3FEUA

Crystal structure of dsba-like thioredoxin domain vf_a0457 from vibrio fischeri
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
183
Chain Sequence
ADPKEGVQYEVLSTSLENDGMAPVTEVFALSCGHCRNMENFLPVISQEAGTDIGKMHITFNQSAHIASMFYYAAEMQVDGAPDHAFMEDLFAATQMGEGTTLTEQQEAYSKAFTSRGLVSPYDFNEEQRDTLIKKVDNAKMLSEKSGISSVPTFVVNGKYNVLIGGHDDPKQIADTIRYLLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative Lipoprotein
publication title Crystal Structure of DsbA-like thioredoxin domain VF_A0457 from Vibrio fischeri
rcsb
source organism Vibrio fischeri
molecule tags Oxidoreductase
total genus 58
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3feuA00
3LG6A 4K0GA 2MMAA 2PGTA 2NDOA 3VWUA 2GQKA 5IMCA 4BWSA 1A2LA 3EU4A 2YOIA 5CRWA 3FY7A 4XRDA 1WRYA 1AW9A 2KP1A 1J08A 1MD3A 2GZYA 3FZ5A 3C7MA 2CA8A 2H8LA 1A8LA 1V9WA 4K2DA 4OCEA 2IMIA 2YCDA 1DBYA 4KSOA 2XPDA 2YNXA 2VO4A 4BVXA 2TRXA 3D4TA 4KUNA 5EVOA 3TCOA 5F8BA 5ID2B 5B8AA 3A2XA 4FYUA 4IS0A 2CZ3A 1EOHA 1YDKA 2LNTA 3EINA 2FA4A 4N0ZA 4F2IA 2NTOA 5HR3A 4IJ3A 2YJ7A 2H0GA 5JCWA 2B7JA 5EL8A 1O8WA 2KP2A 1FOVA 5IMVA 1PN9A 3EE2A 3ZMLA 3EMPA 3GRXA 3LGCA 1S3CA 2KUCA 1TDIA 4TR1B 2H73A 1K3OA 3EWLA 3KH9A 4KH7A 3I9V2 1T00A 4JBBA 1SL0B 4PUAA 5D93A 1XWAA 1TXXA 3ZVJD 1T4ZA 4K7IA 5H5QA 3UVTA 3CYNA 4O7HA 1M7TA 5A4WA 3O3TA 6GSTA 1FHEA 4I6XA 4JEDA 1I5GA 4G10A 2GSRA 3F9UA 4TXVA 3IXRA 3DKSA 1GLPA 2OBIA 3CRUA 1PX6A 4KE3A 2VIMA 5DQYA 5JCUA 2JU5A 4IGJA 4KCAA 4IJIA 3DEXA 2GLRA 2VCXA 3D21A 1GH2A 2C1YA 2YV7A 2Z9SA 2I4AA 5J9CA 4HQSA 2WFCA 3H8QA 2GT5A 3N9JA 1O7UA 2I9HA 5ECOB 1U3AA 3QAVA 3PINA 1K0AA 4RI6A 2OBKA 3GTUA 3IAS2 1R4WA 5C04A 5G1LA 3NIVA 5JWQB 4ZB6A 1JLWA 3P2AA 4PQ1A 3TJGA 3IA1A 1BQ7A 1XBSA 1H4OA 3FZAA 2A4VA 3KM6A 2L57A 3CMIA 2YWIA 4TOPA 1B48A 1O6JA 2IJYA 3VK9A 1PGTA 1G6WA 4IW9A 2RLIA 4D73A 2VL2A 3BCKA 4H86A 3F6FA 1PKZA 3CSHA 3CSJA 3VURA 1GNEA 2QGVA 2H66A 3A5WA 3GL5A 5KN2A 2B1KA 2V32A 2O89A 1TRWA 3UEMA 2L4QA 2ON7A 2RIIA 2GGTA 4CHSA 4ZIJA 2OA7A 2VCWA 2NBSA 4QL9A 1BX9A 2BJXA 3ZITA 1UC7A 3HYPA 4Q5NA 4ZB9A 2YPMA 1R5PA 5ECLB 3KXOA 3D6IA 1GP1A 2YANA 2C4JA 2PWJA 2F51A 4PGTA 3JCML 1QMVA 4NWYA 3QMXA 2GVPA 1HQOA 3VPTA 4TR3A 3UJ1A 1SJIA 1Y6EA 4QQ7A 2FD3A 3VI7A 3E0UA 3HCZA 3HY2A 2AHEA 4GQCA 4LL4B 4LL1B 1XIYA 1T4YA 3WGEA 1Z3EA 6GSYA 4JR6A 3VFIA 3TKSC 3KD0A 3F63A 5KN1A 1YQ1A 2HFDA 3GKMA 3DXBA 2C8UA 2C3TA 2YJHA 1PL1A 3Q6OA 1GWCA 3WT1A 5J9BA 1LJRA 1M2DA 3F4SA 2LRCA 5DJMA 2IWTA 1DE2A 4JZQA 3DMLA 3FK8A 2GSQA 4NXIA 4P3YB 3GSSA 3ZRDA 3APQA 3TOTA 1V40A 2H75A 4OO5A 4K9ZA 4AJ8A 5ECPB 1TKDB 5CAXA 2LJAA 3HVXA 2IL3A 3N5OA 3F8UA 3J7Yb 4HI7A 1HNCA 5B6MA 5DQSA 2DJ1A 2LUSA 2X8GA 1OE7A 4BVYA 1W89A 4WBRD 3TOUA 1ON4A 4HOJA 2LQOA 1AQVA 5ECKB 4POLA 3BJ5A 2IMKA 3M0FA 5AISA 1EV4A 3I43A 2FA8A 4ULXA 2H01A 3F0IA 2R5GA 1S3DA 1YF0A 4WKWA 4BL7A 3KMNA 1O85A 3L0HA 1Z5YE 1K0NA 3I6AA 1BEDA 4HZ2A 10GSA 1EV9A 1F9MA 4PNFA 3TB2A 4IKHA 1TK0B 2WCIA 4GSSA 4PXOA 1GSDA 4POBA 1AC1A 5D9XA 4XHMA 2H1AA 1NHYA 1F2EA 4MJEA 2J9HA 3TJBA 2I81A 4NHWA 4I2UA 4EC0A 5DCGA 2V6KA 1FVKA 3GKNA 4MF7A 3EC3A 3HA9A 4OD7A 1GTAA 5F07A 1EEMA 4CDOA 2VD0A 2VL9A 4K6XA 3IV4A 1B4QA 1ZOFA 2GSSA 2RUEA 2AUVA 3ZLPA 5ECQB 4WETA 5EPFA 5G2ZA 1FVJA 5COHA 4AJ7A 1TTZA 2E2MA 2PN8A 3L9VA 2DJ0A 4YAVA 4YQVA 3D0ZA 1YF1A 2DMMA 3VWVA 1NSWA 4PUFC 1AIUA 5J41A 5KEJA 2B5YA 2XPEA 3QFAC 3ZIVA 3A3TA 2M46A 4DSQA 1Z7RA 1ZCPA 2XHFA 4IP6A 1ZGNA 1O73A 3LORA 3VWXA 2PPTA 2GZPA 3ERWA 5IM9A 2FWEA 4GCIA 3TJKA 3GFKA 2HZEA 1GSSA 4PURA 3P90A 4I2TA 1VGLA 4KDUA 1OKDA 2FY6A 3M1GA 5CRGA 2GT6A 4MJCA 5LD0A 1OC3A 3FKFA 4Z7XA 1T7PB 1K0CA 3ZIJA 1R7HA 3GKKA 2VAFA 1BJXA 1F37A 2WRTA 4F0BA 4EVMA 2H19A 1ZYEA 2PERA 3VLNA 4KW6A 5D9TA 4KGIA 4TR1A 4MP4A 1TI3A 4Q5RA 4WF5A 2VL3A 2LS5A 2TIRA 1XFLA 2C0FA 1SJ6A 4KSMA 1XW5A 2GTUA 1YKCA 2LRTA 4J2FA 4F82A 1VF4A 1A23A 2YWOA 3BOAA 1VF1A 2RUFA 1GNWA 5A4UA 3P7XA 1NHOA 2FCHA 3Q74A 3RDWA 2MBSA 2A2SA 1V2AA 5CYYA 2EIRA 1JLVA 3WGXA 4BA7A 2IMDA 2R6KA 4KDXA 5ENUA 1J0FA 5D8IA 1X0RA 2DJKA 4CW9A 5KN3A 2L5LA 5D73A 5ELGA 3IHQA 3KH7A 1SKSB 2B3SA 4XIHA 4X0XA 3QOUA 2JACA 3WGDA 2VM2A 3TRPA 1I9DA 3QAGA 1QGVA 2HZEB 2YP6A 5ELAA 2FGXA 2OE1A 3GH6A 2B7KA 3M8NA 1PRXA 5JWRB 1AQXA 1K0BA 4TXOA 3VPQA 1TP9A 4MDCA 1ML6A 3GL3A 2VLVA 4NV2A 5J3RA 4I8BA 3RPNA 1BAYA 3GV1A 4OWYA 4TRXA 3G7IA 2MBTA 3O76A 4KDYA 1GTIA 1RW1A 3MDKA 3CTGA 1R26A 2MMOA 1ST9A 2WS2A 1N2AA 2DBCA 1DE1A 1VF2A 4HU9A 1YJ6A 1AXDA 1Z6MA 1XOAA 2QKEA 1QXHA 5IMFA 4HJ2A 2LRNA 1QFNA 5G1KA 3GIXA 1ERTA 3QR6A 3KZQA 4EUYA 1USBA 2A2RA 3F4RA 2P5QA 1Q4JA 4J57E 4XTSA 3C73A 1A0RP 3CXGA 4GF0A 3ZL5A 2C3QA 4ML6A 4TR4A 1GTBA 4RQXA 11GSA 3IR4A 1EP8A 1T3BA 1TRSA 3IAM2 2YZUA 7GSSA 1PL2A 3RAZA 4I5QA 2GZZA 1RK4A 4V2MA 4ZXGA 5A4VA 1ZMAA 3IK7A 1JFUA 1SKWB 1WE0A 3K8NA 1OC9B 5AGYA 3LXZA 2L6CA 1S3AA 5GAPD 1HD2A 1GLQA 3H93A 5CREA 3GNJA 5B8BA 1YEPA 4V1Ap 1JZRA 4EF0A 5CRHA 3ZFLA 5AIXA 4TXOB 3U5RE 4TR0A 3TRXA 2X99A 3FEUA 4PQIA 2PU9C 5DALA 3TKSA 2RM6A 3HVVA 2H76A 3EURA 2YZHA 1TJDA 3L78A 3KJYA 1MTCA 2YN1A 1G0TA 3GX0A 3KCMA 5A5KA 2F3MA 1TU8A 1ABAA 2JZSA 3FYGA 4GWRA 3W8JA 4ISDA 3GUSA 2MMZA 3H1NA 2DJJA 4HEA2 5AN1A 4K0NA 3F3QA 3DD3A 1U3IA 4ECCA 3GKXA 5G5EA 4O92A 5B7CA 3HKRA 2LQQA 2V6OA 4JU5A 5FT3A 2VCZA 2H1GA 2K9FA 5HFIA 18GSA 1A8YA 2G0FA 4EDZA 1XZOA 1XVQA 2IMEA 4ZILA 4OFMA 4ZL9A 2F8FA 2P0GA 4MH3A 5IQYA 1UVZA 1M2AA 4RUVA 3DYRA 3HJOA 4N0VA 4F9ZA 1O81A 4MLYA 2H30A 1B8XA 1GL8A 4HU7A 5FHIA 4MJBA 5J4UA 1EOGA 3IOSA 3LYPA 4YAPA 4N10A 2HT9A 4DEJA 4HQZA 4IBPA 1NW2A 2JADA 1ZYQB 1MEKA 4DSSB 1PD21 1QQ2A 3APSA 3IC4A 1GSEA 1K0MA 4KCEA 2JZTA 2L59A 3EU3A 2R4VA 4GSNA 3KIJA 6GSXA 4K7NA 2YWMA 1M9BA 4ECBA 2R2JA 2VLTA 5LCZA 1GUMA 2CZ2A 3IBHA 3VWWA 4FIWA 4OO4A 2JSZA 1AAZA 5DALB 4QL7A 4EKZA 4AGSA 3GMFA 4MPGA 3QAWA 2LSTA 4MF5A 1OKTA 4ZBAA 4EE0A 2R3XA 2VUPA 5ECMB 1FW1A 4IVFA 1ACVA 3LYKA 1FG4A 2YWNA 2X8CA 1X9SB 5F06A 3EMXA 2OE0A 2M80A 3TJJA 1BG5A 3FR6A 4NV5A 1ERVA 3LJRA 1SYRA 2E2GA 1HNBA 5IOXA 2XBIA 2MYGA 3C8EA 5HR1A 2L6DA 5IOWA 4LMWA 2QC7A 2X8HA 3IK9A 2IN3A 2O8VB 2C0EA 4POKA 3RHCA 3R2QA 1XOBA 1K3YA 1EEJA 2DLXA 1WPIA 2CX3A 3QFBC 4WXTA 2FLSA 1OVNA 2PVQA 2KOKA 2ALBA 4X1UA 3KEBA 4IP1A 2H74A 3DGQA 3FZ9A 3ME7A 3RBTA 1WIKA 4L0UA 1GUHA 4G2EA 1R5AA 4KX4A 2PUKC 2MZCA 2BMXA 3BD2A 4MPFA 1ILOA 1EP7A 5HFKA 5CNWA 1VF3A 2I1UA 1WOUA 1F3BA 2C3NA 2B6MA 2GDRA 2K6VA 2DJ2A 4ZBBA 2P5RA 2HSYA 1M0UA 1HNAA 3EYTA 4ECJA 2I3YA 2GSTA 1FB6A 3TUEA 3L4NA 1BYEA 1VRSD 2PBJA 3KTLA 2WB9A 3FHKA 5IO0A 2VCVA 1GSUA 1MD4A 3LWAA 4WBJA 1OE8A 4IHUA 2N5BA 2B1LA 2F8AA 2MMNA 2PVOC 4JRRA 14GSA 1XW6A 1OYJA 3ZZXA 4E8HA 1T8EB 1J9BA 2GQLA 2PMTA 1EGRA 1A0FA 4HZ4A 2K18A 2X64A 1M99A 2DIYA 5IMDA 3G7JA 1Q98A 5DJLA 2FHEA 3IE3A 4YH2A 5ABRA 5LNKe 5F0GA 1U87A 3MAKA 5DBQA 1SD9A 2L5OA 4ZBDA 2E0QA 4F03A 4HDEA 4XRAA 2L4CA 1URMA 2KHPA 5G30A 2EIOA 4L8EA 4AJ6A 3TKSE 3TKQA 1G7OA 2HE3A 3KTBA 1F6MC 3IDVA 2CVKA 1ERWA 4TKYA 2J23A 4TW5A 4EL1A 5D9VA 3GYKA 2YV9A 2H1DA 3I69A 3E3EA 4MZWA 1A2MA 5B6NA 1T1VA 4OFNA 3W8SA 2V2GA 1TW9A 4LA1A 3UIWA 4K1FA 1SJZA 3HJMA 5E4WA 4XS6A 5DAKA 4ML1A 4ZL8A 3HJPA 5CO3A 4YQUA 2VM1A 5IMAA 1TK8B 4KA0A 1K3LA 1JZDA 5DCHA 2FWFA 4WR4A 1SU9A 3H79A 4HS1A 2H70A 1DUGA 3ED3A 3UBLA 5HFGA 4FYCA 4J56E 1X5DA 2WZ9A 4PQHA 5IIZA 5CRDA 4FH8A 1TOFA 1OC9A 5L71A 5ECRB 5AIVA 1WP0A 1PMTA 1IYIA 5ECNB 1UA5A 2WJUA 3S9FA 3SWLA 1ZZYA 6GSVA 2C80A 1LU4A 4EXJA 3D22A 3UMAA 4FO5A 6GSSA 2WULA 4F0CA 1V98A 2IMFA 4X43A 5EY6A 4EDYA 2JZRA 3DVWA 1GUKA 4XCSA 1PX7A 5E59A 2N5FA 1XVWA 4L5OA 4KB3A 1TI1A 5D96A 5GSSA 1O8XA 4ILFA 3KGKA 2REMA 1XWBA 4NHZA 2K8SA 2H0IA 3LQ7A 1Z6NA 3HZ8A 5HR0A 3ZREA 3UL3A 1G6YA 4HUAA 4IELA 3ZFBA 3TKRA 2DIZA 3FR3A 3MSZA 2VCTA 5ECSA 2B5EA 3O6TA 2CX4A 1YKAA 4LMVA 3HZ4A 2CAQA 3ZYWA 2NPBA 1SD8A 1YEXA 3ISOA 3TGZA 17GSA 3QPMA 3M3MA 16GSA 3C1RA 5DAKB 4BWQA 5GSTA 1HYUA 2E7PA 3BCIA 5F05A 2RM5A 3MWHA 1M9AA 1Z9HA 5JCGA 2H6YA 4WEYA 1XWKA 1SYXA 1JZWA 2LJKA 1X5CA 3ERGA 1EZKA 1W4VA 1QK8A 4RI7A 4RQRA 2HLSA 4GSTA 4XS4A 3KMOA 1KBNA 4MABA 2C0GA 22GSA 3LFLA 4DSSA 3CBUA 1DSBA 1GULA 2HI7A 5G5FA 1SK0A 3WT2A 3F4TA 1FAAA 2VCQA 3PH9A 20GSA 1EWXA 3L9UA 2LTKA 3P8WA 5IPGA 5IO2A 1A2JA 4IQ1A 3G7YA 1OAZA 1B4PA 2C0DA 3FR9A 5HQPA 3HDCA 4TVEA 1SL1B 1PQNA 4WF4A 1SENA 3DVXA 1PSQA 2IIYA 3GHAA 4DVCA 3TJFA 2DMLA 2CVDA 4IN0A 2OJLA 3WD6A 3CSIA 2ZNMA 3AY8A 12GSA 3ERFA 1KNGA 3UVHA 1F3AA 2DJ3A 1K0DA 1K0OA 2AB6A 2QSIA 3H4KA 1TRVA 2VLUA 1U88A 2O85A 4NMUA 4GQFA 1FB0A 2FWGA 1TRUA 4N11A 2N5AA 4G9HA 4Q5QA 3E9JB 1M2BA 3WYWA 1OC8A 2OE3A 3FW2A 5DDLA 1WWJA 8GSSA 1SK1A 3D5JA 3ME8A 3EVIA 5H5SA 2OADA 5H5RA 1A24A 3BBYA 1ERUA 1UN2A 3LEFA 1E6BA 2BTOT 1KEBA 1LBKA 3M9JA 4HJMA 4IQAA 4XS4B 2ZUPA 2AJQB 4E8EA 4V2LA 3C71A 2XBQA 1GSQA 2H6XA 2HNLA 3APOA 2H71A 3J7Yk 1THXA 1GRXA 4DSRA 1TU7A 2CT6A 3Q19A 5INYA 3FRCA 2JL4A 5DVBA 4GXZA 2LKUA 4NAXA 4MH2A 2ZCTA 5C00A 1C72A 3PR8A 4NPBA 4V2NA 4ZB8A 5JWOB 5ECHB 2G2QA 4GLTA 3ZMKA 4TN8A 5D9WA 2VL2C 4OMVA 2IFQA 3GA4A 2HYXA 1SK2A 1Y25A 2FWHA 1CQGA 3GTUB 3W6GA 1B9XC 2XC2A 3DIEA 3SBCA 1THOA 5G31A 4MZCA 1N8JA 1AQWA 2EC4A 3MNGA 2O7KA 3GURA 1X9MB 4I97A 3LSZA 1X5EA 5HR2A 2LV3A 5J5NA 2O87A 1XWGA 1B9YC 1U6TA 2HSHA 3A2VA 4JR4A 2M72A 2KLXA 1RQMA 4D73B 4MA9A 3HD5A 4FYBA 2H0HA 4N30A 1SL2B 1SKRB 4POMA 4KAEA 4OFTA 3UAPA 5IPHA 2CVBA 4ECIA 1V58A 3LXTA 2JSYA 1X9WB 1PA3A 3TKPA 1V57A 4ID0A 1AUCA 2DC5A 1EGOA 3QCPA 1CQHA 2LEGA 4GRFA 4XS1A 6GSUA 2VOCA 1JZOA 1NM3A 3US3A 3GN3A 2AV4A 3CTFA 3UARA 4GTUA 2ES7A 3QDNA 2GS3A 2LNSA 2ON5A 3Q18A 19GSA 1MDKA 1XPVA 5GZZB 4LLRA 5CP1A 1XXUA 4MZBA 1FO5A 3G9BA 2H6ZA 3HHVA 2CAIA 3FZ4A 1YZXA 2IFQB 2HXKA 2IPAA 3TRQA 1XWCA 3F6DA 3M9KA 4K8MA 4L0WA 4O32A 4ZL7A 3IRAA 3HVSA 3GSTA 3C1SA 3F3RA 2V41A 4MF6A 3QD9A 1Z7PA 2HRNA 4YQMA 4MK3A 1QUWA 4V1Ag 3D4MA 3UBKA 4L5LA 4WR5A 1G7EA 1PKWA 1ZL9A 1XW9A 2AAWA 4KNDA 5FWGA 4MMMA 2CV4A 2H72A 2P31A 4K7OA 1GSYA 2VD1A 2LJRA 2K8VA 2GQMA 3UOMA 2AYTA 3NOFA 4JE1A 3RHBA 1MDIA 3A2WA 4PX1A 5ECIB 4MJAA 4MCUA 1JHBA 1KTEA 4ACSA 2WDUA 3RPPA 5KN0A 4OCFA 2NVLA 5ID2A 3DWVA 4PNGA 1E2YA 2CQ9A 1GTUA 3KP8A 2FNOA 1MDJA 4BPYA 2OACA 1IYHA 4Q5FA 2B5XA 2H1BA 2HRFA 9GSSA 2TRCP 3OR5A 1H75A 2R37A 1XCCA 6GSWA 13GSA 2V1MA 3HXSA 2HZFA 3ZTLA 3VI5A 3GX8A 3U6VA 2F9SA 1GSFA 2DSAA 5IMZA 3V1WA 4O5RA 2D2ZA 2FUG2 3IPZA 3L9SA 2WGRA 3CRTA 3KP9A 1WMJA 3DRNA 3NZNA 1TK5B 2EIQA 4EO3A 2OKAA 3GH9A 1WJKA 1YY7A 5GAND 3PGTA 4AF2A 3TDGA 4G19A 3ZVJA
