3FF0A

Crystal structure of a phenazine biosynthesis-related protein (phzb2) from pseudomonas aeruginosa at 1.90 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
162
structure length
162
Chain Sequence
GMLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phenazine biosynthesis protein phzB 2
publication title Crystal structure of protein PhzB2 with cystatin-like fold and unknown function in phenazine biosynthesis (NP_250591.1) from PSEUDOMONAS AERUGINOSA at 1.90 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
total genus 44
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03284 PHZA_PHZB Phenazine biosynthesis protein A/B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff0A01
4N3VA 1OUNA 5HGRA 3JUOA 1OPYA 2CKFB 1O7GB 3FZWA 3FF2A 5EVHA 3STDA 5G2GA 5IENA 3FKAA 2CHCA 4XBYA 3G0KA 5BXQA 1JB4A 5IERA 5D81A 5KP1A 3K0ZA 3MHEA 5CXOA 3A76A 3JUPA 1OF5B 4HJLB 1UUVB 2STDA 1W6YA 5AIIA 2BMQB 1QMAA 2GEYA 2I9WA 3KSPA 2W2CA 4H3UA 3ER7A 4GB5A 3ROBA 3MYTA 4HVNA 3KKGA 3B8LA 2IMJA 4XDVA 1EA2A 1TP6A 4HM4B 2HMKB 3G8ZA 1S5AA 3SOYA 2BMRB 1GS3A 3GWRA 3NXJA 4X2OA 5AEUB 5TGNA 1CQSA 5IG5A 4OVMA 2Z76A 3Q90A 3OV4A 3CNXA 3EF8A 1OF5A 3LZAA 3FSDA 4LGQA 5JPPA 3VGNA 5FW5A 2B24B 1WQLB 4U13A 3DZLA 3NV0B 5IG4A 5IG3A 1O7MB 1K41A 2HMJB 5AI1A 3UJMA 1JB5A 2YFLB 3EBTA 3JUQA 4PEJA 4FCMA 1ULIB 4MJDA 2Z77A 5STDA 4KVHA 4WYKB 4FCJA 1JKGA 3DXOA 3F7SA 2R4IA 1TUHA 3B4PA 4HM0B 2F99A 1OHPA 3VSYA 2GEXA 1BUQA 2RFRA 2BMOB 3HX8A 4HM1B 3FLJA 3MKIA 3CPOA 3NV0A 5AIGA 4J9AA 2K54A 4XDWA 1Q42A 3DUKA 3OWUA 2F98A 4STDA 3RGAA 2A15A 3KZTA 2QIYA 5CF1A 3I0YA 1EG9B 1OHOA 3MG1A 4WYKA 2GBWB 1DMMA 3KE7A 3EHCA 2QGUA 4XBXA 4LEHA 2PZVA 3NHXA 1GY5A 4HM3B 1NWWA 2YFJB 3F8HA 3OWYA 4RZMA 