3FF0A

Crystal structure of a phenazine biosynthesis-related protein (phzb2) from pseudomonas aeruginosa at 1.90 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
162
structure length
162
Chain Sequence
b'GMLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenazine biosynthesis protein phzB 2
publication title Crystal structure of protein PhzB2 with cystatin-like fold and unknown function in phenazine biosynthesis (NP_250591.1) from PSEUDOMONAS AERUGINOSA at 1.90 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 44
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03284 PHZA_PHZB Phenazine biosynthesis protein A/B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff0A01
1TUHA 1CQSA 3LZAA 2GEXA 3NUVA 4RZMA 4U13A 4OUQA 2I9WA 4XM4A 5CXOA 2INXA 3F40A 3S5CA 4HM2B 1ULIB 3DUKA 2F99A 3EN8A 3KZTA 5STDA 5CF1A 1GS3A 2R4IA 1OF5A 3GZYB 1O7NB 1JN5A 5AEUB 5KP4A 1GYBA 3EN1B 1S5AA 2F98A 4K1VA 4XBTA 3VSYA 1OPYA 5IERA 4GB5A 4CDLA 1Z1SA 5AI1A 3NXJA 1AR0A 1ASKA 1E97A 4R9KA 3RGAA 2GXFA 5DREA 1ZX2A 3OXAA 3GRDA 2STDA 3SEDA 4J9AA 1GY5A 3BLZA 5D83A 3FZWA 1NWWA 4HM1B 5AIIA 1W01A 1QMAA 2RCDA 1Q42A 2HMOB 3MG3A 3NV0A 3HK4A 4N3VA 1W02A 2IMJA 1GY6A 2RFRA 4LEHA 3H3HA 1GY7A 2JQ5A 3MHEA 4L8OA 5D81A 5IENA 1Q40B 4WWUC 3FF2A 3F7SA 4LGQA 1OGZA 4ORLA 2Z76A 4L7KA 3WMDA 4L8PA 2K54A 3RGRA 4WP5A 3B4PA 2GEYA 2Z7AA 2BMQB 3A76A 3CNMA 1K41A 5IEPA 2GBXB 3LYGA 4WYKA 2HMLB 4XBYA 1C7HA 4HZBB 1NU3A 3ER7A 1JKGB 1OF5B 1W00A 2GBWB 4K1UA 4XB5A 1JN5B 2YFJB 1HKXA 3H51A 1OHSA 5JPUA 5CF2A 2XSHB 4HJLB 3KSPA 2HMNB 3VGNA 5AEWB 4I4KA 1W6YA 4IIAA 3EF8A 5IG5A 4STDA 2B1XB 4KVHA 5JPPA 6STDA 1E3VA 5KP3A 5EVHA 1UUWB 2RGQA 1EA2A 3FH1A 1OGXA 3MKIA 3NM2A 3EHCA 4R9LA 3DZLA 3MYTA 5CK6A 3FKAA 3CNXA 3KKGA 3FGYA 4XBXA 3M8CA 1O7HB 1OCVA 3EQQB 3OV4A 3EBTA 4HM8B 1DMNA 3T8UA 3GZRA 1ISKA 5D82A 3F9SA 3B4OA 4HM6B 4HM5B 4OVMA 5IEOA 5IF6A 2BMRB 8CHOA 5BVBA 3OWUA 3G16A 3ROBA 4WYKB 2YFIB 4HVNA 4Q53A 3DM8A 4X2OA 3HX8A 3JUQA 4HM3B 5KP1A 2YFLB 1IDPA 1VZZA 1OHOA 3SOAA 5AIHA 3F8HA 3Q90A 2HMJB 4H3UA 3IPTA 2XRXB 3OWSA 4FCJA 1DMMA 1UUVB 1ZO2A 3NBRA 3OWYA 4HM0B 4HM7B 2OWPA 3EC9A 1JB2A 2CKFB 4R1KA 4HKVB 5IG3A 3CU3A 3GWRA 3BB9A 5AIFA 1O7WB 3EBYA 4HZ9B 5IG4A 1A2KA 3G8ZA 1DMQA 3JUPA 1OUNA 2HMKB 1WQLB 3E99A 5AIGA 2XR8B 3ECFA 3EJVA 4LMIA 2QIYA 3SOYA 1JKGA 1NDOB 3G0KA 3F8XA 3UJMA 2W2CA 3D9RA 3NV0B 3MSOA 3F7XA 1ULJB 3FSDA 4XDVA 3MG1A 5IG0A 4J8TA 3GZBA 1QJGA 3FF0A 1TP6A 3T8NA 1OH0A 3UNLA 3DXOA 4PEJA 3STDA 5FW5A 1E3RA 4FCMA 5DRVA 3JUMA 5HGRA 4XDWA 5G2GA 2UX0A 2QGUA 3F14A 2F86B 1O7MB 3DMCA 1JB4A 3MG2A 4X2HA 3EX9A 3JUNA 3NHXA 2XSOB 1SJWA 3HZPA 2BNGA 3CPOA 5TGNA 5BXQA 2B24B 4MJDA 1EG9B 3B8LA 3KE7A 2PZVA 1STDA 7STDA 3K0ZA 1O7PB 3GZXB 1JB5A 2CHCA 3B7CA 4HM4B 3I0YA 3JUOA 1O7GB 2A15A 1BUQA 5CLKA 2HMMB 1OHPA 1Q40A 2Z77A 3OX9A 3K7CA 3FLJA 1U5OA 2BMOB
chains in the Genus database with same CATH superfamily
2Y73A 1RN4A 2KF3A 1CEWI 1TUHA 3AHWA 1CQSA 3LZAA 2GEXA 3NUVA 4RZMA 2UUGC 1WNHA 2CFGA 4U13A 1G02A 2IUJA 4OUQA 2I9WA 2RBIA 2W6JH 3S27A 1A90A 1UGIA 4XM4A 2OOVC 5CXOA 3X40A 1LQMB 1UCJA 1I2GA 2INXA 3F40A 1B2ZA 2Q07A 3RNTA 3I563 1IVWA 3WDGB 1BSDA 1FGRA 1Q7HA 2CFDA 3S5CA 4HM2B 4EV5A 4EW5A 1YGEA 1AQZA 4KT3B 1ULIB 3DUKA 1TIJA 1YNVX 3HIGA 2F99A 1TTOA 4CJNA 2ZL8A 3EN8A 3KZTA 3PXMA 2E2UA 5STDA 4ZM8A 1UDII 3CME3 2OTL3 2OTJ3 2SARA 5CF1A 2FGTA 1M9GA 1GS3A 2CC3A 1TRQA 3AMOA 2R4IA 1RNBA 1CH0A 2P09A 1OF5A 1RJOA 3GZYB 1LOXA 1NO3A 3DGYA 5M19A 1LVNA 1BRKA 1O7NB 1JN5A 1UUGB 5AEUB 3HOHA 3LOYA 5KP4A 1GYBA 1ZS7A 3EN1B 3CCE3 1S5AA 2F98A 1IU7A 1JV2B 4MMYB 4N6UA 3O8YA 4K1VA 1KWIA 4NPBA 4XBTA 3VSYA 1OPYA 5IERA 4GB5A 4R4KA 4CDLA 1FYSA 1V74A 5G1LA 1MNLA 1Z1SA 1I0VA 3LTCA 3X3ZA 3CCS3 2L1SA 1YHQ3 3BU4A 5BU4A 3U1WA 5AI1A 5ELJA 3NXJA 1AR0A 1NB5I 1ASKA 1E97A 1N9JA 4R9KA 3RGAA 2GXFA 5DREA 4BTWA 1FUSA 1ZX2A 3KSED 3OXAA 4O2HA 5IW9A 1L5GB 4LZIA 1SPUA 3GRDA 1V57A 1M904 1PY3A 1OACA 1YIT3 1YJW3 2STDA 2BIRA 1GOUA 3WOFB 3SEDA 7RNTA 2RNTA 4J9AA 1GY5A 1FUTA 2WGQA 2P0XA 3BLZA 3FZWA 5D83A 1IVXA 1RGAA 1LXEA 2CWVA 1NWWA 3FG3A 4ILFA 4HM1B 1M1XB 2OQEA 5AIIA 1W01A 4N6LA 1QMAA 2RCDA 1YI23 1Q42A 2HMOB 3MG3A 3N54B 1R4YA 1RRHA 1C54A 7GSPA 3NV0A 3HK4A 3CD63 5FGOA 3D5IA 2RSXA 4N3VA 1RDSA 1STFI 1KD14 1TFKA 1I3IA 1W02A 2IMJA 1VQO3 1GY6A 4EBGA 2RFRA 1BRGA 4EXRA 4LEHA 3H3HA 1BSEA 2XGLA 1GY7A 