chains in the Genus database with same CATH superfamily
3LG6A 4K0GA 2MMAA 2PGTA 2NDOA 3VWUA 2GQKA 5IMCA 4BWSA 1A2LA 3EU4A 2YOIA 5CRWA 3FY7A 4XRDA 4FQUA 1WRYA 1AW9A 2KP1A 1J08A 1MD3A 2GZYA 3FZ5A 3C7MA 2CA8A 2H8LA 1A8LA 1V9WA 4K2DA 4OCEA 2IMIA 2YCDA 1DBYA 3LW9A 4KSOA 2XPDA 2YNXA 2VO4A 4K5RA 4BVXA 2TRXA 3D4TA 4KUNA 5EVOA 3TCOA 5F8BA 5ID2B 5B8AA 3A2XA 4FYUA 4IS0A 2CZ3A 1EOHA 1YDKA 2LNTA 3EINA 2FA4A 4N0ZA 4F2IA 2NTOA 5HR3A 4IJ3A 2YJ7A 2H0GA 1ZYNA 5JCWA 2B7JA 5EL8A 1O8WA 2KP2A 1FOVA 5IMVA 1PN9A 3EE2A 3ZMLA 4Z2RA 3EMPA 3GRXA 3LGCA 1S3CA 2KUCA 1TDIA 4TR1B 2H73A 1K3OA 3EWLA 3KH9A 4KH7A 3I9V2 1T00A 4JBBA 1SL0B 4PUAA 5D93A 1XWAA 1TXXA 3ZVJD 1T4ZA 4K7IA 5H5QA 3UVTA 3CYNA 4O7HA 1M7TA 5A4WA 3O3TA 3FMWA 6GSTA 1FHEA 4I6XA 4JEDA 1I5GA 4G10A 2GSRA 3F9UA 4TXVA 3IXRA 3DKSA 1GLPA 2OBIA 3CRUA 1PX6A 4KE3A 2VIMA 5DQYA 5JCUA 2JU5A 4IGJA 4KCAA 4IJIA 3DEXA 2GLRA 2VCXA 3D21A 1GH2A 2C1YA 2YV7A 2Z9SA 2I4AA 5J9CA 4HQSA 2WFCA 3H8QA 2GT5A 3N9JA 1O7UA 2I9HA 5ECOB 1U3AA 3QAVA 3PINA 1K0AA 2QA2A 4RI6A 2X49A 2OBKA 3GTUA 3IAS2 1R4WA 5C04A 5G1LA 3NIVA 4BVXB 5JWQB 4EIPA 4ZB6A 1JLWA 3P2AA 4PQ1A 3TJGA 3IA1A 1BQ7A 1XBSA 1H4OA 3FZAA 2A4VA 3KM6A 2L57A 3CMIA 2YWIA 4TOPA 1B48A 1O6JA 2IJYA 3VK9A 1PGTA 1G6WA 4IW9A 2RLIA 4D73A 3MYDA 2VL2A 3BCKA 4H86A 3F6FA 1PKZA 3CSHA 3CSJA 3VURA 1GNEA 2QGVA 2H66A 3A5WA 3GL5A 5KN2A 2B1KA 2V32A 2O89A 1TRWA 3UEMA 2L4QA 2ON7A 2RIIA 2GGTA 4CHSA 4ZIJA 2OA7A 2VCWA 2NBSA 4QL9A 1BX9A 2BJXA 3ZITA 1UC7A 3HYPA 4Q5NA 4ZB9A 2YPMA 1R5PA 5ECLB 3KXOA 3D6IA 1GP1A 2YANA 2C4JA 2PWJA 2F51A 4PGTA 3JCML 1QMVA 4NWYA 3QMXA 2GVPA 1HQOA 3VPTA 4TR3A 3UJ1A 1SJIA 1Y6EA 4QQ7A 2FD3A 3VI7A 3E0UA 3HCZA 3HY2A 2AHEA 4GQCA 4LL4B 4LL1B 1XIYA 1T4YA 3WGEA 1Z3EA 2A2PA 6GSYA 4JR6A 3VFIA 3TKSC 3KD0A 3F63A 5KN1A 1YQ1A 2HFDA 3GKMA 4KF9A 3DXBA 2C8UA 2C3TA 2YJHA 1PL1A 3Q6OA 1GWCA 3WT1A 5J9BA 1LJRA 1M2DA 3F4SA 2LRCA 5DJMA 2IWTA 1DE2A 4JZQA 3MIXA 3DMLA 3FK8A 2GSQA 4NXIA 4P3YB 3GSSA 3ZRDA 3APQA 3TOTA 1V40A 2H75A 4OO5A 4K9ZA 4AJ8A 5ECPB 4Z2UA 1TKDB 5CAXA 2LJAA 3HVXA 2IL3A 3N5OA 3F8UA 3J7Yb 4HI7A 1HNCA 5B6MA 5DQSA 2DJ1A 2LUSA 4PTSA 2X8GA 1OE7A 4BVYA 1W89A 4WBRD 3TOUA 1ON4A 4HOJA 2LQOA 1AQVA 5ECKB 4POLA 3BJ5A 2IMKA 3M0FA 1EV4A 3I43A 5AISA 2FA8A 4ULXA 2H01A 3F0IA 2R5GA 1S3DA 1YF0A 4WKWA 4BL7A 3KMNA 1O85A 3L0HA 1Z5YE 1K0NA 3I6AA 1BEDA 4HZ2A 10GSA 1EV9A 1F9MA 4PNFA 3TB2A 4IKHA 1TK0B 2WCIA 4GSSA 4PXOA 1GSDA 4POBA 1AC1A 5D9XA 4XHMA 2H1AA 1NHYA 1F2EA 4MJEA 2J9HA 3TJBA 2I81A 4NHWA 4I2UA 4EC0A 5DCGA 2V6KA 1FVKA 3GKNA 4MF7A 3EC3A 3HA9A 4OD7A 1GTAA 5F07A 1EEMA 4CDOA 2VD0A 2VL9A 4K6XA 3IV4A 1B4QA 1ZOFA 2GSSA 2RUEA 2AUVA 3ZLPA 5ECQB 4WETA 5EPFA 5G2ZA 1FVJA 5COHA 4AJ7A 1TTZA 2E2MA 2PN8A 3L9VA 2DJ0A 4YAVA 4YQVA 3D0ZA 1YF1A 2DMMA 3VWVA 1NSWA 4PUFC 1AIUA 5J41A 5KEJA 2B5YA 2XPEA 3QFAC 3ZIVA 3A3TA 2M46A 4MNNA 4DSQA 1Z7RA 1ZCPA 2XHFA 4IP6A 1ZGNA 1O73A 3LORA 3VWXA 2PPTA 2GZPA 4USSA 3ERWA 5IM9A 2FWEA 4GCIA 3TJKA 3GFKA 3R3EA 2HZEA 1GSSA 4PURA 3P90A 4I2TA 1VGLA 4KDUA 1OKDA 2FY6A 3M1GA 5CRGA 2GT6A 4MJCA 5LD0A 1OC3A 3FKFA 4Z7XA 1T7PB 1K0CA 3ZIJA 1R7HA 3GKKA 2VAFA 1BJXA 1F37A 2WRTA 4F0BA 4EVMA 2H19A 1ZYEA 2PERA 3VLNA 4KW6A 5D9TA 4KGIA 4TR1A 4MP4A 1TI3A 4Q5RA 4WF5A 2VL3A 2LS5A 2TIRA 1XFLA 2C0FA 1SJ6A 4KSMA 1XW5A 2GTUA 1YKCA 2LRTA 4J2FA 4F82A 1VF4A 1A23A 2YWOA 3BOAA 1VF1A 2RUFA 1GNWA 5A4UA 3P7XA 1NHOA 2FCHA 3Q74A 3RDWA 2MBSA 2A2SA 1V2AA 5CYYA 2EIRA 1JLVA 3WGXA 4BA7A 2IMDA 2R6KA 4KDXA 5ENUA 1J0FA 5D8IA 1X0RA 2DJKA 4CW9A 5KN3A 2L5LA 5D73A 5ELGA 3IHQA 3KH7A 1SKSB 2B3SA 4XIHA 4X0XA 3QOUA 2JACA 3WGDA 2VM2A 3TRPA 1I9DA 3QAGA 1QGVA 2HZEB 2YP6A 5ELAA 2FGXA 1FOHA 2OE1A 3GH6A 2B7KA 3M8NA 1PRXA 5JWRB 1AQXA 1K0BA 4TXOA 3VPQA 1TP9A 4HSCX 4MDCA 1ML6A 3GL3A 2VLVA 4NV2A 5J3RA 4I8BA 3RPNA 1BAYA 3GV1A 4OWYA 3IC8A 4TRXA 3G7IA 2MBTA 3O76A 4KDYA 1GTIA 1RW1A 3MDKA 3CTGA 1R26A 2MMOA 1ST9A 2WS2A 1N2AA 2DBCA 1DE1A 1VF2A 4HU9A 1YJ6A 1AXDA 1Z6MA 1XOAA 2QKEA 1QXHA 5IMFA 4HJ2A 2LRNA 1QFNA 5G1KA 3GIXA 1ERTA 3QR6A 3KZQA 4EUYA 5KOXA 1USBA 2A2RA 3F4RA 2P5QA 1Q4JA 4J57E 4XTSA 3C73A 1A0RP 3CXGA 4GF0A 3ZL5A 2C3QA 4ML6A 4TR4A 1GTBA 4RQXA 11GSA 3IR4A 1EP8A 1T3BA 1TRSA 3IAM2 2YZUA 7GSSA 1PL2A 3RAZA 4I5QA 2GZZA 1RK4A 4V2MA 4ZXGA 5A4VA 2R0GA 1ZMAA 3IK7A 1JFUA 1SKWB 1WE0A 3K8NA 1OC9B 5AGYA 4CY6A 3LXZA 2L6CA 1S3AA 5GAPD 1HD2A 1GLQA 3H93A 5CREA 3GNJA 5B8BA 1YEPA 4V1Ap 1JZRA 4EF0A 5CRHA 3ZFLA 5AIXA 4TXOB 3U5RE 4TR0A 3TRXA 2X99A 3FEUA 4PQIA 2PU9C 5DALA 3TKSA 2RM6A 3HVVA 2H76A 3EURA 2YZHA 1TJDA 3L78A 3KJYA 1MTCA 2YN1A 1G0TA 3GX0A 3KCMA 5A5KA 2F3MA 1TU8A 1ABAA 2JZSA 3FYGA 4GWRA 3W8JA 4ISDA 3GUSA 2MMZA 3H1NA 2DJJA 4HEA2 5AN1A 4K0NA 3F3QA 3DD3A 1U3IA 4ECCA 2R0PA 3GKXA 2DKIA 5G5EA 4O92A 5B7CA 3HKRA 2LQQA 2V6OA 4JU5A 5FT3A 3PPUA 2VCZA 2H1GA 2K9FA 5HFIA 18GSA 1A8YA 2G0FA 4EDZA 1XZOA 1XVQA 2IMEA 4ZILA 4OFMA 4ZL9A 2F8FA 2P0GA 4MH3A 5IQYA 1UVZA 1M2AA 4RUVA 3DYRA 3HJOA 4N0VA 4F9ZA 1O81A 4MLYA 2H30A 1B8XA 1GL8A 4HU7A 5FHIA 4MJBA 5J4UA 1EOGA 3IOSA 3LYPA 4YAPA 4N10A 4CY8A 2HT9A 4DEJA 4HQZA 4IBPA 1NW2A 2JADA 1ZYQB 1MEKA 4DSSB 1PD21 1QQ2A 3APSA 5BRTA 3IC4A 1GSEA 1K0MA 4KCEA 2JZTA 2L59A 3EU3A 2R4VA 4GSNA 3KIJA 6GSXA 4K7NA 2YWMA 4EIQA 1M9BA 4ECBA 2R2JA 2VLTA 5LCZA 1GUMA 2CZ2A 3IBHA 3VWWA 4FIWA 4OO4A 2JSZA 1AAZA 5DALB 4QL7A 4EKZA 1S3RA 4AGSA 3GMFA 4MPGA 3QAWA 2LSTA 4MF5A 1OKTA 4ZBAA 4EE0A 2R3XA 4YKGA 2VUPA 5ECMB 1FW1A 4IVFA 1ACVA 3LYKA 1FG4A 2YWNA 2X8CA 1X9SB 5F06A 5BMUA 3EMXA 2OE0A 2M80A 3TJJA 1BG5A 3FR6A 4NV5A 1ERVA 3LJRA 1SYRA 2E2GA 1HNBA 5IOXA 2XBIA 2MYGA 3C8EA 5HR1A 2L6DA 5IOWA 4LMWA 2QC7A 2X8HA 3IK9A 2IN3A 2O8VB 3A5IA 2C0EA 4POKA 3RHCA 3R2QA 1XOBA 1K3YA 4O5UA 2UZ8A 1EEJA 2DLXA 1WPIA 2CX3A 3QFBC 4WXTA 2FLSA 1OVNA 2PVQA 2KOKA 2ALBA 4X1UA 3KEBA 4IP1A 2H74A 3DGQA 3FZ9A 3ME7A 3RBTA 1WIKA 2R0CA 4L0UA 1GUHA 4G2EA 1R5AA 4KX4A 2PUKC 2MZCA 2BMXA 3BD2A 4MPFA 1ILOA 1EP7A 5HFKA 5CNWA 1VF3A 2I1UA 1WOUA 1F3BA 2C3NA 2B6MA 2GDRA 2K6VA 3CQFA 2DJ2A 4ZBBA 2P5RA 2HSYA 1M0UA 1HNAA 3EYTA 4ECJA 2I3YA 2GSTA 1FB6A 3TUEA 3L4NA 1XG8A 1BYEA 1VRSD 2HRKA 2PBJA 3KTLA 2WB9A 3FHKA 5IO0A 2A4HA 4BIKA 2VCVA 1GSUA 1MD4A 3LWAA 4WBJA 1OE8A 4IHUA 2N5BA 2B1LA 2F8AA 2MMNA 2PVOC 4JRRA 14GSA 1XW6A 1OYJA 3ZZXA 4E8HA 1T8EB 1J9BA 2GQLA 2PMTA 1EGRA 1A0FA 4HZ4A 2K18A 2X64A 1M99A 2DIYA 5IMDA 3G7JA 4O5QA 4ICYA 1Q98A 5DJLA 2FHEA 3IE3A 4YH2A 5ABRA 5LNKe 5F0GA 1U87A 3MAKA 5DBQA 1SD9A 2L5OA 4ZBDA 2E0QA 4F03A 4HDEA 4XRAA 2L4CA 1URMA 2KHPA 5G30A 2EIOA 4L8EA 4AJ6A 3TKSE 3TKQA 1G7OA 2HE3A 3KTBA 1F6MC 3IDVA 2CVKA 1ERWA 4TKYA 2J23A 4TW5A 4EL1A 5D9VA 3GYKA 2YV9A 2H1DA 3I69A 3E3EA 4MZWA 1A2MA 5B6NA 1T1VA 4OFNA 3W8SA 2V2GA 1TW9A 4LA1A 3UIWA 4K1FA 1SJZA 3HJMA 5E4WA 4XS6A 5DAKA 4ML1A 4ZL8A 3HJPA 5CO3A 4YQUA 2VM1A 5IMAA 1TK8B 4KA0A 1K3LA 1JZDA 5DCHA 2FWFA 4WR4A 1SU9A 3H79A 4HS1A 2H70A 2X4AA 1DUGA 3ED3A 3UBLA 5HFGA 4FYCA 4J56E 1X5DA 2WZ9A 4PQHA 5IIZA 5CRDA 4FH8A 1TOFA 1OC9A 5L71A 5ECRB 5AIVA 1WP0A 1PMTA 1IYIA 4YKFA 5ECNB 1UA5A 2WJUA 3S9FA 3SWLA 1ZZYA 6GSVA 2C80A 1LU4A 4EXJA 3D22A 3UMAA 4FO5A 6GSSA 2WULA 4F0CA 1V98A 2IMFA 4X43A 5EY6A 4EDYA 2JZRA 3DVWA 1GUKA 4XCSA 1PX7A 5E59A 2N5FA 1XVWA 4L5OA 4KB3A 1TI1A 5D96A 5GSSA 1O8XA 4ILFA 3KGKA 2REMA 1XWBA 4NHZA 2K8SA 2H0IA 3LQ7A 1Z6NA 3HZ8A 5HR0A 3ZREA 3UL3A 1G6YA 4HUAA 4IELA 3ZFBA 3TKRA 2DIZA 3FR3A 3MSZA 2VCTA 5ECSA 2B5EA 3O6TA 2CX4A 1YKAA 4LMVA 3HZ4A 2CAQA 3ZYWA 2NPBA 1SD8A 1YEXA 3ISOA 4K2XA 3TGZA 17GSA 3QPMA 3M3MA 16GSA 3C1RA 5DAKB 4BWQA 5GSTA 1HYUA 2E7PA 3BCIA 5F05A 2RM5A 3MWHA 1M9AA 1Z9HA 5JCGA 2H6YA 4WEYA 4X4JA 4A5PA 2QA1A 1XWKA 1SYXA 1JZWA 2LJKA 1X5CA 3ERGA 1EZKA 1W4VA 1QK8A 4RI7A 4RQRA 2HLSA 4GSTA 4XS4A 3KMOA 1KBNA 4MABA 2C0GA 22GSA 3LFLA 4DSSA 3CBUA 1DSBA 3HVNA 1GULA 2HI7A 5G5FA 1SK0A 3WT2A 3F4TA 1FAAA 2VCQA 3PH9A 20GSA 1EWXA 3L9UA 2LTKA 3P8WA 5IPGA 5IO2A 1A2JA 4IQ1A 3G7YA 1OAZA 1B4PA 2C0DA 3FR9A 5HQPA 2HRAA 3HDCA 4TVEA 1SL1B 4Z2TA 1PQNA 4WF4A 1SENA 3DVXA 1PSQA 2IIYA 3GHAA 4DVCA 3TJFA 2DMLA 2CVDA 4IN0A 2OJLA 3WD6A 3CSIA 2ZNMA 3AY8A 12GSA 3ERFA 1KNGA 3UVHA 1F3AA 2DJ3A 1K0DA 1K0OA 2AB6A 2QSIA 3H4KA 1TRVA 2VLUA 1U88A 2O85A 4NMUA 4GQFA 1FB0A 2FWGA 1TRUA 4N11A 2N5AA 4G9HA 4Q5QA 3E9JB 1M2BA 3WYWA 1OC8A 2OE3A 3FW2A 5DDLA 1WWJA 8GSSA 1SK1A 3D5JA 3ME8A 3EVIA 5H5SA 2OADA 5H5RA 1A24A 3BBYA 1ERUA 1UN2A 3LEFA 1E6BA 2BTOT 1KEBA 1LBKA 3M9JA 4HJMA 4IQAA 4XS4B 2ZUPA 2AJQB 4E8EA 4V2LA 3C71A 2XBQA 1GSQA 2H6XA 2HNLA 3APOA 1ZYPA 2H71A 3J7Yk 1THXA 1GRXA 4DSRA 1TU7A 2CT6A 3Q19A 5INYA 3FRCA 4G0IA 2JL4A 4GXZA 5DVBA 2LKUA 4NAXA 4MH2A 2ZCTA 5C00A 