3HK4A 3MG3A 5DRVA 2OWPA 4WP5A 5IEOA 3F40A 3F9SA 1IDPA 5DREA 3JUNA 1Q40B 1OCVA 1O7NB 5CLKA 3F14A 1GY7A 1W02A 5IG0A 3OXAA 2GXFA 4J8TA 3B7CA 3F7XA 1ASKA 4I4KA 2HMLB 1JKGB 4XM4A 1OHSA 3NM2A 1DMQA 2F86B 6STDA 3E99A 3EN8A 1O7HB 4K1VA 4IIAA 1VZZA 3DMCA 2XR8B 3UNLA 3MG2A 3FF0A 4R9LA 4XBTA 3MSOA 1Q40A 3EX9A 3T8UA 3H3HA 3NBRA 3SEDA 1ULJB 2XSOB 3GZBA 3BB9A 1ISKA 1OGXA 3CU3A 4WWUC 5KP3A 5CK6A 3EBYA 4HZBB 2HMNB 2RCDA 2RGQA 1ZX2A 3FGYA 3GZYB 5AIHA 1STDA 3OX9A 3DM8A 5D82A 3GZXB 2BNGA 2XRXB 3HZPA 4X2HA 2B1XB 1NU3A 1NDOB 1UUWB 5AEWB 1E3RA 4K1UA 2HMMB 4R1KA 3F8XA 1A2KA 3RGRA 3CNMA 3D9RA 5BVBA 2Z7AA 1E97A 5KP4A 7STDA 1AR0A 4XB5A 4HM8B 3FH1A 3K7CA 4HM6B 3T8NA 3EQQB 1SJWA 3S5CA 2UX0A 8CHOA 4Q53A 1OGZA 5AIFA 2XSHB 1W00A 3G16A 3IPTA 3EJVA 4R9KA 5CF2A 3EC9A 1HKXA 1C7HA 1GY6A 1DMNA 4L8PA 4OUQA 1O7WB 5IEPA 1W01A 1QJGA 1Z1SA 2YFIB 3GRDA 4HZ9B 4HKVB 1JN5B 3BLZA 5JPUA 5D83A 4HM2B 4L7KA 4ORLA 1U5OA 4L8OA 1GYBA 3JUMA 5IF6A 3OWSA 1OH0A 3GZRA 2GBXB 3NUVA 1JB2A 1ZO2A 2INXA 4LMIA 3SOAA 4HM7B 3M8CA 1E3VA 2JQ5A 4CDLA 4HM5B 3EN1B 3B4OA 2HMOB 3WMDA 3LYGA 1JN5A 3ECFA 3H51A 1O7PB
chains in the Genus database with same CATH superfamily
2F5WA 1FGRA 4ZM8A 4N3VA 3O8YA 1LNIA 1OUNA 5HGRA 3JUOA 1OPYA 1RGEA 1O7GB 2CKFB 2GSPA 2L1SA 3FZWA 3PCRA 2CC3A 1DVDA 1G02A 1TJDA 3D79A 3FF2A 3LOYA 5EVHA 1W2ZA 4FMBA 3CME3 4NPBA 5ELUA 2XH9A 5FGOA 3STDA 4CPKA 4AKZA 1ROVA 3LT9A 5G2GA 5IENA 1WMNA 3FKAA 2CHCA 3HOHA 4XBYA 4N6MA 4ILFA 3S67A 4WHAA 1QVG2 1SIHA 5G1KA 3DGOA 1TU5A 1FYSA 1LXEA 3PXMA 3D5GA 3QK9A 2CFKA 3K5TA 3X3YA 1WMOA 3G0KA 2ML6A 1UCLA 1MWUA 4KFFA 1D6UA 1R4YA 1FUTA 1UUGB 1W7CA 1I3IA 1YVSA 1B3SA 5BXQA 1BRGA 1JB4A 3MPHA 5IERA 4DKIA 3DGYA 4N6OB 5D81A 1VQQA 5KP1A 3OW22 1RDSA 1RKYA 3K0ZA 3MHEA 