1FA3A 2SBLA 2JQ5A 1BIRA 1BNFA 3MHEA 1IV9A 1FGMA 1GD4A 2J8XB 3AHSA 4L8OA 3EB8A 3L0RA 5D81A 5IENA 1Q40B 2WO0A 3MWZA 1N9EA 4WWUC 3FF2A 2D42A 3F7SA 3Q1CA 1AVLA 1VQM3 1QALA 1NJI4 4LGQA 2UGIA 1EUIC 5LC7A 3WODG 1OGZA 4ORLA 2H0IA 4AKYA 2Z76A 3BNEA 4K61A 3WOEB 2OQEC 2P0MA 1RHLA 3MPHA 2L4VA 2GU1A 9RNTA 4L7KA 1RKYA 1BNGA 3X42A 1GD3A 3N9HA 1JJ22 3WMDA 1AV4A 1RN7A 1BRSA 4NREA 1LQGC 3IJEB 1JBTA 3PS8A 4L8PA 1VQL3 1MGRA 2K54A 1FW7A 4O3VA 2XEPA 2KRTA 4IT7A 3RGRA 4WP5A 2XGNA 4R80A 3B4PA 2LQVA 2CH9A 2GEYA 4QWTA 1BNRA 3Q3FA 1WMNA 2Z7AA 2BMQB 1X1YA 1W7CA 1YGWA 3A76A 3CNMA 1K41A 4CPKA 5IEPA 2GBXB 3LYGA 4WYKA 2HMLB 4XBYA 3CC43 1C7HA 1IK3A 1MWRA 3GSPA 4HZBB 1ROAA 2BT3A 1NU3A 2AAEA 3AMOB 3LT8A 3PYJA 4RNZA 2Y74A 3ER7A 1JKGB 1OF5B 1W00A 2D1WA 1FUWA 2GBWB 4K1UA 4CCVA 1RTUA 2W56A 2XFSA 3D79A 1BNEA 4XB5A 1BVIA 1JN5B 5AYRB 2YFJB 1Q814 1EKMA 2CW9A 5GSPA 2O3OA 2M7OA 3WA2X 3CCM3 1UGHI 1HKXA 1CYVA 1LRAA 5ELUA 3H51A 1OHSA 3SVAA 3LMLA 5LC6A 3CC73 1HYFA 3ALAA 5JPUA 1K734 4BL2A 2HOHA 4FMDA 4G1MB 1GSPA 5CF2A 2XSHB 1YVSA 1DVCA 1FGQA 4HJLB 4IPBA 1FGOA 3KSPA 4O02B 1EEJA 1RMSA 2KXGA 4J5KA 2HMNB 1JZOA 3ZG0A 3D5GA 1W2ZA 3VGNA 5AEWB 1I8VA 1X1WA 4I4KA 1W6YA 4IIAA 2ZDJA 1RGEA 2GSPA 3AGOA 1TRPA 3LTAA 8RNTA 3DH2A 4GSPA 3EF8A 4EYCA 4STDA 5IG5A 1BRHA 1HU9A 1RGHA 2R41A 3S67A 2B1XB 1J2BA 1FGTA 1LOYA 1QAFA 1VQ83 2KF6A 3T0UA 1SIIA 4WFOA 2CX1A 5G1KA 1GOVA 4KVHA 5JPPA 3FG1A 1BNSA 4O8SA 1T3BA 2C10A 6STDA 1E3VA 1FZUA 1MWSA 1VQQA 5KP3A 3SLUA 1BAOA 3UB1A 3G4S3 2O9UX 5EVHA 3ZG5A 1BOXA 3LTBA 1BRNL 4MMZB 1UUWB 3LTDA 1S723 1UI7A 2IY2A 1EA2A 1I70A 2RGQA 1B2XA 3FH1A 1OGXA 1RGKA 3JVCA 3QK9A 2BO9B 3DGOA 3MKIA 3NM2A 2CX0A 3EHCA 2H0GA 2W0QA 4R9LA 2XH9A 1BSAA 3NX0A 4OK0A 4FR9A 3DZLA 2F5MA 1K8A4 1BRJA 3MYTA 2H0HA 5RNTA 3CCJ3 1ZGXA 5CK6A 2CFWA 3KN4A 1NB3I 2YX9A 3FKAA 3CNXA 3KKGA 5JBSA 3CCR3 2PNCA 3FGYA 4XBXA 5BIRA 1UCKA 1IQYA 1DE3A 1RRLA 3M8CA 4J5GA 3URPA 1O7HB 1OCVA 1DETA 3EQQB 4HAAA 3N8BA 3NBBA 1JRQA 2IYJA 3OV4A 2K3DA 1RLSA 3EBTA 4HM8B 1DMNA 1RGCA 3T8UA 5I97A 3GZRA 1ISKA 5D82A 1V58A 3F9SA 4N6MA 2MC8A 1LNHA 1UW1A 2MF7A 3DGLA 1JBSA 3V98A 3B4OA 1VQ63 1BUJA 4FMAA 3X41A 4HM6B 1LOVA 4HM5B 3PGBA 4OVMA 5IEOA 5IF6A 2BMRB 2V1LA 8CHOA 1QVG2 1N5HA 1YJN3 5BVBA 2CWUA 3OWUA 5HOHA 3G16A 3ROBA 3CXC2 3K9MC 4WYKB 1AVKA 3CCQ3 1IT7A 1GMRA 3VF1A 2YFIB 3K5TA 1NNVA 4HVNA 2W9QA 2QEX3 3S29A 3K63A 2GU3A 2BU4A 5EQLA 4Q53A 4BIRA 1JBRA 3DM8A 4X2OA 1IQXA 3HX8A 1GMPA 3IMAB 3JUQA 1R4CA 4HM3B 4KFFA 2W56B 5KP1A 2YFLB 3CCV3 1I3FA 2OOVA 1G0TA 1IDPA 1Y4KA 1VZZA 3D4AA 4N6OB 1OHOA 3SOAA 1B21A 1RN1A 5AIHA 1W6GA 3F8HA 3Q90A 1VQ53 2HMJB 6RNTA 3G6E3 4H3UA 3OW22 2XF3A 1PU4A 3IPTA 1YIJ3 3V92A 3KFQC 1SQWA 3BNCA 3QRDA 1IVVA 3PZWA 4KZ1A 5A0OB 2XRXB 3OWSA 4KFDA 1WMOA 4FCJA 4EV2A 4BU4A 3HIIA 1TJDA 1B27A 1GMQA 1MGWA 1ROVA 1LNIA 3CCU3 2W03A 1QVF2 1RCLA 1DMMA 1UUVB 1RCKA 3SYUA 3DGNA 1ZO2A 3UL6A 2FXTA 3NBRA 2CIUA 1RGLA 3OWYA 3SXXA 5M18A 1VQ43 2C4BA 4HM0B 1IVUA 4FCZA 4HM7B 3WR2A 2LYXA 2XFTA 1X1UA 4BTXA 1KSIA 1I0XA 2OWPA 3EC9A 1AY7A 2OCTA 4HBRA 2F56A 1CYUA 4RNYA 1JB2A 1D6YA 2CKFB 3BIRA 4R1KA 3PCRA 4HKVB 1YVBI 3LT9A 5IG3A 3CC23 4BL3A 3CU3A 3GWRA 3BB9A 3NQYA 5AIFA 5AYSC 1O7WB 3EBYA 4HZ9B 5IG4A 2CFKA 1A2KA 1US1A 3X3YA 2CFLA 1F8NA 3G8ZA 1PFPA 1BNJA 1DMQA 1I2EA 1OUNA 3EE1A 1W5ZA 3JUPA 3NQZA 1BRIA 1UCLA 1WQLB 2HMKB 3X3XA 3Q2PA 3NBJA 2KCDA 1TFOA 3E99A 3KCHA 4KFEA 3SX1A 1I2FA 1MOLA 2XR8B 5AIGA 4JF8A 4LSOA 3HI7A 1U8CB 1G96A 1YJ93 3BNBA 1BSCA 3ECFA 3EJVA 2ML6A 4LMIA 3DY5A 1SARA 2QIYA 3WA3A 2C11A 3SOYA 1JKGA 1NDOB 2FNQA 1D6ZA 3G0KA 4NHFA 1TU5A 3F8XA 3UJMA 1IYYA 1T5YA 4MEIA 2W2CA 1UCIA 1N5PA 4JRFA 2E2TA 3D9RA 2P05A 1VQK3 1N8R4 3NV0B 4I5QA 3MSOA 1VQ93 1RSNA 1QAKA 3F7XA 1ULJB 1B2SA 3FSDA 4H61A 1IT8A 4XDVA 2WOHA 1IQ8A 3MG1A 2F4YA 2KF4A 5IG0A 1MWUA 2IUKA 2KF5A 4J8TA 1T2IA 4TX4A 3GZBA 2IA7A 1K9M4 1QJGA 4HYZA 3FF0A 1TP6A 3T8NA 1Q7Y4 1OH0A 1RGGA 3UNLA 3DXOA 4PEJA 3TDGA 3STDA 5FW5A 1E3RA 4FCMA 2CWTA 4RBNA 5DRVA 2ZA4A 1W6CA 3JUMA 1HZ1A 2KAAA 4RNTA 1KQS2 1K28A 3NM7A 3PCSA 4XDWA 5G2GA 5HGRA 4HOHA 1SIHA 2Z6BA 2WOFA 1BANA 1T2HA 2UX0A 3BNDA 4FMCA 2QGUA 3RDEA 4BTYA 1X1XA 1Q9EA 3FG4A 3CMA3 1B20A 3F14A 2WGOA 3FCSB 1W4NA 3DGMA 2ZHXB 3G713 1B3SA 2F86B 1N8QA 2QA43 5EEOA 1O7MB 3DMCA 1JB4A 2F5WA 1B2UA 4FMBA 1M1K4 3A5EA 2K0MA 1BNIA 3MG2A 4X2HA 1B2MA 3EX9A 3JUNA 3GAXA 3NHXA 3UL5A 2XSOB 1EQKA 