KL5A 1N9YA 1E5PA 4IMOA 3WZNA 2FGSA 3P24A 1BWYA 4FGIB 4BJ8A 4CPFA 1VPRA 5HZ6A 3NPOA 1MVGA 4QYPA 1ZNHA 3RDSA 3V8UA 2A3FX 1VWQB 1FEMA 2A13A 4CV7A 4ORWA 4MVLA 3ZZVA 1LUQA 3OJYC 1BRQA 1G5WA 1EALA 1K3BA 1SWCA 2FTBA 2A2UA 3Q34A 1VWMB 3D9WA 4U8UM 3APXA 3DTQA 3VE2A 1NDJA 1UYOX 3D95A 3UAQA 3RBYA 4CK4A 3WJEA 4I60A 3EC5A 5B10O 2WPUA 1SRIA 3U03A 4GNWA 2IZGB 4ZHCA 2FKGA 1SWJA 1MOYA 3P6FA 5DPQA 4HPCA 3T2XA 3VG3A 1KZWA 4MIRA 3NQKA 1D3SA 2RTLA 4Z28A 1JJXA 4IB8A 1JYDA 4EEJA 3PPTA 5AEOA 1SWAA 4GNYA 5LJGA 3TGCA 4GETA 4ZH6A 3WYQA 1VWHB 3PK2A 4ZGUA 3MVFA 2F01A 5EEDA 3ZI8A 1Y52X 1EPAA 3IFBA 1XCAA 3NADA 4UU3A 2OY8A 3CBSA 4CDDA 1PTSA 4B55A 1U0XA 3WJBA 1JJUA 1MM9A 1IFBA 1OBPA 2AT5X 4NYRA 4NLJA 5KICA 5HWZA 4ON1A 4XMGA 4O9SA 2GTFX 5LJBA 4LZVA 2JGSA 4OS8A 4RUNA 4KCAA 2HZRA 3EMMA 1RSTB 3FW4A 2RTEB 4QGVA 1DFVA 1JMXA 3T6LA 1RSUB 1ZNEA 2KW1A 1RXHA 2FRSA 2X34A 3RDUA 3BX7A 1SWRA 1VWLB 3QQ2A 3T1DA 3FEPA 3JSQA 1ERXA 1OPAA 4ZR2A 4O4OA 3CQNA 2OL6O 2P8GA 3EYCA 1SLDB 5DG4A 4LZUA 4LKPA 1IW2A 4D6BA 3ZUIA 2CZTA 2NNDA 3P6GA 3FIQA 4Y59A 1IIUA 1O1VA 1MK5A 5FFHA 2WEXA 3STMX 5C0NA 3BU1A 1E06A 2BS5A 4IB7A 3UEWA 1VWFB 5B27A 1EPBA 1X89A 2A2GA 1NQMA 1X8UA 2POAA 3PQUA 4WHIA 2OVDA 3WJFA 3RDMA 2QM9A 2WUTA 3EW1A 3WZPA 2LFOA 2MM3A 1G85A 2GTLO 1QY1A 1SWEA 4EFGA 1FE3A 5KHPA 1JJJA 5B2AO 3U9PC 5HZQA 4YCEA 2Q2MA 2EU7X 1VWCB 4I3DA 2L67A 4ORRA 4HWMA 2X32A 4Z2PA 1R0UA 4Y0PA 3S26A 3CBCA 1CBRA 4TLJA 4GKCA 2R73A 1SWOA 1N0SA 1B8EA 2ZSCA 1NBXA 3EBKA 1TOWA 3T6FA 1QQSA 2ACPX 3NQ9A 1SLFB 4NV8A 4YFQA 1HY2A 4GH7A 1GT3A 1GGLA 4TNNA 3WJDA 2N93A 4BVMA 4QGXA 3ZW0A 2VFBA 2HMBA 3AKMA 2C4IA 3MBTA 4IBAA 4M6SA 3O19A 1OPBA 1Y9LA 2QCBA 2BS6A 5CYBA 3PH5A 4QNIA 1I4UA 3KQ0A 2AMMX 2G78A 2OFAA 3FR2A 2UYWA 3BU9A 1SRHA 1SY0A 4KIIA 5B5GA 1L6MA 1SXWA 4Z2OA 1LELA 1SY2A 2FKJA 4YFPA 4IMNA 1HQQA 2X56A 1XKIA 5F2BA 3IA8A 1B56A 3CR6A 5EDBA 1NP1A 2XKLA 2YMSA 3B2JA 4ZCBA 5HCDC 5B29A 3TZSA 2QMIA 1YWAA 1LKEA 1X8PA 4IABA 2AT6X 3FA9A 1UREA 1Y0GA 3STNA 4ZHDA 2JU3A 1QY0A 2CM4A 1AVEA 3KFGA 1JYJA 4IAXA 4O4SA 4PJ2A 4EQAC 5IRAA 2RA6A 5F58A 1K24A 3F6ZB 1FELA 3FR4A 3ZW2A 4HPDA 5D8JA 4CDFA 1VWBB 3KFHA 4QYNA 2DJGA 1T68X 1VWKB 3UEXA 2ALLX 3VG7A 3ZQ3A 1SWLA 4O3YA 1A18A 3MG5A 4GJSA 1A57A 1I05A 1SWKA 3FELA 2RTIB 1E2TA 1HMTA 4TKJA 5HA0A 5HZ5A 1ICMA 2JMBA 3FA8A 1PEEA 5F6ZA 1LNMA 3B2HA 4FBRA 4JGLA 5FENA 2AVIA 1RBPA 1SWFA 4WBKA 2OFBA 2GTLN 1VWPB 4TJZA 3PP6A 1KT3A 2WQ9A 1S44A 3H3IA 3C78X 4OMXA 2Y32A 4U46A 1SXUA 4GU8A 2F73A 2IZDB 4ZHHA 1SWHA 2L9CA 4ZGFA 1FJ1E 1SA8A 4MEEA 1DC9A 2OF8A 4Y0RA 3RKGA 2Q2PA 4NW4A 3WVMA 1X8QA 4ARHA 4YVBA 5CHKA 3RY1A 4OEMA 3N91A 4JO6A 1PBYA 3ZW0B 2OFMX 4JHQA 1DF3A 1EQDA 1DZKA 4AZQA 3HWGA 1HBPA 1Y9TA 2OVSA 3B2KA 3KFFA 4YGHA 4ALOA 4YBPA 3T2WA 1AB0A 1YP7A 1U18A 1RAVA 4ML7B 4OS3A 1N43A 2IZLB 5KIDA 3F8AA 1KFFA 3HWFA 3APVA 3P6DA 2NP1A 5H9KA 4XMDA 1AQBA 1JMZA 5F1EA 1SRGA 4FBOA 5LJDA 4N7CA 3ZWEA 4BOEA 3KFIA 1G7NA 1PMPA 4EKVA 2HNXA 2X46A 1VWNB 1GX8A 2RTPB 3D96A 1KL3A 1VWDB 5H9LA 1CBSA 4BX6A 5HZ9A 3LTWA 4AZMA 5LJKA 4YGGA 3E3CA 3NQ3A 4YDBA 2M4LA 3Q6LA 1G74A 3GE2A 3NX1A 1STPA 2BC3A 4JNJA 5BVSA 2AL0X 4WFUA 4FBVA 2JOZA 3RSWA 1X8OA 1Z24A 2OVAA 3FIDA 3I17A 1I78A 1E00A 1VYGA 2LB6A 4YCHA 1LFOA 1X8NA 2RTFB 3P6EA 3MM0A 4INNA 5BVTA 1MEPA 2JU7A 5B5FA 2FLJA 2RTJA 4BX5A 3K3LA 3OE3A 2BT9A 2UZ2A 3P6HA 5FQ8E 1ML7A 4FQBB 4AZNA 3HOLA 2BSZA 4ZHFA 2GC9A 1HMRA 1QG5A 1SLGB 4I6SA 3RDXA 1OSPO 3RDOA 1VWIB 3NR3A 1RLBE 1CBQA 3CWKA 1LF7A 1SWGA 2FR2A 1OEJA 4QZUA 1NP4A 3STKA 2WWPA 2W2BA 1FDQA 3HWDA 1DF8A 1W5RA 3S5XA 1N7YA 4GGTA 3WJGA 4L1NA 1KXOA 2C1SA 2CZUA 2JU8A 4AW8A 4DNEA 5K06A 5LJCA 3HTYA 1LCZA 5EEEA 5HZ8A 1KQWA 1VYFA 2X55A 4QRLA 2F09A 3NP1A 4CDEA 4TQ2A 5JR8A 2MHDA 1GT1A 2QO5A 2A5CA 3FLLA 5L8NA 2W2AA 3CQRA 4MVIA 2PI3O 1JV4A 1GXAA 1A3YA 3LV4A 4OKAA 3WZOA 4QAEA 3WOVA 2Q9SA 2RCTA 2OZQA 3EM0A 4ID2A 1ACDA 3D4RA 3S5VA 3PH6A 4YFRA 1RXJA 3FDCA 4AYHA 2X4MA 2G8CO 1TVQA 2CM9A 2RD7C 3AKNA 1GKAA 1HN2A 4YH0A 2KTDA 3BY0A 1OEEA 1B4MA 1HXLA 3RZYA 1IKJA 3WJCA 4ALBA 4BX6B 5K67A 1TOUA 1P6PA 2CAMA 3CKGA 4XMEA 1GT4A 2RTNB 2FR3A 2G7BA 1A2DA 2RTGB 3VG5A 3ZW1A 2WR6A 4AZPA 1YIVA 1OBQA 1VWEB 2KT4B 1W6FA 2R56A 3SOTA 4GGRA 1VWRB 3CKFA 2RN4A 3VU1A 1ZRYA 1SWQA 2L68A 4I3CA 5F6BA 3SZHA 2X45A 2QO4A 3C77X 5L8OA 4I95A 2JW1A 4GGZA 1X71A 2GH7A 2JN3A 5D47A 1TXLA 2A8GA 1BSOA 4OS0A 3KZAA 3JS1A 4BX5B 2OL7A 2CBSA 1W4TA 4CPHA 5L8IA 2A0AA 3TGBA 1VWJB 1QFVA 1GM6A 5BVQA 2Y3EA 5HTEA 2RTRB 2OFRX 2RTHB 1SWNA 3FA7A 4BGFA 4GRJA 5HA1A 1RXKA 2FS6A 3VHMA 2ACOA 5L3YA 4Y0QA 5IXGA 2C1QA 1T0VA 2RTBB 1GX9A 1LDQA 1BJ7A 4MVEA 3QKGA 4OMWA 4CPEA 1LIEA 1LPJA 1NGLA 1UYNX 2E4JA 4Y0SA 1KOIA 3P02A 1BRPA 2IZKA 4A1YA 3PECA 3BRNA 1OBUA 1YWBA 4GZVA 5H9NA 