1Q824 3AGOA 2KXGA 5CXOA 1K9M4 1RGCA 1UGIA 3A76A 3JUPA 7GSPA 3AMOB 1EEJA 1AY7A 1OF5B 1US1A 4HJLB 1K8A4 1UUVB 3BNEA 1NNVA 2STDA 1W6YA 3G713 4MEIA 4TX4A 2WOFA 5AIIA 2C4BA 7RNTA 2P38A 2BMQB 3WOEB 1QMAA 2CIUA 2UUGC 1UCKA 1GOVA 1BRJA 2W03A 1LNHA 3GAXA 4N6LA 3ZFZA 3CCS3 2GEYA 3LTAA 4I5QA 2I9WA 1MOLA 3KSPA 3S27A 3ZG5A 4EC6A 2W2CA 1I2FA 1YJW3 2OQEA 4H3UA 3FG1A 3ER7A 4GB5A 1IQYA 3ROBA 2CG1A 3MYTA 4HVNA 3KKGA 3B8LA 2H0HA 2IMJA 1BUJA 1FUWA 3X3XA 2CFDA 2XGNA 4XDVA 1NO3A 3UB1A 1EA2A 4N6V0 1TP6A 4HM4B 1IVXA 2HMKB 4IT7A 6GSPA 1A2VA 1FZUA 4FR9A 4AEQA 1YVBI 2W04A 3G8ZA 1VQO3 3RNTA 1RGHA 4BU4A 1B27A 1TTOA 1GS3A 1S5AA 2BMRB 3GWRA 2O3OA 3NXJA 3SOYA 1AVLA 1RN1A 1N9JA 1SQWA 3CXC2 1B2MA 4X2OA 5AEUB 1JZOA 1CQSA 5TGNA 5IG5A 3WDGB 3WHOA 1BRHA 1BU4A 2M7OA 2F4YA 1BIRA 1MGWA 2UGIA 3DH2A 2Z76A 4OVMA 3AHSA 1U8CB 6RNTA 5LC6A 4JF8A 3SX1A 3X41A 3Q90A 3AMOA 3OV4A 1IT8A 3CNXA 1OF5A 3EF8A 4OK0A 4EXRA 1L5GB 1KQS2 1FGQA 3LTCA 2OOVA 3LZAA 3VF1A 2YX9A 3FSDA 3G4S3 4LGQA 5JPPA 3NM7A 3VGNA 2BIRA 1FGTA 3PYJA 5FW5A 2B24B 3CCJ3 1WQLB 4U13A 3DZLA 3CMA3 1GD4A 1RRLA 3NV0B 2O9UX 4K90B 1A90A 3IMAB 2FNQA 5IG4A 1GOUA 5M19A 5IG3A 1O7MB 2W9PA 1WMPA 3T0UA 1K41A 2HMJB 1I8VA 3LXUX 3URPA 1M1K4 1JBRA 2WGOA 1BRNL 1SPUA 2RNTA 2PNCA 5AI1A 1R4CA 1JB5A 2YFLB 3EBTA 3JUQA 4PEJA 5GSPA 3UJMA 4FCMA 3DY5A 1ULIB 4MJDA 1WTHA 1RN7A 3SVAA 3UL6A 2Z77A 3CC23 1IVWA 5STDA 1VQ63 4KVHA 4MMXB 4WYKB 4FCJA 1BSBA 2P09A 1BSDA 1JKGA 1IU7A 1RGAA 1RMSA 1LOWA 3DXOA 5LC7A 3CC43 1W4NA 3BU4A 3HIGA 3U97A 3F7SA 3PGBA 4L8OA 1STFI 3NQYA 2R4IA 4BL3A 1D6YA 4FMDA 3SYUA 1TUHA 3B4PA 1VQP3 2CX0A 3ZG0A 4HM0B 2F99A 1OHPA 1PYLA 1W5ZA 5EEOA 1KC84 3VSYA 2CK3H 3QRDA 3BNDA 2GEXA 1RCLA 2JDIH 4RNTA 2XFTA 1CEWI 3D4AA 1BUQA 1AQZA 1LVNA 2RFRA 