4K90B 1JNQA 3CPW2 1SJWA 3KIIA 1LOWA 2P38A 3HZPA 2W9PA 1BSBA 2BNGA 3D3LA 3ZFZA 3CPOA 1BGSA 5TGNA 3U97A 3J7Yd 4GL6A 4AKZA 5BXQA 1RNTA 2B24B 2W04A 4EC6A 6GSPA 1Q864 2BHMA 2E2VA 4N6TA 1IV7A 3AGNA 3LXUX 4MJDA 4N6NB 1EG9B 3B8LA 3KE7A 2PZVA 2CG0A 1RGFA 1WTHA 1STDA 5M1AA 1BU4A 2JDIH 7STDA 3K0ZA 1O7PB 1GOYA 3GZXB 1JB5A 4GHOA 3LH4A 2CHCA 3B7CA 4HM4B 3I0YA 3JUOA 1DVDA 1O7GB 1Q824 2A15A 1WMPA 1A2PA 1VQ73 1VQP3 1BUQA 5CLKA 3WHOA 4WHAA 1JZDA 2ML5A 1PYLA 1A2VA 4DKIA 2HMMB 1A67A 1OHPA 1VQN3 1UI8A 3CCL3 1D6UA 1DYUA 1Q40A 2Z77A 3OX9A 2AADA 3S28A 4AEQA 3K7CA 1KC84 3FLJA 3I553 4LYLB 3V99A 4N6V0 1MWTA 2CG1A 4MMXB 1W2B2 1U5OA 2CK3H 2BMOB
chains in the Genus database with same CATH topology
2Y73A 1CEWI 1TUHA 1CQSA 3LZAA 2GEXA 3NUVA 4RZMA 1WNHA 2CFGA 4U13A 2IUJA 4OUQA 2I9WA 2W6JH 3S27A 1A90A 4XM4A 2OOVC 5CXOA 2INXA 3F40A 2Q07A 3I563 1IVWA 3WDGB 1FGRA 2CFDA 3S5CA 4HM2B 4EV5A 1YGEA 1ULIB 3DUKA 1TIJA 3HIGA 2F99A 2ZL8A 3EN8A 3KZTA 3PXMA 2E2UA 5STDA 4ZM8A 3CME3 2OTJ3 2OTL3 5CF1A 2FGTA 1M9GA 1GS3A 2CC3A 3AMOA 2R4IA 2P09A 1OF5A 1RJOA 3GZYB 1LOXA 1NO3A 1LVNA 1O7NB 1JN5A 5AEUB 3LOYA 5KP4A 1GYBA 3EN1B 3CCE3 1S5AA 2F98A 1IU7A 1JV2B 4MMYB 4N6UA 3O8YA 4K1VA 1KWIA 4XBTA 3VSYA 1OPYA 5IERA 4GB5A 4R4KA 4CDLA 1V74A 1MNLA 1Z1SA 3LTCA 3X3ZA 3CCS3 1YHQ3 3U1WA 5AI1A 5ELJA 3NXJA 1AR0A 1NB5I 1ASKA 1E97A 1N9JA 4R9KA 3RGAA 2GXFA 5DREA 4BTWA 1ZX2A 3KSED 3OXAA 4O2HA 5IW9A 1L5GB 4LZIA 1SPUA 3GRDA 1M904 1OACA 1YIT3 1YJW3 2STDA 3WOFB 3SEDA 4J9AA 1GY5A 2WGQA 2P0XA 3BLZA 3FZWA 5D83A 1IVXA 2CWVA 1LXEA 3FG3A 1NWWA 3X40A 4HM1B 1M1XB 2OQEA 5AIIA 1W01A 4N6LA 1QMAA 2RCDA 1YI23 1Q42A 2HMOB 3MG3A 3N54B 1RRHA 3NV0A 3HK4A 3CD63 5FGOA 2RSXA 4N3VA 1STFI 1KD14 1TFKA 1W02A 2IMJA 1VQO3 1GY6A 4EBGA 2RFRA 4EXRA 4LEHA 3H3HA 2XGLA 1GY7A 1FA3A 2SBLA 2JQ5A 3MHEA 1IV9A 1FGMA 1GD4A 4L8OA 3EB8A 3L0RA 5D81A 5IENA 1Q40B 2WO0A 3MWZA 1N9EA 4WWUC 3FF2A 2D42A 3F7SA 3Q1CA 1AVLA 1VQM3 1QALA 1NJI4 4LGQA 5LC7A 3WODG 1OGZA 4ORLA 4AKYA 2Z76A 3BNEA 4K61A 3WOEB 2OQEC 2P0MA 3MPHA 2L4VA 2GU1A 1RKYA 4L7KA 3X42A 1GD3A 3N9HA 1JJ22 3WMDA 1AV4A 1RN7A 4NREA 3IJEB 1VQL3 3PS8A 4L8PA 2K54A 4O3VA 2XEPA 2KRTA 4IT7A 3RGRA 4WP5A 2XGNA 4R80A 3B4PA 2LQVA 2CH9A 2GEYA 4QWTA 1WMNA 2Z7AA 2BMQB 1W7CA 3A76A 3CNMA 1K41A 5IEPA 2GBXB 3LYGA 4WYKA 2HMLB 4XBYA 3CC43 1C7HA 1IK3A 4HZBB 1ROAA 2BT3A 1NU3A 3PYJA 3AMOB 3LT8A 4RNZA 2Y74A 3ER7A 1JKGB 1OF5B 1W00A 2D1WA 1FUWA 2GBWB 4K1UA 4CCVA 2W56A 2XFSA 4XB5A 1JN5B 5AYRB 2YFJB 1Q814 1EKMA 2CW9A 3CCM3 2O3OA 2M7OA 3WA2X 1HKXA 1CYVA 5ELUA 3H51A 1OHSA 3SVAA 3LMLA 5LC6A 3CC73 3ALAA 5JPUA 1K734 4FMDA 4G1MB 5CF2A 2XSHB 4HJLB 1DVCA 1FGQA 4IPBA 1FGOA 3KSPA 4O02B 2KXGA 2HMNB 1W2ZA 3VGNA 5AEWB 4I4KA 1W6YA 4IIAA 2ZDJA 3LTAA 3EF8A 4EYCA 4STDA 5IG5A 1HU9A 1J2BA 3S67A 2B1XB 1FGTA 1QAFA 1VQ83 3T0UA 1SIIA 4WFOA 4KVHA 5JPPA 3FG1A 4O8SA 2C10A 6STDA 1E3VA 5KP3A 3SLUA 3UB1A 3G4S3 2O9UX 5EVHA 3LTBA 4MMZB 1UUWB 3LTDA 1S723 1UI7A 2RGQA 1EA2A 3FH1A 1OGXA 3JVCA 3QK9A 2BO9B 3DGOA 3MKIA 3NM2A 3EHCA 2W0QA 4R9LA 2XH9A 3NX0A 4OK0A 4FR9A 3DZLA 1K8A4 3MYTA 3CCJ3 5CK6A 2CFWA 3KN4A 1NB3I 2YX9A 3FKAA 3CNXA 3KKGA 5JBSA 3CCR3 2PNCA 3FGYA 4XBXA 1IQYA 1RRLA 3M8CA 1O7HB 1OCVA 3EQQB 3N8BA 3NBBA 1JRQA 3OV4A 3EBTA 4HM8B 1DMNA 3T8UA 5I97A 3GZRA 1ISKA 5D82A 3F9SA 4N6MA 2MC8A 1LNHA 1UW1A 2MF7A 3DGLA 3V98A 3B4OA 1VQ63 4FMAA 3X41A 4HM6B 4HM5B 3PGBA 4OVMA 5IEOA 5IF6A 2BMRB 2V1LA 8CHOA 1QVG2 1N5HA 1YJN3 5BVBA 2CWUA 3OWUA 3G16A 3ROBA 3CXC2 3K9MC 4WYKB 1AVKA 3CCQ3 1IT7A 3VF1A 2YFIB 3K5TA 4HVNA 2W9QA 2QEX3 3S29A 3K63A 2GU3A 5EQLA 4Q53A 3DM8A 4X2OA 1IQXA 3HX8A 3IMAB 3JUQA 4HM3B 1R4CA 4KFFA 5KP1A 2W56B 3CCV3 2YFLB 2OOVA 1IDPA 1Y4KA 1VZZA 4N6OB 1OHOA 3SOAA 5AIHA 1W6GA 3F8HA 3Q90A 1VQ53 2HMJB 3G6E3 4H3UA 3OW22 2XF3A 1PU4A 3IPTA 1YIJ3 3V92A 3KFQC 1SQWA 3BNCA 3QRDA 1IVVA 3PZWA 4KZ1A 5A0OB 2XRXB 3OWSA 4KFDA 1WMOA 4FCJA 4EV2A 3HIIA 1ROVA 3CCU3 1QVF2 2W03A 1DMMA 1UUVB 3DGNA 1ZO2A 3UL6A 2FXTA 3NBRA 2CIUA 3OWYA 3SXXA 1VQ43 4HM0B 1IVUA 4FCZA 4HM7B 2LYXA 2XFTA 4BTXA 1KSIA 2OWPA 3EC9A 4HBRA 2OCTA 1CYUA 4RNYA 1JB2A 1D6YA 2CKFB 4R1KA 3PCRA 4HKVB 1YVBI 3LT9A 5IG3A 3CC23 3CU3A 3GWRA 3BB9A 3NQYA 5AIFA 5AYSC 1O7WB 3EBYA 4HZ9B 5IG4A 2CFKA 1A2KA 1US1A 3X3YA 2CFLA 1F8NA 3G8ZA 1PFPA 1DMQA 3JUPA 1OUNA 3EE1A 1W5ZA 3NQZA 2HMKB 1WQLB 3X3XA 3Q2PA 3NBJA 2KCDA 1TFOA 3E99A 4KFEA 3SX1A 5AIGA 1MOLA 