3FEZA

Crystal structure of uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases (yp_014836.1) from listeria monocytogenes 4b f2365 at 2.10 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
169
structure length
169
Chain Sequence
ENLYFQGMKKVFITTGTEHYLRQLMANYTGGNVTLLQNFSQSLLYQESTGEKLFQEGAEYRVLQSSGSLKGFGVVVFEYIHLRDEEIPIFLQMYQRASLHFSETPGLQSTKLTKAMNMNKFLIISFWDSEVFFHDWKKTPLSKEITNIMKKNNTQSGFSHEDIYHYPEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of uncharacterized ferredoxin fold protein related to antibiotic biosynthesis monooxygenases (YP_014836.1) from LISTERIA MONOCYTOGENES 4b F2365 at 2.10 A resolution
rcsb
source organism Listeria monocytogenes str. 4b f2365
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized ferredoxin fold protein related to antibioti
total genus 44
structure length 169
sequence length 169
ec nomenclature
pdb deposition date 2008-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3430 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fezA00
3FEZA 4OZ5A 3FJ2A 4JOUA 3TVZA 4FVCA 4AE5A 4KIAA
chains in the Genus database with same CATH superfamily
1OQ6A 3CCWA 1JLQB 1Q0NA 2AHOB 1NK4A 2OIHA 4CM2A 1RLDA 1N32J 4OI6A 4LBPA 4DL6A 1FFGB 4MK7A 3PW2A 3VGUA 1M5KC 4M5LA 5THWA 4KY3A 3CDBA 1HNZJ 2NSBA 2Z57B 3ZXWA 4B3RF 4RUBA 2FC9A 4GO5X 2VD3A 2LP4A 4OX9J 3NNAA 1SKUB 2CQ1A 2D3UA 3R27A 2ZITA 3C3LA 4CO5A 1FFSB 5IC4B 3I5CA 3MR5A 2CJXB 5BXIA 3HK2A 2XI3A 2D3ZA 2F63A 3FBFA 4ECUA 3DOMB 4C9DA 1RBAA 1S7HA 2E66A 1KLMA 3MZIA 3M9OB 1I94J 1QAJA 1YLXA 4NMXA 1FI4A 1S4EA 4ZPVR 1R0BG 2AV5A 4OI0A 3AB2B 3VGVA 4ZP8A 3H5YA 1GH8A 2R7RA 2UUAF 3C6TB 3BYPA 4CO3A 3IMQJ 4NA2A 2UXBF 2V8HA 2Q6CA 1HKAA 1PYSB 5GAHU 3CJ3A 4C11A 1QAXA 2GX8A 2V63A 2P6TA 3EXYA 3VGTA 5LSOA 3AAWB 1KHWA 2HGMA 1DY3A 1UCNA 3QGPA 4ICLA 1IJEB 2XMJA 3TZYA 4JI4J 4ID5A 2JVOA 1RCXB 4TU9A 1B3TA 2ADCA 4F50A 3KJQB 3OTOF 2CJAA 4GVBA 4KE5A 2DR6A 1AT1B 1B0PA 4AD6A 3LP0A 2Z56B 3PYEA 3QATA 4JI6J 2QFJA 3CVKA 3CCJS 2HLUA 2ZH1A 3J7Z5 2OI2A 2ZUAA 2HHHJ 4HTIA 4ZVHA 4ZMMA 4M5HA 2ZHBA 1G4CA 2GCFA 4PG8A 3BGLA 3OTOJ 4K4TA 2XHWA 4X4UA 4K4VA 4A4JA 4RUHA 1N48A 1YJRA 1FDNA 1RSCA 3N6MA 1HARA 5ETTA 2WOMB 1NB2A 4LJMA 3BKFA 2FHJD 3W2VB 1U2FA 5BYSA 2AJFE 1N32F 3BQ1A 3G86A 5E3RA 4DR5J 2DGSA 5KFAA 4OYMA 1IKVA 5DGAA 4N56A 4K0KF 5C42A 4J7CA 3KWMA 3WX4A 1XQIA 2DNHA 3GP9A 2LA4A 5FD1A 3LQVA 3R7NB 3V5RA 1DTTA 3BR8A 5AE2A 5LMUF 4J9OA 1S57A 3AQPA 3FEYB 2ZVSA 3A3PB 1RUSA 4J9KA 2K7JA 2YX1A 1LW2A 3HD1A 3K5PA 1XR6A 5KFUA 3VR1A 2ZNYA 2NZCA 2V67A 4NZ7A 4HT7A 4PXBA 2MSSA 2YNHA 3MM5B 1VQ5S 3FBEA 1TUGB 5ETOA 1S97A 2K7KA 2R4FA 4JI6F 5CCMA 4DOZA 2MZJA 3OHAA 4OZNA 4BS2A 4MYUA 3JAMU 2MKYA 1CLFA 1MN7A 1Q8KA 4X2BA 3KG1A 3GV8B 4A8KA 1U26A 4ENOA 2KKHA 1SJ1A 3B8HA 1TKZB 4NX9A 4QW8A 3QNWB 4FP9A 3CCVS 1JKHA 4TLRA 2CUYA 5J1EA 4DR7J 1RAHB 2K3KA 1T9UA 2C1EB 2CQIA 2EFPA 2FY1A 4P2MA 4A8OA 5DM7Q 3AXKA 1WUUA 2NCKL 3WC0A 2YNFA 2JFDA 3E8OA 4RBUA 2K1RB 4DR6F 4HL9A 1IWAA 4EBEA 4WXOA 4USIA 4G1IA 5DS7A 2P5VA 3B4DA 1TKXB 2KXFA 2YQ1A 3B78A 3DDIA 3CCMS 1EP4A 1M1KT 3M1VB 4KBIA 4RX6A 1VQ9S 2K8GA 2BA9A 1JXVA 4P10A 1IKVB 3KLEB 1PJ5A 5DO2A 2G0CA 2LU1A 4OX6A 1VRUA 4NOHA 4OX7A 1S1UB 3CXCR 1Q78A 3LTOA 3KNGA 2EC2A 2VFTA 4CQ1A 1IN0A 1T9XA 2HNYB 3PFEA 3JAMY 5ITHA 1LWEA 2XYPB 3TA1A 1RTIA 2B6AB 1K47A 3MI7X 1LW2B 3TAMA 4QWAA 4A8WA 5K9FA 4CLSA 3AXMA 1YK9A 3AD8C 2ATCB 3MWBA 3U7JA 1N56A 4Q8FA 3OL9A 4WFAQ 2IY5B 1HI8A 1N5TA 2ZVIA 1NEEA 1L3UA 3AJ2A 2HPUA 4DUZJ 1S9EB 3W2WA 1BQMB 2YTCA 2V2QA 4AL7A 4JI3J 2GNKA 2HQIA 3V6JA 2PFDA 3KK2B 4RW4B 1VBKA 4DV2J 2J9DE 4WU2A 4C3MA 5D4OA 2BJ7A 1WG5A 3BDEA 5B0EA 3WIVA 4CO0A 3PKMA 2YKQA 1RAJA 1S1VA 2ZEJA 2KDOA 4B02A 3PJWA 2QMWA 4JI1F 2ZDPA 2NXNA 1WKKA 2QV6A 4G1PA 3ZZTA 3H8YA 3MPWA 4DU7A 4X4OA 1Q8LA 1B0VA 3CT9A 4N7TA 2KHCA 4WIQA 3F73A 3MMAB 1RT4B 1U1PA 4DV2F 3M2RB 2HBRB 4YB5A 1F1BB 1L3SA 1T03A 1S5ZA 4C3LA 2FGOA 3CDWA 1VQ7S 1JJ4A 1JLBB 3LF0A 2JVRA 2K2PA 4I6YA 4ZHRA 4DZ6A 4NI2A 1HNXF 1HNWF 1DURA 1B7YB 4DSJA 5J2PB 3WQPA 2HVIA 3BKTA 4CNYA 4HR2A 1KWMA 4QIFA 3KJFB 3VAFA 4IO9Q 3C6UB 3JTPA 5KFLA 2DR8A 4J9LA 4KKOA 2AGOA 4E2FB 2CZVC 1VQ4S 2KZMA 2MSTA 3KLHA 2YKNA 2W2OP 5D4LA 1KS2A 5IZHA 1RT2A 1ZPVA 5F0UA 5DETA 4DFMA 2BR0A 3GV5B 1MWQA 1M1GA 3CD5A 4ZVPB 1NPRA 1RT3B 4FYVB 4MJKA 5HBMB 4V19J 3GR1A 4IFYA 2IAJB 5KFMA 1HPZB 3K59A 1TELA 4C6AA 3ILOA 4K4YA 1W2IA 2UVRA 1U1MA 1A7GE 1RTJA 1YKWA 3ICLA 1WHYA 4R0JA 5J2NB 3K57A 1LK7A 4KO0A 4K4UA 4TXSA 1WACA 3IG1B 2UU9J 2YKPA 1NCLA 4RU2A 2MDAA 1ELOA 1V6HA 5B0DA 2VPYB 1FXRA 1DHMA 1PJ6A 1SUQB 2IIHA 3P4UB 2EW9A 2DO4A 1T03B 4JB8B 4L74A 4Y2IA 1TL3B 2G2YA 2B3TB 2ZE2B 5D0EA 4CLPA 1V5VA 4F3QA 5IV3A 5F8HA 4AXJA 3H7HB 1UVIA 2DY9A 1GMWA 2Q1LA 1WC4A 3EM1A 3ZZOA 1IVZA 1RA7A 1RWWB 4PQUB 2MZ1A 2H5IB 4UF4A 1VJWA 1RAEB 5I42B 4ECQA 1U1NA 4Q0BB 1C2PA 1H0HB 2VQEJ 4DX7A 2GJFA 3FQLA 5HVFA 3KLHB 2NR0A 1RT2B 2QYCA 3OFEA 2C3OA 3UDLA 1J5OB 4CH1A 3U1LA 2W9CA 2CQBA 3CD0A 4X84A 2HRTA 3D2WA 3NL0A 1DLOB 2V4JB 1FX2A 5HANA 1S9FA 4DV3J 2BJ9A 3EVWA 1NDLA 5IS2A 5JUMA 1R8BA 5IT4A 3J7YU 1DQ8A 1HR0F 2W7AA 3B82A 1WC0A 3RZAA 3R1LA 1YBAA 4ZPAA 4DHVA 3M30A 4HACA 4ZHRB 1MW7A 4NE9C 2W2MP 4ID5B 3W9HA 4YOEA 3BSOA 