3WOFB 2BMOB 1DETA 1IQ8A 1MWTA 3HX8A 4HM1B 1EUIC 3FLJA 3KSED 3MKIA 3CPOA 2MC8A 3KFQC 1A2PA 2RSXA 1B2SA 3NV0A 1UI7A 1VQL3 1ZGXA 1RCKA 4EBGA 1PY3A 1TRQA 4FCZA 5AIGA 4J9AA 3K63A 3KN4A 3NQZA 1Q864 1NJI4 1YGEA 1KD14 1SIIA 2AAEA 2K54A 1BRSA 4J5GA 4XDWA 1Q42A 2P0XA 3WR2A 3JVCA 4KFDA 3PCSA 3DUKA 3OWUA 2F98A 1GD3A 4STDA 3RGAA 3SXXA 1BSAA 1K28A 2A15A 3KZTA 4G1MB 1VQ53 1BNIA 1TFKA 2LYXA 5I97A 2QIYA 5CF1A 3UL5A 4O2HA 1NB5I 3I0YA 1EG9B 1OHOA 4QWTA 3DGLA 1DYUA 3MG1A 4WYKA 1RTUA 3K9MC 2P0MA 2W9QA 4LYLB 2W56B 1Q814 2CWUA 2AADA 2GBWB 1DMMA 3KE7A 4BTXA 1X1XA 3EHCA 1I2GA 1RGLA 1X1UA 2QGUA 3CCL3 4XBXA 4LEHA 3BIRA 2PZVA 3NHXA 1GY5A 3Q3FA 2Z6BA 1CH0A 2KAAA 1NWWA 2YFJB 1FUSA 1T3BA 2FGTA 4HM3B 1T5YA 4R80A 5BU4A 1G96A 3F8HA 2C11A 1W2B2 1QVF2 3OWYA 2CH9A 3PS8A 4RZMA 2K0MA 3HK4A 3MG3A 1IV7A 1LOYA 4RNYA 5DRVA 2OWPA 1SARA 3DGMA 1UGHI 4O8SA 4WP5A 5IEOA 3F40A 3X3ZA 4BIRA 3F9SA 3U1WA 3AHWA 1IDPA 3I563 1FA3A 1IQXA 1VQK3 3CC73 3S28A 5DREA 3JUNA 4K61A 5HOHA 1Q40B 1QAFA 1OCVA 2CX1A 8RNTA 3J7Yd 1O7NB 5CLKA 3F14A 1GY7A 1W02A 5BIRA 1ROAA 1IT7A 1HYFA 3OXAA 2GXFA 5IG0A 1DE3A 4J8TA 2BO9B 3B7CA 2R41A 1W6CA 1ASKA 2Y73A 3F7XA 1S723 2KF6A 2ZL8A 3MWZA 4I4KA 1N8R4 2HMLB 1IK3A 3CPW2 4RNZA 1JKGB 3CCE3 4EV5A 2KF4A 4NHFA 4XM4A 2HOHA 1OHSA 3NM2A 1DMQA 2F86B 2W56A 2V1LA 1RNBA 5JBSA 4WFOA 3CCV3 1A67A 6STDA 3DGNA 1BOXA 1J2BA 1AVKA 2C10A 3E99A 4RBNA 4BTWA 3EN8A 1O7HB 1I0XA 4IIAA 4K1VA 3FG4A 1PFPA 5AYRB 3G6E3 1FGOA 1VZZA 1G0TA 1V58A 3DMCA 1LQMB 1I0VA 1BGSA 2XR8B 3UNLA 3GSPA 1B2UA 2IY2A 3SLUA 2KCDA 1N5HA 2SARA 1T2IA 3NX0A 3MG2A 4N6UA 1FW7A 2WO0A 4FMAA 3FF0A 4R9LA 1VQM3 4XBTA 3MSOA 2QA43 2LQVA 1Q40A 3EX9A 1AV4A 2BHMA 1VQN3 3LH4A 2ML5A 3T8UA 3A5EA 3H3HA 3NBRA 4H61A 1BNEA 1RGFA 3SEDA 