2XR8B 4JF8A 4LSOA 3HI7A 1U8CB 1G96A 1YJ93 3BNBA 3ECFA 3EJVA 4LMIA 2ML6A 3DY5A 2QIYA 3WA3A 2C11A 3SOYA 1JKGA 1NDOB 2FNQA 1D6ZA 3G0KA 4NHFA 1TU5A 3F8XA 3UJMA 1T5YA 4MEIA 2W2CA 1N5PA 4JRFA 2E2TA 3D9RA 2P05A 1VQK3 1N8R4 3NV0B 3MSOA 1VQ93 1QAKA 3F7XA 1ULJB 3FSDA 4H61A 1IT8A 4XDVA 2WOHA 1IQ8A 3MG1A 5IG0A 2IUKA 4J8TA 4TX4A 3GZBA 2IA7A 1K9M4 1QJGA 4HYZA 3FF0A 1TP6A 3T8NA 1Q7Y4 1OH0A 3UNLA 3DXOA 4PEJA 3TDGA 3STDA 5FW5A 1E3RA 4FCMA 2CWTA 4RBNA 5DRVA 1W6CA 3JUMA 1KQS2 1K28A 3NM7A 3PCSA 4XDWA 5G2GA 5HGRA 1SIHA 2Z6BA 2WOFA 2UX0A 3BNDA 4FMCA 2QGUA 3RDEA 4BTYA 3FG4A 3CMA3 3F14A 2WGOA 3FCSB 1W4NA 3DGMA 3G713 2F86B 1N8QA 2QA43 5EEOA 1O7MB 3DMCA 1JB4A 1M1K4 4FMBA 2K0MA 3MG2A 4X2HA 3EX9A 3JUNA 3GAXA 3NHXA 3UL5A 2XSOB 1EQKA 4K90B 1JNQA 3CPW2 1SJWA 3KIIA 2P38A 3HZPA 2W9PA 2BNGA 3D3LA 3CPOA 3U97A 5TGNA 3J7Yd 4GL6A 4AKZA 5BXQA 2B24B 2W04A 4EC6A 1Q864 2BHMA 2E2VA 4N6TA 1IV7A 3LXUX 4MJDA 4N6NB 1EG9B 3B8LA 3KE7A 2PZVA 2CG0A 1WTHA 1STDA 7STDA 2JDIH 3K0ZA 1O7PB 3GZXB 1JB5A 3LH4A 2CHCA 3B7CA 4HM4B 3I0YA 3JUOA 1DVDA 1O7GB 1Q824 2A15A 1WMPA 1VQ73 1VQP3 1BUQA 5CLKA 4WHAA 2ML5A 1A2VA 2HMMB 1A67A 1OHPA 1VQN3 1UI8A 3CCL3 1D6UA 1DYUA 1Q40A 2Z77A 3OX9A 3S28A 4AEQA 1KC84 3K7CA 3FLJA 3I553 3V99A 4N6V0 2CG1A 4MMXB 1W2B2 1U5OA 2CK3H 2BMOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TUH A;  1CQS A;  3LZA A;  2GEX A;  3NUV A;  4RZM A;  4U13 A;  4OUQ A;  2I9W A;  4XM4 A;  5CXO A;  2INX A;  3F40 A;  3S5C A;  4HM2 B;  1ULI B;  3DUK A;  2F99 A;  3EN8 A;  3KZT A;  5STD A;  5CF1 A;  1GS3 A;  2R4I A;  1OF5 A;  3GZY B;  1O7N B;  1JN5 A;  5AEU B;  5KP4 A;  1GYB A;  3EN1 B;  1S5A A;  2F98 A;  4K1V A;  4XBT A;  3VSY A;  1OPY A;  5IER A;  4GB5 A;  4CDL A;  1Z1S A;  5AI1 A;  3NXJ A;  1AR0 A;  1ASK A;  1E97 A;  4R9K A;  3RGA A;  2GXF A;  5DRE A;  1ZX2 A;  3OXA A;  3GRD A;  2STD A;  3SED A;  4J9A A;  1GY5 A;  3BLZ A;  5D83 A;  3FZW A;  1NWW A;  4HM1 B;  5AII A;  1W01 A;  1QMA A;  2RCD A;  1Q42 A;  2HMO B;  3MG3 A;  3NV0 A;  3HK4 A;  4N3V A;  1W02 A;  2IMJ A;  1GY6 A;  2RFR A;  4LEH A;  3H3H A;  1GY7 A;  2JQ5 A;  3MHE A;  4L8O A;  5D81 A;  5IEN A;  1Q40 B;  4WWU C;  3FF2 A;  3F7S A;  4LGQ A;  1OGZ A;  4ORL A;  2Z76 A;  4L7K A;  3WMD A;  4L8P A;  2K54 A;  3RGR A;  4WP5 A;  3B4P A;  2GEY A;  2Z7A A;  2BMQ B;  3A76 A;  3CNM A;  1K41 A;  5IEP A;  2GBX B;  3LYG A;  4WYK A;  2HML B;  4XBY A;  1C7H A;  4HZB B;  1NU3 A;  3ER7 A;  1JKG B;  1OF5 B;  1W00 A;  2GBW B;  4K1U A;  4XB5 A;  1JN5 B;  2YFJ B;  1HKX A;  3H51 A;  1OHS A;  5JPU A;  5CF2 A;  2XSH B;  4HJL B;  3KSP A;  2HMN B;  3VGN A;  5AEW B;  4I4K A;  1W6Y A;  4IIA A;  3EF8 A;  5IG5 A;  4STD A;  2B1X B;  4KVH A;  5JPP A;  6STD A;  1E3V A;  5KP3 A;  5EVH A;  1UUW B;  2RGQ A;  1EA2 A;  3FH1 A;  1OGX A;  3MKI A;  3NM2 A;  3EHC A;  4R9L A;  3DZL A;  3MYT A;  5CK6 A;  3FKA A;  3CNX A;  3KKG A;  3FGY A;  4XBX A;  3M8C A;  1O7H B;  1OCV A;  3EQQ B;  3OV4 A;  3EBT A;  4HM8 B;  1DMN A;  3T8U A;  3GZR A;  1ISK A;  5D82 A;  3F9S A;  3B4O A;  4HM6 B;  4HM5 B;  4OVM A;  5IEO A;  5IF6 A;  2BMR B;  8CHO A;  5BVB A;  3OWU A;  3G16 A;  3ROB A;  4WYK B;  2YFI B;  4HVN A;  4Q53 A;  3DM8 A;  4X2O A;  3HX8 A;  3JUQ A;  4HM3 B;  5KP1 A;  2YFL B;  1IDP A;  1VZZ A;  1OHO A;  3SOA A;  5AIH A;  3F8H A;  3Q90 A;  2HMJ B;  4H3U A;  3IPT A;  2XRX B;  3OWS A;  4FCJ A;  1DMM A;  1UUV B;  1ZO2 A;  3NBR A;  3OWY A;  4HM0 B;  4HM7 B;  2OWP A;  3EC9 A;  1JB2 A;  2CKF B;  4R1K A;  4HKV B;  5IG3 A;  3CU3 A;  3GWR A;  3BB9 A;  5AIF A;  1O7W B;  3EBY A;  4HZ9 B;  5IG4 A;  1A2K A;  3G8Z A;  1DMQ A;  3JUP A;  1OUN A;  2HMK B;  1WQL B;  3E99 A;  5AIG A;  2XR8 B;  3ECF A;  3EJV A;  4LMI A;  2QIY A;  3SOY A;  1JKG A;  1NDO B;  3G0K A;  3F8X A;  3UJM A;  2W2C A;  3D9R A;  3NV0 B;  3MSO A;  3F7X A;  1ULJ B;  3FSD A;  4XDV A;  3MG1 A;  5IG0 A;  4J8T A;  3GZB A;  1QJG A;  3FF0 A;  1TP6 A;  3T8N A;  1OH0 A;  3UNL A;  3DXO A;  4PEJ A;  3STD A;  5FW5 A;  1E3R A;  4FCM A;  5DRV A;  3JUM A;  5HGR A;  4XDW A;  5G2G A;  2UX0 A;  2QGU A;  3F14 A;  2F86 B;  1O7M B;  3DMC A;  1JB4 A;  3MG2 A;  4X2H A;  3EX9 A;  3JUN A;  3NHX A;  2XSO B;  1SJW A;  3HZP A;  2BNG A;  3CPO A;  5TGN A;  5BXQ A;  2B24 B;  4MJD A;  1EG9 B;  3B8L A;  3KE7 A;  2PZV A;  1STD A;  7STD A;  3K0Z A;  1O7P B;  3GZX B;  1JB5 A;  2CHC A;  3B7C A;  4HM4 B;  3I0Y A;  3JUO A;  1O7G B;  2A15 A;  1BUQ A;  5CLK A;  2HMM B;  1OHP A;  1Q40 A;  2Z77 A;  3OX9 A;  3K7C A;  3FLJ A;  1U5O A;  2BMO B; 