1ZPWX 3BGOP 1AW0A 1NH8A 2DBBA 1CJUA 2HQCA 5CA5A 2AD9A 1KN6A 2IRUA 4IRCA 3ZNUA 1EAYC 2BEFA 2RH3A 3PCOB 4RKUC 4DPOA 3R5CA 1TVRB 3TJ9A 3KDOA 3KK1B 1NJWA 3J80Y 2LQ9A 2ZE2A 1M5SA 3NKYA 3RR8A 2LYVA 2D9PA 3I4HX 2E5IA 2BW2A 2HBZB 3M05A 5A2QU 3QT8A 1UVMA 2AJ2A 2X1GA 4ED5A 1OYDA 3H2VE 4HHJA 4JBCA 5BR8F 2PA8D 3MEEA 3AY0A 3KHHA 4PZVA 3QO9A 1WHVA 3BBCA 2HHVA 4FXDA 2U1AA 1MMDA 2O67A 2RQ4A 3C14A 3DFEA 4O0NA 5A6PA 1MROB 2VICA 4ED6A 3BH7B 3S7RA 1HHQA 2FHJA 2XCAA 3FVYA 1W2BR 2VBWA 2HZAA 2CKWA 4OZ2A 1WEZA 1VRQC 1F6TA 2GS8A 3DRPB 1X4HA 2RQCA 4UT4A 2DPJA 2E5LJ 4UUWA 2UUCF 4LF7J 1GEHA 2RMLA 4PABA 4DR6J 4KV8A 3T9ZA 5J1NA 2IFXA 1WTFA 1S12A 4HHHA 1G3OA 2ZH3A 4U96A 3J81Y 2H9ZA 4YEAA 2HS0A 3P3DA 4RL1A 3BZQA 2LVWA 4C8NA 5I3UB 1H2VZ 1PIEA 4MKBA 2Z4PA 3Q8YA 4MT1A 3UO0A 5I3QA 4OJGA 2N3OA 4DV6F 3ZZZA 1HD1A 5J1EB 1P27B 2PE8A 4WP8A 1JLFB 2CQDA 2M88A 2FJBB 3OFGA 1RHUB 3TUIC 4XDDA 1HIYA 2QGFB 4M5DA 4C2MA 1SL2A 2BQ3A 1DTQA 4CLTA 4X4TA 4KJIA 4YHHF 3QRQA 3KYLA 3DN9A 3RTVA 1C4AA 2JC1A 1U25A 2LA6A 3OTEA 4WFZA 2D1CA 3TWZA 8AT1B 5CCLA 1NK0A 2QL5B 2B9YA 3UN3A 3UD4P 9RUBA 3FRYA 2V8PA 4ED4A 1SC4B 5KFJA 1W7WA 3CCUS 4J37A 4RZRA 1URNA 4B3SJ 1VISA 1BD6A 4LF9J 1GT8A 4IQMA 4DR2J 3T1HJ 4K4ZA 3PTWA 4TNOA 2J0QD 4LFCF 3QJJA 1EQ0A 1LFWA 4DU8A 4ZK7M 3M8YA 1JLGA 1JXLA 2IYGA 3RBEA 2KRBA 2IM1A 4CIOA 3CNQP 1HNZF 2GIQA 3KUEA 5DZ6A 4QR1A 5KFZA 4ED2A 1ZTWA 1F2GA 3RRHA 3LAMA 2WSCC 2IM0A 1W25A 4OV6A 3SEOA 4U7CA 3I87A 1XNQJ 3JSBA 3P8BB 3EGZA 1R0AA 1HNXJ 1HNWJ 2M70A 2DYAA 4L73A 1RKIA 1S76D 1BY9A 2YNIB 2F65A 1T9YA 4G1QB 2E7XA 1XMOF 1NDPA 3MR3A 4AUKA 4B3TJ 2HNDB 2R3VA 4MKVA 3TAPA 3NWRA 1KVKA 4DX5A 1WF1A 4TVAB 1O6XA 3GE9A 3A8IA 3IBWA 4X4QA 3EX7B 4OX9F 3MAAB 1LWCB 1PG5B 1KOOA 1TV6A 1WC6A 3BSAA 4U6PA 1SV5A 1YG0A 2WK4A 4TQSA 3BQ0A 1SJQA 3T6JA 2PO4A 3LPYA 2JLEA 5L1LA 1FNOA 3QGIA 1TKZA 1QJHA 2VG5A 3OR2A 4NZ0A 3SQGA 5C25B 2W9AA 4C8LA 2WVCA 2C42A 3TP2A 1UVKA 2ROEA 2ZDOA 3BO3A 4DR4J 3AOAA 2R9LA 4ECRA 2MY8A 2P2CB 4K7QA 4NLDA 4GMKA 1RYRA 2Y9HA 2RQKA 2CJBA 3HHLA 3D1QA 2IJNA 3NBPB 1TK5A 4CLUA 5KG5A 1VBZA 4LF9F 5MLCV 3MAQA 3A8JA 2ZH4A 4K0KJ 3MPVA 4F02A 2CYYA 3M8WA 2NPIA 2VV5A 3CPWR 1X0FA 1HYSB 1T8EA 1REVA 3FZBA 2WW8A 1MROA 4NL5A 4OYBA 4Z7YA 1ZZNA 1B99A 1UWBB 2XI2A 5E0OA 4YHHJ 2OO4A 4H4KC 4DV4J 1N6QB 3IWNC 1T94A 3D6FB 3DM2A 3EPGA 1U2CA 2LEAA 3TI0A 3C16B 4L3NA 4DFJA 2MLZA 2VG7B 3A12A 3I0SA 2Y0BB 3AODA 3ISND 3M6WA 1WKLA 4HHUA 1L3TA 4NXMJ 5F9NA 2HNZA 3LGMA 2FJXA 2CNKB 3BR9A 3PFOA 1GQEA 3MEGA 2DHAA 5L38A 5IT9U 3L7UA 4NLRA 3MM9A 1C1CA 1HBMA 1RWKB 1Y0HA 2HEKA 4OHWA 4ZJOA 4A8XA 1LFPA 4DUTA 4RW7A 4ZP6A 3TJ8A 1S1TB 1QTNB 4I2QA 1S72S 2FVSA 2E5GA 1H38A 3FFIA 4WK1A 3TW0A 2JL9A 2HVHA 3ISNC 4BWMA 2BJ1A 2XG8A 3H2LA 5IFMA 2RS2A 2YQ3A 5CH7B 4JI0J 2V50A 3DDKA 4NLPA 3MGJA 2H4WB 1S9GA 4F2SA 4QJVA 5HVHA 1R43A 1DLOA 4EO6A 2DH8A 4DL3A 1CS4B 3PW4A 2OJ3A 3DLGB 2XY5A 1YDLA 2B5JB 1A6LA 2EKYA 4H54A 5KFDA 4YUDA 3GG0A 1EQMA 3HHEA 4M5NA 4RUCA 3VAKA 5KT7A 1S1WB 4EYIB 2LU2A 5KFOA 4UZCA 5T7LB 1TFYA 4K4SA 1P1LA 2HBQB 2BE7D 2MTLA 1OYEA 3FSYA 5G4DA 1FWPA 3BPSP 3GWCA 2SXLA 1RAOA 1RTHB 4P73A 4ZS6A 3SCJE 4KGXB 1CBKA 1YI2S 3LP2B 2DRAA 2KFNA 3CJ0A 3R3TA 2C2RA 4KSEB 2VOOA 1U0HA 3GMGA 3FUYA 4YR0A 1K1QA 3SQOP 3ZC4A 3JYTB 2ADBA 3X1LB 3LWMA 3MAHA 2HKEA 2QIFA 2ZZTA 4ZCMA 3HVTB 4LFAF 3PG9A 4ZPTR 2HIQA 4OHYA 4DFPA 3W3SA 1K0VA 5K8NA 4KO0B 4JI5F 2HVZA 3MEKA 2R2TA 4I4BA 4ZJLA 3UR0A 2G13A 2VFRA 4KT0C 2J9DA 2DH7A 2B9EA 1C1BA 3DHWC 3AA8A 3LGNA 4OJ3A 2RT3A 5ETNA 2GHWA 2ASDA 1YHQS 2DKOB 3J7A1 4FBUA 2R7XA 4L6V3 2WTFA 2IM3A 1OY6A 3MAAA 1OMSA 2APOA 2QN6B 2KT3A 2YWFA 3F56A 3R5GA 4A48A 1G2EA 3J7YI 1RBLA 4KGMA 5DQHA 2XSJA 2B5JA 1RHMB 2IMOA 1YZ7A 2QZ8A 2YNGB 3C19A 2DNRA 4N5SA 1HQUB 4B9SA 4O3OA 4JI0F 1APSA 1HNIA 2DVIA 3MM8A 3BGRA 3EICA 1HBUB 3L95X 3NG8A 4CLZA 3OR1B 3I9ZA 5D77A 2ATLA 1JNZB 1LQ9A 4MH8A 1HQ2A 4X4SA 2VQFF 1Y9OA 4KFBA 3UN5A 1SH0A 3UN2A 4QWBA 4USWA 2ZUGA 1WKJA 4I0WA 2I9SA 4FKXA 1J2VA 3W2VA 3I32A 5A2QY 4K50A 3DMJB 4M94A 1HHSA 1S77D 2XNQA 4LSNB 2G2ZA 1BQMA 2DY1A 4EWTA 1HWUA 3M4XA 5C24A 1IWGA 4EU0A 3DLEA 2GC8A 1XJWB 2E29A 1QY7A 1X4GA 2N3LA 4HT5A 2DXEA 4F0MA 3K5NA 3GFZA 1IBKF 4LF4J 1X4BA 1L3VA 4B3OB 4WE1A 2MLXA 2GAHC 3OFHA 1X5OA 2WRMA 4O4GB 2DGUA 3DC2A 5K14B 1BMQB 1GMWD 2IJFA 3KOAA 3MEDB 1GMUA 2B7BB 2L48A 1ZH5A 2J9EA 4TY9A 1UW4A 4PXDA 3UDEA 4C4WA 4BBYA 4USTA 4MIAA 4ECSA 3JQJA 1N34J 3CDEA 3IFEA 1JJ2R 1Y5LB 2EWHA 1WI8A 1HQUA 2MGZA 1ZOTA 1S99A 2HFUA 2QE5A 5G0RB 2WCXA 2BQRA 4ATNA 4WP9A 4CT9A 2VPWB 2UXCJ 1DAXA 1SH2A 4LR9A 3ISZA 3M2VB 3PM9A 5KT3A 1RWOB 3DU6A 3G2XA 5M2RA 4DV5F 2UVUA 2O66A 4RNHA 4DN0A 5DG9A 1PC4A 1UPMB 2XSFA 4AQYF 1VLYA 2HNDA 1ZS6A 5DLGA 4OZ5A 3G6XA 4DPXA 3K8WA 1RWNB 2VFUA 1RWVB 1ZM9A 4IFYB 4USJC 2CA9A 2MZQA 3QIDA 1NKEA 1D09B 3MFHA 1KKHA 1TU0B 3VAGA 1TV6B 2DEIA 3LH2S 3LOUA 4HKQA 4QCLA 2OEKA 1RQ0A 3S01A 5IQ6A 1PSDA 4WE1B 1Q82T 2MYFA 5RUBA 1ROFA 2DCLA 3PYDA 3DLKA 4J9RA 4ECWA 2RUSA 4OZJA 1JLCB 2ASYA 5AJ3F 1LW0B 2JLFA 3TAQA 1O51A 3NWGA 4C8MA 3U27A 4UY8T 2HHSA 2XEXA 1C0UB 4ZN3A 2CQ0A 5L39A 1QAYA 4DS4A 3V6DB 3DGPA 4DCJB 2VG6B 4OV1A 1XMQF 5EHHA 4QYZK 1YWXA 4HYKA 5HMWA 2J6UA 3KUGA 1ZETA 5ETVA 5I42A 5KFQA 2GAGC 4I1TA 4ANEA 1EKSA 1S4FA 2XBPA 