4EYCA 1ULJB 1N8QA 2XEPA 2XSOB 3GZBA 1QALA 1QAKA 1BSCA 3BB9A 3I553 1ISKA 1F8NA 4JRFA 2XGLA 3N9HA 4KZ1A 1OGXA 3CU3A 1K734 3N8BA 2OQEC 3HIIA 2F5MA 4WWUC 1KWIA 5KP3A 5CK6A 5IW9A 1EKMA 3EBYA 4HZBB 2HMNB 2RCDA 4N6TA 1BNSA 1JRQA 3HI7A 1VQ73 2RGQA 4HAAA 1PU4A 1ZX2A 1B2ZA 3FGYA 3GZYB 1BNFA 5AIHA 2E2TA 1STDA 1TRPA 2FXTA 1YGWA 1M1XB 1RNTA 1JBTA 4O02B 3OX9A 1NB3I 2D1WA 3DM8A 4HYZA 1I70A 1M904 3CCR3 5AYSC 1UCIA 2ZDJA 5D82A 3Q2PA 3GZXB 3V92A 2BNGA 1RGGA 1B21A 1UW1A 3BNCA 3N54B 4AKYA 2XRXB 4CCVA 4N6NB 1BSEA 4BL2A 2OOVC 3LTDA 3EE1A 3HZPA 4X2HA 1RSNA 9RNTA 4EV2A 1RHLA 2B1XB 1NU3A 1NDOB 1UUWB 2MF7A 5AEWB 1LOXA 2P05A 1E3RA 4K1UA 1LOVA 2Y74A 2HMMB 1WNHA 4R1KA 1IYYA 3F8XA 1YIJ3 1A2KA 1GMRA 2SBLA 1D6ZA 3L0RA 2KF3A 2GU1A 3RGRA 1MGRA 4CJNA 3CNMA 3D9RA 3D3LA 2ZA4A 1GSPA 5BVBA 3V98A 2Z7AA 1JV2B 1E97A 5KP4A 4MMZB 3LTBA 4R4KA 7STDA 2XFSA 3D5IA 1BAOA 1AR0A 4XB5A 1N9EA 2WOHA 3CCM3 2K3DA 3CCQ3 3FG3A 4HM8B 2CFWA 2XF3A 1IV9A 3FH1A 3K7CA 2KF5A 3WA2X 1CYVA 4HM6B 3T8NA 1W6GA 3WA3A 1RLSA 3EQQB 1SJWA 1DVCA 1I3FA 4LZIA 1Q7Y4 3S5CA 1V74A 1VQ83 2UX0A 8CHOA 3X40A 4EW5A 1TFOA 4Q53A 1OGZA 5AIFA 1B2XA 1BRIA 2XSHB 1GOYA 1W00A 3BNBA 2E2VA 3G16A 1YJ93 1BNJA 2IA7A 3IPTA 3EJVA 1MNLA 1FGMA 1B20A 4R9KA 3EC9A 5CF2A 2F56A 2OCTA 1JBSA 1HKXA 1C7HA 1GY6A 1UCJA 1DMNA 2IUJA 4L8PA 1HZ1A 4OUQA 2W0QA 4FMCA 1BRKA 1OACA 2OTL3 1O7WB 5IEPA 1HU9A 1W01A 3FCSB 1VQ43 1BANA 1QJGA 1Z1SA 2YFIB 3GRDA 1MWSA 2CW9A 2CWTA 5RNTA 3Q1CA 4LSOA 4HZ9B 5M18A 4HKVB 1C54A 3X42A 3CCU3 1JN5B 2GU3A 2Q07A 1YNVX 2L4VA 5A0OB 3BLZA 5M1AA 1YIT3 1N5PA 5JPUA 1KSIA 3RDEA 1TIJA 5D83A 1BVIA 2IYJA 4HM2B 4L7KA 3WODG 1YI23 4ORLA 4GHOA 1U5OA 3LMLA 2KRTA 2H0IA 4IPBA 4BTYA 2RBIA 1I2EA 2BU4A 1BNGA 1GYBA 1LRAA 1IVUA 1GMQA 1MWRA 1RGKA 