#chains in the Genus database with same CATH topology
 2Y73 A;  1RN4 A;  2KF3 A;  1CEW I;  1TUH A;  3AHW A;  1CQS A;  3LZA A;  2GEX A;  3NUV A;  4RZM A;  2UUG C;  1WNH A;  2CFG A;  4U13 A;  1G02 A;  2IUJ A;  4OUQ A;  2I9W A;  2RBI A;  2W6J H;  3S27 A;  1A90 A;  1UGI A;  4XM4 A;  2OOV C;  5CXO A;  3X40 A;  1LQM B;  1UCJ A;  1I2G A;  2INX A;  3F40 A;  1B2Z A;  2Q07 A;  3RNT A;  3I56 3;  1IVW A;  3WDG B;  1BSD A;  1FGR A;  1Q7H A;  2CFD A;  3S5C A;  4HM2 B;  4EV5 A;  4EW5 A;  1YGE A;  1AQZ A;  4KT3 B;  1ULI B;  3DUK A;  1TIJ A;  1YNV X;  3HIG A;  2F99 A;  1TTO A;  4CJN A;  2ZL8 A;  3EN8 A;  3KZT A;  3PXM A;  2E2U A;  5STD A;  4ZM8 A;  1UDI I;  3CME 3;  2OTL 3;  2OTJ 3;  2SAR A;  5CF1 A;  2FGT A;  1M9G A;  1GS3 A;  2CC3 A;  1TRQ A;  3AMO A;  2R4I A;  1RNB A;  1CH0 A;  2P09 A;  1OF5 A;  1RJO A;  3GZY B;  1LOX A;  1NO3 A;  3DGY A;  5M19 A;  1LVN A;  1BRK A;  1O7N B;  1JN5 A;  1UUG B;  5AEU B;  3HOH A;  3LOY A;  5KP4 A;  1GYB A;  1ZS7 A;  3EN1 B;  3CCE 3;  1S5A A;  2F98 A;  1IU7 A;  1JV2 B;  4MMY B;  4N6U A;  3O8Y A;  4K1V A;  1KWI A;  4NPB A;  4XBT A;  3VSY A;  1OPY A;  5IER A;  4GB5 A;  4R4K A;  4CDL A;  1FYS A;  1V74 A;  5G1L A;  1MNL A;  1Z1S A;  1I0V A;  3LTC A;  3X3Z A;  3CCS 3;  2L1S A;  1YHQ 3;  3BU4 A;  5BU4 A;  3U1W A;  5AI1 A;  5ELJ A;  3NXJ A;  1AR0 A;  1NB5 I;  1ASK A;  1E97 A;  1N9J A;  4R9K A;  3RGA A;  2GXF A;  5DRE A;  4BTW A;  1FUS A;  1ZX2 A;  3KSE D;  3OXA A;  4O2H A;  5IW9 A;  1L5G B;  4LZI A;  1SPU A;  3GRD A;  1V57 A;  1M90 4;  1PY3 A;  1OAC A;  1YIT 3;  1YJW 3;  2STD A;  2BIR A;  1GOU A;  3WOF B;  3SED A;  7RNT A;  2RNT A;  4J9A A;  1GY5 A;  1FUT A;  2WGQ A;  2P0X A;  3BLZ A;  3FZW A;  5D83 A;  1IVX A;  1RGA A;  1LXE A;  2CWV A;  1NWW A;  3FG3 A;  4ILF A;  4HM1 B;  1M1X B;  2OQE A;  5AII A;  1W01 A;  4N6L A;  1QMA A;  2RCD A;  1YI2 3;  1Q42 A;  2HMO B;  3MG3 A;  3N54 B;  1R4Y A;  1RRH A;  1C54 A;  7GSP A;  3NV0 A;  3HK4 A;  3CD6 3;  5FGO A;  3D5I A;  2RSX A;  4N3V A;  1RDS A;  1STF I;  1KD1 4;  1TFK A;  1I3I A;  1W02 A;  2IMJ A;  1VQO 3;  1GY6 A;  4EBG A;  2RFR A;  1BRG A;  4EXR A;  4LEH A;  3H3H A;  1BSE A;  2XGL A;  1GY7 A;  1FA3 A;  2SBL A;  2JQ5 A;  1BIR A;  1BNF A;  3MHE A;  1IV9 A;  1FGM A;  1GD4 A;  2J8X B;  3AHS A;  4L8O A;  3EB8 A;  3L0R A;  5D81 A;  5IEN A;  1Q40 B;  2WO0 A;  3MWZ A;  1N9E A;  4WWU C;  3FF2 A;  2D42 A;  3F7S A;  3Q1C A;  1AVL A;  1VQM 3;  1QAL A;  1NJI 4;  4LGQ A;  2UGI A;  1EUI C;  5LC7 A;  3WOD G;  1OGZ A;  4ORL A;  2H0I A;  4AKY A;  2Z76 A;  3BNE A;  4K61 A;  3WOE B;  2OQE C;  2P0M A;  1RHL A;  3MPH A;  2L4V A;  2GU1 A;  9RNT A;  4L7K A;  1RKY A;  1BNG A;  3X42 A;  1GD3 A;  3N9H A;  1JJ2 2;  3WMD A;  1AV4 A;  1RN7 A;  1BRS A;  4NRE A;  1LQG C;  3IJE B;  1JBT A;  3PS8 A;  4L8P A;  1VQL 3;  1MGR A;  2K54 A;  1FW7 A;  4O3V A;  2XEP A;  2KRT A;  4IT7 A;  3RGR A;  4WP5 A;  2XGN A;  4R80 A;  3B4P A;  2LQV A;  2CH9 A;  2GEY A;  4QWT A;  1BNR A;  3Q3F A;  1WMN A;  2Z7A A;  2BMQ B;  1X1Y A;  1W7C A;  1YGW A;  3A76 A;  3CNM A;  1K41 A;  4CPK A;  5IEP A;  2GBX B;  3LYG A;  4WYK A;  2HML B;  4XBY A;  3CC4 3;  1C7H A;  1IK3 A;  1MWR A;  3GSP A;  4HZB B;  1ROA A;  2BT3 A;  1NU3 A;  2AAE A;  3AMO B;  3LT8 A;  3PYJ A;  4RNZ A;  2Y74 A;  3ER7 A;  1JKG B;  1OF5 B;  1W00 A;  2D1W A;  1FUW A;  2GBW B;  4K1U A;  4CCV A;  1RTU A;  2W56 A;  2XFS A;  3D79 A;  1BNE A;  4XB5 A;  1BVI A;  1JN5 B;  5AYR B;  2YFJ B;  1Q81 4;  1EKM A;  2CW9 A;  5GSP A;  2O3O A;  2M7O A;  3WA2 X;  3CCM 3;  1UGH I;  1HKX A;  1CYV A;  1LRA A;  5ELU A;  3H51 A;  1OHS A;  3SVA A;  3LML A;  5LC6 A;  3CC7 3;  1HYF A;  3ALA A;  5JPU A;  1K73 4;  4BL2 A;  2HOH A;  4FMD A;  4G1M B;  1GSP A;  5CF2 A;  2XSH B;  1YVS A;  1DVC A;  1FGQ A;  4HJL B;  4IPB A;  1FGO A;  3KSP A;  4O02 B;  1EEJ A;  1RMS A;  2KXG A;  4J5K A;  2HMN B;  1JZO A;  3ZG0 A;  3D5G A;  1W2Z A;  3VGN A;  5AEW B;  1I8V A;  1X1W A;  4I4K A;  1W6Y A;  4IIA A;  2ZDJ A;  1RGE A;  2GSP A;  3AGO A;  1TRP A;  3LTA A;  8RNT A;  3DH2 A;  4GSP A;  3EF8 A;  4EYC A;  4STD A;  5IG5 A;  1BRH A;  1HU9 A;  1RGH A;  2R41 A;  