1C72A 3PR8A 4NPBA 4V2NA 4ZB8A 5JWOB 5ECHB 2G2QA 4GLTA 3ZMKA 4TN8A 5D9WA 2VL2C 4OMVA 2IFQA 3GA4A 1PFOA 2HYXA 1SK2A 1Y25A 2FWHA 1CQGA 3GTUB 3W6GA 1B9XC 2XC2A 3DIEA 3SBCA 1THOA 5G31A 4MZCA 1N8JA 1AQWA 2EC4A 3MNGA 2O7KA 3GURA 1X9MB 4I97A 3LSZA 1X5EA 5HR2A 2LV3A 5J5NA 2O87A 1XWGA 1B9YC 1U6TA 2HSHA 3A2VA 2HSMA 4JR4A 2M72A 2KLXA 1RQMA 4D73B 4MA9A 3HD5A 4FYBA 2H0HA 4N30A 1SL2B 1SKRB 4POMA 4KAEA 4OFTA 3UAPA 5IPHA 2CVBA 4ECIA 1V58A 3LXTA 2JSYA 4G0LA 1X9WB 1PA3A 3TKPA 1V57A 4ID0A 1AUCA 2DC5A 1EGOA 3QCPA 1CQHA 2LEGA 4GRFA 4XS1A 4G0KA 6GSUA 2VOCA 1JZOA 1NM3A 3US3A 3GN3A 2AV4A 3CTFA 3UARA 3EPTA 4GTUA 2ES7A 3QDNA 2GS3A 1M3IA 2LNSA 2ON5A 3Q18A 4K5SA 19GSA 1M3JA 1MDKA 1XPVA 5GZZB 4LLRA 5CP1A 1XXUA 4MZBA 1FO5A 3G9BA 2H6ZA 3HHVA 2CAIA 3FZ4A 1YZXA 2IFQB 2HXKA 2IPAA 3TRQA 1XWCA 3F6DA 3M9KA 4K8MA 4L0WA 4O32A 2DKHA 4ZL7A 3IRAA 3HVSA 3GSTA 3C1SA 3F3RA 2V41A 4MF6A 3QD9A 1Z7PA 2HRNA 4YQMA 4MK3A 3IHGA 1QUWA 4V1Ag 3D4MA 3UBKA 4L5LA 1PN0A 4WR5A 1G7EA 1PKWA 1ZL9A 1XW9A 2AAWA 4KNDA 5FWGA 4MMMA 2CV4A 2H72A 2P31A 4K7OA 1GSYA 2VD1A 2LJRA 2K8VA 2GQMA 3UOMA 2AYTA 3NOFA 4JE1A 3RHBA 4BVYB 1MDIA 3A2WA 4PX1A 5ECIB 4MJAA 4MCUA 1JHBA 1KTEA 4ACSA 2WDUA 3RPPA 5KN0A 4OCFA 2NVLA 5ID2A 4BL7B 3DWVA 4PNGA 1E2YA 2CQ9A 1GTUA 3KP8A 2FNOA 1MDJA 4BPYA 2OACA 1IYHA 4Q5FA 2B5XA 2H1BA 2HRFA 9GSSA 2TRCP 3OR5A 1H75A 2R37A 1XCCA 6GSWA 13GSA 2V1MA 3HXSA 2HZFA 3ZTLA 3VI5A 3GX8A 3U6VA 2F9SA 1GSFA 2DSAA 5IMZA 3V1WA 4O5RA 2D2ZA 2FUG2 3IPZA 3L9SA 2WGRA 3CRTA 3KP9A 1WMJA 3DRNA 5KOWA 3NZNA 1TK5B 2EIQA 4EO3A 2OKAA 3GH9A 1WJKA 1YY7A 5GAND 3PGTA 4AF2A 3TDGA 4G19A 3ZVJA
chains in the Genus database with same CATH topology
3LG6A 4K0GA 2MMAA 2PGTA 2NDOA 3VWUA 2GQKA 5IMCA 4BWSA 1A2LA 3EU4A 2YOIA 5CRWA 3FY7A 4XRDA 4FQUA 1WRYA 1AW9A 2KP1A 1J08A 1MD3A 2GZYA 3FZ5A 3C7MA 2CA8A 2H8LA 1A8LA 1V9WA 4K2DA 4OCEA 2IMIA 2YCDA 1DBYA 3LW9A 4KSOA 2XPDA 2YNXA 2VO4A 4K5RA 4BVXA 2TRXA 3D4TA 4KUNA 5EVOA 3TCOA 5F8BA 5ID2B 5B8AA 3A2XA 4FYUA 4IS0A 2CZ3A 1EOHA 1YDKA 2LNTA 3EINA 2FA4A 4N0ZA 4F2IA 2NTOA 5HR3A 4IJ3A 2YJ7A 2H0GA 1ZYNA 5JCWA 2B7JA 5EL8A 1O8WA 2KP2A 1FOVA 5IMVA 1PN9A 3EE2A 3ZMLA 4Z2RA 3EMPA 3GRXA 3LGCA 1S3CA 2KUCA 1TDIA 4TR1B 2H73A 1K3OA 3EWLA 3KH9A 4KH7A 3I9V2 1T00A 4JBBA 1SL0B 4PUAA 5D93A 1XWAA 1TXXA 3ZVJD 1T4ZA 4K7IA 5H5QA 3UVTA 3CYNA 4O7HA 1M7TA 5A4WA 3O3TA 3FMWA 6GSTA 1FHEA 4I6XA 4JEDA 1I5GA 4G10A 2GSRA 3F9UA 4TXVA 3IXRA 3DKSA 1GLPA 2OBIA 3CRUA 1PX6A 4KE3A 2VIMA 5DQYA 5JCUA 2JU5A 4IGJA 4KCAA 4IJIA 3DEXA 2GLRA 2VCXA 3D21A 1GH2A 2C1YA 2YV7A 2Z9SA 2I4AA 5J9CA 4HQSA 2WFCA 3H8QA 2GT5A 3N9JA 1O7UA 2I9HA 5ECOB 1U3AA 3QAVA 3PINA 1K0AA 2QA2A 4RI6A 2X49A 2OBKA 3GTUA 3IAS2 1R4WA 5C04A 5G1LA 3NIVA 4BVXB 5JWQB 4EIPA 4ZB6A 1JLWA 3P2AA 4PQ1A 3TJGA 3IA1A 1BQ7A 1XBSA 1H4OA 3FZAA 2A4VA 3KM6A 2L57A 3CMIA 2YWIA 4TOPA 1B48A 1O6JA 2IJYA 3VK9A 1PGTA 1G6WA 4IW9A 2RLIA 4D73A 3MYDA 2VL2A 3BCKA 4H86A 3F6FA 1PKZA 3CSHA 3CSJA 3VURA 1GNEA 2QGVA 2H66A 3A5WA 3GL5A 5KN2A 2B1KA 2V32A 2O89A 1TRWA 3UEMA 2L4QA 2ON7A 2RIIA 2GGTA 4CHSA 4ZIJA 2OA7A 2VCWA 2NBSA 4QL9A 1BX9A 2BJXA 3ZITA 1UC7A 3HYPA 4Q5NA 4ZB9A 2YPMA 1R5PA 5ECLB 3KXOA 3D6IA 1GP1A 2YANA 2C4JA 2PWJA 2F51A 4PGTA 3JCML 1QMVA 4NWYA 3QMXA 2GVPA 1HQOA 3VPTA 4TR3A 3UJ1A 1SJIA 1Y6EA 4QQ7A 2FD3A 3VI7A 3E0UA 3HCZA 3HY2A 2AHEA 4GQCA 4LL4B 4LL1B 1XIYA 1T4YA 3WGEA 1Z3EA 2A2PA 6GSYA 4JR6A 3VFIA 3TKSC 3KD0A 3F63A 5KN1A 1YQ1A 2HFDA 3GKMA 4KF9A 3DXBA 2C8UA 2C3TA 2YJHA 1PL1A 3Q6OA 1GWCA 3WT1A 5J9BA 1LJRA 1M2DA 3F4SA 2LRCA 5DJMA 2IWTA 1DE2A 4JZQA 3MIXA 3DMLA 3FK8A 2GSQA 4NXIA 4P3YB 3GSSA 3ZRDA 3APQA 3TOTA 1V40A 2H75A 4OO5A 4K9ZA 4AJ8A 5ECPB 4Z2UA 1TKDB 5CAXA 2LJAA 3HVXA 2IL3A 3N5OA 3F8UA 3J7Yb 4HI7A 1HNCA 5B6MA 5DQSA 2DJ1A 2LUSA 4PTSA 2X8GA 1OE7A 4BVYA 1W89A 4WBRD 3TOUA 1ON4A 4HOJA 2LQOA 1AQVA 5ECKB 4POLA 3BJ5A 2IMKA 3M0FA 5AISA 1EV4A 3I43A 2FA8A 4ULXA 2H01A 3F0IA 2R5GA 1S3DA 1YF0A 4WKWA 4BL7A 3KMNA 1O85A 3L0HA 1Z5YE 1K0NA 3I6AA 1BEDA 4HZ2A 10GSA 1EV9A 1F9MA 4PNFA 3TB2A 4IKHA 1TK0B 2WCIA 4GSSA 4PXOA 1GSDA 4POBA 1AC1A 5D9XA 4XHMA 2H1AA 1NHYA 1F2EA 4MJEA 2J9HA 3TJBA 2I81A 4NHWA 4I2UA 4EC0A 5DCGA 2V6KA 1FVKA 3GKNA 4MF7A 3EC3A 3HA9A 4OD7A 1GTAA 5F07A 1EEMA 4CDOA 2VD0A 2VL9A 4K6XA 3IV4A 1B4QA 1ZOFA 2GSSA 2RUEA 2AUVA 3ZLPA 5ECQB 4WETA 5EPFA 5G2ZA 1FVJA 5COHA 4AJ7A 1TTZA 2E2MA 2PN8A 3L9VA 2DJ0A 4YAVA 4YQVA 3D0ZA 1YF1A 2DMMA 3VWVA 1NSWA 4PUFC 1AIUA 5J41A 5KEJA 2B5YA 2XPEA 3QFAC 3ZIVA 3A3TA 2M46A 4MNNA 4DSQA 1Z7RA 1ZCPA 2XHFA 4IP6A 1ZGNA 1O73A 3LORA 3VWXA 2PPTA 2GZPA 4USSA 3ERWA 5IM9A 2FWEA 4GCIA 3TJKA 3GFKA 3R3EA 2HZEA 1GSSA 4PURA 3P90A 4I2TA 1VGLA 4KDUA 1OKDA 2FY6A 3M1GA 5CRGA 2GT6A 4MJCA 5LD0A 1OC3A 3FKFA 4Z7XA 1T7PB 1K0CA 3ZIJA 1R7HA 3GKKA 2VAFA 1BJXA 1F37A 2WRTA 4F0BA 4EVMA 2H19A 1ZYEA 2PERA 3VLNA 4KW6A 5D9TA 4KGIA 4TR1A 4MP4A 1TI3A 4Q5RA 4WF5A 2VL3A 2LS5A 2TIRA 1XFLA 2C0FA 1SJ6A 4KSMA 1XW5A 2GTUA 1YKCA 2LRTA 4J2FA 4F82A 1VF4A 1A23A 2YWOA 3BOAA 1VF1A 2RUFA 1GNWA 5A4UA 3P7XA 1NHOA 2FCHA 3Q74A 3RDWA 2MBSA 2A2SA 1V2AA 5CYYA 2EIRA 1JLVA 3WGXA 4BA7A 2IMDA 2R6KA 4KDXA 5ENUA 1J0FA 5D8IA 1X0RA 2DJKA 4CW9A 5KN3A 2L5LA 5D73A 5ELGA 3IHQA 3KH7A 1SKSB 2B3SA 4XIHA 4X0XA 3QOUA 2JACA 3WGDA 2VM2A 3TRPA 1I9DA 3QAGA 1QGVA 2HZEB 2YP6A 5ELAA 2FGXA 1FOHA 2OE1A 3GH6A 2B7KA 3M8NA 1PRXA 5JWRB 1AQXA 1K0BA 4TXOA 3VPQA 1TP9A 4MDCA 1ML6A 3GL3A 2VLVA 4NV2A 5J3RA 4I8BA 3RPNA 1BAYA 3GV1A 4OWYA 3IC8A 4TRXA 3G7IA 2MBTA 3O76A 4KDYA 1GTIA 1RW1A 3MDKA 3CTGA 1R26A 2MMOA 1ST9A 2WS2A 1N2AA 2DBCA 1DE1A 1VF2A 4HU9A 1YJ6A 1AXDA 1Z6MA 1XOAA 2QKEA 1QXHA 5IMFA 4HJ2A 2LRNA 1QFNA 5G1KA 3GIXA 1ERTA 3QR6A 3KZQA 4EUYA 5KOXA 1USBA 2A2RA 3F4RA 2P5QA 1Q4JA 4J57E 4XTSA 3C73A 1A0RP 3CXGA 4GF0A 3ZL5A 2C3QA 4ML6A 4TR4A 1GTBA 4RQXA 11GSA 3IR4A 1EP8A 1T3BA 1TRSA 3IAM2 2YZUA 7GSSA 1PL2A 3RAZA 4I5QA 2GZZA 1RK4A 4V2MA 4ZXGA 5A4VA 2R0GA 1ZMAA 3IK7A 1JFUA 1SKWB 1WE0A 3K8NA 1OC9B 5AGYA 4CY6A 3LXZA 2L6CA 1S3AA 5GAPD 1HD2A 1GLQA 3H93A 5CREA 3GNJA 5B8BA 1YEPA 4V1Ap 1JZRA 4EF0A 5CRHA 3ZFLA 5AIXA 4TXOB 3U5RE 4TR0A 3TRXA 2X99A 3FEUA 4PQIA 2PU9C 5DALA 3TKSA 2RM6A 3HVVA 2H76A 3EURA 2YZHA 1TJDA 3L78A 3KJYA 1MTCA 2YN1A 1G0TA 3GX0A 3KCMA 5A5KA 2F3MA 1TU8A 1ABAA 2JZSA 3FYGA 4GWRA 3W8JA 4ISDA 3GUSA 2MMZA 3H1NA 2DJJA 4HEA2 5AN1A 4K0NA 3F3QA 3DD3A 1U3IA 4ECCA 2R0PA 3GKXA 2DKIA 5G5EA 4O92A 5B7CA 3HKRA 2LQQA 2V6OA 4JU5A 5FT3A 3PPUA 2VCZA 2H1GA 2K9FA 5HFIA 18GSA 1A8YA 2G0FA 4EDZA 1XZOA 1XVQA 2IMEA 4ZILA 4OFMA 4ZL9A 2F8FA 2P0GA 4MH3A 5IQYA 1UVZA 1M2AA 4RUVA 3DYRA 3HJOA 4N0VA 4F9ZA 1O81A 4MLYA 2H30A 1B8XA 1GL8A 4HU7A 5FHIA 4MJBA 5J4UA 1EOGA 3IOSA 3LYPA 4YAPA 4N10A 4CY8A 2HT9A 4DEJA 4HQZA 4IBPA 1NW2A 2JADA 1ZYQB 1MEKA 4DSSB 1PD21 1QQ2A 3APSA 5BRTA 3IC4A 1GSEA 1K0MA 4KCEA 2JZTA 2L59A 3EU3A 2R4VA 4GSNA 3KIJA 6GSXA 4K7NA 2YWMA 4EIQA 1M9BA 4ECBA 2R2JA 2VLTA 5LCZA 1GUMA 2CZ2A 3IBHA 3VWWA 4FIWA 4OO4A 2JSZA 1AAZA 5DALB 4QL7A 4EKZA 4AGSA 3GMFA 4MPGA 3QAWA 2LSTA 4MF5A 1OKTA 4ZBAA 4EE0A 2R3XA 4YKGA 2VUPA 5ECMB 1FW1A 4IVFA 1ACVA 3LYKA 1FG4A 2YWNA 2X8CA 1X9SB 5F06A 5BMUA 3EMXA 2OE0A 2M80A 3TJJA 1BG5A 3FR6A 4NV5A 1ERVA 3LJRA 1SYRA 2E2GA 1HNBA 5IOXA 2XBIA 2MYGA 3C8EA 5HR1A 2L6DA 5IOWA 4LMWA 2QC7A 2X8HA 3IK9A 2IN3A 2O8VB 3A5IA 2C0EA 4POKA 3RHCA 3R2QA 1XOBA 1K3YA 4O5UA 2UZ8A 1EEJA 2DLXA 1WPIA 2CX3A 3QFBC 4WXTA 2FLSA 1OVNA 2PVQA 2KOKA 2ALBA 4X1UA 3KEBA 4IP1A 2H74A 3DGQA 3FZ9A 3ME7A 3RBTA 1WIKA 2R0CA 4L0UA 1GUHA 4G2EA 1R5AA 4KX4A 2PUKC 2MZCA 2BMXA 3BD2A 4MPFA 1ILOA 1EP7A 5HFKA 5CNWA 1VF3A 2I1UA 1WOUA 1F3BA 2C3NA 2B6MA 2GDRA 2K6VA 2DJ2A 4ZBBA 2P5RA 2HSYA 1M0UA 1HNAA 3EYTA 4ECJA 2I3YA 2GSTA 1FB6A 3TUEA 3L4NA 1BYEA 1VRSD 2HRKA 2PBJA 3KTLA 2WB9A 3FHKA 5IO0A 2A4HA 2VCVA 1GSUA 1MD4A 3LWAA 4WBJA 1OE8A 4IHUA 2N5BA 2B1LA 2F8AA 2MMNA 2PVOC 4JRRA 14GSA 1XW6A 1OYJA 3ZZXA 4E8HA 1T8EB 1J9BA 2GQLA 2PMTA 1EGRA 1A0FA 4HZ4A 2K18A 2X64A 1M99A 2DIYA 5IMDA 3G7JA 4O5QA 4ICYA 1Q98A 5DJLA 2FHEA 3IE3A 4YH2A 5ABRA 5LNKe 5F0GA 1U87A 3MAKA 5DBQA 1SD9A 2L5OA 4ZBDA 2E0QA 4F03A 4HDEA 4XRAA 2L4CA 1URMA 2KHPA 5G30A 2EIOA 4L8EA 4AJ6A 3TKSE 3TKQA 1G7OA 2HE3A 3KTBA 1F6MC 3IDVA 2CVKA 1ERWA 4TKYA 2J23A 4TW5A 4EL1A 5D9VA 3GYKA 2YV9A 2H1DA 3I69A 3E3EA 4MZWA 1A2MA 5B6NA 1T1VA 4OFNA 3W8SA 2V2GA 1TW9A 4LA1A 3UIWA 4K1FA 1SJZA 3HJMA 5E4WA 4XS6A 5DAKA 4ML1A 4ZL8A 3HJPA 5CO3A 4YQUA 2VM1A 5IMAA 1TK8B 4KA0A 1K3LA 1JZDA 5DCHA 2FWFA 4WR4A 1SU9A 3H79A 4HS1A 2H70A 2X4AA 1DUGA 3ED3A 3UBLA 5HFGA 4FYCA 4J56E 1X5DA 2WZ9A 4PQHA 5IIZA 5CRDA 4FH8A 1TOFA 1OC9A 5L71A 5ECRB 5AIVA 1WP0A 1PMTA 1IYIA 4YKFA 5ECNB 1UA5A 2WJUA 3S9FA 3SWLA 1ZZYA 6GSVA 2C80A 1LU4A 4EXJA 3D22A 3UMAA 4FO5A 6GSSA 2WULA 4F0CA 1V98A 2IMFA 4X43A 5EY6A 4EDYA 2JZRA 3DVWA 1GUKA 4XCSA 1PX7A 5E59A 2N5FA 1XVWA 4L5OA 4KB3A 1TI1A 5D96A 5GSSA 1O8XA 4ILFA 3KGKA 2REMA 1XWBA 4NHZA 2K8SA 2H0IA 3LQ7A 1Z6NA 3HZ8A 5HR0A 3ZREA 3UL3A 1G6YA 4HUAA 4IELA 3ZFBA 3TKRA 2DIZA 3FR3A 3MSZA 2VCTA 5ECSA 2B5EA 3O6TA 2CX4A 1YKAA 4LMVA 3HZ4A 2CAQA 3ZYWA 2NPBA 1SD8A 1YEXA 3ISOA 4K2XA 3TGZA 17GSA 3QPMA 3M3MA 16GSA 3C1RA 5DAKB 4BWQA 5GSTA 1HYUA 2E7PA 3BCIA 5F05A 2RM5A 3MWHA 1M9AA 1Z9HA 5JCGA 2H6YA 4WEYA 4X4JA 4A5PA 2QA1A 1XWKA 1SYXA 1JZWA 2LJKA 1X5CA 3ERGA 1EZKA 1W4VA 1QK8A 4RI7A 4RQRA 2HLSA 4GSTA 4XS4A 3KMOA 1KBNA 4MABA 2C0GA 22GSA 3LFLA 4DSSA 3CBUA 1DSBA 1GULA 2HI7A 5G5FA 1SK0A 3WT2A 3F4TA 1FAAA 2VCQA 3PH9A 20GSA 1EWXA 3L9UA 2LTKA 3P8WA 5IPGA 5IO2A 1A2JA 4IQ1A 3G7YA 1OAZA 1B4PA 2C0DA 3FR9A 