3JUMA 3OWSA 1JZDA 3S29A 1OH0A 3NBBA 5IF6A 2J8XB 3GZRA 1Q7HA 4KT3B 2H0GA 1YJN3 1JJ22 2WGQA 4GSPA 2CFLA 2GBXB 3NBJA 1Y4KA 4J5KA 5ELJA 3LT8A 2OTJ3 3NUVA 3TDGA 2CFGA 4O3VA 4NREA 2ZHXB 1JB2A 1JNQA 1ZO2A 2E2UA 5G1LA 1Q9EA 1T2HA 2INXA 1RJOA 1YHQ3 1RN4A 3PZWA 2QEX3 2CWVA 4LMIA 1V57A 3SOAA 4HM7B 1CYUA 3M8CA 1E3VA 2JQ5A 1BNRA 4CDLA 4KFEA 3EB8A 4GL6A 4HM5B 2IUKA 1GMPA 3EN1B 3B4OA 3KIIA 1X1WA 3KCHA 1ZS7A 2HMOB 3ALAA 4HOHA 1X1YA 3WMDA 5EQLA 2BT3A 3LYGA 1LQGC 1UDII 1UI8A 2CG0A 1JN5A 1IVVA 1RRHA 3ECFA 3H51A 4HBRA 3IJEB 3V99A 3CD63 3AGNA 2W6JH 1EQKA 1O7PB 2D42A 1M9GA 4MMYB 1VQ93
chains in the Genus database with same CATH topology
1FGRA 4ZM8A 4N3VA 3O8YA 1OUNA 5HGRA 3JUOA 1OPYA 2CKFB 1O7GB 3FZWA 3PCRA 1DVDA 2CC3A 3FF2A 3LOYA 5EVHA 3CME3 1W2ZA 4FMBA 5ELUA 2XH9A 5FGOA 3STDA 4AKZA 1ROVA 3LT9A 5G2GA 5IENA 1WMNA 3FKAA 2CHCA 4XBYA 4N6MA 3S67A 4WHAA 1QVG2 1SIHA 3DGOA 1TU5A 1LXEA 3PXMA 3QK9A 2CFKA 3K5TA 3X3YA 1WMOA 3G0KA 2ML6A 4KFFA 1D6UA 1W7CA 5BXQA 1JB4A 3MPHA 5IERA 4N6OB 5D81A 5KP1A 3OW22 1RKYA 3K0ZA 3MHEA 1Q824 1K9M4 2KXGA 5CXOA 3A76A 3JUPA 3AMOB 1OF5B 1US1A 1K8A4 4HJLB 1UUVB 3BNEA 2STDA 1W6YA 3G713 4MEIA 4TX4A 2WOFA 5AIIA 2P38A 2BMQB 3WOEB 1QMAA 2CIUA 2W03A 1LNHA 3GAXA 4N6LA 3CCS3 2GEYA 3LTAA 3S27A 2I9WA 1MOLA 3KSPA 4EC6A 2W2CA 1YJW3 2OQEA 4H3UA 3FG1A 3ER7A 4GB5A 1IQYA 3ROBA 2CG1A 3MYTA 4HVNA 3KKGA 3B8LA 2IMJA 1FUWA 3X3XA 2CFDA 2XGNA 4XDVA 1NO3A 3UB1A 1EA2A 4N6V0 1TP6A 4HM4B 1IVXA 2HMKB 4IT7A 1A2VA 4FR9A 4AEQA 1YVBI 2W04A 3G8ZA 1VQO3 1GS3A 1S5AA 2BMRB 3GWRA 2O3OA 3NXJA 3SOYA 1AVLA 1SQWA 1N9JA 3CXC2 4X2OA 5AEUB 5TGNA 1CQSA 5IG5A 3WDGB 2M7OA 4OVMA 2Z76A 1U8CB 5LC6A 4JF8A 3SX1A 3X41A 3Q90A 3AMOA 3OV4A 1IT8A 3CNXA 1OF5A 3EF8A 4OK0A 4EXRA 1L5GB 1KQS2 