1KT6A 4A1HA 4ZFXA 4KT5A 4RUUA 3BX8A 2OL8O 2GTLM 2ZAIA 5EPQA 1BSQA 3NBXX 2O62A 4Z2VA 4Y5DA 3LHNA 4GDZA 1FTPA 1SRFA 4GJVA 4YKOA 1EIOA 2X8SA 1SWTA 3PEDA 1SY3A 4MVKA 1Y55X 1VWGB 5AQ6A 3O22A 4GK9A 4IAWA 1QWDA 2LA7A 4YKMA 3WBGA 4NP1A 5BYPA 1ADLA 3HPEA 1MX7A 4YMYA 1GKAB 1IFCA 5FAZA 4KC7A 1SWSA 1KT7A 4ORUA 3VHIA 2OYBO 2QOSC 1IKEA 2AT0X 4ODDA 1PM1X 2LBAA 3APUA 2Z4HA 5HAEA 2AT8X 1BBPA 2WSJA 2A5BA 4NNSA 5H9AA 3ZW1B 1EUOA 2OY5O 4BQUA 1ERBA 1YWDA 2K23A 1YWCA 4IRWA 1I06A 3AEHA 1STRB 5D45A 1N9MA 1O1UA 4GE1A 1QABE 3HWEA 1NC9A 1BSYA 1HQPA 1LIFA 1MX8A 3ELZA 4ORXA 1S7DA 3GAQA 5IO7A 1ZNDA 3APWA 4U8UN 3CMPA 1CRBA 1H91A 4CPHB 4ORYA 3BDRA 4UU2A 5IRUA 4EDEA 3OD9A 3PQSA 1EIIA 2QO6A 1BLRA 1JBHA 1BEBA 2Z4IA 3SLTA 4BX7A 1LCVA 1ZNKA 4Z27A 2IZIA 3SZIA 2I5VO 3EW2A 1EXSA 4U9CA 2IZAA 2AT3X 1HBQA 4EXZA 1B0OA 2GJ5A 4GUZA 2XSTA 3FR5A 4D6AA 1JIWI 2RTDB 1SREA 1DZPA 2G5LA 3PDFA 2VDFA 2IZEB 4KH8A 5K68A 1KT5A 4M7MA 1QY2A 1SMPI 3RDQA 2HKDA 4WFVA 2OVEA 4AZOA 2RTMA 4LQZA 1TW4A 2IZCB 4LKTA 4DQ3A 4PSQA 1OEKA 1ALBA 2MJIA 1MUPA 5D4AA 4ZH9A 4ORSA 5JD2A 3VG4A 5HCEC 2DJFA 2I5ZO 4K19A 2IFBA 1IJ8A 4I9SA 3UEVA 2HZQA 4L3RA 1STSB 3RY2A 1VYOA 5LKEA 5F7GA 2G79A 2IZHB 2HLVA
chains in the Genus database with same CATH topology
4MISA 3VE1A 4NLIA 3WXQA 2ZAGA 4NNTA 2ANSA 2WQAE 1FENA 3TZSA 3TF6A 4CSBA 3MX7A 3HOEA 1SXXA 4O4XA 4QZTA 3EBWA 2R74A 4QGWA 1KZXA 1S2PA 4HPBA 3UEUA 1BM5A 3JQOA 4KC8A 2CBRA 3G7XA 3HK1A 1KT4A 2KD2A 3O2YA 3F9DA 4YDAA 1ZNGA 3B2LA 4A8ZA 1HMSA 4N7DA 1LIBA 4QQ1A 1CJ5A 5FQ7E 4ZJ0A 1ICNA 5H8TA 4U3QA 4XMFA 2Q39A 1LICA 2AKQA 3B2IA 4O49A 5LJEA 3FENA 4YBUA 1AVGI 3I0AA 1YUPA 3ZUOA 5HTDA 1PBOA 4HPAA 5EDCA 3BS2A 5CE4A 3ELXA 4XMHA 2X8FA 5LKFA 2DM5A 4XMCA 3VG2A 4U8UO 4TKBA 2WEWA 1UZ2X 2AH7X 4O3XB 4ES7A 2BHVA 3DSZA 2NNQA 1T8VA 3FMZA 1DV9A 3SAOA 3L4RA 4R0BA 1YP6A 4O3ZA 1EI5A 1QFTA 1SY1A 1U17A 2HYSA 3D97A 2LBVA 2RCQA 2K62A 2Q4NA 4IB6A 5AJBA 5HBSA 3U0DA 3NX2A 4COTA 2ASNX 3VG6A 2RQ0A 2LKKA 2PY1A 1O8VA 3FA6A 1KGLA 1GT5A 3P6CA 4NYQA 3TGAA 4DQ4A 2YG2A 4O3WA 3VPJE 4I9RA 2NNEA 4AZRA 5FQ6E 2FT9A 1E02A 2MO5A 3BSZE 3FW5A 3OBLA 2BLGA 2MWHA 5EZ2A 4O4UA 1DZJA 1ZNLA 2KTSA 2X8TA 1LIDA 1MDCA 1I04A 3C76X 5D48A 2L5PA 5AJCA 1AELA 2FS7A 4A60A 1CBIA 4HFOA 4I3BA 5HCCC 5LJHA 2FWVA 4ZHGA 1DZMA 1EW3A 1JZUA 3FEKA 5IO6A 3S60A 1KQXA 4IB9A 3FYFA 3RWXA 3BLGA 1SXYA 1D2UA 4TKHA 4YGZA 5IO5A 2W2FA 4IMOA 1E5PA 3P24A 1BWYA 4FGIB 1VPRA 5HZ6A 3NPOA 1MVGA 4QYPA 1ZNHA 3V8UA 2A3FX 1FEMA 2A13A 4CV7A 4ORWA 4MVLA 3ZZVA 3OJYC 1BRQA 1G5WA 1EALA 2FTBA 2A2UA 4U8UM 3VE2A 3APXA 3DTQA 4CK4A 3UAQA 3D95A 3RBYA 3WJEA 4GNWA 4ZHCA 5DPQA 3P6FA 4HPCA 1KZWA 4MIRA 3NQKA 1D3SA 1JJXA 4IB8A 1JYDA 4EEJA 3PPTA 5AEOA 4GNYA 5LJGA 3TGCA 4GETA 4ZH6A 4ZGUA 3MVFA 5EEDA 3ZI8A 1EPAA 3IFBA 1XCAA 3NADA 4UU3A 3CBSA 1U0XA 3WJBA 1OBPA 1IFBA 2AT5X 5KICA 4NYRA 4NLJA 5HWZA 4ON1A 4XMGA 4O9SA 2GTFX 5LJBA 4LZVA 4OS8A 4RUNA 4KCAA 2HZRA 3EMMA 3FW4A 4QGVA 1DFVA 1ZNEA 2KW1A 2FRSA 3BX7A 3T1DA 3FEPA 3JSQA 1ERXA 1OPAA 4ZR2A 4O4OA 3CQNA 2P8GA 3EYCA 5DG4A 4LZUA 4LKPA 1IW2A 4D6BA 3ZUIA 2CZTA 2NNDA 3P6GA 3FIQA 1IIUA 1O1VA 5FFHA 5C0NA 2WEXA 3STMX 3BU1A 1E06A 2BS5A 4IB7A 3UEWA 5B27A 1EPBA 1X89A 2A2GA 1X8UA 2POAA 3PQUA 4WHIA 2OVDA 3WJFA 2QM9A 2WUTA 2LFOA 2MM3A 1G85A 2GTLO 1QY1A 4EFGA 1FE3A 5KHPA 1JJJA 3U9PC 5HZQA 4YCEA 2Q2MA 2EU7X 4I3DA 4ORRA 2L67A 4HWMA 1R0UA 4Y0PA 3S26A 3CBCA 1CBRA 4TLJA 4GKCA 2R73A 1N0SA 1B8EA 3EBKA 1TOWA 1QQSA 2ACPX 3NQ9A 4YFQA 4GH7A 1GT3A 1GGLA 4TNNA 3WJDA 2N93A 4BVMA 4QGXA 3ZW0A 2HMBA 3AKMA 3MBTA 4IBAA 4M6SA 3O19A 1OPBA 1Y9LA 2BS6A 5CYBA 3PH5A 4QNIA 1I4UA 3KQ0A 2AMMX 2G78A 3FR2A 4KIIA 3U03A 3BU9A 1SY0A 1L6MA 1SXWA 1SY2A 4YFPA 4IMNA 1XKIA 3IA8A 1B56A 3CR6A 5EDBA 1NP1A 2XKLA 2YMSA 3B2JA 4ZCBA 5HCDC 5B29A 2QMIA 1YWAA 1LKEA 1X8PA 4IABA 2AT6X 3FA9A 1UREA 3STNA 4ZHDA 2JU3A 1QY0A 2CM4A 3KFGA 1JYJA 4IAXA 4O4SA 4PJ2A 4EQAC 2RA6A 5F58A 3F6ZB 3FR4A 1FELA 3ZW2A 4HPDA 5D8JA 3KFHA 4QYNA 1T68X 3UEXA 2ALLX 3VG7A 3ZQ3A 4O3YA 1A18A 1A57A 1I05A 3FELA 1HMTA 4TKJA 5HA0A 5HZ5A 1ICMA 2JMBA 3FA8A 1PEEA 5F6ZA 1LNMA 3B2HA 4FBRA 4JGLA 5FENA 1RBPA 4WBKA 2GTLN 4TJZA 3PP6A 1KT3A 2WQ9A 1S44A 3H3IA 3C78X 4OMXA 1SXUA 4GU8A 2F73A 4ZHHA 2L9CA 4ZGFA 1SA8A 1DC9A 4Y0RA 3RKGA 2Q2PA 4NW4A 3WVMA 1X8QA 4ARHA 3N91A 3ZW0B 2OFMX 1DF3A 1EQDA 1DZKA 4AZQA 3HWGA 1HBPA 1Y9TA 2OVSA 3B2KA 3KFFA 4YGHA 4ALOA 4YBPA 1AB0A 1YP7A 1U18A 4ML7B 4OS3A 5KIDA 3F8AA 3HWFA 3APVA 3P6DA 2NP1A 5H9KA 4XMDA 1AQBA 5F1EA 5LJDA 4FBOA 3ZWEA 4BOEA 4N7CA 3KFIA 1G7NA 1PMPA 2HNXA 2X46A 1GX8A 3D96A 5H9LA 1CBSA 5HZ9A 4AZMA 5LJKA 4YGGA 3E3CA 3NQ3A 4YDBA 2M4LA 3Q6LA 1G74A 3GE2A 3NX1A 5BVSA 3VG3A 3RSWA 2AL0X 4WFUA 4FBVA 2JOZA 1X8OA 2OVAA 1Z24A 4YCHA 3I17A 1E00A 