5HQPA 2HRAA 3HDCA 4TVEA 1SL1B 4Z2TA 1PQNA 4WF4A 1SENA 3DVXA 1PSQA 2IIYA 3GHAA 4DVCA 3TJFA 2DMLA 2CVDA 4IN0A 2OJLA 3WD6A 3CSIA 2ZNMA 3AY8A 12GSA 3ERFA 1KNGA 3UVHA 1F3AA 2DJ3A 1K0DA 1K0OA 2AB6A 2QSIA 3H4KA 1TRVA 2VLUA 1U88A 2O85A 4NMUA 4GQFA 1FB0A 2FWGA 1TRUA 4N11A 2N5AA 4G9HA 4Q5QA 3E9JB 1M2BA 3WYWA 1OC8A 2OE3A 3FW2A 5DDLA 1WWJA 8GSSA 1SK1A 3D5JA 3ME8A 3EVIA 5H5SA 2OADA 5H5RA 1A24A 3BBYA 1ERUA 1UN2A 3LEFA 1E6BA 2BTOT 1KEBA 1LBKA 3M9JA 4HJMA 4IQAA 4XS4B 2ZUPA 2AJQB 4E8EA 4V2LA 3C71A 2XBQA 1GSQA 2H6XA 2HNLA 3APOA 1ZYPA 2H71A 3J7Yk 1THXA 1GRXA 4DSRA 1TU7A 2CT6A 3Q19A 5INYA 3FRCA 4G0IA 2JL4A 4GXZA 5DVBA 2LKUA 4NAXA 4MH2A 2ZCTA 5C00A 1C72A 3PR8A 4NPBA 4V2NA 4ZB8A 5JWOB 5ECHB 2G2QA 4GLTA 3ZMKA 4TN8A 5D9WA 2VL2C 4OMVA 2IFQA 3GA4A 2HYXA 1SK2A 1Y25A 2FWHA 1CQGA 3GTUB 3W6GA 1B9XC 2XC2A 3DIEA 3SBCA 1THOA 5G31A 4MZCA 1N8JA 1AQWA 2EC4A 3MNGA 2O7KA 3GURA 1X9MB 4I97A 3LSZA 1X5EA 5HR2A 2LV3A 5J5NA 2O87A 1XWGA 1B9YC 1U6TA 2HSHA 3A2VA 2HSMA 4JR4A 2M72A 2KLXA 1RQMA 4D73B 4MA9A 3HD5A 4FYBA 2H0HA 4N30A 1SL2B 1SKRB 4POMA 4KAEA 4OFTA 3UAPA 5IPHA 2CVBA 4ECIA 1V58A 3LXTA 2JSYA 4G0LA 1X9WB 1PA3A 3TKPA 1V57A 4ID0A 1AUCA 2DC5A 1EGOA 3QCPA 1CQHA 2LEGA 4GRFA 4XS1A 4G0KA 6GSUA 2VOCA 1JZOA 1NM3A 3US3A 3GN3A 2AV4A 3CTFA 3UARA 3EPTA 4GTUA 2ES7A 3QDNA 2GS3A 2LNSA 2ON5A 3Q18A 4K5SA 19GSA 1MDKA 1XPVA 5GZZB 4LLRA 5CP1A 1XXUA 4MZBA 1FO5A 3G9BA 2H6ZA 3HHVA 2CAIA 3FZ4A 1YZXA 2IFQB 2HXKA 2IPAA 3TRQA 1XWCA 3F6DA 3M9KA 4K8MA 4L0WA 4O32A 2DKHA 4ZL7A 3IRAA 3HVSA 3GSTA 3C1SA 3F3RA 2V41A 4MF6A 3QD9A 1Z7PA 2HRNA 4YQMA 4MK3A 3IHGA 1QUWA 4V1Ag 3D4MA 3UBKA 4L5LA 1PN0A 4WR5A 1G7EA 1PKWA 1ZL9A 1XW9A 2AAWA 4KNDA 5FWGA 4MMMA 2CV4A 2H72A 2P31A 4K7OA 1GSYA 2VD1A 2LJRA 2K8VA 2GQMA 3UOMA 2AYTA 3NOFA 4JE1A 3RHBA 4BVYB 1MDIA 3A2WA 4PX1A 5ECIB 4MJAA 4MCUA 1JHBA 1KTEA 4ACSA 2WDUA 3RPPA 5KN0A 4OCFA 2NVLA 5ID2A 4BL7B 3DWVA 4PNGA 1E2YA 2CQ9A 1GTUA 3KP8A 2FNOA 1MDJA 4BPYA 2OACA 1IYHA 4Q5FA 2B5XA 2H1BA 2HRFA 9GSSA 2TRCP 3OR5A 1H75A 2R37A 1XCCA 6GSWA 13GSA 2V1MA 3HXSA 2HZFA 3ZTLA 3VI5A 3GX8A 3U6VA 2F9SA 1GSFA 2DSAA 5IMZA 3V1WA 4O5RA 2D2ZA 2FUG2 3IPZA 3L9SA 2WGRA 3CRTA 3KP9A 1WMJA 3DRNA 5KOWA 3NZNA 1TK5B 2EIQA 4EO3A 2OKAA 3GH9A 1WJKA 1YY7A 5GAND 3PGTA 4AF2A 3TDGA 4G19A 3ZVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LG6 A;  4K0G A;  2MMA A;  2PGT A;  2NDO A;  3VWU A;  2GQK A;  5IMC A;  4BWS A;  1A2L A;  3EU4 A;  2YOI A;  5CRW A;  3FY7 A;  4XRD A;  1WRY A;  1AW9 A;  2KP1 A;  1J08 A;  1MD3 A;  2GZY A;  3FZ5 A;  3C7M A;  2CA8 A;  2H8L A;  1A8L A;  1V9W A;  4K2D A;  4OCE A;  2IMI A;  2YCD A;  1DBY A;  4KSO A;  2XPD A;  2YNX A;  2VO4 A;  4BVX A;  2TRX A;  3D4T A;  4KUN A;  5EVO A;  3TCO A;  5F8B A;  5ID2 B;  5B8A A;  3A2X A;  4FYU A;  4IS0 A;  2CZ3 A;  1EOH A;  1YDK A;  2LNT A;  3EIN A;  2FA4 A;  4N0Z A;  4F2I A;  2NTO A;  5HR3 A;  4IJ3 A;  2YJ7 A;  2H0G A;  5JCW A;  2B7J A;  5EL8 A;  1O8W A;  2KP2 A;  1FOV A;  5IMV A;  1PN9 A;  3EE2 A;  3ZML A;  3EMP A;  3GRX A;  3LGC A;  1S3C A;  2KUC A;  1TDI A;  4TR1 B;  2H73 A;  1K3O A;  3EWL A;  3KH9 A;  4KH7 A;  3I9V 2;  1T00 A;  4JBB A;  1SL0 B;  4PUA A;  5D93 A;  1XWA A;  1TXX A;  3ZVJ D;  1T4Z A;  4K7I A;  5H5Q A;  3UVT A;  3CYN A;  4O7H A;  1M7T A;  5A4W A;  3O3T A;  6GST A;  1FHE A;  4I6X A;  4JED A;  1I5G A;  4G10 A;  2GSR A;  3F9U A;  4TXV A;  3IXR A;  3DKS A;  1GLP A;  2OBI A;  3CRU A;  1PX6 A;  4KE3 A;  2VIM A;  5DQY A;  5JCU A;  2JU5 A;  4IGJ A;  4KCA A;  4IJI A;  3DEX A;  2GLR A;  2VCX A;  3D21 A;  1GH2 A;  2C1Y A;  2YV7 A;  2Z9S A;  2I4A A;  5J9C A;  4HQS A;  2WFC A;  3H8Q A;  2GT5 A;  3N9J A;  1O7U A;  2I9H A;  5ECO B;  1U3A A;  3QAV A;  3PIN A;  1K0A A;  4RI6 A;  2OBK A;  3GTU A;  3IAS 2;  1R4W A;  5C04 A;  5G1L A;  3NIV A;  5JWQ B;  4ZB6 A;  1JLW A;  3P2A A;  4PQ1 A;  3TJG A;  3IA1 A;  1BQ7 A;  1XBS A;  1H4O A;  3FZA A;  2A4V A;  3KM6 A;  2L57 A;  3CMI A;  2YWI A;  4TOP A;  1B48 A;  1O6J A;  2IJY A;  3VK9 A;  1PGT A;  1G6W A;  4IW9 A;  2RLI A;  4D73 A;  2VL2 A;  3BCK A;  4H86 A;  3F6F A;  1PKZ A;  3CSH A;  3CSJ A;  3VUR A;  1GNE A;  2QGV A;  2H66 A;  3A5W A;  3GL5 A;  5KN2 A;  2B1K A;  2V32 A;  2O89 A;  1TRW A;  3UEM A;  2L4Q A;  2ON7 A;  2RII A;  2GGT A;  4CHS A;  4ZIJ A;  2OA7 A;  2VCW A;  2NBS A;  4QL9 A;  1BX9 A;  2BJX A;  3ZIT A;  1UC7 A;  3HYP A;  4Q5N A;  4ZB9 A;  2YPM A;  1R5P A;  5ECL B;  3KXO A;  3D6I A;  1GP1 A;  2YAN A;  2C4J A;  2PWJ A;  2F51 A;  4PGT A;  3JCM L;  1QMV A;  4NWY A;  3QMX A;  2GVP A;  1HQO A;  3VPT A;  4TR3 A;  3UJ1 A;  1SJI A;  1Y6E A;  4QQ7 A;  2FD3 A;  3VI7 A;  3E0U A;  3HCZ A;  3HY2 A;  2AHE A;  4GQC A;  4LL4 B;  4LL1 B;  1XIY A;  1T4Y A;  3WGE A;  1Z3E A;  6GSY A;  4JR6 A;  3VFI A;  3TKS C;  3KD0 A;  3F63 A;  5KN1 A;  1YQ1 A;  2HFD A;  3GKM A;  3DXB A;  2C8U A;  2C3T A;  2YJH A;  1PL1 A;  3Q6O A;  1GWC A;  3WT1 A;  5J9B A;  1LJR A;  1M2D A;  3F4S A;  2LRC A;  5DJM A;  2IWT A;  1DE2 A;  4JZQ A;  3DML A;  3FK8 A;  2GSQ A;  4NXI A;  4P3Y B;  3GSS A;  3ZRD A;  3APQ A;  3TOT A;  1V40 A;  2H75 A;  4OO5 A;  4K9Z A;  4AJ8 A;  5ECP B;  1TKD B;  5CAX A;  2LJA A;  3HVX A;  2IL3 A;  3N5O A;  3F8U A;  3J7Y b;  4HI7 A;  1HNC A;  5B6M A;  5DQS A;  2DJ1 A;  2LUS A;  2X8G A;  1OE7 A;  4BVY A;  1W89 A;  4WBR D;  3TOU A;  1ON4 A;  4HOJ A;  2LQO A;  1AQV A;  5ECK B;  4POL A;  3BJ5 A;  2IMK A;  3M0F A;  5AIS A;  1EV4 A;  3I43 A;  2FA8 A;  4ULX A;  2H01 A;  3F0I A;  2R5G A;  1S3D A;  1YF0 A;  4WKW A;  4BL7 A;  3KMN A;  1O85 A;  3L0H A;  1Z5Y E;  1K0N A;  3I6A A;  1BED A;  4HZ2 A;  10GS A;  1EV9 A;  1F9M A;  4PNF A;  3TB2 A;  4IKH A;  1TK0 B;  2WCI A;  4GSS A;  4PXO A;  1GSD A;  4POB A;  1AC1 A;  5D9X A;  4XHM A;  2H1A A;  1NHY A;  1F2E A;  4MJE A;  2J9H A;  3TJB A;  2I81 A;  4NHW A;  4I2U A;  4EC0 A;  5DCG A;  2V6K A;  1FVK A;  3GKN A;  4MF7 A;  3EC3 A;  3HA9 A;  4OD7 A;  1GTA A;  5F07 A;  1EEM A;  4CDO A;  2VD0 A;  2VL9 A;  4K6X A;  3IV4 A;  1B4Q A;  1ZOF A;  2GSS A;  2RUE A;  2AUV A;  3ZLP A;  5ECQ B;  4WET A;  5EPF A;  5G2Z A;  1FVJ A;  5COH A;  4AJ7 A;  1TTZ A;  2E2M A;  2PN8 A;  3L9V A;  2DJ0 A;  4YAV A;  4YQV A;  3D0Z A;  1YF1 A;  2DMM A;  3VWV A;  1NSW A;  4PUF C;  1AIU A;  5J41 A;  5KEJ A;  2B5Y A;  2XPE A;  3QFA C;  3ZIV A;  3A3T A;  2M46 A;  4DSQ A;  1Z7R A;  1ZCP A;  2XHF A;  4IP6 A;  1ZGN A;  1O73 A;  3LOR A;  3VWX A;  2PPT A;  2GZP A;  3ERW A;  5IM9 A;  2FWE A;  4GCI A;  3TJK A;  3GFK A;  2HZE A;  1GSS A;  4PUR A;  3P90 A;  4I2T A;  1VGL A;  4KDU A;  1OKD A;  2FY6 A;  3M1G A;  5CRG A;  2GT6 A;  4MJC A;  5LD0 A;  1OC3 A;  3FKF A;  4Z7X A;  1T7P B;  1K0C A;  3ZIJ A;  1R7H A;  3GKK A;  2VAF A;  1BJX A;  1F37 A;  2WRT A;  4F0B A;  4EVM A;  2H19 A;  1ZYE A;  2PER A;  3VLN A;  4KW6 A;  5D9T A;  4KGI A;  4TR1 A;  4MP4 A;  1TI3 A;  4Q5R A;  4WF5 A;  2VL3 A;  2LS5 A;  2TIR A;  1XFL A;  2C0F A;  1SJ6 A;  4KSM A;  1XW5 A;  2GTU A;  1YKC A;  2LRT A;  4J2F A;  4F82 A;  1VF4 A;  1A23 A;  2YWO A;  3BOA A;  1VF1 A;  2RUF A;  1GNW A;  5A4U A;  3P7X A;  1NHO A;  2FCH A;  3Q74 A;  3RDW A;  2MBS A;  2A2S A;  1V2A A;  5CYY A;  2EIR A;  1JLV A;  3WGX A;  4BA7 A;  2IMD A;  2R6K A;  4KDX A;  5ENU A;  1J0F A;  5D8I A;  1X0R A;  2DJK A;  4CW9 A;  5KN3 A;  2L5L A;  5D73 A;  5ELG A;  3IHQ A;  3KH7 A;  1SKS B;  2B3S A;  4XIH A;  4X0X A;  3QOU A;  2JAC A;  3WGD A;  2VM2 A;  3TRP A;  1I9D A;  3QAG A;  1QGV A;  2HZE B;  2YP6 A;  5ELA A;  2FGX A;  2OE1 A;  3GH6 A;  2B7K A;  3M8N A;  1PRX A;  5JWR B;  1AQX A;  1K0B A;  4TXO A;  3VPQ A;  1TP9 A;  4MDC A;  1ML6 A;  3GL3 A;  2VLV A;  4NV2 A;  5J3R A;  4I8B A;  3RPN A;  1BAY A;  3GV1 A;  4OWY A;  4TRX A;  3G7I A;  2MBT A;  3O76 A;  4KDY A;  1GTI A;  1RW1 A;  3MDK A;  3CTG A;  1R26 A;  2MMO A;  1ST9 A;  2WS2 A;  1N2A A;  2DBC A;  1DE1 A;  1VF2 A;  4HU9 A;  1YJ6 A;  1AXD A;  1Z6M A;  1XOA A;  2QKE A;  1QXH A;  5IMF A;  4HJ2 A;  2LRN A;  1QFN A;  5G1K A;  3GIX A;  1ERT A;  3QR6 A;  3KZQ A;  4EUY A;  1USB A;  2A2R A;  3F4R A;  2P5Q A;  1Q4J A;  4J57 E;  4XTS A;  3C73 A;  1A0R P;  3CXG A;  4GF0 A;  3ZL5 A;  2C3Q A;  4ML6 A;  4TR4 A;  1GTB A;  4RQX A;  11GS A;  3IR4 A;  1EP8 A;  1T3B A;  1TRS A;  3IAM 2;  2YZU A;  7GSS A;  1PL2 A;  3RAZ A;  4I5Q A;  2GZZ A;  1RK4 A;  4V2M A;  4ZXG A;  5A4V A;  1ZMA A;  3IK7 A;  1JFU A;  1SKW B;  1WE0 A;  3K8N A;  1OC9 B;  5AGY A;  3LXZ A;  2L6C A;  1S3A A;  5GAP D;  1HD2 A;  1GLQ A;  3H93 A;  5CRE A;  3GNJ A;  5B8B A;  1YEP A;  4V1A p;  1JZR A;  4EF0 A;  5CRH A;  3ZFL A;  5AIX A;  4TXO B;  3U5R E;  4TR0 A;  3TRX A;  2X99 A;  3FEU A;  4PQI A;  2PU9 C;  5DAL A;  3TKS A;  2RM6 A;  3HVV A;  2H76 A;  3EUR A;  2YZH A;  1TJD A;  3L78 A;  3KJY A;  1MTC A;  2YN1 A;  1G0T A;  3GX0 A;  3KCM A;  5A5K A;  2F3M A;  1TU8 A;  1ABA A;  2JZS A;  3FYG A;  4GWR A;  3W8J A;  4ISD A;  3GUS A;  2MMZ A;  3H1N A;  2DJJ A;  4HEA 2;  5AN1 A;  4K0N A;  3F3Q A;  3DD3 A;  1U3I A;  4ECC A;  3GKX A;  5G5E A;  4O92 A;  5B7C A;  3HKR A;  2LQQ A;  2V6O A;  4JU5 A;  5FT3 A;  2VCZ A;  2H1G A;  2K9F A;  5HFI A;  18GS A;  1A8Y A;  2G0F A;  4EDZ A;  1XZO A;  1XVQ A;  2IME A;  4ZIL A;  4OFM A;  4ZL9 A;  2F8F A;  2P0G A;  4MH3 A;  5IQY A;  1UVZ A;  1M2A A;  4RUV A;  3DYR A;  3HJO A;  4N0V A;  4F9Z A;  1O81 A;  4MLY A;  2H30 A;  1B8X A;  1GL8 A;  4HU7 A;  5FHI A;  4MJB