3S67 A;  2B1X B;  1J2B A;  1FGT A;  1LOY A;  1QAF A;  1VQ8 3;  2KF6 A;  3T0U A;  1SII A;  4WFO A;  2CX1 A;  5G1K A;  1GOV A;  4KVH A;  5JPP A;  3FG1 A;  1BNS A;  4O8S A;  1T3B A;  2C10 A;  6STD A;  1E3V A;  1FZU A;  1MWS A;  1VQQ A;  5KP3 A;  3SLU A;  1BAO A;  3UB1 A;  3G4S 3;  2O9U X;  5EVH A;  3ZG5 A;  1BOX A;  3LTB A;  1BRN L;  4MMZ B;  1UUW B;  3LTD A;  1S72 3;  1UI7 A;  2IY2 A;  1EA2 A;  1I70 A;  2RGQ A;  1B2X A;  3FH1 A;  1OGX A;  1RGK A;  3JVC A;  3QK9 A;  2BO9 B;  3DGO A;  3MKI A;  3NM2 A;  2CX0 A;  3EHC A;  2H0G A;  2W0Q A;  4R9L A;  2XH9 A;  1BSA A;  3NX0 A;  4OK0 A;  4FR9 A;  3DZL A;  2F5M A;  1K8A 4;  1BRJ A;  3MYT A;  2H0H A;  5RNT A;  3CCJ 3;  1ZGX A;  5CK6 A;  2CFW A;  3KN4 A;  1NB3 I;  2YX9 A;  3FKA A;  3CNX A;  3KKG A;  5JBS A;  3CCR 3;  2PNC A;  3FGY A;  4XBX A;  5BIR A;  1UCK A;  1IQY A;  1DE3 A;  1RRL A;  3M8C A;  4J5G A;  3URP A;  1O7H B;  1OCV A;  1DET A;  3EQQ B;  4HAA A;  3N8B A;  3NBB A;  1JRQ A;  2IYJ A;  3OV4 A;  2K3D A;  1RLS A;  3EBT A;  4HM8 B;  1DMN A;  1RGC A;  3T8U A;  5I97 A;  3GZR A;  1ISK A;  5D82 A;  1V58 A;  3F9S A;  4N6M A;  2MC8 A;  1LNH A;  1UW1 A;  2MF7 A;  3DGL A;  1JBS A;  3V98 A;  3B4O A;  1VQ6 3;  1BUJ A;  4FMA A;  3X41 A;  4HM6 B;  1LOV A;  4HM5 B;  3PGB A;  4OVM A;  5IEO A;  5IF6 A;  2BMR B;  2V1L A;  8CHO A;  1QVG 2;  1N5H A;  1YJN 3;  5BVB A;  2CWU A;  3OWU A;  5HOH A;  3G16 A;  3ROB A;  3CXC 2;  3K9M C;  4WYK B;  1AVK A;  3CCQ 3;  1IT7 A;  1GMR A;  3VF1 A;  2YFI B;  3K5T A;  1NNV A;  4HVN A;  2W9Q A;  2QEX 3;  3S29 A;  3K63 A;  2GU3 A;  2BU4 A;  5EQL A;  4Q53 A;  4BIR A;  1JBR A;  3DM8 A;  4X2O A;  1IQX A;  3HX8 A;  1GMP A;  3IMA B;  3JUQ A;  1R4C A;  4HM3 B;  4KFF A;  2W56 B;  5KP1 A;  2YFL B;  3CCV 3;  1I3F A;  2OOV A;  1G0T A;  1IDP A;  1Y4K A;  1VZZ A;  3D4A A;  4N6O B;  1OHO A;  3SOA A;  1B21 A;  1RN1 A;  5AIH A;  1W6G A;  3F8H A;  3Q90 A;  1VQ5 3;  2HMJ B;  6RNT A;  3G6E 3;  4H3U A;  3OW2 2;  2XF3 A;  1PU4 A;  3IPT A;  1YIJ 3;  3V92 A;  3KFQ C;  1SQW A;  3BNC A;  3QRD A;  1IVV A;  3PZW A;  4KZ1 A;  5A0O B;  2XRX B;  3OWS A;  4KFD A;  1WMO A;  4FCJ A;  4EV2 A;  4BU4 A;  3HII A;  1TJD A;  1B27 A;  1GMQ A;  1MGW A;  1ROV A;  1LNI A;  3CCU 3;  2W03 A;  1QVF 2;  1RCL A;  1DMM A;  1UUV B;  1RCK A;  3SYU A;  3DGN A;  1ZO2 A;  3UL6 A;  2FXT A;  3NBR A;  2CIU A;  1RGL A;  3OWY A;  3SXX A;  5M18 A;  1VQ4 3;  2C4B A;  4HM0 B;  1IVU A;  4FCZ A;  4HM7 B;  3WR2 A;  2LYX A;  2XFT A;  1X1U A;  4BTX A;  1KSI A;  1I0X A;  2OWP A;  3EC9 A;  1AY7 A;  2OCT A;  4HBR A;  2F56 A;  1CYU A;  4RNY A;  1JB2 A;  1D6Y A;  2CKF B;  3BIR A;  4R1K A;  3PCR A;  4HKV B;  1YVB I;  3LT9 A;  5IG3 A;  3CC2 3;  4BL3 A;  3CU3 A;  3GWR A;  3BB9 A;  3NQY A;  5AIF A;  5AYS C;  1O7W B;  3EBY A;  4HZ9 B;  5IG4 A;  2CFK A;  1A2K A;  1US1 A;  3X3Y A;  2CFL A;  1F8N A;  3G8Z A;  1PFP A;  1BNJ A;  1DMQ A;  1I2E A;  1OUN A;  3EE1 A;  1W5Z A;  3JUP A;  3NQZ A;  1BRI A;  1UCL A;  1WQL B;  2HMK B;  3X3X A;  3Q2P A;  3NBJ A;  2KCD A;  1TFO A;  3E99 A;  3KCH A;  4KFE A;  3SX1 A;  1I2F A;  1MOL A;  2XR8 B;  5AIG A;  4JF8 A;  4LSO A;  3HI7 A;  1U8C B;  1G96 A;  1YJ9 3;  3BNB A;  1BSC A;  3ECF A;  3EJV A;  2ML6 A;  4LMI A;  3DY5 A;  1SAR A;  2QIY A;  3WA3 A;  2C11 A;  3SOY A;  1JKG A;  1NDO B;  2FNQ A;  1D6Z A;  3G0K A;  4NHF A;  1TU5 A;  3F8X A;  3UJM A;  1IYY A;  1T5Y A;  4MEI A;  2W2C A;  1UCI A;  1N5P A;  4JRF A;  2E2T A;  3D9R A;  2P05 A;  1VQK 3;  1N8R 4;  3NV0 B;  4I5Q A;  3MSO A;  1VQ9 3;  1RSN A;  1QAK A;  3F7X A;  1ULJ B;  1B2S A;  3FSD A;  4H61 A;  1IT8 A;  4XDV A;  2WOH A;  1IQ8 A;  3MG1 A;  2F4Y A;  2KF4 A;  5IG0 A;  1MWU A;  2IUK A;  2KF5 A;  4J8T A;  1T2I A;  4TX4 A;  3GZB A;  2IA7 A;  1K9M 4;  1QJG A;  4HYZ A;  3FF0 A;  1TP6 A;  3T8N A;  1Q7Y 4;  1OH0 A;  1RGG A;  3UNL A;  3DXO A;  4PEJ A;  3TDG A;  3STD A;  5FW5 A;  1E3R A;  4FCM A;  2CWT A;  4RBN A;  5DRV A;  2ZA4 A;  1W6C A;  3JUM A;  1HZ1 A;  2KAA A;  4RNT A;  1KQS 2;  1K28 A;  3NM7 A;  3PCS A;  4XDW A;  5G2G A;  5HGR A;  4HOH A;  1SIH A;  2Z6B A;  2WOF A;  1BAN A;  1T2H A;  2UX0 A;  3BND A;  4FMC A;  2QGU A;  3RDE A;  4BTY A;  1X1X A;  1Q9E A;  3FG4 A;  3CMA 3;  1B20 A;  3F14 A;  2WGO A;  3FCS B;  1W4N A;  3DGM A;  2ZHX B;  3G71 3;  1B3S A;  2F86 B;  1N8Q A;  2QA4 