1VYGA 2LB6A 1LFOA 1X8NA 3P6EA 4INNA 5BVTA 2JU7A 2FLJA 3K3LA 3OE3A 2BT9A 5FQ8E 3P6HA 1ML7A 4FQBB 4AZNA 3HOLA 4ZHFA 2GC9A 1HMRA 1QG5A 4I6SA 3NR3A 1RLBE 1CBQA 3CWKA 1LF7A 2FR2A 1OEJA 4QZUA 1NP4A 3STKA 2WWPA 2W2BA 1FDQA 3HWDA 3S5XA 3WJGA 4L1NA 1KXOA 2CZUA 2JU8A 4AW8A 5LJCA 5K06A 3HTYA 5EEEA 5HZ8A 1KQWA 1VYFA 4QRLA 2F09A 3NP1A 4TQ2A 5JR8A 2MHDA 1GT1A 2QO5A 3FLLA 5L8NA 2W2AA 3CQRA 4MVIA 1JV4A 1GXAA 1A3YA 3LV4A 4QAEA 3WOVA 2Q9SA 2RCTA 2OZQA 3EM0A 4ID2A 1ACDA 3D4RA 3S5VA 3PH6A 4YFRA 4AYHA 1TVQA 2CM9A 2RD7C 3AKNA 1GKAA 1HN2A 4YH0A 2KTDA 3BY0A 1OEEA 1B4MA 3RZYA 1IKJA 3WJCA 4ALBA 1TOUA 1P6PA 4XMEA 1GT4A 2FR3A 2G7BA 1A2DA 3VG5A 3ZW1A 2WR6A 4AZPA 1YIVA 1OBQA 2KT4B 3SOTA 2R56A 3VU1A 2RN4A 1ZRYA 2L68A 4I3CA 5F6BA 2X45A 2QO4A 3C77X 5L8OA 4I95A 2JW1A 1X71A 2JN3A 5D47A 1TXLA 4OS0A 1BSOA 3KZAA 3JS1A 2CBSA 5L8IA 2A0AA 3TGBA 1QFVA 1GM6A 5BVQA 5HTEA 2OFRX 3FA7A 4GRJA 5HA1A 2FS6A 2ACOA 4Y0QA 1T0VA 1GX9A 1BJ7A 4MVEA 3QKGA 4OMWA 1LIEA 1LPJA 1NGLA 2E4JA 4Y0SA 1KOIA 3P02A 1BRPA 4A1YA 3PECA 3BRNA 1OBUA 1YWBA 4GZVA 5H9NA 1KT6A 4A1HA 4ZFXA 4KT5A 4RUUA 3BX8A 2ZAIA 2GTLM 5EPQA 1BSQA 3NBXX 2O62A 3LHNA 4GDZA 1FTPA 4YKOA 1EIOA 2X8SA 3PEDA 1SY3A 4MVKA 5AQ6A 3O22A 4GK9A 4IAWA 1QWDA 2LA7A 4YKMA 3WBGA 4NP1A 5BYPA 1ADLA 1MX7A 4YMYA 1GKAB 1IFCA 5FAZA 4KC7A 1KT7A 4ORUA 2QOSC 1IKEA 2AT0X 4ODDA 1PM1X 2LBAA 3APUA 2Z4HA 5HAEA 2AT8X 1BBPA 2WSJA 4NNSA 5H9AA 3ZW1B 4BQUA 1EUOA 1ERBA 1YWDA 2K23A 1YWCA 1I06A 5D45A 1O1UA 4GE1A 1QABE 3HWEA 1BSYA 1HQPA 1LIFA 1MX8A 3ELZA 4ORXA 1S7DA 3GAQA 5IO7A 1ZNDA 3APWA 4U8UN 3CMPA 1CRBA 1H91A 4ORYA 3BDRA 4UU2A 4EDEA 3OD9A 3PQSA 1EIIA 2QO6A 1BLRA 1JBHA 1BEBA 2Z4IA 1ZNKA 1EXSA 4U9CA 2AT3X 1HBQA 4EXZA 1B0OA 2GJ5A 4D6AA 2XSTA 3FR5A 1JIWI 1DZPA 4KH8A 1KT5A 4M7MA 1QY2A 1SMPI 4WFVA 2OVEA 4AZOA 4LQZA 1TW4A 4LKTA 4DQ3A 4PSQA 1OEKA 1ALBA 2MJIA 1MUPA 5D4AA 4ZH9A 4ORSA 3VG4A 5HCEC 4K19A 2IFBA 4I9SA 3UEVA 2HZQA 4L3RA 5LKEA 5F7GA 2G79A 2HLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLI A;  3WXQ A;  4NNT A;  2ANS A;  2WQA E;  1FEN A;  3TZS A;  3TF6 A;  1SXX A;  4QZT A;  3EBW A;  2R74 A;  4QGW A;  1KZX A;  1S2P A;  4HPB A;  3UEU A;  1BM5 A;  2CBR A;  3G7X A;  3HK1 A;  1KT4 A;  3O2Y A;  3F9D A;  4YDA A;  1ZNG A;  3B2L A;  4A8Z A;  1HMS A;  4N7D A;  1LIB A;  1CJ5 A;  4ZJ0 A;  1ICN A;  5H8T A;  4XMF A;  2Q39 A;  1LIC A;  2AKQ A;  3B2I A;  5LJE A;  3FEN A;  4YBU A;  1AVG I;  3I0A A;  1YUP A;  3ZUO A;  5HTD A;  1PBO A;  4HPA A;  5EDC A;  3BS2 A;  5CE4 A;  3ELX A;  4XMH A;  5LKF A;  2DM5 A;  4XMC A;  3VG2 A;  4TKB A;  2WEW A;  1UZ2 X;  2AH7 X;  4ES7 A;  3DSZ A;  3FMZ A;  2NNQ A;  1T8V A;  1DV9 A;  3SAO A;  3L4R A;  4R0B A;  1YP6 A;  1QFT A;  1SY1 A;  1U17 A;  2HYS A;  3D97 A;  2LBV A;  2RCQ A;  2K62 A;  2Q4N A;  4IB6 A;  5HBS A;  3U0D A;  3NX2 A;  2ASN X;  3VG6 A;  2RQ0 A;  2LKK A;  2PY1 A;  1O8V A;  3FA6 A;  1KGL A;  1GT5 A;  3P6C A;  4NYQ A;  3TGA A;  4DQ4 A;  2YG2 A;  4I9R A;  2NNE A;  4AZR A;  2FT9 A;  1E02 A;  2MO5 A;  3BSZ E;  3FW5 A;  2BLG A;  5EZ2 A;  1DZJ A;  1ZNL A;  1LID A;  1MDC A;  1I04 A;  3C76 X;  5D48 A;  2L5P A;  1AEL A;  2FS7 A;  4A60 A;  1CBI A;  4HFO A;  4I3B A;  5HCC C;  5LJH A;  2FWV A;  4ZHG A;  1DZM A;  1EW3 A;  1JZU A;  3FEK A;  5IO6 A;  1KQX A;  4IB9 A;  3BLG A;  1SXY A;  1D2U A;  4TKH A;  4YGZ A;  5IO5 A;  2W2F A;  4IMO A;  1E5P A;  1BWY A;  1VPR A;  5HZ6 A;  3NPO A;  1MVG A;  4QYP A;  1ZNH A;  2A3F X;  1FEM A;  2A13 A;  4ORW A;  4MVL A;  3OJY C;  1BRQ A;  1G5W A;  1EAL A;  2FTB A;  2A2U A;  3APX A;  3DTQ A;  4CK4 A;  3D95 A;  3WJE A;  4GNW A;  4ZHC A;  5DPQ A;  3P6F A;  4HPC A;  1KZW A;  1D3S A;  1JJX A;  4IB8 A;  1JYD A;  4EEJ A;  3PPT A;  4GNY A;  5LJG A;  3TGC A;  4GET A;  4ZH6 A;  4ZGU A;  3MVF A;  5EED A;  1EPA A;  3IFB A;  1XCA A;  3NAD A;  4UU3 A;  3CBS A;  1U0X A;  3WJB A;  1OBP A;  1IFB A;  2AT5 X;  5KIC A;  4NYR A;  4NLJ A;  5HWZ A;  4XMG A;  4O9S A;  2GTF X;  5LJB A;  4LZV A;  4OS8 A;  4RUN A;  2HZR A;  3EMM A;  3FW4 A;  4QGV A;  1DFV A;  1ZNE A;  2FRS A;  3BX7 A;  3T1D A;  3FEP A;  3JSQ A;  1ERX A;  1OPA A;  4ZR2 A;  3CQN A;  2P8G A;  3EYC A;  5DG4 A;  4LZU A;  4LKP A;  1IW2 A;  4D6B A;  3ZUI A;  2CZT A;  2NND A;  3P6G A;  3FIQ A;  1IIU A;  1O1V A;  5FFH A;  5C0N A;  2WEX A;  3STM X;  3BU1 A;  1E06 A;  4IB7 A;  3UEW A;  5B27 A;  1EPB A;  1X89 A;  2A2G A;  1X8U A;  2POA A;  2OVD A;  3WJF A;  2QM9 A;  2WUT A;  2LFO A;  2MM3 A;  1G85 A;  4EFG A;  1QY1 A;  1FE3 A;  5KHP A;  1JJJ A;  3U9P C;  5HZQ A;  4YCE A;  2Q2M A;  2EU7 X;  4I3D A;  4ORR A;  2L67 A;  1R0U A;  4Y0P A;  3S26 A;  3CBC A;  1CBR A;  4TLJ A;  4GKC A;  2R73 A;  1N0S A;  1B8E