A;  5J4U A;  1EOG A;  3IOS A;  3LYP A;  4YAP A;  4N10 A;  2HT9 A;  4DEJ A;  4HQZ A;  4IBP A;  1NW2 A;  2JAD A;  1ZYQ B;  1MEK A;  4DSS B;  1PD2 1;  1QQ2 A;  3APS A;  3IC4 A;  1GSE A;  1K0M A;  4KCE A;  2JZT A;  2L59 A;  3EU3 A;  2R4V A;  4GSN A;  3KIJ A;  6GSX A;  4K7N A;  2YWM A;  1M9B A;  4ECB A;  2R2J A;  2VLT A;  5LCZ A;  1GUM A;  2CZ2 A;  3IBH A;  3VWW A;  4FIW A;  4OO4 A;  2JSZ A;  1AAZ A;  5DAL B;  4QL7 A;  4EKZ A;  4AGS A;  3GMF A;  4MPG A;  3QAW A;  2LST A;  4MF5 A;  1OKT A;  4ZBA A;  4EE0 A;  2R3X A;  2VUP A;  5ECM B;  1FW1 A;  4IVF A;  1ACV A;  3LYK A;  1FG4 A;  2YWN A;  2X8C A;  1X9S B;  5F06 A;  3EMX A;  2OE0 A;  2M80 A;  3TJJ A;  1BG5 A;  3FR6 A;  4NV5 A;  1ERV A;  3LJR A;  1SYR A;  2E2G A;  1HNB A;  5IOX A;  2XBI A;  2MYG A;  3C8E A;  5HR1 A;  2L6D A;  5IOW A;  4LMW A;  2QC7 A;  2X8H A;  3IK9 A;  2IN3 A;  2O8V B;  2C0E A;  4POK A;  3RHC A;  3R2Q A;  1XOB A;  1K3Y A;  1EEJ A;  2DLX A;  1WPI A;  2CX3 A;  3QFB C;  4WXT A;  2FLS A;  1OVN A;  2PVQ A;  2KOK A;  2ALB A;  4X1U A;  3KEB A;  4IP1 A;  2H74 A;  3DGQ A;  3FZ9 A;  3ME7 A;  3RBT A;  1WIK A;  4L0U A;  1GUH A;  4G2E A;  1R5A A;  4KX4 A;  2PUK C;  2MZC A;  2BMX A;  3BD2 A;  4MPF A;  1ILO A;  1EP7 A;  5HFK A;  5CNW A;  1VF3 A;  2I1U A;  1WOU A;  1F3B A;  2C3N A;  2B6M A;  2GDR A;  2K6V A;  2DJ2 A;  4ZBB A;  2P5R A;  2HSY A;  1M0U A;  1HNA A;  3EYT A;  4ECJ A;  2I3Y A;  2GST A;  1FB6 A;  3TUE A;  3L4N A;  1BYE A;  1VRS D;  2PBJ A;  3KTL A;  2WB9 A;  3FHK A;  5IO0 A;  2VCV A;  1GSU A;  1MD4 A;  3LWA A;  4WBJ A;  1OE8 A;  4IHU A;  2N5B A;  2B1L A;  2F8A A;  2MMN A;  2PVO C;  4JRR A;  14GS A;  1XW6 A;  1OYJ A;  3ZZX A;  4E8H A;  1T8E B;  1J9B A;  2GQL A;  2PMT A;  1EGR A;  1A0F A;  4HZ4 A;  2K18 A;  2X64 A;  1M99 A;  2DIY A;  5IMD A;  3G7J A;  1Q98 A;  5DJL A;  2FHE A;  3IE3 A;  4YH2 A;  5ABR A;  5LNK e;  5F0G A;  1U87 A;  3MAK A;  5DBQ A;  1SD9 A;  2L5O A;  4ZBD A;  2E0Q A;  4F03 A;  4HDE A;  4XRA A;  2L4C A;  1URM A;  2KHP A;  5G30 A;  2EIO A;  4L8E A;  4AJ6 A;  3TKS E;  3TKQ A;  1G7O A;  2HE3 A;  3KTB A;  1F6M C;  3IDV A;  2CVK A;  1ERW A;  4TKY A;  2J23 A;  4TW5 A;  4EL1 A;  5D9V A;  3GYK A;  2YV9 A;  2H1D A;  3I69 A;  3E3E A;  4MZW A;  1A2M A;  5B6N A;  1T1V A;  4OFN A;  3W8S A;  2V2G A;  1TW9 A;  4LA1 A;  3UIW A;  4K1F A;  1SJZ A;  3HJM A;  5E4W A;  4XS6 A;  5DAK A;  4ML1 A;  4ZL8 A;  3HJP A;  5CO3 A;  4YQU A;  2VM1 A;  5IMA A;  1TK8 B;  4KA0 A;  1K3L A;  1JZD A;  5DCH A;  2FWF A;  4WR4 A;  1SU9 A;  3H79 A;  4HS1 A;  2H70 A;  1DUG A;  3ED3 A;  3UBL A;  5HFG A;  4FYC A;  4J56 E;  1X5D A;  2WZ9 A;  4PQH A;  5IIZ A;  5CRD A;  4FH8 A;  1TOF A;  1OC9 A;  5L71 A;  5ECR B;  5AIV A;  1WP0 A;  1PMT A;  1IYI A;  5ECN B;  1UA5 A;  2WJU A;  3S9F A;  3SWL A;  1ZZY A;  6GSV A;  2C80 A;  1LU4 A;  4EXJ A;  3D22 A;  3UMA A;  4FO5 A;  6GSS A;  2WUL A;  4F0C A;  1V98 A;  2IMF A;  4X43 A;  5EY6 A;  4EDY A;  2JZR A;  3DVW A;  1GUK A;  4XCS A;  1PX7 A;  5E59 A;  2N5F A;  1XVW A;  4L5O A;  4KB3 A;  1TI1 A;  5D96 A;  5GSS A;  1O8X A;  4ILF A;  3KGK A;  2REM A;  1XWB A;  4NHZ A;  2K8S A;  2H0I A;  3LQ7 A;  1Z6N A;  3HZ8 A;  5HR0 A;  3ZRE A;  3UL3 A;  1G6Y A;  4HUA A;  4IEL A;  3ZFB A;  3TKR A;  2DIZ A;  3FR3 A;  3MSZ A;  2VCT A;  5ECS A;  2B5E A;  3O6T A;  2CX4 A;  1YKA A;  4LMV A;  3HZ4 A;  2CAQ A;  3ZYW A;  2NPB A;  1SD8 A;  1YEX A;  3ISO A;  3TGZ A;  17GS A;  3QPM A;  3M3M A;  16GS A;  3C1R A;  5DAK B;  4BWQ A;  5GST A;  1HYU A;  2E7P A;  3BCI A;  5F05 A;  2RM5 A;  3MWH A;  1M9A A;  1Z9H A;  5JCG A;  2H6Y A;  4WEY A;  1XWK A;  1SYX A;  1JZW A;  2LJK A;  1X5C A;  3ERG A;  1EZK A;  1W4V A;  1QK8 A;  4RI7 A;  4RQR A;  2HLS A;  4GST A;  4XS4 A;  3KMO A;  1KBN A;  4MAB A;  2C0G A;  22GS A;  3LFL A;  4DSS A;  3CBU A;  1DSB A;  1GUL A;  2HI7 A;  5G5F A;  1SK0 A;  3WT2 A;  3F4T A;  1FAA A;  2VCQ A;  3PH9 A;  20GS A;  1EWX A;  3L9U A;  2LTK A;  3P8W A;  5IPG A;  5IO2 A;  1A2J A;  4IQ1 A;  3G7Y A;  1OAZ A;  1B4P A;  2C0D A;  3FR9 A;  5HQP A;  3HDC A;  4TVE A;  1SL1 B;  1PQN A;  4WF4 A;  1SEN A;  3DVX A;  1PSQ A;  2IIY A;  3GHA A;  4DVC A;  3TJF A;  2DML A;  2CVD A;  4IN0 A;  2OJL A;  3WD6 A;  3CSI A;  2ZNM A;  3AY8 A;  12GS A;  3ERF A;  1KNG A;  3UVH A;  1F3A A;  2DJ3 A;  1K0D A;  1K0O A;  2AB6 A;  2QSI A;  3H4K A;  1TRV A;  2VLU A;  1U88 A;  2O85 A;  4NMU A;  4GQF A;  1FB0 A;  2FWG A;  1TRU A;  4N11 A;  2N5A A;  4G9H A;  4Q5Q A;  3E9J B;  1M2B A;  3WYW A;  1OC8 A;  2OE3 A;  3FW2 A;  5DDL A;  1WWJ A;  8GSS A;  1SK1 A;  3D5J A;  3ME8 A;  3EVI A;  5H5S A;  2OAD A;  5H5R A;  1A24 A;  3BBY A;  1ERU A;  1UN2 A;  3LEF A;  1E6B A;  2BTO T;  1KEB A;  1LBK A;  3M9J A;  4HJM A;  4IQA A;  4XS4 B;  2ZUP A;  2AJQ B;  4E8E A;  4V2L A;  3C71 A;  2XBQ A;  1GSQ A;  2H6X A;  2HNL A;  3APO A;  2H71 A;  3J7Y k;  1THX A;  1GRX A;  4DSR A;  1TU7 A;  2CT6 A;  3Q19 A;  5INY A;  3FRC A;  2JL4 A;  5DVB A;  4GXZ A;  2LKU A;  4NAX A;  4MH2 A;  2ZCT A;  5C00 A;  1C72 A;  3PR8 A;  4NPB A;  4V2N A;  4ZB8 A;  5JWO B;  5ECH B;  2G2Q A;  4GLT A;  3ZMK A;  4TN8 A;  5D9W A;  2VL2 C;  4OMV A;  2IFQ A;  3GA4 A;  2HYX A;  1SK2 A;  1Y25 A;  2FWH A;  1CQG A;  3GTU B;  3W6G A;  1B9X C;  2XC2 A;  3DIE A;  3SBC A;  1THO A;  5G31 A;  4MZC A;  1N8J A;  1AQW A;  2EC4 A;  3MNG A;  2O7K A;  3GUR A;  1X9M B;  4I97 A;  3LSZ A;  1X5E A;  5HR2 A;  2LV3 A;  5J5N A;  2O87 A;  1XWG A;  1B9Y C;  1U6T A;  2HSH A;  3A2V A;  4JR4 A;  2M72 A;  2KLX A;  1RQM A;  4D73 B;  4MA9 A;  3HD5 A;  4FYB A;  2H0H A;  4N30 A;  1SL2 B;  1SKR B;  4POM A;  4KAE A;  4OFT A;  3UAP A;  5IPH A;  2CVB A;  4ECI A;  1V58 A;  3LXT A;  2JSY A;  1X9W B;  1PA3 A;  3TKP A;  1V57 A;  4ID0 A;  1AUC A;  2DC5 A;  1EGO A;  3QCP A;  1CQH A;  2LEG A;  4GRF A;  4XS1 A;  6GSU A;  2VOC A;  1JZO A;  1NM3 A;  3US3 A;  3GN3 A;  2AV4 A;  3CTF A;  3UAR A;  4GTU A;  2ES7 A;  3QDN A;  2GS3 A;  2LNS A;  2ON5 A;  3Q18 A;  19GS A;  1MDK A;  1XPV A;  5GZZ B;  4LLR A;  5CP1 A;  1XXU A;  4MZB A;  1FO5 A;  3G9B A;  2H6Z A;  3HHV A;  2CAI A;  3FZ4 A;  1YZX A;  2IFQ B;  2HXK A;  2IPA A;  3TRQ A;  1XWC A;  3F6D A;  3M9K A;  4K8M A;  4L0W A;  4O32 A;  4ZL7 A;  3IRA A;  3HVS A;  3GST A;  3C1S A;  3F3R A;  2V41 A;  4MF6 A;  3QD9 A;  1Z7P A;  2HRN A;  4YQM A;  4MK3 A;  1QUW A;  4V1A g;  3D4M A;  3UBK A;  4L5L A;  4WR5 A;  1G7E A;  1PKW A;  1ZL9 A;  1XW9 A;  2AAW A;  4KND A;  5FWG A;  4MMM A;  2CV4 A;  2H72 A;  2P31 A;  4K7O A;  1GSY A;  2VD1 A;  2LJR A;  2K8V A;  2GQM A;  3UOM A;  2AYT A;  3NOF A;  4JE1 A;  3RHB A;  1MDI A;  3A2W A;  4PX1 A;  5ECI B;  4MJA A;  4MCU A;  1JHB A;  1KTE A;  4ACS A;  2WDU A;  3RPP A;  5KN0 A;  4OCF A;  2NVL A;  5ID2 A;  3DWV A;  4PNG A;  1E2Y A;  2CQ9 A;  1GTU A;  3KP8 A;  2FNO A;  1MDJ A;  4BPY A;  2OAC A;  1IYH A;  4Q5F A;  2B5X A;  2H1B A;  2HRF A;  9GSS A;  2TRC P;  3OR5 A;  1H75 A;  2R37 A;  1XCC A;  6GSW A;  13GS A;  2V1M A;  3HXS A;  2HZF A;  3ZTL A;  3VI5 A;  3GX8 A;  3U6V A;  2F9S A;  1GSF A;  2DSA A;  5IMZ A;  3V1W A;  4O5R A;  2D2Z A;  2FUG 2;  3IPZ A;  3L9S A;  2WGR A;  3CRT A;  3KP9 A;  1WMJ A;  3DRN A;  3NZN A;  1TK5 B;  2EIQ A;  4EO3 A;  2OKA A;  3GH9 A;  1WJK A;  1YY7 A;  5GAN D;  3PGT A;  4AF2 A;  3TDG A;  4G19 A;  3ZVJ A; 
#chains in the Genus database with same CATH topology
 3LG6 A;  4K0G A;  2MMA A;  2PGT A;  2NDO A;  3VWU A;  2GQK A;  5IMC A;  4BWS A;  1A2L A;  3EU4 A;  2YOI A;  5CRW A;  3FY7 A;  4XRD A;  4FQU A;  1WRY A;  1AW9 A;  2KP1 A;  1J08 A;  1MD3 A;  2GZY A;  3FZ5 A;  3C7M A;  2CA8 A;  2H8L A;  1A8L A;  1V9W A;  4K2D A;  4OCE A;  2IMI A;  2YCD A;  1DBY A;  3LW9 A;  4KSO A;  2XPD A;  2YNX A;  2VO4 A;  4K5R A;  4BVX A;  2TRX A;  3D4T A;  4KUN A;  5EVO A;  3TCO A;  5F8B A;  5ID2 B;  5B8A A;  3A2X A;  4FYU A;  4IS0 A;  2CZ3 A;  1EOH A;  1YDK A;  2LNT A;  3EIN A;  2FA4 A;  4N0Z A;  4F2I A;  2NTO A;  5HR3 A;  4IJ3 A;  2YJ7 A;  2H0G A;  1ZYN A;  5JCW A;  2B7J A;  5EL8 A;  1O8W A;  2KP2 A;  1FOV A;  5IMV A;  1PN9 A;  3EE2 A;  3ZML A;  4Z2R A;  3EMP A;  3GRX A;  3LGC A;  1S3C A;  2KUC A;  1TDI A;  4TR1 B;  2H73 A;  1K3O A;  3EWL A;  3KH9 A;  4KH7 A;  3I9V 2;  1T00 A;  4JBB A;  1SL0 B;  4PUA A;  5D93 A;  1XWA A;  1TXX A;  3ZVJ D;  1T4Z A;  4K7I A;  5H5Q A;  3UVT A;  3CYN A;  4O7H A;  1M7T A;  5A4W A;  3O3T A;  3FMW A;  6GST A;  1FHE A;  4I6X A;  4JED A;  1I5G A;  4G10 A;  2GSR A;  3F9U A;  4TXV A;  3IXR A;  3DKS A;  1GLP A;  2OBI A;  3CRU A;  1PX6 A;  4KE3 A;  2VIM A;  5DQY A;  5JCU A;  2JU5 A;  4IGJ A;  4KCA A;  4IJI A;  3DEX A;  2GLR A;  2VCX A;  3D21 A;  1GH2 A;  2C1Y A;  2YV7 A;  2Z9S A;  2I4A A;  5J9C A;  4HQS A;  2WFC A;  3H8Q A;  2GT5 A;  3N9J A;  1O7U A;  2I9H A;  5ECO B;  1U3A A;  3QAV A;  3PIN A;  1K0A A;  2QA2 A;  4RI6 A;  2X49 A;  2OBK A;  3GTU A;  3IAS 2;  1R4W A;  5C04 A;  5G1L A;  3NIV A;  4BVX B;  5JWQ B;  4EIP A;  4ZB6 A;  1JLW A;  3P2A A;  4PQ1 A;  3TJG A;  3IA1 A;  1BQ7 A;  1XBS A;  1H4O A;  3FZA A;  2A4V A;  3KM6 A;  2L57 A;  3CMI A;  2YWI A;  4TOP A;  1B48 A;  1O6J A;  2IJY A;  3VK9 A;  1PGT A;  1G6W A;  4IW9 A;  2RLI A;  4D73 A;  3MYD A;  2VL2 A;  3BCK A;  4H86 A;  3F6F A;  1PKZ A;  3CSH A;  3CSJ A;  3VUR A;  1GNE A;  2QGV A;  2H66 A;  3A5W A;  3GL5 A;  5KN2 A;  2B1K A;  2V32 A;  2O89 A;  1TRW A;  