3L7OA 3TNVA 1CJKA 1GXLA 3FBCA 5DG7A 3R97A 3RB3A 3KG4A 1WDTA 3BF4A 5EN1A 3UVJA 4B3SF 1HLWA 3O8WA 4LQ9A 4J9SA 1L3KA 1WDDA 1N6QA 2KZZA 1FKOA 1HNVA 1Y11A 3VZHA 4DR3J 1U0SA 1D9FA 3DOKB 2KM8B 5HMZA 1MU2A 4F0KA 3QBCA 1UFLA 1PCAA 1Q79A 4JI8F 3CWJA 2V34A 2XMAA 3T1YJ 3J7AN 5DM6Q 3K7RA 2OGUA 2ZFHA 2O1PA 3D3BJ 1MWYA 4OJ1A 1N5VA 3HVRA 3D7SB 4DSIA 2DTJA 2B7CB 2DB1A 2E1RA 2WB1D 3GU0A 4M5MA 2YXLA 3R2CJ 1KOHA 1N88A 3WIUA 1YRXA 2OPRA 3IP0A 1S1XA 4NEYA 5KT2A 3ADAC 3CD7A 4RNMA 4DL2A 4RWXA 1IR2A 3H5SA 4Z2XA 4ZLJA 5KFXA 1F60B 4G1QA 2FD2A 1HBNB 3DYAB 1SKRA 2H48B 1BWVA 2FYXA 3RUBL 3OW2R 5J2MA 1KFSA 4C11B 5FLXU 2J8AA 2EC0A 1SQGA 1CC7A 1IKYA 2KTQA 2XC9A 2MQPA 1TAQA 3GIMA 2GMHA 1ZYQA 1MWZA 3Q8SB 1YVFA 1RT7B 1IJFB 4DEZA 1NHKL 2F9JA 4TU7A 2B56A 4O3QA 5ADZA 3PY8A 4FZVA 2UVVA 2CWXA 2V8DA 4LF5F 3GJRB 4DV0J 4HH0A 3B6BA 3CW2C 5CHCB 3NS5A 5KFFA 3QAUA 3V4IB 5T7LA 2XMMA 4NLOA 3DOKA 1YRUA 4FYWB 3FGVA 2UUBJ 3GONA 2OELA 3IR6B 3LP2A 4KGZB 3SSQA 1AYEA 4FNHA 1JJHA 3W5XA 4WTOB 5F3ZA 1ACMB 1YQHA 3GCWP 3W9IA 4NXMF 3ETOA 4R5PB 4ZKAA 5DDOC 3I96A 4IR9A 4I69A 2E9RX 5CYMB 3IAS9 2XULA 3I0RA 4YS2A 1X9SA 5KG6A 1T05A 3CJTA 2DGXA 2VC1A 4JUZA 1U1LA 4R25A 5CYQA 4NA1A 1CJTB 1DTTB 4LRDA 2OMOA 3O5TB 2CNLB 2ZHOA 4CYUB 1AB8A 3N5BA 2CPJA 4OHZA 1S0VA 1IQTA 2CADA 4PXCA 3RU0A 4B9TA 1C0TB 1NBEB 2VC0A 1CPZA 1WWHA 1RISA 5B0CA 2Z2LA 1XWLA 8RUCA 2NXJA 3BPDA 5KT5A 1Y3KA 3RBDA 1UA0A 1VBYA 3O2IA 5D8HB 3FSXA 1H7XA 2NREA 1JLEA 3ZNJ1 4PG5A 3ZTRA 4LFBF 1FWKA 2FVCA 3OTBA 3KLVA 1VGYA 3FDSA 2M2BA 5KFSA 1M1HA 3FQKA 2W7PA 1U1KA 4USMA 4O44B 4ITSA 1JLCA 4FXVA 4ZIVA 3OR1A 3H25A 3RRGA 1XEZA 2QLWA 3OT9A 5F8MA 1RT5B 1VI7A 1AFIA 2LMIA 2DIUA 3B4MA 2VJUA 2AMCB 3HSGA 4ELUA 1KNZA 5H9EJ 5L9XA 4OZ0A 2R7TA 2K1RA 3P45B 2RDIA 2WVBA 4DV0F 3O1LA 2KG0A 1XIQA 5HBMA 2HWHA 4OYOA 1HI0P 4NA3A 4BHQA 2F5GA 5IT0A 1X9WA 2NS1B 1RGVA 3CD6S 4USVA 5D3GB 2LXUA 2UUTA 1FO1A 3MHYA 1YJ7A 4IDKB 2A6OA 4B9NA 2DHSA 1JXEA 2RS8A 3LAKA 1YTYA 1NPPA 2GGPA 5F8JA 4DSLA 3UD3P 1JJCB 4ILRA 1KONA 4ZVQB 4DV7F 1FVQA 4JV5J 1JB0C 2MKCA 3EZOA 3NCRA 1XMBA 1K1SA 2IHR1 2N4DA 2RKIB 5K14A 4DSEA 3HF5A 3IM8A 1XNRJ 3HLUA 3LA0A 2VFSA 2FDNA 4CO2A 2F8HA 3JYTA 1Q53A 1ZA1B 4DSKA 3MPYA 1KVJA 1GTEA 1RWPB 1KR4A 1YJVA 3EMTA 2O5DA 3JSRA 4U8VA 2J0SD 4YN3B 3Q8UA 2DH9A 2L9DA 3M2UA 3DRRB 5HSPA 1NK9A 2LDYA 2PSZA 1VIOA 2F40A 3DI6B 4USKA 4CH7A 4ZJQA 4O0IA 2VQFJ 3P6YC 4OHVA 2E5LF 2UUCJ 4JV2A 2FZKB 4Y2MA 2HMIA 3IO1A 2YH1A 4K2XA 2GQCA 3NCQA 3DRYA 4I64A 2E5HA 4AYBD 1FEEA 2G2OA 3BGUA 4LF2A 1S0MA 2OH2A 3ZZPA 2Z58B 3KMSA 4ED1A 1F2HA 2IA0A 3HSDA 5ETLA 4LIWA 1SL1A 1M90T 4PUOA 1LXNA 2M5YA 4J91A 4F67A 1TMMA 3Q89A 2OUGA 3KUHA 1OY8A 3BGRB 3M30B 2I1RA 3ZO7A 4ER8A 4B9LA 1OWXA 2JC0A 1UETA 4XK8C 2QL7B 5A6WA 4C8OA 3HJVA 5JVHQ 1XK8A 2JEGA 4IQXA 1U7LA 2KB2A 3B54A 5A8WA 3T5LA 1X9MA 4FF1A 3C2PA 2HW3A 1Q7LB 4YB7A 4IRKA 3R6LB 3AQOA 4X62J 1A9NB 4X4NA 2IPOB 2F4FA 3TVZA 5JVGQ 2A3JA 3GPAA 2RB7A 4UOGA 2N82B 5D0HA 1RT6A 3G96A 3A3NB 2COLA 4L75A 5K8MA 4CNZA 3TZWA 3CC4S 4KH0B 2V68A 3BH6B 4HI1A 4N8OA 2X51A 4OI1A 3VTIA 2MXYA 5H9EK 1QVGR 2VA3A 2RF2A 4JI7J 3DRRA 4LFCJ 1QE1B 3DCAA 1WEXA 4HDGA 5KT6A 1FXDA 3CJQA 4OQJA 3IG1A 3IR5B 4O4RA 2YKMA 3IM9A 3PNIA 1QAIA 4JI5J 2J0WA 4ZCKA 3DDNA 1CG2A 5E3CA 1V3SA 1EETB 1R0CB 2BJ8A 4KH1B 3ZZUA 1S49A 3T3FA 2CDQA 3M8SA 1FCAA 3ELHA 2IA6A 2X1FA 1YJNS 4DR7F 3CJKA 2DNNA 2MZTA 2GVDA 2XLKA 1BUXA 2CPDA 3AJ1A 2CQGA 2GJ2A 3QFHA 3QO9B 5HQMA 1SV5B 2J6SA 2Y8WA 3KLEA 2XY6A 2R7SA 2HHQA 1WD6A 2OEMA 3JSMB 3J81U 4YB1P 3CMAS 1S1WA 1U1OA 1N4LA 4TY8B 1ZAWA 5AXKA 3EYZA 1M5PC 1U8WA 4QU6A 4GKJJ 1IBLJ 1EHWA 4E98A 4CDIA 1TKDA 2EEYA 3MMCB 2BX6A 3THVA 4W92B 2F4VJ 3ET6A 1QUVA 2AJ1A 1JLAB 5IXUA 2EBGA 2BM0A 2JZ5A 2ACYA 1MLAA 3K17A 1IKXA 1Q5YA 2BE2A 2E1PA 2BM1A 4JI8J 2LXIA 3SI8A 2PI5A 4EBCA 4WYWA 4RNNA 1LWXA 4CLYA 2DD8S 3AOCA 3CJ8A 5HO4A 1F9FA 1AXQA 4J9NA 3R5JB 5LMNF 2W4CA 4FS2A 4QW9A 4H4MB 5HATA 1N0VC 3DLKB 2XZDB 2BXJA 4ZLPA 2NXCA 2EFVA 3PXGa 3UNYA 1M5VC 2WVFA 4M8LA 2GHPA 3T5JA 2VIHA 1RTDB 4LRFA 3JS9A 5IT9Y 3CCES 1I3OB 3V6KA 2HQDA 3CCTA 2LKZA 4YB6A 1BQNA 1HBMB 2NUHA 4WK3A 2C3PA 1TTHB 2XGQA 3VWSA 2YWWA 1CVJA 3QFWA 2IBKA 3PV8A 3MR6A 2YWGA 4MFBB 5ETSA 2XYGB 3W66A 2AKWB 2W8LA 1RTZA 4KQZA 5EWEA 1C4CA 4P74A 2NXEA 2Z30B 3MFIA 2OEJA 4I7FB 2K06A 4M5KA 4WFXA 1IR0A 1F9HA 1GXTA 5D4PA 5E41A 4EZ9A 3NGSA 5KAKA 5GVQA 2ZBQA 5F8NA 2VPXB 5GADU 4X65J 2M8DB 4PAAA 1T9WA 4UOFA 2DGVA 1OQ3A 3I9V9 3OXFA 3L4BC 1WOPA 2BW7A 4WWSA 2IVYA 3NMAA 2KL8A 2DGOA 1LWFA 2POKA 3ENVA 1D1UA 1I94F 4CT8A 4V1Ak 2JWNA 3IWXA 5KG1A 4LMZA 4USHA 3DLBA 4IR1A 2KM8C 1H73A 3KMQA 1U0HB 1RT5A 2AJ4A 5HL7Q 3RYLA 3F0NA 3GFHA 3K8VA 3M8PA 4CTAA 5F9LA 1IBLF 1UP1A 4NLYA 1BQNB 3BQ2A 1NJIT 2HHHF 1UW9A 5HLFA 1H7WA 3DLLQ 1LOUA 5CQGA 4OLPA 4OL8A 1HFEL 1TL7A 1AZSB 2J7UA 2RF2B 2ZKUA 5K8OA 1HW8A 1TUVA 4DF4A 1FTRA 1NKBA 1QLNA 2JNJA 1IKWA 4OHXA 3TA0A 1XMOJ 1OSCA 2HS4A 1NSKL 2O01C 4CWBA 3A8KA 3F41A 3MMAA 1EETA 3PHEA 4KGVB 1DQ9A 3MPDA 1N33J 2IC3B 1IUJA 3IWLA 3U1MA 2ASJA 5FDLB 3G4SS 4I7FA 5AXLA 1U02A 1OS5A 1FJEB 1J5EJ 1JLGB 1SH3A 3GLJA 5C5JA 1EKRA 4IH6A 2MQOA 4WYLA 2W9BB 1RP5A 3T5KA 1NZ8A 2YNGA 1XBWA 4QIWD 3HPOA 5F8IA 3R6GB 2AU0A 1RLCL 1FD8A 3M8QB 4EBDA 3OSNA 4F4AA 1IXKA 