A;  3EBK A;  1TOW A;  1QQS A;  2ACP X;  3NQ9 A;  4YFQ A;  4GH7 A;  1GT3 A;  1GGL A;  4TNN A;  3WJD A;  2N93 A;  4BVM A;  4QGX A;  2HMB A;  3AKM A;  3MBT A;  4IBA A;  4M6S A;  3O19 A;  1OPB A;  3PH5 A;  1I4U A;  3KQ0 A;  2AMM X;  2G78 A;  3FR2 A;  4KII A;  3U03 A;  3BU9 A;  1SY0 A;  1L6M A;  1SXW A;  1SY2 A;  4YFP A;  4IMN A;  1XKI A;  3IA8 A;  1B56 A;  3CR6 A;  5EDB A;  1NP1 A;  2XKL A;  3B2J A;  5HCD C;  4ZCB A;  5B29 A;  1YWA A;  1LKE A;  1X8P A;  2AT6 X;  3FA9 A;  1URE A;  3STN A;  4ZHD A;  2JU3 A;  1QY0 A;  2CM4 A;  3KFG A;  1JYJ A;  4IAX A;  2RA6 A;  5F58 A;  3FR4 A;  1FEL A;  4HPD A;  5D8J A;  3KFH A;  4QYN A;  1T68 X;  3UEX A;  2ALL X;  3VG7 A;  3ZQ3 A;  1A18 A;  1A57 A;  1I05 A;  3FEL A;  1HMT A;  4TKJ A;  5HA0 A;  5HZ5 A;  1ICM A;  3FA8 A;  1PEE A;  5F6Z A;  1LNM A;  3B2H A;  5FEN A;  1RBP A;  4WBK A;  4TJZ A;  3PP6 A;  1KT3 A;  2WQ9 A;  1S44 A;  3C78 X;  4OMX A;  1SXU A;  2F73 A;  4ZHH A;  2L9C A;  1SA8 A;  1DC9 A;  4Y0R A;  2Q2P A;  3WVM A;  1X8Q A;  4ARH A;  2OFM X;  1DF3 A;  1EQD A;  1DZK A;  4AZQ A;  3HWG A;  1HBP A;  3B2K A;  4ALO A;  3KFF A;  4YGH A;  4YBP A;  1AB0 A;  1YP7 A;  1U18 A;  4OS3 A;  5KID A;  3F8A A;  3HWF A;  3APV A;  3P6D A;  2NP1 A;  5H9K A;  4XMD A;  1AQB A;  5F1E A;  5LJD A;  4BOE A;  4N7C A;  3KFI A;  1G7N A;  1PMP A;  2HNX A;  2X46 A;  1GX8 A;  3D96 A;  5H9L A;  1CBS A;  5HZ9 A;  4AZM A;  5LJK A;  4YGG A;  3NQ3 A;  4YDB A;  3VG3 A;  3Q6L A;  1G74 A;  3NX1 A;  5BVS A;  3RSW A;  2AL0 X;  4WFU A;  2JOZ A;  1X8O A;  2OVA A;  1Z24 A;  4YCH A;  3I17 A;  1E00 A;  1VYG A;  2LB6 A;  1LFO A;  1X8N A;  3P6E A;  5BVT A;  2JU7 A;  2FLJ A;  3K3L A;  3P6H A;  1ML7 A;  4AZN A;  4ZHF A;  2GC9 A;  1HMR A;  1QG5 A;  3NR3 A;  1RLB E;  1CBQ A;  3CWK A;  1LF7 A;  2FR2 A;  1OEJ A;  4QZU A;  1NP4 A;  3STK A;  2WWP A;  2W2B A;  1FDQ A;  3HWD A;  3WJG A;  4AW8 A;  1KXO A;  2CZU A;  2JU8 A;  5LJC A;  5K06 A;  5EEE A;  5HZ8 A;  1KQW A;  1VYF A;  3NP1 A;  4TQ2 A;  5JR8 A;  2QO5 A;  1GT1 A;  3FLL A;  5L8N A;  2W2A A;  3CQR A;  4MVI A;  1JV4 A;  1GXA A;  1A3Y A;  4QAE A;  2Q9S A;  2RCT A;  2OZQ A;  3EM0 A;  1ACD A;  3PH6 A;  4YFR A;  4AYH A;  1TVQ A;  2CM9 A;  2RD7 C;  3AKN A;  1GKA A;  1HN2 A;  4YH0 A;  2KTD A;  3BY0 A;  1OEE A;  1B4M A;  3RZY A;  1IKJ A;  3WJC A;  4ALB A;  1TOU A;  1P6P A;  4XME A;  1GT4 A;  2FR3 A;  2G7B A;  1A2D A;  3VG5 A;  2WR6 A;  4AZP A;  1YIV A;  1OBQ A;  2KT4 B;  2R56 A;  1ZRY A;  2L68 A;  4I3C A;  5F6B A;  2X45 A;  2QO4 A;  3C77 X;  5L8O A;  1X71 A;  2JN3 A;  5D47 A;  1TXL A;  4OS0 A;  1BSO A;  3KZA A;  3JS1 A;  2CBS A;  5L8I A;  2A0A A;  3TGB A;  1QFV A;  1GM6 A;  5BVQ A;  5HTE A;  2OFR X;  3FA7 A;  4GRJ A;  5HA1 A;  2FS6 A;  2ACO A;  4Y0Q A;  1T0V A;  1GX9 A;  1BJ7 A;  4OMW A;  3QKG A;  1LIE A;  1LPJ A;  1NGL A;  2E4J A;  4Y0S A;  1KOI A;  1BRP A;  4A1Y A;  3PEC A;  3BRN A;  1OBU A;  1YWB A;  5H9N A;  4A1H A;  1KT6 A;  4ZFX A;  4RUU A;  3BX8 A;  5EPQ A;  1BSQ A;  2O62 A;  1FTP A;  4YKO A;  1EIO A;  3PED A;  1SY3 A;  4MVK A;  5AQ6 A;  3O22 A;  4IAW A;  1QWD A;  4YKM A;  3WBG A;  4NP1 A;  1ADL A;  1MX7 A;  4YMY A;  1GKA B;  1IFC A;  5FAZ A;  1KT7 A;  4ORU A;  2QOS C;  1IKE A;  2AT0 X;  4ODD A;  1PM1 X;  2LBA A;  3APU A;  5HAE A;  2AT8 X;  1BBP A;  2WSJ A;  4NNS A;  5H9A A;  4BQU A;  1EUO A;  1ERB A;  1YWD A;  2K23 A;  1YWC A;  1I06 A;  5D45 A;  1O1U A;  4GE1 A;  1QAB E;  3HWE A;  1BSY A;  1HQP A;  1LIF A;  1MX8 A;  3ELZ A;  4ORX A;  1S7D A;  3GAQ A;  5IO7 A;  1ZND A;  3APW A;  3CMP A;  1CRB A;  1H91 A;  4ORY A;  3BDR A;  4UU2 A;  4EDE A;  1EII A;  2QO6 A;  1BLR A;  1JBH A;  1BEB A;  1ZNK A;  1EXS A;  2AT3 X;  1HBQ A;  4EXZ A;  1B0O A;  2GJ5 A;  4D6A A;  2XST A;  3FR5 A;  1DZP A;  1KT5 A;  4M7M A;  1QY2 A;  4WFV A;  2OVE A;  4AZO A;  1TW4 A;  4LKT A;  4DQ3 A;  4PSQ A;  1OEK A;  1ALB A;  2MJI A;  1MUP A;  5D4A A;  4ZH9 A;  4ORS A;  3VG4 A;  5HCE C;  4K19 A;  2IFB A;  4I9S A;  3UEV A;  2HZQ A;  5LKE A;  5F7G A;  2G79 A;  2HLV A; 
#chains in the Genus database with same CATH topology