3UEM A;  2L4Q A;  2ON7 A;  2RII A;  2GGT A;  4CHS A;  4ZIJ A;  2OA7 A;  2VCW A;  2NBS A;  4QL9 A;  1BX9 A;  2BJX A;  3ZIT A;  1UC7 A;  3HYP A;  4Q5N A;  4ZB9 A;  2YPM A;  1R5P A;  5ECL B;  3KXO A;  3D6I A;  1GP1 A;  2YAN A;  2C4J A;  2PWJ A;  2F51 A;  4PGT A;  3JCM L;  1QMV A;  4NWY A;  3QMX A;  2GVP A;  1HQO A;  3VPT A;  4TR3 A;  3UJ1 A;  1SJI A;  1Y6E A;  4QQ7 A;  2FD3 A;  3VI7 A;  3E0U A;  3HCZ A;  3HY2 A;  2AHE A;  4GQC A;  4LL4 B;  4LL1 B;  1XIY A;  1T4Y A;  3WGE A;  1Z3E A;  2A2P A;  6GSY A;  4JR6 A;  3VFI A;  3TKS C;  3KD0 A;  3F63 A;  5KN1 A;  1YQ1 A;  2HFD A;  3GKM A;  4KF9 A;  3DXB A;  2C8U A;  2C3T A;  2YJH A;  1PL1 A;  3Q6O A;  1GWC A;  3WT1 A;  5J9B A;  1LJR A;  1M2D A;  3F4S A;  2LRC A;  5DJM A;  2IWT A;  1DE2 A;  4JZQ A;  3MIX A;  3DML A;  3FK8 A;  2GSQ A;  4NXI A;  4P3Y B;  3GSS A;  3ZRD A;  3APQ A;  3TOT A;  1V40 A;  2H75 A;  4OO5 A;  4K9Z A;  4AJ8 A;  5ECP B;  4Z2U A;  1TKD B;  5CAX A;  2LJA A;  3HVX A;  2IL3 A;  3N5O A;  3F8U A;  3J7Y b;  4HI7 A;  1HNC A;  5B6M A;  5DQS A;  2DJ1 A;  2LUS A;  4PTS A;  2X8G A;  1OE7 A;  4BVY A;  1W89 A;  4WBR D;  3TOU A;  1ON4 A;  4HOJ A;  2LQO A;  1AQV A;  5ECK B;  4POL A;  3BJ5 A;  2IMK A;  3M0F A;  1EV4 A;  3I43 A;  5AIS A;  2FA8 A;  4ULX A;  2H01 A;  3F0I A;  2R5G A;  1S3D A;  1YF0 A;  4WKW A;  4BL7 A;  3KMN A;  1O85 A;  3L0H A;  1Z5Y E;  1K0N A;  3I6A A;  1BED A;  4HZ2 A;  10GS A;  1EV9 A;  1F9M A;  4PNF A;  3TB2 A;  4IKH A;  1TK0 B;  2WCI A;  4GSS A;  4PXO A;  1GSD A;  4POB A;  1AC1 A;  5D9X A;  4XHM A;  2H1A A;  1NHY A;  1F2E A;  4MJE A;  2J9H A;  3TJB A;  2I81 A;  4NHW A;  4I2U A;  4EC0 A;  5DCG A;  2V6K A;  1FVK A;  3GKN A;  4MF7 A;  3EC3 A;  3HA9 A;  4OD7 A;  1GTA A;  5F07 A;  1EEM A;  4CDO A;  2VD0 A;  2VL9 A;  4K6X A;  3IV4 A;  1B4Q A;  1ZOF A;  2GSS A;  2RUE A;  2AUV A;  3ZLP A;  5ECQ B;  4WET A;  5EPF A;  5G2Z A;  1FVJ A;  5COH A;  4AJ7 A;  1TTZ A;  2E2M A;  2PN8 A;  3L9V A;  2DJ0 A;  4YAV A;  4YQV A;  3D0Z A;  1YF1 A;  2DMM A;  3VWV A;  1NSW A;  4PUF C;  1AIU A;  5J41 A;  5KEJ A;  2B5Y A;  2XPE A;  3QFA C;  3ZIV A;  3A3T A;  2M46 A;  4MNN A;  4DSQ A;  1Z7R A;  1ZCP A;  2XHF A;  4IP6 A;  1ZGN A;  1O73 A;  3LOR A;  3VWX A;  2PPT A;  2GZP A;  4USS A;  3ERW A;  5IM9 A;  2FWE A;  4GCI A;  3TJK A;  3GFK A;  3R3E A;  2HZE A;  1GSS A;  4PUR A;  3P90 A;  4I2T A;  1VGL A;  4KDU A;  1OKD A;  2FY6 A;  3M1G A;  5CRG A;  2GT6 A;  4MJC A;  5LD0 A;  1OC3 A;  3FKF A;  4Z7X A;  1T7P B;  1K0C A;  3ZIJ A;  1R7H A;  3GKK A;  2VAF A;  1BJX A;  1F37 A;  2WRT A;  4F0B A;  4EVM A;  2H19 A;  1ZYE A;  2PER A;  3VLN A;  4KW6 A;  5D9T A;  4KGI A;  4TR1 A;  4MP4 A;  1TI3 A;  4Q5R A;  4WF5 A;  2VL3 A;  2LS5 A;  2TIR A;  1XFL A;  2C0F A;  1SJ6 A;  4KSM A;  1XW5 A;  2GTU A;  1YKC A;  2LRT A;  4J2F A;  4F82 A;  1VF4 A;  1A23 A;  2YWO A;  3BOA A;  1VF1 A;  2RUF A;  1GNW A;  5A4U A;  3P7X A;  1NHO A;  2FCH A;  3Q74 A;  3RDW A;  2MBS A;  2A2S A;  1V2A A;  5CYY A;  2EIR A;  1JLV A;  3WGX A;  4BA7 A;  2IMD A;  2R6K A;  4KDX A;  5ENU A;  1J0F A;  5D8I A;  1X0R A;  2DJK A;  4CW9 A;  5KN3 A;  2L5L A;  5D73 A;  5ELG A;  3IHQ A;  3KH7 A;  1SKS B;  2B3S A;  4XIH A;  4X0X A;  3QOU A;  2JAC A;  3WGD A;  2VM2 A;  3TRP A;  1I9D A;  3QAG A;  1QGV A;  2HZE B;  2YP6 A;  5ELA A;  2FGX A;  1FOH A;  2OE1 A;  3GH6 A;  2B7K A;  3M8N A;  1PRX A;  5JWR B;  1AQX A;  1K0B A;  4TXO A;  3VPQ A;  1TP9 A;  4HSC X;  4MDC A;  1ML6 A;  3GL3 A;  2VLV A;  4NV2 A;  5J3R A;  4I8B A;  3RPN A;  1BAY A;  3GV1 A;  4OWY A;  3IC8 A;  4TRX A;  3G7I A;  2MBT A;  3O76 A;  4KDY A;  1GTI A;  1RW1 A;  3MDK A;  3CTG A;  1R26 A;  2MMO A;  1ST9 A;  2WS2 A;  1N2A A;  2DBC A;  1DE1 A;  1VF2 A;  4HU9 A;  1YJ6 A;  1AXD A;  1Z6M A;  1XOA A;  2QKE A;  1QXH A;  5IMF A;  4HJ2 A;  2LRN A;  1QFN A;  5G1K A;  3GIX A;  1ERT A;  3QR6 A;  3KZQ A;  4EUY A;  5KOX A;  1USB A;  2A2R A;  3F4R A;  2P5Q A;  1Q4J A;  4J57 E;  4XTS A;  3C73 A;  1A0R P;  3CXG A;  4GF0 A;  3ZL5 A;  2C3Q A;  4ML6 A;  4TR4 A;  1GTB A;  4RQX A;  11GS A;  3IR4 A;  1EP8 A;  1T3B A;  1TRS A;  3IAM 2;  2YZU A;  7GSS A;  1PL2 A;  3RAZ A;  4I5Q A;  2GZZ A;  1RK4 A;  4V2M A;  4ZXG A;  5A4V A;  2R0G A;  1ZMA A;  3IK7 A;  1JFU A;  1SKW B;  1WE0 A;  3K8N A;  1OC9 B;  5AGY A;  4CY6 A;  3LXZ A;  2L6C A;  1S3A A;  5GAP D;  1HD2 A;  1GLQ A;  3H93 A;  5CRE A;  3GNJ A;  5B8B A;  1YEP A;  4V1A p;  1JZR A;  4EF0 A;  5CRH A;  3ZFL A;  5AIX A;  4TXO B;  3U5R E;  4TR0 A;  3TRX A;  2X99 A;  3FEU A;  4PQI A;  2PU9 C;  5DAL A;  3TKS A;  2RM6 A;  3HVV A;  2H76 A;  3EUR A;  2YZH A;  1TJD A;  3L78 A;  3KJY A;  1MTC A;  2YN1 A;  1G0T A;  3GX0 A;  3KCM A;  5A5K A;  2F3M A;  1TU8 A;  1ABA A;  2JZS A;  3FYG A;  4GWR A;  3W8J A;  4ISD A;  3GUS A;  2MMZ A;  3H1N A;  2DJJ A;  4HEA 2;  5AN1 A;  4K0N A;  3F3Q A;  3DD3 A;  1U3I A;  4ECC A;  2R0P A;  3GKX A;  2DKI A;  5G5E A;  4O92 A;  5B7C A;  3HKR A;  2LQQ A;  2V6O A;  4JU5 A;  5FT3 A;  3PPU A;  2VCZ A;  2H1G A;  2K9F A;  5HFI A;  18GS A;  1A8Y A;  2G0F A;  4EDZ A;  1XZO A;  1XVQ A;  2IME A;  4ZIL A;  4OFM A;  4ZL9 A;  2F8F A;  2P0G A;  4MH3 A;  5IQY A;  1UVZ A;  1M2A A;  4RUV A;  3DYR A;  3HJO A;  4N0V A;  4F9Z A;  1O81 A;  4MLY A;  2H30 A;  1B8X A;  1GL8 A;  4HU7 A;  5FHI A;  4MJB A;  5J4U A;  1EOG A;  3IOS A;  3LYP A;  4YAP A;  4N10 A;  4CY8 A;  2HT9 A;  4DEJ A;  4HQZ A;  4IBP A;  1NW2 A;  2JAD A;  1ZYQ B;  1MEK A;  4DSS B;  1PD2 1;  1QQ2 A;  3APS A;  5BRT A;  3IC4 A;  1GSE A;  1K0M A;  4KCE A;  2JZT A;  2L59 A;  3EU3 A;  2R4V A;  4GSN A;  3KIJ A;  6GSX A;  4K7N A;  2YWM A;  4EIQ A;  1M9B A;  4ECB A;  2R2J A;  2VLT A;  5LCZ A;  1GUM A;  2CZ2 A;  3IBH A;  3VWW A;  4FIW A;  4OO4 A;  2JSZ A;  1AAZ A;  5DAL B;  4QL7 A;  4EKZ A;  1S3R A;  4AGS A;  3GMF A;  4MPG A;  3QAW A;  2LST A;  4MF5 A;  1OKT A;  4ZBA A;  4EE0 A;  2R3X A;  4YKG A;  2VUP A;  5ECM B;  1FW1 A;  4IVF A;  1ACV A;  3LYK A;  1FG4 A;  2YWN A;  2X8C A;  1X9S B;  5F06 A;  5BMU A;  3EMX A;  2OE0 A;  2M80 A;  3TJJ A;  1BG5 A;  3FR6 A;  4NV5 A;  1ERV A;  3LJR A;  1SYR A;  2E2G A;  1HNB A;  5IOX A;  2XBI A;  2MYG A;  3C8E A;  5HR1 A;  2L6D A;  5IOW A;  4LMW A;  2QC7 A;  2X8H A;  3IK9 A;  2IN3 A;  2O8V B;  3A5I A;  2C0E A;  4POK A;  3RHC A;  3R2Q A;  1XOB A;  1K3Y A;  4O5U A;  2UZ8 A;  1EEJ A;  2DLX A;  1WPI A;  2CX3 A;  3QFB C;  4WXT A;  2FLS A;  1OVN A;  2PVQ A;  2KOK A;  2ALB A;  4X1U A;  3KEB A;  4IP1 A;  2H74 A;  3DGQ A;  3FZ9 A;  3ME7 A;  3RBT A;  1WIK A;  2R0C A;  4L0U A;  1GUH A;  4G2E A;  1R5A A;  4KX4 A;  2PUK C;  2MZC A;  2BMX A;  3BD2 A;  4MPF A;  1ILO A;  1EP7 A;  5HFK A;  5CNW A;  1VF3 A;  2I1U A;  1WOU A;  1F3B A;  2C3N A;  2B6M A;  2GDR A;  2K6V A;  3CQF A;  2DJ2 A;  4ZBB A;  2P5R A;  2HSY A;  1M0U A;  1HNA A;  3EYT A;  4ECJ A;  2I3Y A;  2GST A;  1FB6 A;  3TUE A;  3L4N A;  1XG8 A;  1BYE A;  1VRS D;  2HRK A;  2PBJ A;  3KTL A;  2WB9 A;  3FHK A;  5IO0 A;  2A4H A;  4BIK A;  2VCV A;  1GSU A;  1MD4 A;  3LWA A;  4WBJ A;  1OE8 A;  4IHU A;  2N5B A;  2B1L A;  2F8A A;  2MMN A;  2PVO C;  4JRR A;  14GS A;  1XW6 A;  1OYJ A;  3ZZX A;  4E8H A;  1T8E B;  1J9B A;  2GQL A;  2PMT A;  1EGR A;  1A0F A;  4HZ4 A;  2K18 A;  2X64 A;  1M99 A;  2DIY A;  5IMD A;  3G7J A;  4O5Q A;  4ICY A;  1Q98 A;  5DJL A;  2FHE A;  3IE3 A;  4YH2 A;  5ABR A;  5LNK e;  5F0G A;  1U87 A;  3MAK A;  5DBQ A;  1SD9 A;  2L5O A;  4ZBD A;  2E0Q A;  4F03 A;  4HDE A;  4XRA A;  2L4C A;  1URM A;  2KHP A;  5G30 A;  2EIO A;  4L8E A;  4AJ6 A;  3TKS E;  3TKQ A;  1G7O A;  2HE3 A;  3KTB A;  1F6M C;  3IDV A;  2CVK A;  1ERW A;  4TKY A;  2J23 A;  4TW5 A;  4EL1 A;  5D9V A;  3GYK A;  2YV9 A;  2H1D A;  3I69 A;  3E3E A;  4MZW A;  1A2M A;  5B6N A;  1T1V A;  4OFN A;  3W8S A;  2V2G A;  1TW9 A;  4LA1 A;  3UIW A;  4K1F A;  1SJZ A;  3HJM A;  5E4W A;  4XS6 A;  5DAK A;  4ML1 A;  4ZL8 A;  3HJP A;  5CO3 A;  4YQU A;  2VM1 A;  5IMA A;  1TK8 B;  4KA0 A;  1K3L A;  1JZD A;  5DCH A;  2FWF A;  4WR4 A;  1SU9 A;  3H79 A;  4HS1 A;  2H70 A;  2X4A A;  1DUG A;  3ED3 A;  3UBL A;  5HFG A;  4FYC A;  4J56 E;  1X5D A;  2WZ9 A;  4PQH A;  5IIZ A;  5CRD A;  4FH8 A;  1TOF A;  1OC9 A;  5L71 A;  5ECR B;  5AIV A;  1WP0 A;  1PMT A;  1IYI A;  4YKF A;  5ECN B;  1UA5 A;  2WJU A;  3S9F A;  3SWL A;  1ZZY A;  6GSV A;  2C80 A;  1LU4 A;  4EXJ A;  3D22 A;  3UMA A;  4FO5 A;  6GSS A;  2WUL A;  4F0C A;  1V98 A;  2IMF A;  4X43 A;  5EY6 A;  4EDY A;  2JZR A;  3DVW A;  1GUK A;  4XCS A;  1PX7 A;  5E59 A;  2N5F A;  1XVW A;  4L5O A;  4KB3 A;  1TI1 A;  5D96 A;  5GSS A;  1O8X A;  4ILF A;  3KGK A;  2REM A;  1XWB A;  4NHZ A;  2K8S A;  2H0I A;  3LQ7 A;  1Z6N A;  3HZ8 A;  5HR0 A;  3ZRE A;  3UL3 A;  1G6Y A;  4HUA A;  4IEL A;  3ZFB A;  3TKR A;  2DIZ A;  3FR3 A;  3MSZ A;  2VCT A;  5ECS A;  2B5E A;  3O6T A;  2CX4 A;  1YKA A;  4LMV A;  3HZ4 A;  2CAQ A;  3ZYW A;  2NPB A;  1SD8 A;  1YEX A;  3ISO A;  4K2X A;  3TGZ A;  17GS A;  3QPM A;  3M3M A;  16GS A;  3C1R A;  5DAK B;  4BWQ A;  5GST A;  1HYU A;  2E7P A;  3BCI A;  5F05 A;  2RM5 A;  3MWH A;  1M9A A;  1Z9H A;  5JCG A;  2H6Y A;  4WEY A;  4X4J A;  4A5P A;  2QA1 A;  1XWK A;  1SYX A;  1JZW A;  2LJK A;  1X5C A;  3ERG A;  1EZK A;  1W4V A;  1QK8 A;  4RI7 A;  4RQR A;  2HLS A;  4GST A;  4XS4 A;  3KMO A;  1KBN A;  4MAB A;  2C0G A;  22GS A;  3LFL A;  4DSS A;  