3;  5EEO A;  1O7M B;  3DMC A;  1JB4 A;  2F5W A;  1B2U A;  4FMB A;  1M1K 4;  3A5E A;  2K0M A;  1BNI A;  3MG2 A;  4X2H A;  1B2M A;  3EX9 A;  3JUN A;  3GAX A;  3NHX A;  3UL5 A;  2XSO B;  1EQK A;  4K90 B;  1JNQ A;  3CPW 2;  1SJW A;  3KII A;  1LOW A;  2P38 A;  3HZP A;  2W9P A;  1BSB A;  2BNG A;  3D3L A;  3ZFZ A;  3CPO A;  1BGS A;  5TGN A;  3U97 A;  3J7Y d;  4GL6 A;  4AKZ A;  5BXQ A;  1RNT A;  2B24 B;  2W04 A;  4EC6 A;  6GSP A;  1Q86 4;  2BHM A;  2E2V A;  4N6T A;  1IV7 A;  3AGN A;  3LXU X;  4MJD A;  4N6N B;  1EG9 B;  3B8L A;  3KE7 A;  2PZV A;  2CG0 A;  1RGF A;  1WTH A;  1STD A;  5M1A A;  1BU4 A;  2JDI H;  7STD A;  3K0Z A;  1O7P B;  1GOY A;  3GZX B;  1JB5 A;  4GHO A;  3LH4 A;  2CHC A;  3B7C A;  4HM4 B;  3I0Y A;  3JUO A;  1DVD A;  1O7G B;  1Q82 4;  2A15 A;  1WMP A;  1A2P A;  1VQ7 3;  1VQP 3;  1BUQ A;  5CLK A;  3WHO A;  4WHA A;  1JZD A;  2ML5 A;  1PYL A;  1A2V A;  4DKI A;  2HMM B;  1A67 A;  1OHP A;  1VQN 3;  1UI8 A;  3CCL 3;  1D6U A;  1DYU A;  1Q40 A;  2Z77 A;  3OX9 A;  2AAD A;  3S28 A;  4AEQ A;  3K7C A;  1KC8 4;  3FLJ A;  3I55 3;  4LYL B;  3V99 A;  4N6V 0;  1MWT A;  2CG1 A;  4MMX B;  1W2B 2;  1U5O A;  2CK3 H;  2BMO B; 
#chains in the Genus database with same CATH homology
 2Y73 A;  1CEW I;  1TUH A;  1CQS A;  3LZA A;  2GEX A;  3NUV A;  4RZM A;  1WNH A;  2CFG A;  4U13 A;  2IUJ A;  4OUQ A;  2I9W A;  2W6J H;  3S27 A;  1A90 A;  4XM4 A;  2OOV C;  5CXO A;  2INX A;  3F40 A;  2Q07 A;  3I56 3;  1IVW A;  3WDG B;  1FGR A;  2CFD A;  3S5C A;  4HM2 B;  4EV5 A;  1YGE A;  1ULI B;  3DUK A;  1TIJ A;  3HIG A;  2F99 A;  2ZL8 A;  3EN8 A;  3KZT A;  3PXM A;  2E2U A;  5STD A;  4ZM8 A;  3CME 3;  2OTJ 3;  2OTL 3;  5CF1 A;  2FGT A;  1M9G A;  1GS3 A;  2CC3 A;  3AMO A;  2R4I A;  2P09 A;  1OF5 A;  1RJO A;  3GZY B;  1LOX A;  1NO3 A;  1LVN A;  1O7N B;  1JN5 A;  5AEU B;  3LOY A;  5KP4 A;  1GYB A;  3EN1 B;  3CCE 3;  1S5A A;  2F98 A;  1IU7 A;  1JV2 B;  4MMY B;  4N6U A;  3O8Y A;  4K1V A;  1KWI A;  4XBT A;  3VSY A;  1OPY A;  5IER A;  4GB5 A;  4R4K A;  4CDL A;  1V74 A;  1MNL A;  1Z1S A;  3LTC A;  3X3Z A;  3CCS 3;  1YHQ 3;  3U1W A;  5AI1 A;  5ELJ A;  3NXJ A;  1AR0 A;  1NB5 I;  1ASK A;  1E97 A;  1N9J A;  4R9K A;  3RGA A;  2GXF A;  5DRE A;  4BTW A;  1ZX2 A;  3KSE D;  3OXA A;  4O2H A;  5IW9 A;  1L5G B;  4LZI A;  1SPU A;  3GRD A;  1M90 4;  1OAC A;  1YIT 3;  1YJW 3;  2STD A;  3WOF B;  3SED A;  4J9A A;  1GY5 A;  2WGQ A;  2P0X A;  3BLZ A;  3FZW A;  5D83 A;  1IVX A;  2CWV A;  1LXE A;  3FG3 A;  1NWW A;  3X40 A;  4HM1 B;  1M1X B;  2OQE A;  5AII A;  1W01 A;  4N6L A;  1QMA A;  2RCD A;  1YI2 3;  1Q42 A;  2HMO B;  3MG3 A;  3N54 B;  1RRH A;  3NV0 A;  3HK4 A;  3CD6 3;  5FGO A;  2RSX A;  4N3V A;  1STF I;  1KD1 4;  1TFK A;  1W02 A;  2IMJ A;  1VQO 3;  1GY6 A;  4EBG A;  2RFR A;  4EXR A;  4LEH A;  3H3H A;  2XGL A;  1GY7 A;  1FA3 A;  2SBL A;  2JQ5 A;  3MHE A;  1IV9 A;  1FGM A;  1GD4 A;  4L8O A;  3EB8 A;  3L0R A;  5D81 A;  5IEN A;  1Q40 B;  2WO0 A;  3MWZ A;  1N9E A;  4WWU C;  3FF2 A;  2D42 A;  3F7S A;  3Q1C A;  1AVL A;  1VQM 3;  1QAL A;  1NJI 4;  4LGQ A;  5LC7 A;  3WOD G;  1OGZ A;  4ORL A;  4AKY A;  2Z76 A;  3BNE A;  4K61 A;  3WOE B;  2OQE C;  2P0M A;  3MPH A;  2L4V A;  2GU1 A;  1RKY A;  4L7K A;  3X42 A;  1GD3 A;  3N9H A;  1JJ2 2;  3WMD A;  1AV4 A;  1RN7 A;  4NRE A;  3IJE B;  1VQL 3;  3PS8 A;  4L8P A;  2K54 A;  4O3V A;  2XEP A;  2KRT A;  4IT7 A;  3RGR A;  4WP5 A;  2XGN A;  4R80 A;  3B4P A;  2LQV A;  2CH9 A;  2GEY A;  4QWT A;  1WMN A;  2Z7A A;  2BMQ B;  1W7C A;  3A76 A;  3CNM A;  1K41 A;  5IEP A;  2GBX B;  3LYG A;  4WYK A;  2HML B;  4XBY A;  3CC4 3;  1C7H A;  1IK3 A;  4HZB B;  1ROA A;  2BT3 A;  1NU3 A;  3PYJ A;  3AMO B;  3LT8 A;  4RNZ A;  2Y74 A;  3ER7 A;  1JKG B;  1OF5 B;  1W00 A;  2D1W A;  1FUW A;  2GBW B;  4K1U A;  4CCV A;  2W56 A;  2XFS A;  4XB5 A;  1JN5 B;  5AYR B;  2YFJ B;  1Q81 4;  1EKM A;  2CW9 A;  3CCM 3;  2O3O A;  2M7O A;  3WA2 X;  1HKX A;  1CYV A;  5ELU A;  3H51 A;  1OHS A;  3SVA A;  3LML A;  5LC6 A;  3CC7 3;  3ALA A;  5JPU A;  1K73 4;  4FMD A;  4G1M B;  5CF2 A;  2XSH B;  4HJL B;  1DVC A;  1FGQ A;  4IPB A;  1FGO A;  3KSP A;  4O02 B;  2KXG A;  2HMN B;  1W2Z A;  3VGN A;  5AEW B;  4I4K A;  1W6Y A;  4IIA A;  2ZDJ A;  3LTA A;  3EF8 A;  4EYC A;  4STD A;  5IG5 A;  1HU9 A;  1J2B A;  3S67 A;  2B1X