 4MIS A;  3VE1 A;  4NLI A;  3WXQ A;  2ZAG A;  4NNT A;  2ANS A;  1VWA B;  2WQA E;  1FEN A;  2AF5 A;  1I9H A;  1NQN A;  3AUM O;  3MX7 A;  3TF6 A;  3HOE A;  1SXX A;  4O4X A;  5B3M O;  4C5P A;  4CSB A;  4QZT A;  1HXZ A;  3EBW A;  1AVD A;  2R74 A;  4QGW A;  2RTO B;  1KZX A;  1S2P A;  4HPB A;  3UEU A;  1BM5 A;  3JQO A;  4KC8 A;  2CBR A;  3G7X A;  2QOM A;  3HK1 A;  1KT4 A;  1VWO B;  4GD9 A;  4NV7 A;  2KD2 A;  3O2Y A;  2RTK A;  1SWD A;  3F9D A;  4YDA A;  1ZNG A;  3B2L A;  4A8Z A;  2Y3F A;  1HMS A;  4N7D A;  3RE5 A;  2RTC B;  3RE6 A;  1LIB A;  3SLJ A;  4CPI A;  4QQ1 A;  1SRJ A;  1CJ5 A;  5FQ7 E;  4ZJ0 A;  1ICN A;  2OY1 O;  5H8T A;  1WUB A;  4U3Q A;  4BCS A;  4XMF A;  2Q39 A;  1LIC A;  1SWB A;  2IZJ A;  2AKQ A;  2OY7 A;  1GX3 A;  3B2I A;  4O49 A;  3WZQ A;  5LJE A;  3FEN A;  4BX7 B;  4YBU A;  1AVG I;  1SWU A;  3I0A A;  1YUP A;  3ZUO A;  5HTD A;  1JQP A;  1PBO A;  4HPA A;  5EDC A;  2RTQ B;  3BS2 A;  3SZJ A;  5CE4 A;  3ELX A;  4XMH A;  3SLO A;  2X8F A;  5LKF A;  3U0D A;  2DM5 A;  5B11 O;  4XMC A;  3VG2 A;  4U8U O;  2FHL A;  4TKB A;  2WEW A;  1UZ2 X;  2IZB A;  4O3X B;  2AH7 X;  4ES7 A;  2BHV A;  3DSZ A;  1SWP A;  1T8V A;  2NNQ A;  3FMZ A;  1WBI A;  1DV9 A;  3SAO A;  3L4R A;  4R0B A;  1YP6 A;  4O3Z A;  1EI5 A;  1QFT A;  1SY1 A;  1U17 A;  2HYS A;  3D97 A;  2LBV A;  2RCQ A;  2K62 A;  2Q4N A;  4IB6 A;  5AJB A;  5HBS A;  3VGW A;  2MF6 A;  3NX2 A;  2ASN X;  4BBO A;  3VG6 A;  4COT A;  2RQ0 A;  2LKK A;  2PY1 A;  1O8V A;  2IZF B;  3FA6 A;  1KGL A;  2OF9 A;  1GT5 A;  3P6C A;  4NYQ A;  3TGA A;  1LCW A;  2YG2 A;  4O3W A;  4DQ4 A;  2FHN X;  3VPJ E;  2RTA A;  4I9R A;  2NNE A;  1LDO A;  5FQ6 E;  2FT9 A;  4AZR A;  1N4J A;  1SLE B;  1E02 A;  2MO5 A;  3BSZ E;  3FW5 A;  3OBL A;  2BLG A;  4CDC A;  3WYP A;  2MWH A;  3X00 A;  5EZ2 A;  4O4U A;  4Z6J A;  3KVN A;  1DZJ A;  1ZNL A;  2KTS A;  2X8T A;  1LID A;  1MDC A;  1I04 A;  1Y53 X;  3C76 X;  5D48 A;  2L5P A;  5AJC A;  1AEL A;  2FS7 A;  4A60 A;  1CBI A;  5CSE A;  4GDA A;  2VFC A;  5IRW A;  4HFO A;  4I3B A;  5HCC C;  5LJH A;  2FWV A;  4ZHG A;  1DZM A;  1EW3 A;  1JZU A;  4DCB A;  3FEK A;  5IO6 A;  3S60 A;  1KQX A;  4IB9 A;  3FYF A;  4OEL A;  3RWX A;  3BLG A;  3VHH A;  1SXY A;  1D2U A;  4TKH A;  1KL4 A;  4YGZ A;  5IO5 A;  2W2F A;  1KL5 A;  1N9Y A;  1E5P A;  4IMO A;  3WZN A;  2FGS A;  3P24 A;  1BWY A;  4FGI B;  4BJ8 A;  4CPF A;  1VPR A;  5HZ6 A;  3NPO A;  1MVG A;  4QYP A;  1ZNH A;  3RDS A;  3V8U A;  2A3F X;  1VWQ B;  1FEM A;  2A13 A;  4CV7 A;  4ORW A;  4MVL A;  3ZZV A;  1LUQ A;  3OJY C;  1BRQ A;  1G5W A;  1EAL A;  1K3B A;  1SWC A;  2FTB A;  2A2U A;  3Q34 A;  1VWM B;  3D9W A;  4U8U M;  3APX A;  3DTQ A;  3VE2 A;  1NDJ A;  1UYO X;  3D95 A;  3UAQ A;  3RBY A;  4CK4 A;  3WJE A;  4I60 A;  3EC5 A;  5B10 O;  2WPU A;  1SRI A;  3U03 A;  4GNW A;  2IZG B;  4ZHC A;  2FKG A;  1SWJ A;  1MOY A;  3P6F A;  5DPQ A;  4HPC A;  3T2X A;  3VG3 A;  1KZW A;  4MIR A;  3NQK A;  1D3S A;  2RTL A;  4Z28 A;  1JJX A;  4IB8 A;  1JYD A;  4EEJ A;  3PPT A;  5AEO A;  1SWA A;  4GNY A;  5LJG A;  3TGC A;  4GET A;  4ZH6 A;  3WYQ A;  1VWH B;  3PK2 A;  4ZGU A;  3MVF A;  2F01 A;  5EED A;  3ZI8 A;  1Y52 X;  1EPA A;  3IFB A;  1XCA A;  3NAD A;  4UU3 A;  2OY8 A;  3CBS A;  4CDD A;  1PTS A;  4B55 A;  1U0X A;  3WJB A;  1JJU A;  1MM9 A;  1IFB A;  1OBP A;  2AT5 X;  4NYR A;  4NLJ A;  5KIC A;  5HWZ A;  4ON1 A;  4XMG A;  4O9S A;  2GTF X;  5LJB A;  4LZV A;  2JGS A;  4OS8 A;  4RUN A;  4KCA A;  2HZR A;  3EMM A;  1RST B;  3FW4 A;  2RTE B;  4QGV A;  1DFV A;  1JMX A;  3T6L A;  1RSU B;  1ZNE A;  2KW1 A;  1RXH A;  2FRS A;  2X34 A;  3RDU A;  3BX7 A;  1SWR A;  1VWL B;  3QQ2 A;  3T1D A;  3FEP A;  3JSQ A;  1ERX A;  1OPA A;  4ZR2 A;  4O4O A;  3CQN A;  2OL6 O;  2P8G A;  3EYC A;  1SLD B;  5DG4 A;  4LZU A;  4LKP A;  1IW2 A;  4D6B A;  3ZUI A;  2CZT A;  2NND A;  3P6G A;  3FIQ A;  4Y59 A;  1IIU A;  1O1V A;  1MK5 A;  5FFH A;  2WEX A;  3STM X;  5C0N A;  3BU1 A;  1E06 A;  2BS5 A;  4IB7 A;  3UEW A;  1VWF B;  5B27 A;  1EPB A;  1X89 A;  2A2G A;  1NQM A;  1X8U A;  2POA A;  3PQU A;  4WHI A;  2OVD A;  3WJF A;  3RDM A;  2QM9 A;  2WUT A;  3EW1 A;  3WZP A;  2LFO A;  2MM3 A;  1G85 A;  2GTL O;  1QY1 A;  1SWE A;  4EFG A;  1FE3 A;  5KHP A;  1JJJ A;  5B2A O;  3U9P C;  5HZQ A;  4YCE A;  2Q2M A;  2EU7 X;  1VWC B;  4I3D A;  2L67 A;  4ORR A;  4HWM A;  2X32 A;  4Z2P A;  1R0U A;  4Y0P A;  3S26 A;  3CBC A;  1CBR A;  4TLJ A;  4GKC A;  2R73 A;  1SWO A;  1N0S A;  1B8E A;  2ZSC A;  1NBX A;  3EBK A;  1TOW A;  3T6F A;  1QQS A;  2ACP X;  3NQ9 A;  1SLF B;  4NV8 A;  4YFQ A;  1HY2 A;  4GH7 A;  1GT3 A;  1GGL A;  4TNN A;  3WJD A;  2N93 A;  4BVM A;  4QGX A;  3ZW0 A;  2VFB A;  2HMB A;  3AKM A;  2C4I A;  3MBT A;  4IBA A;  4M6S A;  3O19 A;  1OPB A;  1Y9L A;  2QCB A;  2BS6 A;  5CYB A;  3PH5 A;  4QNI A;  1I4U A;  3KQ0 A;  2AMM X;  2G78 A;  2OFA A;  3FR2 A;  2UYW A;  3BU9 A;  1SRH A;  1SY0 A;  4KII A;  5B5G A;  1L6M A;  1SXW A;  4Z2O A;  1LEL A;  1SY2 A;  2FKJ A;  4YFP A;  4IMN A;  1HQQ A;  2X56 A;  1XKI A;  5F2B A;  3IA8 A;  1B56 A;  3CR6 A;  5EDB A;  1NP1 A;  2XKL A;  2YMS A;  3B2J A;  4ZCB A;  5HCD C;  5B29 A;  3TZS A;  2QMI A;  1YWA A;  1LKE A;  1X8P A;  4IAB A;  2AT6 X;  3FA9 A;  