3CBU A;  1DSB A;  3HVN A;  1GUL A;  2HI7 A;  5G5F A;  1SK0 A;  3WT2 A;  3F4T A;  1FAA A;  2VCQ A;  3PH9 A;  20GS A;  1EWX A;  3L9U A;  2LTK A;  3P8W A;  5IPG A;  5IO2 A;  1A2J A;  4IQ1 A;  3G7Y A;  1OAZ A;  1B4P A;  2C0D A;  3FR9 A;  5HQP A;  2HRA A;  3HDC A;  4TVE A;  1SL1 B;  4Z2T A;  1PQN A;  4WF4 A;  1SEN A;  3DVX A;  1PSQ A;  2IIY A;  3GHA A;  4DVC A;  3TJF A;  2DML A;  2CVD A;  4IN0 A;  2OJL A;  3WD6 A;  3CSI A;  2ZNM A;  3AY8 A;  12GS A;  3ERF A;  1KNG A;  3UVH A;  1F3A A;  2DJ3 A;  1K0D A;  1K0O A;  2AB6 A;  2QSI A;  3H4K A;  1TRV A;  2VLU A;  1U88 A;  2O85 A;  4NMU A;  4GQF A;  1FB0 A;  2FWG A;  1TRU A;  4N11 A;  2N5A A;  4G9H A;  4Q5Q A;  3E9J B;  1M2B A;  3WYW A;  1OC8 A;  2OE3 A;  3FW2 A;  5DDL A;  1WWJ A;  8GSS A;  1SK1 A;  3D5J A;  3ME8 A;  3EVI A;  5H5S A;  2OAD A;  5H5R A;  1A24 A;  3BBY A;  1ERU A;  1UN2 A;  3LEF A;  1E6B A;  2BTO T;  1KEB A;  1LBK A;  3M9J A;  4HJM A;  4IQA A;  4XS4 B;  2ZUP A;  2AJQ B;  4E8E A;  4V2L A;  3C71 A;  2XBQ A;  1GSQ A;  2H6X A;  2HNL A;  3APO A;  1ZYP A;  2H71 A;  3J7Y k;  1THX A;  1GRX A;  4DSR A;  1TU7 A;  2CT6 A;  3Q19 A;  5INY A;  3FRC A;  4G0I A;  2JL4 A;  4GXZ A;  5DVB A;  2LKU A;  4NAX A;  4MH2 A;  2ZCT A;  5C00 A;  1C72 A;  3PR8 A;  4NPB A;  4V2N A;  4ZB8 A;  5JWO B;  5ECH B;  2G2Q A;  4GLT A;  3ZMK A;  4TN8 A;  5D9W A;  2VL2 C;  4OMV A;  2IFQ A;  3GA4 A;  1PFO A;  2HYX A;  1SK2 A;  1Y25 A;  2FWH A;  1CQG A;  3GTU B;  3W6G A;  1B9X C;  2XC2 A;  3DIE A;  3SBC A;  1THO A;  5G31 A;  4MZC A;  1N8J A;  1AQW A;  2EC4 A;  3MNG A;  2O7K A;  3GUR A;  1X9M B;  4I97 A;  3LSZ A;  1X5E A;  5HR2 A;  2LV3 A;  5J5N A;  2O87 A;  1XWG A;  1B9Y C;  1U6T A;  2HSH A;  3A2V A;  2HSM A;  4JR4 A;  2M72 A;  2KLX A;  1RQM A;  4D73 B;  4MA9 A;  3HD5 A;  4FYB A;  2H0H A;  4N30 A;  1SL2 B;  1SKR B;  4POM A;  4KAE A;  4OFT A;  3UAP A;  5IPH A;  2CVB A;  4ECI A;  1V58 A;  3LXT A;  2JSY A;  4G0L A;  1X9W B;  1PA3 A;  3TKP A;  1V57 A;  4ID0 A;  1AUC A;  2DC5 A;  1EGO A;  3QCP A;  1CQH A;  2LEG A;  4GRF A;  4XS1 A;  4G0K A;  6GSU A;  2VOC A;  1JZO A;  1NM3 A;  3US3 A;  3GN3 A;  2AV4 A;  3CTF A;  3UAR A;  3EPT A;  4GTU A;  2ES7 A;  3QDN A;  2GS3 A;  1M3I A;  2LNS A;  2ON5 A;  3Q18 A;  4K5S A;  19GS A;  1M3J A;  1MDK A;  1XPV A;  5GZZ B;  4LLR A;  5CP1 A;  1XXU A;  4MZB A;  1FO5 A;  3G9B A;  2H6Z A;  3HHV A;  2CAI A;  3FZ4 A;  1YZX A;  2IFQ B;  2HXK A;  2IPA A;  3TRQ A;  1XWC A;  3F6D A;  3M9K A;  4K8M A;  4L0W A;  4O32 A;  2DKH A;  4ZL7 A;  3IRA A;  3HVS A;  3GST A;  3C1S A;  3F3R A;  2V41 A;  4MF6 A;  3QD9 A;  1Z7P A;  2HRN A;  4YQM A;  4MK3 A;  3IHG A;  1QUW A;  4V1A g;  3D4M A;  3UBK A;  4L5L A;  1PN0 A;  4WR5 A;  1G7E A;  1PKW A;  1ZL9 A;  1XW9 A;  2AAW A;  4KND A;  5FWG A;  4MMM A;  2CV4 A;  2H72 A;  2P31 A;  4K7O A;  1GSY A;  2VD1 A;  2LJR A;  2K8V A;  2GQM A;  3UOM A;  2AYT A;  3NOF A;  4JE1 A;  3RHB A;  4BVY B;  1MDI A;  3A2W A;  4PX1 A;  5ECI B;  4MJA A;  4MCU A;  1JHB A;  1KTE A;  4ACS A;  2WDU A;  3RPP A;  5KN0 A;  4OCF A;  2NVL A;  5ID2 A;  4BL7 B;  3DWV A;  4PNG A;  1E2Y A;  2CQ9 A;  1GTU A;  3KP8 A;  2FNO A;  1MDJ A;  4BPY A;  2OAC A;  1IYH A;  4Q5F A;  2B5X A;  2H1B A;  2HRF A;  9GSS A;  2TRC P;  3OR5 A;  1H75 A;  2R37 A;  1XCC A;  6GSW A;  13GS A;  2V1M A;  3HXS A;  2HZF A;  3ZTL A;  3VI5 A;  3GX8 A;  3U6V A;  2F9S A;  1GSF A;  2DSA A;  5IMZ A;  3V1W A;  4O5R A;  2D2Z A;  2FUG 2;  3IPZ A;  3L9S A;  2WGR A;  3CRT A;  3KP9 A;  1WMJ A;  3DRN A;  5KOW A;  3NZN A;  1TK5 B;  2EIQ A;  4EO3 A;  2OKA A;  3GH9 A;  1WJK A;  1YY7 A;  5GAN D;  3PGT A;  4AF2 A;  3TDG A;  4G19 A;  3ZVJ A; 
#chains in the Genus database with same CATH homology
 3LG6 A;  4K0G A;  2MMA A;  2PGT A;  2NDO A;  3VWU A;  2GQK A;  5IMC A;  4BWS A;  1A2L A;  3EU4 A;  2YOI A;  5CRW A;  3FY7 A;  4XRD A;  4FQU A;  1WRY A;  1AW9 A;  2KP1 A;  1J08 A;  1MD3 A;  2GZY A;  3FZ5 A;  3C7M A;  2CA8 A;  2H8L A;  1A8L A;  1V9W A;  4K2D A;  4OCE A;  2IMI A;  2YCD A;  1DBY A;  3LW9 A;  4KSO A;  2XPD A;  2YNX A;  2VO4 A;  4K5R A;  4BVX A;  2TRX A;  3D4T A;  4KUN A;  5EVO A;  3TCO A;  5F8B A;  5ID2 B;  5B8A A;  3A2X A;  4FYU A;  4IS0 A;  2CZ3 A;  1EOH A;  1YDK A;  2LNT A;  3EIN A;  2FA4 A;  4N0Z A;  4F2I A;  2NTO A;  5HR3 A;  4IJ3 A;  2YJ7 A;  2H0G A;  1ZYN A;  5JCW A;  2B7J A;  5EL8 A;  1O8W A;  2KP2 A;  1FOV A;  5IMV A;  1PN9 A;  3EE2 A;  3ZML A;  4Z2R A;  3EMP A;  3GRX A;  3LGC A;  1S3C A;  2KUC A;  1TDI A;  4TR1 B;  2H73 A;  1K3O A;  3EWL A;  3KH9 A;  4KH7 A;  3I9V 2;  1T00 A;  4JBB A;  1SL0 B;  4PUA A;  5D93 A;  1XWA A;  1TXX A;  3ZVJ D;  1T4Z A;  4K7I A;  5H5Q A;  3UVT A;  3CYN A;  4O7H A;  1M7T A;  5A4W A;  3O3T A;  3FMW A;  6GST A;  1FHE A;  4I6X A;  4JED A;  1I5G A;  4G10 A;  2GSR A;  3F9U A;  4TXV A;  3IXR A;  3DKS A;  1GLP A;  2OBI A;  3CRU A;  1PX6 A;  4KE3 A;  2VIM A;  5DQY A;  5JCU A;  2JU5 A;  4IGJ A;  4KCA A;  4IJI A;  3DEX A;  2GLR A;  2VCX A;  3D21 A;  1GH2 A;  2C1Y A;  2YV7 A;  2Z9S A;  2I4A A;  5J9C A;  4HQS A;  2WFC A;  3H8Q A;  2GT5 A;  3N9J A;  1O7U A;  2I9H A;  5ECO B;  1U3A A;  3QAV A;  3PIN A;  1K0A A;  2QA2 A;  4RI6 A;  2X49 A;  2OBK A;  3GTU A;  3IAS 2;  1R4W A;  5C04 A;  5G1L A;  3NIV A;  4BVX B;  5JWQ B;  4EIP A;  4ZB6 A;  1JLW A;  3P2A A;  4PQ1 A;  3TJG A;  3IA1 A;  1BQ7 A;  1XBS A;  1H4O A;  3FZA A;  2A4V A;  3KM6 A;  2L57 A;  3CMI A;  2YWI A;  4TOP A;  1B48 A;  1O6J A;  2IJY A;  3VK9 A;  1PGT A;  1G6W A;  4IW9 A;  2RLI A;  4D73 A;  3MYD A;  2VL2 A;  3BCK A;  4H86 A;  3F6F A;  1PKZ A;  3CSH A;  3CSJ A;  3VUR A;  1GNE A;  2QGV A;  2H66 A;  3A5W A;  3GL5 A;  5KN2 A;  2B1K A;  2V32 A;  2O89 A;  1TRW A;  3UEM A;  2L4Q A;  2ON7 A;  2RII A;  2GGT A;  4CHS A;  4ZIJ A;  2OA7 A;  2VCW A;  2NBS A;  4QL9 A;  1BX9 A;  2BJX A;  3ZIT A;  1UC7 A;  3HYP A;  4Q5N A;  4ZB9 A;  2YPM A;  1R5P A;  5ECL B;  3KXO A;  3D6I A;  1GP1 A;  2YAN A;  2C4J A;  2PWJ A;  2F51 A;  4PGT A;  3JCM L;  1QMV A;  4NWY A;  3QMX A;  2GVP A;  1HQO A;  3VPT A;  4TR3 A;  3UJ1 A;  1SJI A;  1Y6E A;  4QQ7 A;  2FD3 A;  3VI7 A;  3E0U A;  3HCZ A;  3HY2 A;  2AHE A;  4GQC A;  4LL4 B;  4LL1 B;  1XIY A;  1T4Y A;  3WGE A;  1Z3E A;  2A2P A;  6GSY A;  4JR6 A;  3VFI A;  3TKS C;  3KD0 A;  3F63 A;  5KN1 A;  1YQ1 A;  2HFD A;  3GKM A;  4KF9 A;  3DXB A;  2C8U A;  2C3T A;  2YJH A;  1PL1 A;  3Q6O A;  1GWC A;  3WT1 A;  5J9B A;  1LJR A;  1M2D A;  3F4S A;  2LRC A;  5DJM A;  2IWT A;  1DE2 A;  4JZQ A;  3MIX A;  3DML A;  3FK8 A;  2GSQ A;  4NXI A;  4P3Y B;  3GSS A;  3ZRD A;  3APQ A;  3TOT A;  1V40 A;  2H75 A;  4OO5 A;  4K9Z A;  4AJ8 A;  5ECP B;  4Z2U A;  1TKD B;  5CAX A;  2LJA A;  3HVX A;  2IL3 A;  3N5O A;  3F8U A;  3J7Y b;  4HI7 A;  1HNC A;  5B6M A;  5DQS A;  2DJ1 A;  2LUS A;  4PTS A;  2X8G A;  1OE7 A;  4BVY A;  1W89 A;  4WBR D;  3TOU A;  1ON4 A;  4HOJ A;  2LQO A;  1AQV A;  5ECK B;  4POL A;  3BJ5 A;  2IMK A;  3M0F A;  5AIS A;  1EV4 A;  3I43 A;  2FA8 A;  4ULX A;  2H01 A;  3F0I A;  2R5G A;  1S3D A;  1YF0 A;  4WKW A;  4BL7 A;  3KMN A;  1O85 A;  3L0H A;  1Z5Y E;  1K0N A;  3I6A A;  1BED A;  4HZ2 A;  10GS A;  1EV9 A;  1F9M A;  4PNF A;  3TB2 A;  4IKH A;  1TK0 B;  2WCI A;  4GSS A;  4PXO A;  1GSD A;  4POB A;  1AC1 A;  5D9X A;  4XHM A;  2H1A A;  1NHY A;  1F2E A;  4MJE A;  2J9H A;  3TJB A;  2I81 A;  4NHW A;  4I2U A;  4EC0 A;  5DCG A;  2V6K A;  1FVK A;  3GKN A;  4MF7 A;  3EC3 A;  3HA9 A;  4OD7 A;  1GTA A;  5F07 A;  1EEM A;  4CDO A;  2VD0 A;  2VL9 A;  4K6X A;  3IV4 A;  1B4Q A;  1ZOF A;  2GSS A;  2RUE A;  2AUV A;  3ZLP A;  5ECQ B;  4WET A;  5EPF A;  5G2Z A;  1FVJ A;  5COH A;  4AJ7 A;  1TTZ A;  2E2M A;  2PN8 A;  3L9V A;  2DJ0 A;  4YAV A;  4YQV A;  3D0Z A;  1YF1 A;  2DMM A;  3VWV A;  1NSW A;  4PUF C;  1AIU A;  5J41 A;  5KEJ A;  2B5Y A;  2XPE A;  3QFA C;  3ZIV A;  3A3T A;  2M46 A;  4MNN A;  4DSQ A;  1Z7R A;  1ZCP A;  2XHF A;  4IP6 A;  1ZGN A;  1O73 A;  3LOR A;  3VWX A;  2PPT A;  2GZP A;  4USS A;  3ERW A;  5IM9 A;  2FWE A;  4GCI A;  3TJK A;  3GFK A;  3R3E A;  2HZE A;  1GSS A;  4PUR A;  3P90 A;  4I2T A;  1VGL A;  4KDU A;  1OKD A;  2FY6 A;  3M1G A;  5CRG A;  2GT6 A;  4MJC A;  5LD0 A;  1OC3 A;  3FKF A;  4Z7X A;  1T7P B;  1K0C A;  3ZIJ A;  1R7H A;  3GKK A;  2VAF A;  1BJX A;  1F37 A;  2WRT A;  4F0B A;  4EVM A;  2H19 A;  1ZYE A;  2PER A;  3VLN A;  4KW6 A;  5D9T A;  4KGI A;  4TR1 A;  4MP4 A;  1TI3 A;  4Q5R A;  4WF5 A;  2VL3 A;  2LS5 A;  2TIR A;  1XFL A;  2C0F A;  1SJ6 A;  4KSM A;  1XW5 A;  2GTU A;  1YKC A;  2LRT A;  4J2F A;  4F82 A;  1VF4 A;  1A23 A;  2YWO A;  3BOA A;  1VF1 A;  2RUF A;  1GNW A;  5A4U A;  3P7X A;  1NHO A;  2FCH A;  3Q74 A;  3RDW A;  2MBS A;  2A2S A;  1V2A A;  5CYY A;  2EIR A;  1JLV A;  3WGX A;  4BA7 A;  2IMD A;  2R6K A;  4KDX A;  5ENU A;  1J0F A;  5D8I A;  1X0R A;  2DJK A;  4CW9 A;  5KN3 A;  2L5L A;  5D73 A;  5ELG A;  3IHQ A;  3KH7 A;  1SKS B;  2B3S A;  4XIH A;  4X0X A;  3QOU A;  2JAC A;  3WGD A;  2VM2 A;  3TRP A;  1I9D A;  3QAG A;  1QGV A;  2HZE B;  2YP6 A;  5ELA A;  2FGX A;  1FOH A;  2OE1 A;  3GH6 A;  2B7K A;  3M8N A;  1PRX A;  5JWR B;  1AQX A;  1K0B A;  4TXO A;  3VPQ A;  1TP9 A;  4MDC A;  1ML6 A;  3GL3 A;  2VLV A;  4NV2 A;  5J3R A;  4I8B A;  3RPN A;  1BAY A;  3GV1 A;  4OWY A;  3IC8 A;  4TRX A;  3G7I A;  2MBT A;  3O76 A;  4KDY A;  1GTI A;  1RW1 A;  3MDK