B;  1FGT A;  1QAF A;  1VQ8 3;  3T0U A;  1SII A;  4WFO A;  4KVH A;  5JPP A;  3FG1 A;  4O8S A;  2C10 A;  6STD A;  1E3V A;  5KP3 A;  3SLU A;  3UB1 A;  3G4S 3;  2O9U X;  5EVH A;  3LTB A;  4MMZ B;  1UUW B;  3LTD A;  1S72 3;  1UI7 A;  2RGQ A;  1EA2 A;  3FH1 A;  1OGX A;  3JVC A;  3QK9 A;  2BO9 B;  3DGO A;  3MKI A;  3NM2 A;  3EHC A;  2W0Q A;  4R9L A;  2XH9 A;  3NX0 A;  4OK0 A;  4FR9 A;  3DZL A;  1K8A 4;  3MYT A;  3CCJ 3;  5CK6 A;  2CFW A;  3KN4 A;  1NB3 I;  2YX9 A;  3FKA A;  3CNX A;  3KKG A;  5JBS A;  3CCR 3;  2PNC A;  3FGY A;  4XBX A;  1IQY A;  1RRL A;  3M8C A;  1O7H B;  1OCV A;  3EQQ B;  3N8B A;  3NBB A;  1JRQ A;  3OV4 A;  3EBT A;  4HM8 B;  1DMN A;  3T8U A;  5I97 A;  3GZR A;  1ISK A;  5D82 A;  3F9S A;  4N6M A;  2MC8 A;  1LNH A;  1UW1 A;  2MF7 A;  3DGL A;  3V98 A;  3B4O A;  1VQ6 3;  4FMA A;  3X41 A;  4HM6 B;  4HM5 B;  3PGB A;  4OVM A;  5IEO A;  5IF6 A;  2BMR B;  2V1L A;  8CHO A;  1QVG 2;  1N5H A;  1YJN 3;  5BVB A;  2CWU A;  3OWU A;  3G16 A;  3ROB A;  3CXC 2;  3K9M C;  4WYK B;  1AVK A;  3CCQ 3;  1IT7 A;  3VF1 A;  2YFI B;  3K5T A;  4HVN A;  2W9Q A;  2QEX 3;  3S29 A;  3K63 A;  2GU3 A;  5EQL A;  4Q53 A;  3DM8 A;  4X2O A;  1IQX A;  3HX8 A;  3IMA B;  3JUQ A;  4HM3 B;  1R4C A;  4KFF A;  5KP1 A;  2W56 B;  3CCV 3;  2YFL B;  2OOV A;  1IDP A;  1Y4K A;  1VZZ A;  4N6O B;  1OHO A;  3SOA A;  5AIH A;  1W6G A;  3F8H A;  3Q90 A;  1VQ5 3;  2HMJ B;  3G6E 3;  4H3U A;  3OW2 2;  2XF3 A;  1PU4 A;  3IPT A;  1YIJ 3;  3V92 A;  3KFQ C;  1SQW A;  3BNC A;  3QRD A;  1IVV A;  3PZW A;  4KZ1 A;  5A0O B;  2XRX B;  3OWS A;  4KFD A;  1WMO A;  4FCJ A;  4EV2 A;  3HII A;  1ROV A;  3CCU 3;  1QVF 2;  2W03 A;  1DMM A;  1UUV B;  3DGN A;  1ZO2 A;  3UL6 A;  2FXT A;  3NBR A;  2CIU A;  3OWY A;  3SXX A;  1VQ4 3;  4HM0 B;  1IVU A;  4FCZ A;  4HM7 B;  2LYX A;  2XFT A;  4BTX A;  1KSI A;  2OWP A;  3EC9 A;  4HBR A;  2OCT A;  1CYU A;  4RNY A;  1JB2 A;  1D6Y A;  2CKF B;  4R1K A;  3PCR A;  4HKV B;  1YVB I;  3LT9 A;  5IG3 A;  3CC2 3;  3CU3 A;  3GWR A;  3BB9 A;  3NQY A;  5AIF A;  5AYS C;  1O7W B;  3EBY A;  4HZ9 B;  5IG4 A;  2CFK A;  1A2K A;  1US1 A;  3X3Y A;  2CFL A;  1F8N A;  3G8Z A;  1PFP A;  1DMQ A;  3JUP A;  1OUN A;  3EE1 A;  1W5Z A;  3NQZ A;  2HMK B;  1WQL B;  3X3X A;  3Q2P A;  3NBJ A;  2KCD A;  1TFO A;  3E99 A;  4KFE A;  3SX1 A;  5AIG A;  1MOL A;  2XR8 B;  4JF8 A;  4LSO A;  3HI7 A;  1U8C B;  1G96 A;  1YJ9 3;  3BNB A;  3ECF A;  3EJV A;  4LMI A;  2ML6 A;  3DY5 A;  2QIY A;  3WA3 A;  2C11 A;  3SOY A;  1JKG A;  1NDO B;  2FNQ A;  1D6Z A;  3G0K A;  4NHF A;  1TU5 A;  3F8X A;  3UJM A;  1T5Y A;  4MEI A;  2W2C A;  1N5P A;  4JRF A;  2E2T A;  3D9R A;  2P05 A;  1VQK 3;  1N8R 4;  3NV0 B;  3MSO A;  1VQ9 3;  1QAK A;  3F7X A;  1ULJ B;  3FSD A;  4H61 A;  1IT8 A;  4XDV A;  2WOH A;  1IQ8 A;  3MG1 A;  5IG0 A;  2IUK A;  4J8T A;  4TX4 A;  3GZB A;  2IA7 A;  1K9M 4;  1QJG A;  4HYZ A;  3FF0 A;  1TP6 A;  3T8N A;  1Q7Y 4;  1OH0 A;  3UNL A;  3DXO A;  4PEJ A;  3TDG A;  3STD A;  5FW5 A;  1E3R A;  4FCM A;  2CWT A;  4RBN A;  5DRV A;  1W6C A;  3JUM A;  1KQS 2;  1K28 A;  3NM7 A;  3PCS A;  4XDW A;  5G2G A;  5HGR A;  1SIH A;  2Z6B A;  2WOF A;  2UX0 A;  3BND A;  4FMC A;  2QGU A;  3RDE A;  4BTY A;  3FG4 A;  3CMA 3;  3F14 A;  2WGO A;  3FCS B;  1W4N A;  3DGM A;  3G71 3;  2F86 B;  1N8Q A;  2QA4 3;  5EEO A;  1O7M B;  3DMC A;  1JB4 A;  1M1K 4;  4FMB A;  2K0M A;  3MG2 A;  4X2H A;  3EX9 A;  3JUN A;  3GAX A;  3NHX A;  3UL5 A;  2XSO B;  1EQK A;  4K90 B;  1JNQ A;  3CPW 2;  1SJW A;  3KII A;  2P38 A;  3HZP A;  2W9P A;  2BNG A;  3D3L A;  3CPO A;  3U97 A;  5TGN A;  3J7Y d;  4GL6 A;  4AKZ A;  5BXQ A;  2B24 B;  2W04 A;  4EC6 A;  1Q86 4;  2BHM A;  2E2V A;  4N6T A;  1IV7 A;  3LXU X;  4MJD A;  4N6N B;  1EG9 B;  3B8L A;  3KE7 A;  2PZV A;  2CG0 A;  1WTH A;  1STD A;  7STD A;  2JDI H;  3K0Z A;  1O7P B;  3GZX B;  1JB5 A;  3LH4 A;  2CHC A;  3B7C A;  4HM4 B;  3I0Y A;  3JUO A;  1DVD A;  1O7G B;  1Q82 4;  2A15 A;  1WMP A;  1VQ7 3;  1VQP 3;  1BUQ A;  5CLK A;  4WHA A;  2ML5 A;  1A2V A;  2HMM B;  1A67 A;  1OHP A;  1VQN 3;  1UI8 A;  3CCL 3;  1D6U A;  1DYU A;  1Q40 A;  2Z77 A;  3OX9 A;  3S28 A;  4AEQ A;  1KC8 4;  3K7C A;  3FLJ A;  3I55 3;  3V99 A;  4N6V 0;  2CG1 A;  4MMX B;  1W2B 2;  1U5O A;  2CK3 H;  2BMO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...