1URE A;  1Y0G A;  3STN A;  4ZHD A;  2JU3 A;  1QY0 A;  2CM4 A;  1AVE A;  3KFG A;  1JYJ A;  4IAX A;  4O4S A;  4PJ2 A;  4EQA C;  5IRA A;  2RA6 A;  5F58 A;  1K24 A;  3F6Z B;  1FEL A;  3FR4 A;  3ZW2 A;  4HPD A;  5D8J A;  4CDF A;  1VWB B;  3KFH A;  4QYN A;  2DJG A;  1T68 X;  1VWK B;  3UEX A;  2ALL X;  3VG7 A;  3ZQ3 A;  1SWL A;  4O3Y A;  1A18 A;  3MG5 A;  4GJS A;  1A57 A;  1I05 A;  1SWK A;  3FEL A;  2RTI B;  1E2T A;  1HMT A;  4TKJ A;  5HA0 A;  5HZ5 A;  1ICM A;  2JMB A;  3FA8 A;  1PEE A;  5F6Z A;  1LNM A;  3B2H A;  4FBR A;  4JGL A;  5FEN A;  2AVI A;  1RBP A;  1SWF A;  4WBK A;  2OFB A;  2GTL N;  1VWP B;  4TJZ A;  3PP6 A;  1KT3 A;  2WQ9 A;  1S44 A;  3H3I A;  3C78 X;  4OMX A;  2Y32 A;  4U46 A;  1SXU A;  4GU8 A;  2F73 A;  2IZD B;  4ZHH A;  1SWH A;  2L9C A;  4ZGF A;  1FJ1 E;  1SA8 A;  4MEE A;  1DC9 A;  2OF8 A;  4Y0R A;  3RKG A;  2Q2P A;  4NW4 A;  3WVM A;  1X8Q A;  4ARH A;  4YVB A;  5CHK A;  3RY1 A;  4OEM A;  3N91 A;  4JO6 A;  1PBY A;  3ZW0 B;  2OFM X;  4JHQ A;  1DF3 A;  1EQD A;  1DZK A;  4AZQ A;  3HWG A;  1HBP A;  1Y9T A;  2OVS A;  3B2K A;  3KFF A;  4YGH A;  4ALO A;  4YBP A;  3T2W A;  1AB0 A;  1YP7 A;  1U18 A;  1RAV A;  4ML7 B;  4OS3 A;  1N43 A;  2IZL B;  5KID A;  3F8A A;  1KFF A;  3HWF A;  3APV A;  3P6D A;  2NP1 A;  5H9K A;  4XMD A;  1AQB A;  1JMZ A;  5F1E A;  1SRG A;  4FBO A;  5LJD A;  4N7C A;  3ZWE A;  4BOE A;  3KFI A;  1G7N A;  1PMP A;  4EKV A;  2HNX A;  2X46 A;  1VWN B;  1GX8 A;  2RTP B;  3D96 A;  1KL3 A;  1VWD B;  5H9L A;  1CBS A;  4BX6 A;  5HZ9 A;  3LTW A;  4AZM A;  5LJK A;  4YGG A;  3E3C A;  3NQ3 A;  4YDB A;  2M4L A;  3Q6L A;  1G74 A;  3GE2 A;  3NX1 A;  1STP A;  2BC3 A;  4JNJ A;  5BVS A;  2AL0 X;  4WFU A;  4FBV A;  2JOZ A;  3RSW A;  1X8O A;  1Z24 A;  2OVA A;  3FID A;  3I17 A;  1I78 A;  1E00 A;  1VYG A;  2LB6 A;  4YCH A;  1LFO A;  1X8N A;  2RTF B;  3P6E A;  3MM0 A;  4INN A;  5BVT A;  1MEP A;  2JU7 A;  5B5F A;  2FLJ A;  2RTJ A;  4BX5 A;  3K3L A;  3OE3 A;  2BT9 A;  2UZ2 A;  3P6H A;  5FQ8 E;  1ML7 A;  4FQB B;  4AZN A;  3HOL A;  2BSZ A;  4ZHF A;  2GC9 A;  1HMR A;  1QG5 A;  1SLG B;  4I6S A;  3RDX A;  1OSP O;  3RDO A;  1VWI B;  3NR3 A;  1RLB E;  1CBQ A;  3CWK A;  1LF7 A;  1SWG A;  2FR2 A;  1OEJ A;  4QZU A;  1NP4 A;  3STK A;  2WWP A;  2W2B A;  1FDQ A;  3HWD A;  1DF8 A;  1W5R A;  3S5X A;  1N7Y A;  4GGT A;  3WJG A;  4L1N A;  1KXO A;  2C1S A;  2CZU A;  2JU8 A;  4AW8 A;  4DNE A;  5K06 A;  5LJC A;  3HTY A;  1LCZ A;  5EEE A;  5HZ8 A;  1KQW A;  1VYF A;  2X55 A;  4QRL A;  2F09 A;  3NP1 A;  4CDE A;  4TQ2 A;  5JR8 A;  2MHD A;  1GT1 A;  2QO5 A;  2A5C A;  3FLL A;  5L8N A;  2W2A A;  3CQR A;  4MVI A;  2PI3 O;  1JV4 A;  1GXA A;  1A3Y A;  3LV4 A;  4OKA A;  3WZO A;  4QAE A;  3WOV A;  2Q9S A;  2RCT A;  2OZQ A;  3EM0 A;  4ID2 A;  1ACD A;  3D4R A;  3S5V A;  3PH6 A;  4YFR A;  1RXJ A;  3FDC A;  4AYH A;  2X4M A;  2G8C O;  1TVQ A;  2CM9 A;  2RD7 C;  3AKN A;  1GKA A;  1HN2 A;  4YH0 A;  2KTD A;  3BY0 A;  1OEE A;  1B4M A;  1HXL A;  3RZY A;  1IKJ A;  3WJC A;  4ALB A;  4BX6 B;  5K67 A;  1TOU A;  1P6P A;  2CAM A;  3CKG A;  4XME A;  1GT4 A;  2RTN B;  2FR3 A;  2G7B A;  1A2D A;  2RTG B;  3VG5 A;  3ZW1 A;  2WR6 A;  4AZP A;  1YIV A;  1OBQ A;  1VWE B;  2KT4 B;  1W6F A;  2R56 A;  3SOT A;  4GGR A;  1VWR B;  3CKF A;  2RN4 A;  3VU1 A;  1ZRY A;  1SWQ A;  2L68 A;  4I3C A;  5F6B A;  3SZH A;  2X45 A;  2QO4 A;  3C77 X;  5L8O A;  4I95 A;  2JW1 A;  4GGZ A;  1X71 A;  2GH7 A;  2JN3 A;  5D47 A;  1TXL A;  2A8G A;  1BSO A;  4OS0 A;  3KZA A;  3JS1 A;  4BX5 B;  2OL7 A;  2CBS A;  1W4T A;  4CPH A;  5L8I A;  2A0A A;  3TGB A;  1VWJ B;  1QFV A;  1GM6 A;  5BVQ A;  2Y3E A;  5HTE A;  2RTR B;  2OFR X;  2RTH B;  1SWN A;  3FA7 A;  4BGF A;  4GRJ A;  5HA1 A;  1RXK A;  2FS6 A;  3VHM A;  2ACO A;  5L3Y A;  4Y0Q A;  5IXG A;  2C1Q A;  1T0V A;  2RTB B;  1GX9 A;  1LDQ A;  1BJ7 A;  4MVE A;  3QKG A;  4OMW A;  4CPE A;  1LIE A;  1LPJ A;  1NGL A;  1UYN X;  2E4J A;  4Y0S A;  1KOI A;  3P02 A;  1BRP A;  2IZK A;  4A1Y A;  3PEC A;  3BRN A;  1OBU A;  1YWB A;  4GZV A;  5H9N A;  1KT6 A;  4A1H A;  4ZFX A;  4KT5 A;  4RUU A;  3BX8 A;  2OL8 O;  2GTL M;  2ZAI A;  5EPQ A;  1BSQ A;  3NBX X;  2O62 A;  4Z2V A;  4Y5D A;  3LHN A;  4GDZ A;  1FTP A;  1SRF A;  4GJV A;  4YKO A;  1EIO A;  2X8S A;  1SWT A;  3PED A;  1SY3 A;  4MVK A;  1Y55 X;  1VWG B;  5AQ6 A;  3O22 A;  4GK9 A;  4IAW A;  1QWD A;  2LA7 A;  4YKM A;  3WBG A;  4NP1 A;  5BYP A;  1ADL A;  3HPE A;  1MX7 A;  4YMY A;  1GKA B;  1IFC A;  5FAZ A;  4KC7 A;  1SWS A;  1KT7 A;  4ORU A;  3VHI A;  2OYB O;  2QOS C;  1IKE A;  2AT0 X;  4ODD A;  1PM1 X;  2LBA A;  3APU A;  2Z4H A;  5HAE A;  2AT8 X;  1BBP A;  2WSJ A;  