3R5DA 1M5OC 2M3DA 4YDXA 4K59A 4J9PA 4A8YA 2ZZMA 2CVEA 4YP3A 3US5A 2PI4A 2W01A 2C28A 4GC7A 1A0OB 1YJWS 3MM5A 3VALA 2HK2A 1N5YB 3CSKA 2ZH6A 2MHNA 3DMJA 2ZBRA 2YH0A 5KFIA 2LEBA 1IKXB 4EZ6A 2OTLS 4LF8F 2DJWA 2LDIA 1NDKA 1SC3B 4J9UE 3BS9A 5HLFB 5HN0A 3EDQB 2WVEA 2X3DA 2H54B 4OIXA 4RLEA 3HO1A 2QSFA 4RW8A 3PIOQ 4P72A 2FQQB 1SPBP 3M1VA 4W98A 3TARA 2DGTA 4PKDB 4B9UA 2QMXA 3L7PA 2RRBA 3W5YA 3W65A 5AXNA 2AZ1A 4OYPA 1E6VB 4PQAA 2YNFB 2M7SA 4RPFA 1VQLS 2I8EA 2LFVA 1WSRA 1T95A 1Y4ZB 2HVEA 3CC2S 3IC1A 3CCSS 4CCHA 4DQIA 1N36F 4P71A 4DQRA 2XZTB 1REGX 4ZVEA 1R6YA 1FJ7A 2RUGA 3CJ2A 4NYPA 4ZVRB 3NS7B 1X7VA 2WW4A 2QG9B 1MMNA 1VDHA 3FEZA 4PWWA 5G0RA 2DCUB 2C3UA 3T1AA 1R89A 4X4VA 1Q4RA 2RDJA 3CEDA 3FKBA 4L3KA 4PEOA 3SDEA 4ES2A 3K0JA 4DBQA 3D1OA 4OI4A 1VC0A 2PFFB 5D4NA 1MNEA 3QIPA 2DITA 4GVLA 3WDOA 4F3MA 2UP1A 1D0EA 4PWDA 1T3OA 3A3OB 2UVWA 4AQYJ 1O0PA 2PC6A 5KG4A 2GGPB 1WC1A 2OP5A 3ZZRA 3RW7A 5MAOA 2MJNA 2DIVA 4DQSA 2EFQA 3KLFB 3EGVA 3HVWA 1RT4A 1X0PA 2AT1B 2GO8A 2FTRA 2GFFA 4P2XA 3CCQS 1F5AA 2HAIA 3DRSB 3IRXA 1AA1B 1GTHA 1KP6A 3AA9A 3G8TA 1IBKJ 4I67A 2HHWA 1UA1A 1Q1KA 2CDRB 2KI2A 5KFVA 3CMQA 3J80U 2GQQA 1FFWB 2D3O1 2V2ZA 1Q5VA 3JQKA 1ZZFA 2GA7A 3K5OA 3MM6A 5D0RA 3CCLS 3TUJC 4WFNQ 1S1TA 2HRYA 5H9FJ 1QTMA 1NSAA 3M2RA 3NEKA 3DI6A 3PHTA 3GV7B 3OTDA 1K8AT 4B9VA 3V81B 3EVOA 4U9RA 3IS9A 4M63A 3FSIA 3TX0A 4BDPA 4UQGA 4ANCA 2Y1RI 5JMNA 1DRZA 4UTGA 3TYTA 1KLNA 2RD5C 4A8FA 2PMZD 3SV3A 1F9EB 1RKJA 2KN4A 1TL1B 3IN5A 2HYIB 2D9OA 5IOLA 2X7IA 3RG6A 2R2SA 2B8PA 3VAIA 1NPKA 1W26A 3EGWB 4OYIA 5ETMA 2MEWA 2XO7A 1IR1A 2QC3A 1LKZA 2V8VA 4KFBB 3Q8VA 4LT6A 3DLEB 3QT7A 4BWJA 5LJ3Y 1U49A 4FYYB 3VVUA 5LMUJ 2IC3A 3CULA 2BRLA 1WF0A 3CTRA 2AW0A 4DPYA 3OUYA 3PYFA 2H4YB 3C8YA 1RACB 1LK5A 3ITHB 5KFBA 1T0TV 2FVPA 3Q2TC 4F04B 1ZM4A 2ZKTA 1VQ8S 2F4VF 3BJYA 2VZ9A 1SUQA 2VL1A 5HI7A 2CQ3A 4IG0A 1FVSA 1F5BA 4DV6J 3PO5A 3IRXB 1S1UA 2JDJA 1YX2A 5FLXY 2CJQA 1P9QC 4MMOA 1LWCA 2XS7A 1EB0A 4ILLA 1PKUA 3GB0A 1S1XB 2XY7A 2I6WA 3MDFA 2VG5B 3AT1B 3SCLE 3UW1A 2OAUA 4UOHA 2MGZB 3KK3B 3SV4A 2BOAA 1OY9A 2EG2A 3DOLB 3WZ0A 4OYZA 4WP3A 4ANDA 1WSVA 4DDFA 5GAEI 2YKMB 1RAAB 2FLLA 2MB0B 4GKJF 3M2VA 2UUWA 3ENWA 4AL6A 3UCUP 2MKIA 1NJZA 1MG7A 1Z2LA 3JSYA 1WI6A 2W4PA 1WOOA 1UVJA 2QSWA 2AGPA 2EBEA 4F36A 3KDNA 1VK8A 2H51B 4NYOA 1XNRF 3OVSA 1UVLA 2CZ4A 1GMVA 2ALYB 3EE3A 3NGRA 1YBUA 3OFFA 2Z0GA 5KFKA 3LWLA 3A8EA 1IBMJ 1FERA 1SC1B 3CE8A 4DV5J 2IJRA 4YMEA 1S6PB 2VDIA 4Y34A 3DXSX 2G1DA 4ZVTB 2EK1A 1OSDA 2HHXA 2CAJA 2ZBIA 4IH5A 3HD2A 2AX1A 3TRGA 3C16A 3SYZA 3ETMA 4OI2A 3SFUA 3BSCA 2NUUG 2HG4A 2KVIA 4DR4F 5LSRA 2M4MA 4R5PA 4DUZF 3JTOA 3NXZA 1S7IA 2ABYA 3ZFVA 1QSYA 3MOJB 1UFWA 4URSA 4R0EA 1FKPA 1CULB 2CQHA 3CGIA 4UUXA 2BUNA 3POTB 2VKRA 1HR0J 2VFVA 4KR0B 1ZBTA 2RQMA 1TVRA 2HIYA 1YITS 4FPIA 3MD1A 5HMXA 2HZCA 5EX0A 5DRKA 3OBIA 2ZOMA 3UR3C 4ZCIA 1JK9B 2WBRA 5CD4H 5L1IA 2E1CA 4IKAA 2KH9A 3HJFA 2BJDA 1EX8A 2FGCA 3AFGA 3MMBA 1VBXA 3MOZA 2JX2A 2Q6BA 1RT1B 4PG6A 3H98A 4IH7A 5ETPA 3T6BA 3HCXA 1YRTA 2W9BA 1TUWA 4IRDA 4LREA 2UXCF 3R5BA 1HD0A 3SFGA 3UI3A 1TP7A 2DXFA 5B0BA 3ZTQA 3PW7A 3Q0AA 1L5UA 1H3DA 1VRUB 4KHMA 2C2OB 4ZA1A 5HJYA 3GR0A 4KHPJ 2YX4A 4IFVA 3I31A 3V81A 2BJ3A 3TAMB 2CRLA 5J1PA 1FJGF 3BB5A 1DFDA 1FRIA 4U67Q 4KV8B 3S8SA 3IR7B 3MD3A 3UDCA 1JLFA 4C97A 1FF2A 3H4DA 2E9ZA 4LR8A 4Y2AA 4X66J 3KLIA 5J2MB 2MJUA 1SIZA 2FB0A 4M5IA 1NNDA 1N54B 2B4VA 3EGNA 4KHRA 3R2DJ 2B0GA 1E6YA 4RU9A 3OD2A 1SKSA 3QLHB 3HDSA 3LPEA 2AJQA 4L76A 3GSDA 3NAHA 3Q8PB 1KC8T 5E3AA 4URQU 2HAFA 1FESA 2QLJB 1RAIB 3CO0P 3FC9A 1MMLA 1CQMA 3CJKB 3WBZA 4TKTA 4WJBA 4B08A 4Q2MA 4UW2A 3CC7S 3PZPA 4X4RA 1HHTP 2BANA 2LQBA 4DR1F 3DRXA 3N28A 1HWIA 1KVIA 3W5ZA 2KHDA 3QT6A 3ZZYA 2Y8YA 2YBVA 2EK6A 4NLSA 2HZVA 3RR7A 3MEEB 3QZ7A 1YBTA 4IFVB 4GO7X 5A8KA 4P2FA 1BLUA 2PIIA 4ZITA 3RB0A 2NQPA 1CJKB 2XHCA 2IVFB 3SCKE 4B17A 1NK5A 4H4OA 3I55S 2E7VA 2NSCA 1EARA 4AT1B 4X64F 1TL5A 2B8QA 3ILIA 1VQYA 4LUBA 4QIVA 3HFZB 3RGIA 2XM3A 1YJ9S 1N33F 2WAQD 3K89A 2GIFA 2J7KA 2PGCA 2VPZB 3NRBA 3MURP 2FJVA 2QO3A 8ATCB 4EYHB 3GIRA 3FZ2A 1PGZA 4DPUA 1FWLA 2FHKA 5CABA 4TQRA 3WC2A 5KFEA 1R6VA 2EKNA 2IM2A 2HURA 2MQNA 2A2DA 1CJTA 3WX8A 2ZH8A 3GFXA 3MTKA 1FK9A 2L41A 1VC6A 2OTJS 1LWEB 1BQXA 1XN9A 1ZTTA 4PRFA 2YWHA 3TQ1A 4QZVB 3D66A 4H4MA 2NZ4A 2AGQA 1KTVA 4DG1B 3RW6A 2H5EA 2IRYA 2AYEA 3G87A 4KRWA 3J7ZT 4WF9Q 1X4FA 3H90A 5KG7A 2N7CA 3NGUA 2B9XA 4M5DB 4B9MA 2BANB 1EIYB 2V2VA 1DTQB 3EUNA 4IOBA 3KK2A 2OLWA 5KG0A 4FN5A 3VAJA 1HQEB 2GQ2A 1UL3A 4Z37A 5A8KB 5FIIA 1VQ6S 4Q0BA 4O3PA 2VF3A 4DPTA 4X4PA 4TU8A 1DZ5A 2HHPA 2DHHA 2ZOGA 3D5MA 4ZLLA 1C1BB 1RDRA 2BQUA 2GV1A 4LF4F 3KJNB 2HBYB 4J5OA 5GAEU 1EZZB 3PKYA 2B4PA 1H72C 3H2UB 2UV8G 2C2KB 1DQAA 3IBFB 2R7OA 3NOGA 4JP8A 3D3CJ 5D0GA 3UD5A 1PJ7A 2BMBA 2RHSB 1Q86T 5FJ4A 4IG0B 3BYRA 4C8KA 2BKOA 2HFVA 3H42A 1RK8A 2M9KA 2WBMA 2ZWPA 3BGFA 3I82A 1Z4UA 4HACB 3RJMB 3SXLA 3TX8A 2CPIA 4KKOB 4PCQA 5A0YB 1S79A 2OPPB 2CZ9A 2ACMA 3H0PA 5GAHI 4G6VB 4RW7B 2YKOA 1KEKA 5DDRC 2MKHA 1DJ0A 4DZDA 3I56S 2KU7A 2QLFB 1S0OA 2MY7A 5J2QA 4DQPA 1RT3A 3KHRA 5H9FK 3A4TA 4CYUA 1SJ3P 3O3LA 4XO0A 1YJTA 3X3UA 4DCPB 1RBOB 5D15A 1G6BA 1RU1A 4DV1J 2BOPA 3BDPA 2F7VA 4F8RA 4TYBA 1Y3JA 