A;  3CTG A;  1R26 A;  2MMO A;  1ST9 A;  2WS2 A;  1N2A A;  2DBC A;  1DE1 A;  1VF2 A;  4HU9 A;  1YJ6 A;  1AXD A;  1Z6M A;  1XOA A;  2QKE A;  1QXH A;  5IMF A;  4HJ2 A;  2LRN A;  1QFN A;  5G1K A;  3GIX A;  1ERT A;  3QR6 A;  3KZQ A;  4EUY A;  5KOX A;  1USB A;  2A2R A;  3F4R A;  2P5Q A;  1Q4J A;  4J57 E;  4XTS A;  3C73 A;  1A0R P;  3CXG A;  4GF0 A;  3ZL5 A;  2C3Q A;  4ML6 A;  4TR4 A;  1GTB A;  4RQX A;  11GS A;  3IR4 A;  1EP8 A;  1T3B A;  1TRS A;  3IAM 2;  2YZU A;  7GSS A;  1PL2 A;  3RAZ A;  4I5Q A;  2GZZ A;  1RK4 A;  4V2M A;  4ZXG A;  5A4V A;  2R0G A;  1ZMA A;  3IK7 A;  1JFU A;  1SKW B;  1WE0 A;  3K8N A;  1OC9 B;  5AGY A;  4CY6 A;  3LXZ A;  2L6C A;  1S3A A;  5GAP D;  1HD2 A;  1GLQ A;  3H93 A;  5CRE A;  3GNJ A;  5B8B A;  1YEP A;  4V1A p;  1JZR A;  4EF0 A;  5CRH A;  3ZFL A;  5AIX A;  4TXO B;  3U5R E;  4TR0 A;  3TRX A;  2X99 A;  3FEU A;  4PQI A;  2PU9 C;  5DAL A;  3TKS A;  2RM6 A;  3HVV A;  2H76 A;  3EUR A;  2YZH A;  1TJD A;  3L78 A;  3KJY A;  1MTC A;  2YN1 A;  1G0T A;  3GX0 A;  3KCM A;  5A5K A;  2F3M A;  1TU8 A;  1ABA A;  2JZS A;  3FYG A;  4GWR A;  3W8J A;  4ISD A;  3GUS A;  2MMZ A;  3H1N A;  2DJJ A;  4HEA 2;  5AN1 A;  4K0N A;  3F3Q A;  3DD3 A;  1U3I A;  4ECC A;  2R0P A;  3GKX A;  2DKI A;  5G5E A;  4O92 A;  5B7C A;  3HKR A;  2LQQ A;  2V6O A;  4JU5 A;  5FT3 A;  3PPU A;  2VCZ A;  2H1G A;  2K9F A;  5HFI A;  18GS A;  1A8Y A;  2G0F A;  4EDZ A;  1XZO A;  1XVQ A;  2IME A;  4ZIL A;  4OFM A;  4ZL9 A;  2F8F A;  2P0G A;  4MH3 A;  5IQY A;  1UVZ A;  1M2A A;  4RUV A;  3DYR A;  3HJO A;  4N0V A;  4F9Z A;  1O81 A;  4MLY A;  2H30 A;  1B8X A;  1GL8 A;  4HU7 A;  5FHI A;  4MJB A;  5J4U A;  1EOG A;  3IOS A;  3LYP A;  4YAP A;  4N10 A;  4CY8 A;  2HT9 A;  4DEJ A;  4HQZ A;  4IBP A;  1NW2 A;  2JAD A;  1ZYQ B;  1MEK A;  4DSS B;  1PD2 1;  1QQ2 A;  3APS A;  5BRT A;  3IC4 A;  1GSE A;  1K0M A;  4KCE A;  2JZT A;  2L59 A;  3EU3 A;  2R4V A;  4GSN A;  3KIJ A;  6GSX A;  4K7N A;  2YWM A;  4EIQ A;  1M9B A;  4ECB A;  2R2J A;  2VLT A;  5LCZ A;  1GUM A;  2CZ2 A;  3IBH A;  3VWW A;  4FIW A;  4OO4 A;  2JSZ A;  1AAZ A;  5DAL B;  4QL7 A;  4EKZ A;  4AGS A;  3GMF A;  4MPG A;  3QAW A;  2LST A;  4MF5 A;  1OKT A;  4ZBA A;  4EE0 A;  2R3X A;  4YKG A;  2VUP A;  5ECM B;  1FW1 A;  4IVF A;  1ACV A;  3LYK A;  1FG4 A;  2YWN A;  2X8C A;  1X9S B;  5F06 A;  5BMU A;  3EMX A;  2OE0 A;  2M80 A;  3TJJ A;  1BG5 A;  3FR6 A;  4NV5 A;  1ERV A;  3LJR A;  1SYR A;  2E2G A;  1HNB A;  5IOX A;  2XBI A;  2MYG A;  3C8E A;  5HR1 A;  2L6D A;  5IOW A;  4LMW A;  2QC7 A;  2X8H A;  3IK9 A;  2IN3 A;  2O8V B;  3A5I A;  2C0E A;  4POK A;  3RHC A;  3R2Q A;  1XOB A;  1K3Y A;  4O5U A;  2UZ8 A;  1EEJ A;  2DLX A;  1WPI A;  2CX3 A;  3QFB C;  4WXT A;  2FLS A;  1OVN A;  2PVQ A;  2KOK A;  2ALB A;  4X1U A;  3KEB A;  4IP1 A;  2H74 A;  3DGQ A;  3FZ9 A;  3ME7 A;  3RBT A;  1WIK A;  2R0C A;  4L0U A;  1GUH A;  4G2E A;  1R5A A;  4KX4 A;  2PUK C;  2MZC A;  2BMX A;  3BD2 A;  4MPF A;  1ILO A;  1EP7 A;  5HFK A;  5CNW A;  1VF3 A;  2I1U A;  1WOU A;  1F3B A;  2C3N A;  2B6M A;  2GDR A;  2K6V A;  2DJ2 A;  4ZBB A;  2P5R A;  2HSY A;  1M0U A;  1HNA A;  3EYT A;  4ECJ A;  2I3Y A;  2GST A;  1FB6 A;  3TUE A;  3L4N A;  1BYE A;  1VRS D;  2HRK A;  2PBJ A;  3KTL A;  2WB9 A;  3FHK A;  5IO0 A;  2A4H A;  2VCV A;  1GSU A;  1MD4 A;  3LWA A;  4WBJ A;  1OE8 A;  4IHU A;  2N5B A;  2B1L A;  2F8A A;  2MMN A;  2PVO C;  4JRR A;  14GS A;  1XW6 A;  1OYJ A;  3ZZX A;  4E8H A;  1T8E B;  1J9B A;  2GQL A;  2PMT A;  1EGR A;  1A0F A;  4HZ4 A;  2K18 A;  2X64 A;  1M99 A;  2DIY A;  5IMD A;  3G7J A;  4O5Q A;  4ICY A;  1Q98 A;  5DJL A;  2FHE A;  3IE3 A;  4YH2 A;  5ABR A;  5LNK e;  5F0G A;  1U87 A;  3MAK A;  5DBQ A;  1SD9 A;  2L5O A;  4ZBD A;  2E0Q A;  4F03 A;  4HDE A;  4XRA A;  2L4C A;  1URM A;  2KHP A;  5G30 A;  2EIO A;  4L8E A;  4AJ6 A;  3TKS E;  3TKQ A;  1G7O A;  2HE3 A;  3KTB A;  1F6M C;  3IDV A;  2CVK A;  1ERW A;  4TKY A;  2J23 A;  4TW5 A;  4EL1 A;  5D9V A;  3GYK A;  2YV9 A;  2H1D A;  3I69 A;  3E3E A;  4MZW A;  1A2M A;  5B6N A;  1T1V A;  4OFN A;  3W8S A;  2V2G A;  1TW9 A;  4LA1 A;  3UIW A;  4K1F A;  1SJZ A;  3HJM A;  5E4W A;  4XS6 A;  5DAK A;  4ML1 A;  4ZL8 A;  3HJP A;  5CO3 A;  4YQU A;  2VM1 A;  5IMA A;  1TK8 B;  4KA0 A;  1K3L A;  1JZD A;  5DCH A;  2FWF A;  4WR4 A;  1SU9 A;  3H79 A;  4HS1 A;  2H70 A;  2X4A A;  1DUG A;  3ED3 A;  3UBL A;  5HFG A;  4FYC A;  4J56 E;  1X5D A;  2WZ9 A;  4PQH A;  5IIZ A;  5CRD A;  4FH8 A;  1TOF A;  1OC9 A;  5L71 A;  5ECR B;  5AIV A;  1WP0 A;  1PMT A;  1IYI A;  4YKF A;  5ECN B;  1UA5 A;  2WJU A;  3S9F A;  3SWL A;  1ZZY A;  6GSV A;  2C80 A;  1LU4 A;  4EXJ A;  3D22 A;  3UMA A;  4FO5 A;  6GSS A;  2WUL A;  4F0C A;  1V98 A;  2IMF A;  4X43 A;  5EY6 A;  4EDY A;  2JZR A;  3DVW A;  1GUK A;  4XCS A;  1PX7 A;  5E59 A;  2N5F A;  1XVW A;  4L5O A;  4KB3 A;  1TI1 A;  5D96 A;  5GSS A;  1O8X A;  4ILF A;  3KGK A;  2REM A;  1XWB A;  4NHZ A;  2K8S A;  2H0I A;  3LQ7 A;  1Z6N A;  3HZ8 A;  5HR0 A;  3ZRE A;  3UL3 A;  1G6Y A;  4HUA A;  4IEL A;  3ZFB A;  3TKR A;  2DIZ A;  3FR3 A;  3MSZ A;  2VCT A;  5ECS A;  2B5E A;  3O6T A;  2CX4 A;  1YKA A;  4LMV A;  3HZ4 A;  2CAQ A;  3ZYW A;  2NPB A;  1SD8 A;  1YEX A;  3ISO A;  4K2X A;  3TGZ A;  17GS A;  3QPM A;  3M3M A;  16GS A;  3C1R A;  5DAK B;  4BWQ A;  5GST A;  1HYU A;  2E7P A;  3BCI A;  5F05 A;  2RM5 A;  3MWH A;  1M9A A;  1Z9H A;  5JCG A;  2H6Y A;  4WEY A;  4X4J A;  4A5P A;  2QA1 A;  1XWK A;  1SYX A;  1JZW A;  2LJK A;  1X5C A;  3ERG A;  1EZK A;  1W4V A;  1QK8 A;  4RI7 A;  4RQR A;  2HLS A;  4GST A;  4XS4 A;  3KMO A;  1KBN A;  4MAB A;  2C0G A;  22GS A;  3LFL A;  4DSS A;  3CBU A;  1DSB A;  1GUL A;  2HI7 A;  5G5F A;  1SK0 A;  3WT2 A;  3F4T A;  1FAA A;  2VCQ A;  3PH9 A;  20GS A;  1EWX A;  3L9U A;  2LTK A;  3P8W A;  5IPG A;  5IO2 A;  1A2J A;  4IQ1 A;  3G7Y A;  1OAZ A;  1B4P A;  2C0D A;  3FR9 A;  5HQP A;  2HRA A;  3HDC A;  4TVE A;  1SL1 B;  4Z2T A;  1PQN A;  4WF4 A;  1SEN A;  3DVX A;  1PSQ A;  2IIY A;  3GHA A;  4DVC A;  3TJF A;  2DML A;  2CVD A;  4IN0 A;  2OJL A;  3WD6 A;  3CSI A;  2ZNM A;  3AY8 A;  12GS A;  3ERF A;  1KNG A;  3UVH A;  1F3A A;  2DJ3 A;  1K0D A;  1K0O A;  2AB6 A;  2QSI A;  3H4K A;  1TRV A;  2VLU A;  1U88 A;  2O85 A;  4NMU A;  4GQF A;  1FB0 A;  2FWG A;  1TRU A;  4N11 A;  2N5A A;  4G9H A;  4Q5Q A;  3E9J B;  1M2B A;  3WYW A;  1OC8 A;  2OE3 A;  3FW2 A;  5DDL A;  1WWJ A;  8GSS A;  1SK1 A;  3D5J A;  3ME8 A;  3EVI A;  5H5S A;  2OAD A;  5H5R A;  1A24 A;  3BBY A;  1ERU A;  1UN2 A;  3LEF A;  1E6B A;  2BTO T;  1KEB A;  1LBK A;  3M9J A;  4HJM A;  4IQA A;  4XS4 B;  2ZUP A;  2AJQ B;  4E8E A;  4V2L A;  3C71 A;  2XBQ A;  1GSQ A;  2H6X A;  2HNL A;  3APO A;  1ZYP A;  2H71 A;  3J7Y k;  1THX A;  1GRX A;  4DSR A;  1TU7 A;  2CT6 A;  3Q19 A;  5INY A;  3FRC A;  4G0I A;  2JL4 A;  4GXZ A;  5DVB A;  2LKU A;  4NAX A;  4MH2 A;  2ZCT A;  5C00 A;  1C72 A;  3PR8 A;  4NPB A;  4V2N A;  4ZB8 A;  5JWO B;  5ECH B;  2G2Q A;  4GLT A;  3ZMK A;  4TN8 A;  5D9W A;  2VL2 C;  4OMV A;  2IFQ A;  3GA4 A;  2HYX A;  1SK2 A;  1Y25 A;  2FWH A;  1CQG A;  3GTU B;  3W6G A;  1B9X C;  2XC2 A;  3DIE A;  3SBC A;  1THO A;  5G31 A;  4MZC A;  1N8J A;  1AQW A;  2EC4 A;  3MNG A;  2O7K A;  3GUR A;  1X9M B;  4I97 A;  3LSZ A;  1X5E A;  5HR2 A;  2LV3 A;  5J5N A;  2O87 A;  1XWG A;  1B9Y C;  1U6T A;  2HSH A;  3A2V A;  2HSM A;  4JR4 A;  2M72 A;  2KLX A;  1RQM A;  4D73 B;  4MA9 A;  3HD5 A;  4FYB A;  2H0H A;  4N30 A;  1SL2 B;  1SKR B;  4POM A;  4KAE A;  4OFT A;  3UAP A;  5IPH A;  2CVB A;  4ECI A;  1V58 A;  3LXT A;  2JSY A;  4G0L A;  1X9W B;  1PA3 A;  3TKP A;  1V57 A;  4ID0 A;  1AUC A;  2DC5 A;  1EGO A;  3QCP A;  1CQH A;  2LEG A;  4GRF A;  4XS1 A;  4G0K A;  6GSU A;  2VOC A;  1JZO A;  1NM3 A;  3US3 A;  3GN3 A;  2AV4 A;  3CTF A;  3UAR A;  3EPT A;  4GTU A;  2ES7 A;  3QDN A;  2GS3 A;  2LNS A;  2ON5 A;  3Q18 A;  4K5S A;  19GS A;  1MDK A;  1XPV A;  5GZZ B;  4LLR A;  5CP1 A;  1XXU A;  4MZB A;  1FO5 A;  3G9B A;  2H6Z A;  3HHV A;  2CAI A;  3FZ4 A;  1YZX A;  2IFQ B;  2HXK A;  2IPA A;  3TRQ A;  1XWC A;  3F6D A;  3M9K A;  4K8M A;  4L0W A;  4O32 A;  2DKH A;  4ZL7 A;  3IRA A;  3HVS A;  3GST A;  3C1S A;  3F3R A;  2V41 A;  4MF6 A;  3QD9 A;  1Z7P A;  2HRN A;  4YQM A;  4MK3 A;  3IHG A;  1QUW A;  4V1A g;  3D4M A;  3UBK A;  4L5L A;  1PN0 A;  4WR5 A;  1G7E A;  1PKW A;  1ZL9 A;  1XW9 A;  2AAW A;  4KND A;  5FWG A;  4MMM A;  2CV4 A;  2H72 A;  2P31 A;  4K7O A;  1GSY A;  2VD1 A;  2LJR A;  2K8V A;  2GQM A;  3UOM A;  2AYT A;  3NOF A;  4JE1 A;  3RHB A;  4BVY B;  1MDI A;  3A2W A;  4PX1 A;  5ECI B;  4MJA A;  4MCU A;  1JHB A;  1KTE A;  4ACS A;  2WDU A;  3RPP A;  5KN0 A;  4OCF A;  2NVL A;  5ID2 A;  4BL7 B;  3DWV A;  4PNG A;  1E2Y A;  2CQ9 A;  1GTU A;  3KP8 A;  2FNO A;  1MDJ A;  4BPY A;  2OAC A;  1IYH A;  4Q5F A;  2B5X A;  2H1B A;  2HRF A;  9GSS A;  2TRC P;  3OR5 A;  1H75 A;  2R37 A;  1XCC A;  6GSW A;  13GS A;  2V1M A;  3HXS A;  2HZF A;  3ZTL A;  3VI5 A;  3GX8 A;  3U6V A;  2F9S A;  1GSF A;  2DSA A;  5IMZ A;  3V1W A;  4O5R A;  2D2Z A;  2FUG 2;  3IPZ A;  3L9S A;  2WGR A;  3CRT A;  3KP9 A;  1WMJ A;  3DRN A;  5KOW A;  3NZN A;  1TK5 B;  2EIQ A;  4EO3 A;  2OKA A;  3GH9 A;  1WJK A;  1YY7 A;  5GAN D;  3PGT A;  4AF2 A;  3TDG A;  4G19 A;  3ZVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...