2A5B A;  4NNS A;  5H9A A;  3ZW1 B;  1EUO A;  2OY5 O;  4BQU A;  1ERB A;  1YWD A;  2K23 A;  1YWC A;  4IRW A;  1I06 A;  3AEH A;  1STR B;  5D45 A;  1N9M A;  1O1U A;  4GE1 A;  1QAB E;  3HWE A;  1NC9 A;  1BSY A;  1HQP A;  1LIF A;  1MX8 A;  3ELZ A;  4ORX A;  1S7D A;  3GAQ A;  5IO7 A;  1ZND A;  3APW A;  4U8U N;  3CMP A;  1CRB A;  1H91 A;  4CPH B;  4ORY A;  3BDR A;  4UU2 A;  5IRU A;  4EDE A;  3OD9 A;  3PQS A;  1EII A;  2QO6 A;  1BLR A;  1JBH A;  1BEB A;  2Z4I A;  3SLT A;  4BX7 A;  1LCV A;  1ZNK A;  4Z27 A;  2IZI A;  3SZI A;  2I5V O;  3EW2 A;  1EXS A;  4U9C A;  2IZA A;  2AT3 X;  1HBQ A;  4EXZ A;  1B0O A;  2GJ5 A;  4GUZ A;  2XST A;  3FR5 A;  4D6A A;  1JIW I;  2RTD B;  1SRE A;  1DZP A;  2G5L A;  3PDF A;  2VDF A;  2IZE B;  4KH8 A;  5K68 A;  1KT5 A;  4M7M A;  1QY2 A;  1SMP I;  3RDQ A;  2HKD A;  4WFV A;  2OVE A;  4AZO A;  2RTM A;  4LQZ A;  1TW4 A;  2IZC B;  4LKT A;  4DQ3 A;  4PSQ A;  1OEK A;  1ALB A;  2MJI A;  1MUP A;  5D4A A;  4ZH9 A;  4ORS A;  5JD2 A;  3VG4 A;  5HCE C;  2DJF A;  2I5Z O;  4K19 A;  2IFB A;  1IJ8 A;  4I9S A;  3UEV A;  2HZQ A;  4L3R A;  1STS B;  3RY2 A;  1VYO A;  5LKE A;  5F7G A;  2G79 A;  2IZH B;  2HLV A; 
#chains in the Genus database with same CATH homology
 4MIS A;  3VE1 A;  4NLI A;  3WXQ A;  2ZAG A;  4NNT A;  2ANS A;  2WQA E;  1FEN A;  3TZS A;  3TF6 A;  4CSB A;  3MX7 A;  3HOE A;  1SXX A;  4O4X A;  4QZT A;  3EBW A;  2R74 A;  4QGW A;  1KZX A;  1S2P A;  4HPB A;  3UEU A;  1BM5 A;  3JQO A;  4KC8 A;  2CBR A;  3G7X A;  3HK1 A;  1KT4 A;  2KD2 A;  3O2Y A;  3F9D A;  4YDA A;  1ZNG A;  3B2L A;  4A8Z A;  1HMS A;  4N7D A;  1LIB A;  4QQ1 A;  1CJ5 A;  5FQ7 E;  4ZJ0 A;  1ICN A;  5H8T A;  4U3Q A;  4XMF A;  2Q39 A;  1LIC A;  2AKQ A;  3B2I A;  4O49 A;  5LJE A;  3FEN A;  4YBU A;  1AVG I;  3I0A A;  1YUP A;  3ZUO A;  5HTD A;  1PBO A;  4HPA A;  5EDC A;  3BS2 A;  5CE4 A;  3ELX A;  4XMH A;  2X8F A;  5LKF A;  2DM5 A;  4XMC A;  3VG2 A;  4U8U O;  4TKB A;  2WEW A;  1UZ2 X;  2AH7 X;  4O3X B;  4ES7 A;  2BHV A;  3DSZ A;  2NNQ A;  1T8V A;  3FMZ A;  1DV9 A;  3SAO A;  3L4R A;  4R0B A;  1YP6 A;  4O3Z A;  1EI5 A;  1QFT A;  1SY1 A;  1U17 A;  2HYS A;  3D97 A;  2LBV A;  2RCQ A;  2K62 A;  2Q4N A;  4IB6 A;  5AJB A;  5HBS A;  3U0D A;  3NX2 A;  4COT A;  2ASN X;  3VG6 A;  2RQ0 A;  2LKK A;  2PY1 A;  1O8V A;  3FA6 A;  1KGL A;  1GT5 A;  3P6C A;  4NYQ A;  3TGA A;  4DQ4 A;  2YG2 A;  4O3W A;  3VPJ E;  4I9R A;  2NNE A;  4AZR A;  5FQ6 E;  2FT9 A;  1E02 A;  2MO5 A;  3BSZ E;  3FW5 A;  3OBL A;  2BLG A;  2MWH A;  5EZ2 A;  4O4U A;  1DZJ A;  1ZNL A;  2KTS A;  2X8T A;  1LID A;  1MDC A;  1I04 A;  3C76 X;  5D48 A;  2L5P A;  5AJC A;  1AEL A;  2FS7 A;  4A60 A;  1CBI A;  4HFO A;  4I3B A;  5HCC C;  5LJH A;  2FWV A;  4ZHG A;  1DZM A;  1EW3 A;  1JZU A;  3FEK A;  5IO6 A;  3S60 A;  1KQX A;  4IB9 A;  3FYF A;  3RWX A;  3BLG A;  1SXY A;  1D2U A;  4TKH A;  4YGZ A;  5IO5 A;  2W2F A;  4IMO A;  1E5P A;  3P24 A;  1BWY A;  4FGI B;  1VPR A;  5HZ6 A;  3NPO A;  1MVG A;  4QYP A;  1ZNH A;  3V8U A;  2A3F X;  1FEM A;  2A13 A;  4CV7 A;  4ORW A;  4MVL A;  3ZZV A;  3OJY C;  1BRQ A;  1G5W A;  1EAL A;  2FTB A;  2A2U A;  4U8U M;  3VE2 A;  3APX A;  3DTQ A;  4CK4 A;  3UAQ A;  3D95 A;  3RBY A;  3WJE A;  4GNW A;  4ZHC A;  5DPQ A;  3P6F A;  4HPC A;  1KZW A;  4MIR A;  3NQK A;  1D3S A;  1JJX A;  4IB8 A;  1JYD A;  4EEJ A;  3PPT A;  5AEO A;  4GNY A;  5LJG A;  3TGC A;  4GET A;  4ZH6 A;  4ZGU A;  3MVF A;  5EED A;  3ZI8 A;  1EPA A;  3IFB A;  1XCA A;  3NAD A;  4UU3 A;  3CBS A;  1U0X A;  3WJB A;  1OBP A;  1IFB A;  2AT5 X;  5KIC A;  4NYR A;  4NLJ A;  5HWZ A;  4ON1 A;  4XMG A;  4O9S A;  2GTF X;  5LJB A;  4LZV A;  4OS8 A;  4RUN A;  4KCA A;  2HZR A;  3EMM A;  3FW4 A;  4QGV A;  1DFV A;  1ZNE A;  2KW1 A;  2FRS A;  3BX7 A;  3T1D A;  3FEP A;  3JSQ A;  1ERX A;  1OPA A;  4ZR2 A;  4O4O A;  3CQN A;  2P8G A;  3EYC A;  5DG4 A;  4LZU A;  4LKP A;  1IW2 A;  4D6B A;  3ZUI A;  2CZT A;  2NND A;  3P6G A;  3FIQ A;  1IIU A;  1O1V A;  5FFH A;  5C0N A;  2WEX A;  3STM X;  3BU1 A;  1E06 A;  2BS5 A;  4IB7 A;  3UEW A;  5B27 A;  1EPB A;  1X89 A;  2A2G A;  1X8U A;  2POA A;  3PQU A;  4WHI A;  2OVD A;  3WJF A;  2QM9 A;  2WUT A;  2LFO A;  2MM3 A;  1G85 A;  2GTL O;  1QY1 A;  4EFG A;  1FE3 A;  5KHP A;  1JJJ A;  3U9P C;  5HZQ A;  4YCE A;  2Q2M A;  2EU7 X;  4I3D A;  4ORR A;  2L67 A;  4HWM A;  1R0U A;  4Y0P A;  3S26 A;  3CBC A;  1CBR A;  4TLJ A;  4GKC A;  2R73 A;  1N0S A;  1B8E A;  3EBK A;  1TOW A;  1QQS A;  2ACP X;  3NQ9 A;  4YFQ A;  4GH7 A;  1GT3 A;  1GGL A;  4TNN A;  3WJD A;  2N93 A;  4BVM A;  4QGX A;  3ZW0 A;  2HMB A;  3AKM A;  3MBT A;  4IBA A;  4M6S A;  3O19 A;  1OPB A;  1Y9L