4MAKA 1R0AB 1U45A 2VG6A 2IDEA 2XMUA 1BGXT 2D7SA 3H4BA 4LF6F 2C2DA 3KTQA 3FCWA 1XC9A 1YZ6A 2HS3A 1TAUA 2HLTA 3LO3A 2OFHX 1O8BA 4F0HA 2EI5A 2D3OR 4JI2J 2CPFA 3GJSB 4LBIA 1Z2ZA 4CLKA 1RAFB 2XQCA 3P5BP 3OJUA 2JEIA 1TZ0A 3LP0B 2XLIA 2GVZB 3MUVP 2C3YA 1SC6A 1RTDA 2XNRA 1VJQA 1VCTA 1AUSL 3E01B 1VFJA 3ENQA 4QU7A 2OSQA 4GC6A 3UCZP 2I0XA 3PVXA 3K58A 4PUOB 3UPFA 5GMDA 1Y5NB 3TUZC 2QRRA 2VHGA 1NLKL 5HP1B 4PQUA 5F0WA 3C15A 3NOCA 1F5CA 3N5FA 1X5TA 2OD4A 5A0YA 3QT5A 2KT2A 2RRAA 1FDDA 2OPPA 4WU3A 4HH1A 3ZZ0A 4YY3F 4H4OB 3NP5A 1CULA 3Q8RB 2VQEF 4OZLA 4DR2F 2M8HA 2P9CA 4RW6B 4DL4A 2DISA 2QA2A 2PEHA 3NBPA 1S0NA 3KNAA 1JQGA 2I5JB 2KO1A 2ZD1A 4FDFA 4N47A 1HBNA 1SQEA 2O3DA 2EXUA 3DYAA 1LXJA 1PILA 2MQ8A 4LRCA 2RE1A 3F44A 4BCAA 2KG1A 4ELVA 2BRKA 4GKKJ 4EMDA 3PX0A 5BJRA 4JI7F 5IM0B 4QOTA 3DLHA 4XDCA 1XR7A 4PR6A 2DNLA 1Y10A 2ZNZA 2VASA 1R7IA 3N6NA 4PYAA 4P52A 1LWFB 1ZAXA 2X3GA 2KVQE 3ENAA 2CIMA 4ELTA 5LL6d 1FRKA 3CIZA 4QQBA 4LQ3A 1E6VA 5JJBA 3N79A 3T5HA 3OXGA 4A46A 3AD7C 3ONQA 1V9OA 2KYZA 3V2UC 2F8EX 2N7YA 3MM9B 2BJEA 3EZ5A 2B4OA 3HHLC 1HQEA 2FHOB 5J2PA 1JX4A 5DDQC 4AL5A 2Q79A 1RWXB 2JFKA 4DFKA 4LSNA 4E0DA 4MIBA 4NXNJ 4J9VA 1B4SA 1T05B 2OKQA 5ETQA 4MKYA 5HQ8A 5LXRA 3TEGA 5KFPA 1NJXA 1SIWB 1OPZA 2FC8A 4DV4F 2V9WA 3CMES 5FDLA 2MKKA 4MK9A 4UZBA 1G1XA 2Y0SD 4CO1A 1SL0A 4OI3A 5C7PA 1F3FA 1B0TA 5A8WB 5DDPC 4ECYA 5KFTA 3PO4A 2HHTA 4IG3A 1VQNS 2CFXA 4F4XA 2DHGA 1FX4A 1TFWA 3Q8QB 4ED7A 1WG4A 2YWEA 2CNOB 2RNEA 2J9CA 3QZ8A 5L9NA 1UMJA 1IQZA 1NB7A 2ZH5A 2YKAA 4O3NA 3W63A 4F4YA 3TUPA 3WHIA 3EVMA 5I3UA 4MK8A 1NDCA 2QLBB 1CQNA 4FVMA 2ZH2A 1S1VB 3NGDA 1SI9A 1VHIA 3OTCA 4X62F 4XPCA 2FZCB 2ZM6J 1VOMA 3GG1A 1S9EA 3W2WB 2ERRA 4F3OA 1QD1A 1ZM3A 2UZAA 5D6GA 2EFGA 4RW9B 3D6TB 3GYGA 5F41A 2KYXA 4A8MP 1YJUA 1LNQA 4JI1J 2Q3PA 3K5LA 2GVDB 1RT7A 2DR9A 3DKDA 2AZ3A 1SBRA 3VVTA 1REVB 1RHRB 5A8RA 4IDKA 2HRUA 2J7WA 1NU4A 4NZ6A 3W62A 4U95A 3DM2B 4LIRA 4F4WA 1CJVB 1HBOA 2XMTA 1WC3A 3THPA 3FBBA 3IGNA 3D1HA 4QIEA 1WJ9A 2W24A 2JH3A 2OMLA 3M8ZA 5LM7E 2G1HA 2YQ0A 2HK3A 2V2KA 2RILA 4WCEQ 1ZA2B 2HQ3A 1K73T 2D41A 3MCSA 2HQGA 4XIUA 4DV7J 1X4CA 2ZWOA 4KAIA 2UUBF 1WHXA 1KLMB 1VQOS 3BV8A 3AHPA 2B51A 3ZTPA 3N6LA 4P9SA 4PXEA 4EO8A 2P9GA 4C8YA 1JKHB 3D67A 2PD1A 1D9AA 1IM4A 3FFIB 1UFKA 4ZVFA 3LANA 4ALZA 4DI6A 4RO0A 9ATCB 5DG8A 2PEBA 3NAIA 1N36J 4PPZA 3JXOA 3QAEA 1SKWA 3N4WA 5C24B 1S9GB 3E3XA 4AXIA 1KTQA 3M8RA 5SUHA 1MU2B 3DLJA 1TK8A 4MYTA 4LFAJ 1FEHA 3KXDA 2R7UA 2C2NA 4XPEA 3MM6B 2XMVA 2E7WA 2G0JA 5F3TA 1UJ6A 1XMQJ 2IYIA 4MTPA 2V0NA 1FKOB 2OFGX 2QA1A 3PJXA 4CO4A 4WXWA 1R8AA 4GRSA 1ULRA 2MKSA 1RXOB 3PW5A 1LV5A 3TJAA 4ILMA 1I51B 3IA0A 5K8PA 2KXHA 2FUG9 2GMLA 2E5JA 3VF0B 4LVNP 4WZQA 2CPXA 3IGVA 1Y00A 2J5AA 2RHQB 3MCOA 2HSEB 3GYNA 4AFFA 4RBTA 3M8QA 4DSFA 4R8UA 3AB4B 4L72B 2Z8QA 3MUTP 2BDPA 4HVZA 2VU5A 3QYYA 4CM0A 2R8KA 1ZAVA 1RADB 2CQ2A 2DGQA 3G82A 3QWPA 3A1YG 3FCVA 4FVCA 2R8IA 3HVTA 1TK0A 2DNGA 1B64A 2A6MA 2MLYA 3QGHA 1U8SA 2LLZA 3AD9C 3PRBA 3M6XA 4M1KA 2GMJA 3HZGA 1KQKA 4RBVA 4LF8J 2OPSA 1AFJA 1PAEX 2JOQA 2MHEA 3P96A 3QQCD 2P6SA 3AOBA 3I0SB 4ZPDA 3VHQA 1FT8A 2RKIA 3THTA 3UE2A 4X64J 4DMZA 2RJZA 4I56A 1NKCA 5AXMA 2R8HA 2OPQB 2JLGA 1X31C 2DK2A 4NLGA 4O3SA 3EDRB 1RB0A 3IXQA 3PEJA 3KJVA 4OZ1A 2E44A 1H2UX 2D69A 3SSSA 4U7UK 4QBUA 2DNOA 4LRAA 2FLNA 3UQSA 1RABB 3KK3A 1FRMA 3C15B 1RHKB 4TY8A 3SMZA 3OV7A 3TZZA 1PC5A 2B9WA 3C6UA 3R7BB 2MZSA 3V6HA 4ERDA 2EPIA 2ZH7A 3GSIA 4XTTA 2V8GA 4LFBJ 3ILLA 4NASA 4RW9A 3VCDA 2YNIA 3G8QA 3MPUB 1WG1A 3SSRA 3G8SA 2R7VA 5GMKa 2NYIA 4WFYA 1Y7PA 2AJ0A 2ZBCA 1KFDA 3N9UC 1TKXA 2GW8A 3O6QA 3W1YC 4R8UB 4V19X 1CS4A 3A13A 5M2PA 4A8SA 2W2PP 3R5AA 1FA0A 1TQLA 2IAJA 3C14B 1Q8BA 2E1AA 1WC5A 4Y2CA 3EZUA 2MQMA 3UVJB 5LXYA 2VBYA 1VLOA 3K5MA 3VAMA 4LF1A 1UJ4A 1XR5A 4LVOP 5DZ7A 1OO0B 3TVYA 5L46A 1V5IB 5GMEA 2XGPA 3DRPA 2CPYA 1BE4A 1NUEA 1RA6A 1P9YA 4M5JA 1RI7A 2HHUA 1Y5IB 2L9WA 4DUYJ 4A8QA 3OVBA 5BR8J 2GIRA 2FZGB 4U7UD 3PX4A 1U4BA 1GAOA 3GTYX 3HHDA 4BC9A 4FNIA 2EFNA 2GZOA 2W8KA 2WSFC 2Z2ZA 1UPPA 2G9OA 4GVBB 4CP5A 4D3HA 5H1SV 5L1KA 2DNPA 2MMYA 3DU5A 4WZMA 3POTA 5U47A 1K9MT 4ZPWR 2OHDA 1UAWA 3ZTSA 3H5UA 4G65A 1NH7A 1VRTA 2Z2YB 3LUYA 2QA4G 2JEFA 3IS9B 4OYWA 3PRVA 4NLVA 4M95A 3IBCB 4KIAA 2C3MA 3VV2B 4QYZJ 1UWBA 2HFSA 4DR3F 2FVQA 4PWUA 5IC6B 4C0BA 5B09A 3R9LA 2FVRA 2XMWA 2ROGA 1U09A 2VG7A 3NCPA 4DV1F 2XSJB 1HYSA 4DLEA 4FF4A 3G71S 3QSIA 2MZRA 3MF5A 2WONA 2HFOA 2YWKA 5CYMA 1FE4A 1HWJA 3EWGA 3MCMA 4UOCA 4NLQA 3EPIA 2JRSA 2LEPA 1V3RA 2YKNB 1B70B 2DHXA 4FXWA 3NLCA 7FD1A 5IV4A 2HGNA 3CCRS 1SXLA 1NK7A 2KFYA 1ZM2A 3QWUA 2XWYA 3I5BA 2NLWA 1S10A 1B7FA 4ECTA 4FYXB 1N34F 1SJFA 1YSJA 3G82B 4QIGA 1ICEB 4K2JA 1MN9A 1FTCA 5K5MA 4JV5F 3GILA 3OXLA 1RHJB 3HM9A 4IUFA 2LXFA 4DX8H 1RTJB 4F25A 3DOLA 1U2RA 1TKTA 4HTJA 1BHNA 1E6YB 3C6TA 3DLGA 2QLXA 3Q2SC 4LR7A 1R8HA 1X4EA 1XERA 2LQ8A 2OPSB 4EGLA 3OSPA 3H20A 1C0TA 3D0GE 2R2RA 1D9DA 2V94A 3D28A 3BREA 1NM2A 2BV3A 2CJYB 4PG4A 3QJLA 2MQLA 1D3WA 4QR0A 2GJIA 4Q5VA 5KFNA 2JHEA 3KLGA 1U1RA 3JTNA 3GIJA 4DF8A 3DNCA 1JLEB 1VIXA 2XTJP 3OL8A 2CQCA 5T14A 2VOPA 6FD1A 2KJVA 4O44A 1DARA 1X5PA 5JXSA 1Z1ZA 2QX0A 4Q8EA 3C66A 3VQTA 4ZVOB 5KFRA 4J9QA 4NPOA 4DCOB 3P49B 2W4DA 2A2CA 3V4MA 4DV3F 1T3NA 5L1JA 5CAAA 4C98A 5B0GA 2WZ1A 4Y28C 7FDRA 2C2MB 4ES3A 1VQPS 1N5YA 1FKAF 4XAKA 3OUYB 2RVJA 1VQMS 2ZC4A 2A1BA 4N77A 1OPIA 1K0TA 3CO9A 3D9BA 3QSYB 3HT3A 2QA4S 4I68A 2Y3YA 2GHVC 1GXUA 1TR0A 5C42B 5IWAF 2VJVA 3GQCA 2JEJA 3HULA 2UU9F 2MQQA 1QSLA 4IOAQ 4P2SA 2AYBA 1TKTB 4B3TF 2CXEA 2YY3A 4I6AA 1NK6A 1PBUA 3AH6A 2MKJA 1FD2A 1RZMA 3M7VA 5CZXA 1RWMB 4QWCA 3V4IA 4G3IA 2L9NA 2BYCA 2OSRA 3EJMA 1UZHA 2FY8A 4M5GA 5BYRA 3MMCA 3W9JA 1SJRA 3DHXA 2YX7A 1RU2A 3GYXB 3M8PB 4P6QA 5I3PA 4CTAB 5LJ5Y 1WNEA 3HHNB 4WKYA 2VA2A 4EEYA 2BZ2A 2K3IA 1NZAA 1QM9A 4QPXA 2A18A 1TL7B 1AROP 1NHUA 1CEZA 5HROB 2LQJA 3HX9A 1NJYA 1KSPA 2Q66A 2BKPA 3BKUA 1G7CB 1GFWB 3DOMA 3LALA 3VQSA 2C2EA 4KC5A 4X65F 3PX6A 1PBAA 4BC7A 5C2CA 2PN6A 2XS2A 4OLOA 3FMBA 4ECZA 2FJAB 1KQFB 3SCIE 1JWWA 1NAQA 4A47A 4C48A 4C3KA 1RTIB 2B6AA 2FJEB 3GFYA 5ETKA 4EFAC 5HQLA 1GX5A 3KLIB 1Q95G 5DLFA 2JJ4D 4UY85 1FRHA 2UXBJ 2C2ZB 2QL9B 3Q83A 4KYZA 3R1HA 4O3RA 3MEDA 4N8NA 1U6FA 2DNQA 1NSQA 3BBFA 3OQ2A 5J2NA 2G0IA 3PIPQ 1N52B 2B43A 1U6ZA 2DNKA 5CD4A 4I2PB 4YQWA 4NXNF 5HJXA 1FJGJ 3QRRA 1S6QA 3OR2B 3SQGB 2J6TA 1TMJA 3CB4A 3KKFA 2ZJPQ 4RUAA 2VH7A 5F8LA 3OVAA 3ULHA 4DUYF 4QR2A 3O44A 2VDHA 1N5QA 1H98A 2VBZA 2RIJA 2BBEA 2UV8A 3R8YA 3J81j 1S59A 2WOMA 3MMBB 2IBOA 4IO1A 1CC8A 1VQSA 4DJBA 2CQPA 3HT0A 5DGBA 2W1BA 3HP6A 4F7VA 2U2FA 1N5SA 5F8GA 2AF6A 1J5EF 2BVZA 1UKUA 2G4BA 5KTQA 2RU9A 5M2UA 2RU3A 4RNFA 5E3QA 4NI2B 3UFCX 3OL6A 5GAGU 4LBHA 3D6HB 2VKZG 4NLUA 2L08A 3FMWA 3MXHP 3CIMA 2RAQA 2ZOFA 4DQQA 3FNNA 4Y2KA 1RHQB 5IWAJ 1IM6A 2ZC3A 5EUHA 4CH0S 1FK9B 3MTJA 5LSLA 3E01A 3D6MB 3ILJA 4HLBA 7AT1B 5KG2A 1F0XA 3KLGB 4Q7AA 5AT1B 3MR2A 1P6TA 1NK8A 1BWEA 2AX0A 2QYGA 4LSLA 1XNQF 4OX8A 2CG4A 5EX3A 2H5JB 5DJBA 4CI0B 4FYDA 1JLAA 1WELA 2CG8A 1LW0A 2DRDA 1BXNA 3D0HE 3HMJG 2V5HG 1HBUA 4PG7A 5EDWA 2HNZB 1D8ZA 2N4CA 3TO8A 4YY3J 1I6JA 4B3MF 3TEHB 4FBTA 1X8DA 1WOSA 2W2QP 5EGYA 1QVFR 4JYAF 4I2PA 2EFOA 1N0UA 3SIPB 3T19A 2VONA 2KJWA 4PWDB 4LF5J 1WHWA 1FE0A 3AJDA 4DX6A 2I5JA 2DO0A 3PR4A 4FPRA 3MECA 4U8YA 1VYAA 4F4KA 2XB2D 3BSNA 2DXDA 3KLFA 1FRLA 1R27B 2VUGA 3TOQA 1HMVB 4O23A 1KQGB 3BM7A 2XZWA 4WPAA 3IRWP 2DR7A 3KHLA 5IM0A 2EVZA 2F8MA 1K44A 1TL3A 4ZVSB 5C2GA 3DGVA 2R2UA 1SCJB 2A0FB 1WEYA 3KFWX 4TN2A 3UDVA 1TL4A 4CZCA 5LOQA 4YR2A 3KJVB 2R7WA 1J5OA 2UXDJ 4NCBA 3PW0A 4IYQA 2H3EB 3SZ2A 1HNVB 1RWUA 4K8RA 3D54A 2BABA 4MIWA 2ILYA 2QJ3A 2BKNA 2OPRB 1RTHA 4JYAJ 3BBBA 1FHTA 5I4MA 3HHKA 2HQFA 3GJQB 2E1MC 1HWKA 3G6YA 2DT9A 4FS1A 3H59A 4KB7A 1F3VA 3Q86A 3S1TA 4CRJA 3LP1B 4JI2F 4ECVA 1FNXH 5SZTA 2HFZA 2V69A 2DPIA 4RW4A 1FKPB 4Y6IA 1P8GA 1X60A 4S0MA 3RBXA 2RDDA 2KXNB 3MCNA 2UUAJ 1NHVA 2M52A 5B7WA 5J2QB 5LMNJ 1X5SA 2CNNB 4NLWA 2I2YA 2XCPA 4H4KA 3CDUA 4OFZA 1Q81T 1CJUB 4DG1A 2YNHB 1YIJS 5L8RC 3M9MB 2CPHA 4ZIWA 4LSZB 2J76E 4WTYA 2CWKA 1WF2A 1ITPA 4WBFA 1RT1A 2Q43A 3TQEA 1UWAA 1RCOB 4CLWA 3VAHA 1GNKA 2VODA 3FCHA 5KT4A 2AYMA 3DGPB 1U1QA 3QRPA 2H65B 3M6UA 4ZP9A 1FJCA 4ID8A 5HP1A 3M2UB 2RSQA 3MM8B 2OD6A 5DQIA 3R7SB 3KHGA 3MM7B 1M0SA 1KDNA 1KBRA 5E2QA 1VRTB 3RRKA 4QWEA 1JIHA 4ZP7A 3GCXP 2PT0A 1UEUA 1NRKA 1R3NA 2X1BA 2Z2MA 1NMEB 3E51A 3W8GA 5AE3A 3PR5B 5B0FA 5HK4A 2V4QA 2DEJA 4ETZA 3OLBA 1EP4B 1FRJA 2FHMA 2LECA 4LRBA 3SDEB 2VBXA 4LF7F 3HVAA 3RAMA 3QJPA 3PRDA 4ZVUB 2L3MA 2KT5A 1M5HA 1FRXA 5EWGA 2A10A 4OYAA 4ZDNA 2HNYA 2LQ5A 2ZD1B 4DLGA 1PYOB 4ZCLA 4NMLA 5KFWA 3Q22A 2DNZA 4Y65A 6AT1B 3FRZA 3PDNA 4LSLB 2F1FA 2RRNA 2AP6A 1S6UA 4O4GA 5E7OB 2CQ4A 2XO6A 4ED0A 2NXUA 2R42A 1GX6A 1WORA 3VZIA 3TR5A 3M6VA 1PO6A 5KFYA 3OLAA 5KOXA 2ZHAA 2BE9B 2VB6A 2KFZA 1UTAA 4DPWA 4ZOSA 5KG3A 1KD1T 3MMJA 3QMQA 5E3PA 5E5NA 3W61A 3HKZD 3GIKA 3I5AA 4ZPBA 5HROA 2ILZA 3GIIA 2IVMA 1U48A 4WKRA 3M32B 3HI9A 4MFBA 2V6AA 3T1YF 1DBDA 5IQQA 5A76A 5B08A 4KHPF 1VS3A 2GVZA 4HEA9 4LF6J 4RW8B 4P7TA 3L9ZA 4DR5F 1FNMA 2V4JA 3HSJA 3RBZA 2QEXS 1J27A 1VMBA 1JLBA 1SJ4P 1UEKA 3CCZA 3GJTB 4J90A 4TYAA 4WIIA 3TVKA 4E8UA 3M9NB 4IOCQ 2ASLA 4PPDA 4K4WA 4DXLA 1VQKS 1T9TA 3MR7A 3CF5Q 4ECXA 3VGSA 2QT7A 4DR1J 2IDLA 3HHLD 4N41A 1URRA 4Y00A 3ET6B 1T02A 2CJKA 2CVIA 4FKYA 5HAOA 4ZN1A 1EJ7L 4WFBQ 1RYSA 3NMRA 3K2YA 3NS6A 3W7BA 1U6BA 4P7VA 4JI4F 4ED3A 3W64A 2HMIB 2FIUA 2DNMA 3I0RB 1RE1B 2XLJA 4DL0C 3NY0A 2Y1LB 4QPTA 3D0IE 4C0HA 2AWZA 1N8RT 1SVDA 2I38A 1SQFA 3QIPB 6FDRA 4NCGA 1AZSA 3RAXA 4NWBA 5E33A 2NYHA 3W60A 1R8CA 3N0VA 4C8ZA 1T11A 2XWXA 2P9EA 4ED8A 3OL7A 1VC5A 1JMTA 1OJ4A 4YDDB 2CPZA 5BYQA 5C25A 5LT5A 4GKKF 5B0AA 4Y3CA 1IBMF 1VHFA 3CJSA 2DRBA 3EXCX 4ICLB 2PMWA 2F9DA 1BC6A 4BLGA 1VR6A 4F2RA 3G9CA 3T41A 1SB6A 4QYRA 4Q45A 1R31A 3FEXB 4EI2A 2PMHA 5A8RB 2V4RA 1X4DA 3GZ7A 5AJ3J 4MKAA 2XMKA 3P5TL 4OZ3A 5KOWA 3L3CA 2ZM6F 1HW9A 1QSSA 1CJVA 1JNRB 1HBOB 4FF2A 3CJ5A 4USUA 1H6KX 4W4MA 2AYGA 2XYHB 1HA1A 2WVDA 4DL7A 1PAUB 1QE1A 5KFGA 4OYXA 5K20B 2AEJA 1P1TA 2YPZA 3CJRA 3OPKA 3ITHA 3QGGA 4ES1A 1FDBA 1Q8IA 5EWFA 5CXTA 1RT6B 4IG3B 4P75A 2WSEC 2ZJRQ 3JB9k 2ROPA 1HMVA 1UVNA 3SBMA 3UWTA 1IKYB 4NCGB 2BACA 4KTQA 3MUMP 4K4XA 4F4ZA 1D8YA 2J8SA 3MEGB 1HWLA 3U1NA 1O5JA 4X66F 4DL5A 1JLQA 3BO2A 2B4UA 4Q44A 3G6ES 4I2QB 5CYJA 3BEGB 1IBCB 3I6PA 1Q16B 3KK1A 3Q23A 1NXIA 2EG1A 2J0XA 3NGTA 2HGLA 4J9MA 1C0UA 4JV1A 