A;  2BS6 A;  5CYB A;  3PH5 A;  4QNI A;  1I4U A;  3KQ0 A;  2AMM X;  2G78 A;  3FR2 A;  4KII A;  3U03 A;  3BU9 A;  1SY0 A;  1L6M A;  1SXW A;  1SY2 A;  4YFP A;  4IMN A;  1XKI A;  3IA8 A;  1B56 A;  3CR6 A;  5EDB A;  1NP1 A;  2XKL A;  2YMS A;  3B2J A;  4ZCB A;  5HCD C;  5B29 A;  2QMI A;  1YWA A;  1LKE A;  1X8P A;  4IAB A;  2AT6 X;  3FA9 A;  1URE A;  3STN A;  4ZHD A;  2JU3 A;  1QY0 A;  2CM4 A;  3KFG A;  1JYJ A;  4IAX A;  4O4S A;  4PJ2 A;  4EQA C;  2RA6 A;  5F58 A;  3F6Z B;  3FR4 A;  1FEL A;  3ZW2 A;  4HPD A;  5D8J A;  3KFH A;  4QYN A;  1T68 X;  3UEX A;  2ALL X;  3VG7 A;  3ZQ3 A;  4O3Y A;  1A18 A;  1A57 A;  1I05 A;  3FEL A;  1HMT A;  4TKJ A;  5HA0 A;  5HZ5 A;  1ICM A;  2JMB A;  3FA8 A;  1PEE A;  5F6Z A;  1LNM A;  3B2H A;  4FBR A;  4JGL A;  5FEN A;  1RBP A;  4WBK A;  2GTL N;  4TJZ A;  3PP6 A;  1KT3 A;  2WQ9 A;  1S44 A;  3H3I A;  3C78 X;  4OMX A;  1SXU A;  4GU8 A;  2F73 A;  4ZHH A;  2L9C A;  4ZGF A;  1SA8 A;  1DC9 A;  4Y0R A;  3RKG A;  2Q2P A;  4NW4 A;  3WVM A;  1X8Q A;  4ARH A;  3N91 A;  3ZW0 B;  2OFM X;  1DF3 A;  1EQD A;  1DZK A;  4AZQ A;  3HWG A;  1HBP A;  1Y9T A;  2OVS A;  3B2K A;  3KFF A;  4YGH A;  4ALO A;  4YBP A;  1AB0 A;  1YP7 A;  1U18 A;  4ML7 B;  4OS3 A;  5KID A;  3F8A A;  3HWF A;  3APV A;  3P6D A;  2NP1 A;  5H9K A;  4XMD A;  1AQB A;  5F1E A;  5LJD A;  4FBO A;  3ZWE A;  4BOE A;  4N7C A;  3KFI A;  1G7N A;  1PMP A;  2HNX A;  2X46 A;  1GX8 A;  3D96 A;  5H9L A;  1CBS A;  5HZ9 A;  4AZM A;  5LJK A;  4YGG A;  3E3C A;  3NQ3 A;  4YDB A;  2M4L A;  3Q6L A;  1G74 A;  3GE2 A;  3NX1 A;  5BVS A;  3VG3 A;  3RSW A;  2AL0 X;  4WFU A;  4FBV A;  2JOZ A;  1X8O A;  2OVA A;  1Z24 A;  4YCH A;  3I17 A;  1E00 A;  1VYG A;  2LB6 A;  1LFO A;  1X8N A;  3P6E A;  4INN A;  5BVT A;  2JU7 A;  2FLJ A;  3K3L A;  3OE3 A;  2BT9 A;  5FQ8 E;  3P6H A;  1ML7 A;  4FQB B;  4AZN A;  3HOL A;  4ZHF A;  2GC9 A;  1HMR A;  1QG5 A;  4I6S A;  3NR3 A;  1RLB E;  1CBQ A;  3CWK A;  1LF7 A;  2FR2 A;  1OEJ A;  4QZU A;  1NP4 A;  3STK A;  2WWP A;  2W2B A;  1FDQ A;  3HWD A;  3S5X A;  3WJG A;  4L1N A;  1KXO A;  2CZU A;  2JU8 A;  4AW8 A;  5LJC A;  5K06 A;  3HTY A;  5EEE A;  5HZ8 A;  1KQW A;  1VYF A;  4QRL A;  2F09 A;  3NP1 A;  4TQ2 A;  5JR8 A;  2MHD A;  1GT1 A;  2QO5 A;  3FLL A;  5L8N A;  2W2A A;  3CQR A;  4MVI A;  1JV4 A;  1GXA A;  1A3Y A;  3LV4 A;  4QAE A;  3WOV A;  2Q9S A;  2RCT A;  2OZQ A;  3EM0 A;  4ID2 A;  1ACD A;  3D4R A;  3S5V A;  3PH6 A;  4YFR A;  4AYH A;  1TVQ A;  2CM9 A;  2RD7 C;  3AKN A;  1GKA A;  1HN2 A;  4YH0 A;  2KTD A;  3BY0 A;  1OEE A;  1B4M A;  3RZY A;  1IKJ A;  3WJC A;  4ALB A;  1TOU A;  1P6P A;  4XME A;  1GT4 A;  2FR3 A;  2G7B A;  1A2D A;  3VG5 A;  3ZW1 A;  2WR6 A;  4AZP A;  1YIV A;  1OBQ A;  2KT4 B;  3SOT A;  2R56 A;  3VU1 A;  2RN4 A;  1ZRY A;  2L68 A;  4I3C A;  5F6B A;  2X45 A;  2QO4 A;  3C77 X;  5L8O A;  4I95 A;  2JW1 A;  1X71 A;  2JN3 A;  5D47 A;  1TXL A;  4OS0 A;  1BSO A;  3KZA A;  3JS1 A;  2CBS A;  5L8I A;  2A0A A;  3TGB A;  1QFV A;  1GM6 A;  5BVQ A;  5HTE A;  2OFR X;  3FA7 A;  4GRJ A;  5HA1 A;  2FS6 A;  2ACO A;  4Y0Q A;  1T0V A;  1GX9 A;  1BJ7 A;  4MVE A;  3QKG A;  4OMW A;  1LIE A;  1LPJ A;  1NGL A;  2E4J A;  4Y0S A;  1KOI A;  3P02 A;  1BRP A;  4A1Y A;  3PEC A;  3BRN A;  1OBU A;  1YWB A;  4GZV A;  5H9N A;  1KT6 A;  4A1H A;  4ZFX A;  4KT5 A;  4RUU A;  3BX8 A;  2ZAI A;  2GTL M;  5EPQ A;  1BSQ A;  3NBX X;  2O62 A;  3LHN A;  4GDZ A;  1FTP A;  4YKO A;  1EIO A;  2X8S A;  3PED A;  1SY3 A;  4MVK A;  5AQ6 A;  3O22 A;  4GK9 A;  4IAW A;  1QWD A;  2LA7 A;  4YKM A;  3WBG A;  4NP1 A;  5BYP A;  1ADL A;  1MX7 A;  4YMY A;  1GKA B;  1IFC A;  5FAZ A;  4KC7 A;  1KT7 A;  4ORU A;  2QOS C;  1IKE A;  2AT0 X;  4ODD A;  1PM1 X;  2LBA A;  3APU A;  2Z4H A;  5HAE A;  2AT8 X;  1BBP A;  2WSJ A;  4NNS A;  5H9A A;  3ZW1 B;  4BQU A;  1EUO A;  1ERB A;  1YWD A;  2K23 A;  1YWC A;  1I06 A;  5D45 A;  1O1U A;  4GE1 A;  1QAB E;  3HWE A;  1BSY A;  1HQP A;  1LIF A;  1MX8 A;  3ELZ A;  4ORX A;  1S7D A;  3GAQ A;  5IO7 A;  1ZND A;  3APW A;  4U8U N;  3CMP A;  1CRB A;  1H91 A;  4ORY A;  3BDR A;  4UU2 A;  4EDE A;  3OD9 A;  3PQS A;  1EII A;  2QO6 A;  1BLR A;  1JBH A;  1BEB A;  2Z4I A;  1ZNK A;  1EXS A;  4U9C A;  2AT3 X;  1HBQ A;  4EXZ A;  1B0O A;  2GJ5 A;  4D6A A;  2XST A;  3FR5 A;  1JIW I;  1DZP A;  4KH8 A;  1KT5 A;  4M7M A;  1QY2 A;  1SMP I;  4WFV A;  2OVE A;  4AZO A;  4LQZ A;  1TW4 A;  4LKT A;  4DQ3 A;  4PSQ A;  1OEK A;  1ALB A;  2MJI A;  1MUP A;  5D4A A;  4ZH9 A;  4ORS A;  3VG4 A;  5HCE C;  4K19 A;  2IFB A;  4I9S A;  3UEV A;  2HZQ A;  4L3R A;  5LKE A;  5F7G A;  2G79 A;  2HLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...