2YVSA 3TZXA 4JI3F 1C1CB 3D68A 4DWIA 3D4JA 3LW5C 4D3GA 5CZVA 2FLOA 3PYGA 1UZDA 2KRRA 1AUDA 2XS5A 1HNIB 3N01A 1RAGB 3PEHA 3OHBA 4KPYA 4CLFA 1H74A 2DNYA 2BE2B 3LP1A 1I5OB 2W7OA 5DQGA 2UXDF 3E2EA 3HFKA 4YFUA 2FJDB 1S6PA 3H40A 2QMUB 4UQTA 1FXLA 3CDAA 3HKWA 2IRXA 2PA3A 3I4PA 3KG0A 1WTBA 2D74B 3TA2A 1NO8A 3TANA 3QLHA 4NRTA 3L09A 3S6EA 2Y1IA 3FK4A 1QDUB 1UEVA 3RB4A 4C0OC 1FDAA 1HPZA 3G6VA 2FLPA 1GK8A 4FF3A 2HFNA 2WHOA 4NRUA 3BN7A 4HI2A 1KQSR 2WONB 2OPQA 2H1YA 3ZTOA 2M0GB 4ZVGA 4QWDA 4DS5A 2AEFA 2YPYA 4NEZA 2R7QA 5AE1A 2ZH9A 1U47A 1V3ZA 2R8JA 4JOUA 4YR3A 4KPCA 1XTZA 2W2NP 3NGKA 1R8PA 4F26A 2LCWA 2HWIA 4HDHA 5HMYA 3MM7A 4RWWA 5T41A 2CPEA 4NLTA 4C7QA 3LGHA 3UNGC 5KFCA 2ZJQQ 3MECB 4CLLA 3H5XA 1VK3A 2Y1JA 2C22A 3HHLB 4EK2A 3BN4A 2DR5A 2NPFA 5KFHA 5HVGA 2R8GA 1TL1A 3OJSA 3C46A 3HSZA 1QUPA 3PACA 4NYZA 2ALZA 1T7PA 3Q24A 2WB4A 4RJVA 3HXMA 2ZZNA 3CJ4A 4Q43A 4Q2LA 4TLQA 4ZPCA 4N76A 3FJ2A 3CUNA 5D3GA 3NNHA 4PYDA 1OIAA 1CSJA 1KRPA 2MPUA 3JSMA 1Q7YT 4AE5A 3RB6A 4K5SA 2AQ4A 5ETRA 2F3JA 1S48A 2W25A 1HI1A 4NCAA 2W9CB 2FJWA 3QPIA 3JQMA 3BO4A 2QTWA 1RJJA 4NLXA 4Y0FA 2FPHX 2AIRB 2ZBPA 1X4AA 3HZEA 2AEMA 3UCGA 2P8IA 1U24A 3DXBA 2GO9A 1UJ5A 4URGA 4RR5A 4JV0A 1MSWD 4OJHA 1I1GA 4RNOA 4B3RJ 5D78A 4B3MJ 2E9TA 2QFIA 2HVDA 2DGWA 2HWTA 3HFVA 3T9NA 1S6QB 5GADI 3T1HF 1LEOA 2JSXA 4ETXA 4RW6A 5GAGI 2X1AA 1PYTA 3IAM9 5CYQB 2PDAA 1IKWB 1YGYA 3M32A 1KHVA 4KGKA 4B3OA 4K5RA 3U02A 3V6DA 4EUVA 4OMFG 2V9KA 3PJ9A 3RAQA 2CJ9A 3DRSA 1T9VA 3NNCA 1S6OA 1NSPA 1HL6A 4I6WA 4Z7CA 2IMWP 4W90B 4DN9A 3W8PA 1H2TZ 4ZLNA
chains in the Genus database with same CATH topology
1OQ6A 3CCWA 1JLQB 1NK4A 2OIHA 4OI6A 4DL6A 4MK7A 3PW2A 1M5KC 5THWA 3CDBA 2NSBA 4B3RF 2FC9A 4GO5X 2VD3A 3NNAA 2D3UA 2CQ1A 3R27A 3C3LA 2ZITA 4CO5A 3I5CA 3MR5A 3HK2A 2XI3A 2D3ZA 4ECUA 2KTQA 4C9DA 2E66A 1S7HA 3MZIA 1KLMA 3M9OB 1QAJA 4C8YA 4K4SA 4ZPVR 2AV5A 4OI0A 3AB2B 3H5YA 4ZP8A 1GH8A 2R7RA 2UUAF 3C6TB 4CO3A 4NA2A 2UXBF 2V8HA 2Q6CA 5GAHU 3CJ3A 4C11A 1QAXA 2GX8A 3EXYA 2P6TA 5LSOA 3AAWB 1KHWA 2HGMA 3QGPA 4ICLA 1IJEB 2XMJA 4ID5A 2JVOA 4TU9A 2ADCA 4F50A 3OTOF 2CJAA 4KE5A 1B0PA 3LP0A 2QFJA 3CVKA 3CCJS 2HLUA 2ZH1A 3J7Z5 4HTIA 4ZVHA 4ZMMA 2ZHBA 4PG8A 2GCFA 4K4TA 3BGLA 4X4UA 2XHWA 4K4VA 4A4JA 4RUHA 1N48A 1YJRA 1FDNA 3N6MA 1HARA 2WOMB 4LJMA 3W2VB 2FHJD 5BYSA 1U2FA 2AJFE 1N32F 3BQ1A 3G86A 5E3RA 2DGSA 5KFAA 1IKVA 5DGAA 4N56A 5C42A 3KWMA 3WX4A 2DNHA 5FD1A 2LA4A 3LQVA 3V5RA 1DTTA 3BR8A 5AE2A 5LMUF 3KNAA 3AQPA 3FEYB 2ZVSA 4J9KA 2K7JA 2YX1A 1LW2A 3K5PA 5KFUA 1XR6A 3VR1A 4FS1A 2ZNYA 4PXBA 4NZ7A 2HHWA 4HT7A 2MSSA 2YNHA 3MM5B 1VQ5S 1S97A 2K7KA 2R4FA 4JI6F 5CCMA 4DOZA 2MZJA 3OHAA 4OZNA 4BS2A 4MYUA 1CLFA 4X2BA 3KG1A 3GV8B 4A8KA 1U26A 2KKHA 1SJ1A 3B8HA 1TKZB 4NX9A 4QW8A 4FP9A 3CCVS 1JKHA 4TLRA 5J1EA 2K3KA 2CQIA 2EFPA 2FY1A 4A8OA 5DM7Q 4DR6F 3WC0A 2YNFA 2JFDA 3E8OA 4RBUA 2K1RB 4HL9A 4EBEA 4WXOA 4USIA 4G1IA 5DS7A 2P5VA 3B4DA 1TKXB 2KXFA 1M1KT 3B78A 1KN6A 3CCMS 1EP4A 3M1VB 4KBIA 4RX6A 1VQ9S 2K8GA 2BA9A 3KLEB 1IKVB 5DO2A 2G0CA 2LU1A 4OX6A 1VRUA 4NOHA 4OX7A 1S1UB 3CXCR 1Q78A 3KNGA 2VFTA 4CQ1A 1IN0A 2HNYB 3PFEA 5ITHA 3JAMY 1LWEA 3TA1A 1RTIA 2B6AB 3MI7X 3TAMA 1LW2B 4QWAA 4A8WA 5K9FA 3OL9A 3MWBA 3U7JA 1N56A 4Q8FA 4WFAQ 1HI8A 1N5TA 1NEEA 1L3UA 3AJ2A 2HPUA 1S9EB 3W2WA 1BQMB 2YTCA 4AL7A 2GNKA 2HQIA 3V6JA 3KK2B 4RW4B 2J9DE 4WU2A 4C3MA 5D4OA 3PKMA 1WG5A 3BDEA 5B0EA 4CO0A 2YKQA 1RAJA 1S1VA 4B02A 2KDOA 3PJWA 2QMWA 4JI1F 2ZDPA 4G1PA 2QV6A 4X4OA 3ZZTA 3H8YA 3MPWA 1Q8LA 1B0VA 3CT9A 3F73A 2KHCA 3MMAB 1RT4B 1U1PA 4DV2F 3M2RB 4YB5A 1L3SA 1T03A 4C3LA 2FGOA 3CDWA 1VQ7S 1JJ4A 1JLBB 3LF0A 2JVRA 2K2PA 4I6YA 1HNXF 1HNWF 1DURA 4DSJA 2HVIA 5J2PB 4CNYA 4QIFA 3VAFA 4IO9Q 2DR8A 3C6UB 3JTPA 5KFLA 4J9LA 4KKOA 2AGOA 1VQ4S 2CZVC 2KZMA 2MSTA 3KLHA 2YKNA 5D4LA 1KS2A 5IZHA 1RT2A 1ZPVA 5F0UA 5DETA 4DFMA 2BR0A 3GV5B 3CD5A 1RT3B 4MJKA 5HBMB 4V19J 3GR1A 4IFYA 2IAJB 5KFMA 1HPZB 3K59A 4K4YA 1W2IA 2UVRA 1U1MA 1A7GE 1RTJA 3ICLA 4R0JA 1WHYA 5J2NB 4K4UA 3K57A 1LK7A 4KO0A 4TXSA 1WACA 3IG1B 2YKPA 4RU2A 2MDAA 1ELOA 1V6HA 5B0DA 2VPYB 1FXRA 1DHMA 1SUQB 2EW9A 2DO4A 4Y2IA 1TL3B 2B3TB 2ZE2B 4F3QA 5F8HA 4AXJA 1UVIA 2Q1LA 3ZZOA 1RA7A 4PQUB 2MZ1A 1VJWA 5I42B 4ECQA 1U1NA 4Q0BB 1C2PA 1H0HB 3FQLA 3KLHB 2NR0A 1RT2B 2QYCA 3OFEA 2C3OA 3UDLA 1J5OB 4CH1A 3U1LA 2W9CA 2CQBA 3CD0A 4X84A 3D2WA 3NL0A 1DLOB 2V4JB 1S9FA 5IS2A 3J7YU 5JUMA 1R8BA 5IT4A 1DQ8A 1HR0F 2W7AA 3B82A 3RZAA 3R1LA 1YBAA 4ZPAA 4DHVA 3M30A 4ZHRB 1MW7A 4ID5B 4YOEA 3BSOA 1ZPWX 1AW0A 1NH8A 2DBBA 5CA5A 2AD9A 2IRUA 4IRCA 2RH3A 4RKUC 4DPOA 3R5CA 1TVRB 3KK1B 1NJWA 3J80Y 2LQ9A 2ZE2A 1M5SA 3NKYA 3RR8A 2LYVA 2D9PA 3I4HX 2E5IA 2BW2A 3M05A 1UVMA 2X1GA 4ED5A 3H2VE 4HHJA 4JBCA 5BR8F 2PA8D 3MEEA 3AY0A 3KHHA 3QO9A 1WHVA 2HHVA 4FXDA 2U1AA 1MMDA 2O67A 2RQ4A 3DFEA 5A6PA 1MROB 4ED6A 3S7RA 2FHJA 2XCAA 1W2BR 3FVYA 2VBWA 2CKWA 1WEZA 3DRPB 2DPJA 1X4HA 2RQCA 2UUCF 4UUWA 2RMLA 4KV8A 3T9ZA 5J1NA 2IFXA 1WTFA 1G3OA 2ZH3A 3J81Y 2H9ZA 4YEAA 2HS0A 3P3DA 3BZQA 2LVWA 4C8NA 5I3UB 1H2VZ 4MKBA 2Z4PA 4DV6F 1HD1A 5I3QA 4OJGA 2N3OA 3ZZZA 5J1EB 1P27B 2PE8A 3TUIC 1JLFB 2CQDA 2M88A 2FJBB 3OFGA 4XDDA 4C2MA 4M5DA 1SL2A 2BQ3A 1DTQA 4X4TA 4KJIA 4YHHF 3KYLA 3DN9A 3RTVA 1C4AA 2JC1A 1U25A 2LA6A 3OTEA 4WFZA 2D1CA 5CCLA 1NK0A 2B9YA 3UD4P 3FRYA 5KFJA 3CCUS 4J37A 4RZRA 1URNA 1BD6A 1GT8A 4IQMA 4K4ZA 4TNOA 2J0QD 4LFCF 3QJJA 1LFWA 4ZK7M 1JLGA 1JXLA 2IYGA 2KRBA 2IM1A 4CIOA 1HNZF 2GIQA 5KFZA 1ZTWA 4QR1A 1F2GA 3RRHA 3LAMA 2WSCC 2IM0A 1W25A 3SEOA 4U7CA 3I87A 3JSBA 3EGZA 1R0AA 2M70A 1RKIA 1S76D 1BY9A 2YNIB 4G1QB 2E7XA 1XMOF 3MR3A 2HNDB 3TAPA 1WF1A 3GE9A 3IBWA 4X4QA 3EX7B 4OX9F 1LWCB 3BSAA 1KOOA 1TV6A 4U6PA 1SV5A 1YG0A 2WK4A 4TQSA 3BQ0A 1SJQA 3T6JA 2PO4A 3LPYA 2JLEA 5L1LA 1FNOA 3QGIA 1TKZA 1QJHA 2VG5A 3OR2A 4NZ0A 3SQGA 5C25B 2W9AA 4C8LA 2C42A 3TP2A 1UVKA 2ROEA 2ZDOA 3BO3A 2R9LA 2MY8A 4NLDA 4GMKA 1RYRA 2RQKA 2CJBA 3HHLA 3D1QA 2IJNA 3NBPB 1TK5A 5KG5A 1VBZA 4LF9F 5MLCV 3MAQA 2ZH4A 3MPVA 4F02A 2CYYA 2NPIA 2VV5A 3CPWR 1X0FA 1HYSB 1T8EA 1REVA 3FZBA 2WW8A 1MROA 4NL5A 1ZZNA 2XI2A 1UWBB 5E0OA 1N6QB 3IWNC 2OO4A 4H4KC 1T94A 3DM2A 3EPGA 2LEAA 3TI0A 4DFJA 4L3NA 2VG7B 3I0SA 3ISND 3M6WA 1L3TA 5F9NA 2HNZA 3LGMA 2FJXA 3BR9A 3PFOA 1GQEA 3MEGA 2DHAA 5L38A 4NLRA 4OHWA 3MM9A 1C1CA 1HBMA 1Y0HA 4A8XA 1LFPA 4RW7A 4ZP6A 1S1TB 4I2QA 1S72S 2FVSA 2E5GA 1H38A 3FFIA 4WK1A 3TW0A 2JL9A 2HVHA 3ISNC 4BWMA 2XG8A 3H2LA 5IFMA 2RS2A 2YQ3A 5CH7B 3DDKA 4NLPA 3MGJA 1S9GA 4F2SA 4QJVA 1R43A 1DLOA 4EO6A 2DH8A 4DL3A 3PW4A 3DLGB 2XY5A 2B5JB 1A6LA 2EKYA 4H54A 5KFDA 4YUDA 3GG0A 3HHEA 4RUCA 3VAKA 4EYIB 5KT7A 1S1WB 2LU2A 5KFOA 5T7LB 1TFYA 1P1LA 5G4DA 3FSYA 3GWCA 5A2QY 2SXLA 4ZS6A 1RTHB 1YI2S 3SCJE 2DRAA 2KFNA 3LP2B 3CJ0A 3R3TA 2C2RA 4KSEB 4YR0A 3GMGA 1K1QA 3ZC4A 2ADBA 3JYTB 3X1LB 3LWMA 3MAHA 2QIFA 4ZCMA 3HVTB 4LFAF 4ZPTR 2HIQA 4OHYA 4DFPA 3W3SA 1K0VA 5K8NA 4KO0B 4JI5F 2HVZA 3MEKA 2R2TA 4I4BA 3UR0A 2G13A 2VFRA 4KT0C 2J9DA 2DH7A 3RB4A 3DHWC 1C1BA 3AA8A 3LGNA 4OJ3A 2RT3A 2ASDA 2GHWA 1YHQS 3J7A1 4FBUA 2R7XA 4L6V3 2WTFA 2IM3A 1G2EA 2APOA 2YWFA 2KT3A 4A48A 3F56A 3J7YI 4KGMA 5DQHA 2XSJA 2B5JA 2IMOA 2QZ8A 2YNGB 4N5SA 2DNRA 1HQUB 4B9SA 4O3OA 4JI0F 1APSA 1HNIA 2DVIA 3MM8A 3BGRA 3L95X 1HBUB 3NG8A 3OR1B 3I9ZA 5D77A 2ATLA 1JNZB 1LQ9A 4MH8A 4X4SA 2VQFF 1Y9OA 4KFBA 1SH0A 4QWBA 2ZUGA 4I0WA 2I9SA 1J2VA 3W2VA 3I32A 4K50A 3DMJB 4M94A 1HHSA 1S77D 2XNQA 4LSNB 1BQMA 4EWTA 1HWUA 3M4XA 5C24A 4EU0A 3DLEA 2GC8A 2E29A 1QY7A 1X4GA 2N3LA 4HT5A 3K5NA 1IBKF 3GFZA 1X4BA 1L3VA 4B3OB 4WE1A 3OFHA 1X5OA 2WRMA 4O4GB 2DGUA 3DC2A 5K14B 2IJFA 3KOAA 3MEDB 2B7BB 2L48A 1ZH5A 2J9EA 4TY9A 1UW4A 4PXDA 4C4WA 4BBYA 4MIAA 4ECSA 3CDEA 3IFEA 1JJ2R 1Y5LB 2EWHA 1WI8A 1HQUA 2MGZA 1ZOTA 1S99A 2QE5A 5G0RB 2R8KA 2WCXA 2BQRA 4ATNA 4CT9A 2VPWB 1DAXA 1SH2A 3ISZA 3M2VB 3PM9A 5KT3A 3DU6A 5M2RA 4DV5F 2UVUA 2O66A 4RNHA 4DN0A 5DG9A 1PC4A 2XSFA 4AQYF 1VLYA 2HNDA 5DLGA 4OZ5A 3G6XA 3K8WA 2VFUA 1ZM9A 4USJC 4IFYB 2MZQA 3QIDA 1NKEA 3MFHA 3VAGA 1TV6B 3LH2S 3LOUA 4HKQA 4QCLA 1RQ0A 3S01A 5IQ6A 1PSDA 4WE1B 1Q82T 2MYFA 1ROFA 2DCLA 3DLKA 4J9RA 4ECWA 4OZJA 1JLCB 2ASYA 5AJ3F 1LW0B 2JLFA 3TAQA 1O51A 3NWGA 4C8MA 3U27A 4UY8T 2HHSA 2XEXA 1C0UB 2CQ0A 5L39A 1QAYA 4DS4A 3V6DB 3DGPA 2VG6B 4OV1A 1XMQF 5EHHA 1YWXA 4HYKA 5HMWA 2J6UA 1ZETA 5I42A 5KFQA 4I1TA 1S4FA 2XBPA 3L7OA 3TNVA 3RRGA 1GXLA 5DG7A 3RB3A 3KG4A 3BF4A 5EN1A 4B3SF 3O8WA 4LQ9A 4J9SA 1L3KA 1N6QA 2KZZA 1FKOA 1HNVA 3VZHA 1D9FA 3DOKB 2KM8B 5HMZA 1MU2A 4JI8F 1UFLA 1Q79A 3CWJA 5DM6Q 3K7RA 2ZFHA 2O1PA 1MWYA 4OJ1A 1N5VA 3HVRA 4DSIA 2DTJA 2B7CB 2DB1A 2E1RA 2WB1D 1KOHA 1N88A 1YRXA 2OPRA 5KT2A 1S1XA 4RNMA 4DL2A 3CD7A 2OJ3A 4RWXA 3H5SA 4Z2XA 5KFXA 1F60B 4G1QA 2FD2A 1HBNB 3DYAB 1SKRA 3OW2R 5J2MA 1KFSA 4C11B 2EC0A 2J8AA 1CC7A 1IKYA 2XC9A 2MQPA 1TAQA 3GIMA 2GMHA 1ZYQA 1MWZA 3Q8SB 1YVFA 1RT7B 1IJFB 4DEZA 2F9JA 4TU7A 3PY8A 2B56A 4O3QA 5ADZA 4FZVA 2UVVA 2V8DA 4LF5F 4HH0A 5CHCB 3NS5A 5KFFA 3QAUA 3V4IB 5T7LA 2XMMA 4NLOA 3DOKA 1YRUA 3FGVA 3SSQA 4AUKA 3IR6B 3LP2A 5F3ZA 2XS5A 4FNHA 1JJHA 1YQHA 4NXMF 3ETOA 4R5PB 4ZKAA 5DDOC 3I96A 4IR9A 4I69A 2E9RX 5CYMB 3IAS9 2XULA 3I0RA 1X9SA 5KG6A 1T05A 2DGXA 2VC1A 4JUZA 1U1LA 4R25A 5CYQA 4NA1A 1DTTB 2OMOA 3O5TB 2ZHOA 3N5BA 2CPJA 4OHZA 1S0VA 1IQTA 4PXCA 3RU0A 4B9TA 1C0TB 2VC0A 1WWHA 1RISA 5B0CA 2Z2LA 1XWLA 5KT5A 1Y3KA 3RBDA 1UA0A 1VBYA 3O2IA 5D8HB 3FSXA 1H7XA 2NREA 1JLEA 4PG5A 4LFBF 2FVCA 3OTBA 3KLVA 1VGYA 3FDSA 2M2BA 5KFSA 2W7PA 3FQKA 1U1KA 4O44B 4ITSA 1JLCA 4FXVA 3H25A 3OR1A 1XEZA 2QLWA 5F8MA 1RT5B 1VI7A 1AFIA 2LMIA 2DIUA 3B4MA 4ELUA 1KNZA 5H9EJ 5L9XA 4OZ0A 2R7TA 2K1RA 2RDIA 4DV0F 3O1LA 2KG0A 1HI0P 5HBMA 2HWHA 4NA3A 4BHQA 5IT0A 1X9WA 2NS1B 1RGVA 3CD6S 5D3GB 2LXUA 2UUTA 1FO1A 3MHYA 4IDKB 4B9NA 1JXEA 2DHSA 2RS8A 3LAKA 1YTYA 2GGPA 5F8JA 4DSLA 3UD3P 4ILRA 1KONA 4DV7F 1FVQA 1JB0C 2MKCA 3NCRA 1XMBA 1K1SA 2IHR1 2N4DA 2RKIB 5K14A 4DSEA 3HF5A 3HLUA 2VFSA 2FDNA 4CO2A 2F8HA 3JYTA 1Q53A 4DSKA 3MPYA 1KVJA 1GTEA 1KR4A 1YJVA 3JSRA 2O5DA 2J0SD 2DH9A 2L9DA 3M2UA 3DRRB 1NK9A 2LDYA 2PSZA 1VIOA 2F40A 3DI6B 4CH7A 3P6YC 4OHVA 2E5LF 4JV2A 4Y2MA 2HMIA 3IO1A 2YH1A 4K2XA 2GQCA 3NCQA 3DRYA 4I64A 2E5HA 4AYBD 1FEEA 3BGUA 1S0MA 2OH2A 3ZZPA 3KMSA 4ED1A 2IA0A 1M90T 1SL1A 4LIWA 4PUOA 1LXNA 2M5YA 4F67A 1G1XA 3M30B 3BGRB 2I1RA 4B9LA 1OWXA 2JC0A 1UETA 4XK8C 5A6WA 4C8OA 5JVHQ 4IQXA 1XK8A 1U7LA 2KB2A 5A8WA 3T5LA 1X9MA 4FF1A 3C2PA 2HW3A 1Q7LB 4YB7A 4IRKA 3AQOA 1A9NB 4X4NA 3TVZA