1FGQA 3LTCA 2OOVA 3LZAA 3VF1A 2YX9A 3FSDA 3G4S3 4LGQA 5JPPA 3NM7A 3VGNA 1FGTA 3PYJA 5FW5A 2B24B 3CCJ3 1WQLB 4U13A 3DZLA 3CMA3 1GD4A 1RRLA 3NV0B 2O9UX 4K90B 1A90A 3IMAB 2FNQA 5IG4A 5IG3A 1O7MB 2W9PA 1WMPA 3T0UA 1K41A 2HMJB 3LXUX 1M1K4 2WGOA 1SPUA 2PNCA 5AI1A 1R4CA 1JB5A 2YFLB 3EBTA 3JUQA 4PEJA 3UJMA 3UL6A 4FCMA 3DY5A 1ULIB 4MJDA 1WTHA 1RN7A 3SVAA 2Z77A 3CC23 1IVWA 5STDA 1VQ63 4KVHA 4MMXB 4WYKB 4FCJA 2P09A 1JKGA 1IU7A 3DXOA 3CC43 5LC7A 1W4NA 3HIGA 3U97A 3F7SA 3PGBA 1STFI 3NQYA 2R4IA 1D6YA 4FMDA 1VQP3 1TUHA 3B4PA 4HM0B 2F99A 1OHPA 1W5ZA 5EEOA 1KC84 3VSYA 2CK3H 3QRDA 3BNDA 2GEXA 2JDIH 2XFTA 1CEWI 1BUQA 3WOFB 1LVNA 2RFRA 2BMOB 3HX8A 1IQ8A 4HM1B 3FLJA 3KSED 3MKIA 3CPOA 2MC8A 3KFQC 2RSXA 3NV0A 1UI7A 1VQL3 4EBGA 4FCZA 5AIGA 1NJI4 1Q864 4J9AA 3K63A 3KN4A 3NQZA 1YGEA 1KD14 1SIIA 2K54A 4XDWA 1Q42A 2P0XA 3JVCA 4KFDA 3PCSA 3DUKA 3OWUA 2F98A 1GD3A 4STDA 3RGAA 3SXXA 1K28A 2A15A 3KZTA 4G1MB 1VQ53 1TFKA 2LYXA 5I97A 2QIYA 5CF1A 3UL5A 4O2HA 1NB5I 3I0YA 1EG9B 1OHOA 4QWTA 3DGLA 1DYUA 3MG1A 4WYKA 3K9MC 2P0MA 2W9QA 2W56B 1Q814 2CWUA 2GBWB 1DMMA 3KE7A 4BTXA 3EHCA 2QGUA 3CCL3 4XBXA 4LEHA 2PZVA 3NHXA 1GY5A 2Z6BA 4HM3B 1NWWA 2YFJB 2FGTA 4R80A 1T5YA 1G96A 3F8HA 2C11A 1W2B2 1QVF2 3OWYA 2CH9A 3PS8A 4RZMA 2K0MA 3HK4A 3MG3A 1IV7A 4RNYA 5DRVA 2OWPA 3DGMA 4O8SA 4WP5A 5IEOA 3F40A 3X3ZA 3F9SA 3U1WA 3I563 1IDPA 1FA3A 1IQXA 1VQK3 3CC73 3S28A 5DREA 3JUNA 4K61A 1Q40B 1QAFA 1OCVA 3J7Yd 1O7NB 5CLKA 3F14A 1GY7A 1W02A 1ROAA 1IT7A 3OXAA 5IG0A 2GXFA 4J8TA 2BO9B 3B7CA 3F7XA 2Y73A 1W6CA 1ASKA 1S723 4I4KA 2ZL8A 3MWZA 1N8R4 2HMLB 1IK3A 3CPW2 4RNZA 1JKGB 3CCE3 4EV5A 4NHFA 4XM4A 1OHSA 3NM2A 1DMQA 2F86B 2W56A 2V1LA 5JBSA 4WFOA 3CCV3 1A67A 6STDA 3DGNA 1J2BA 1AVKA 2C10A 3E99A 4RBNA 4BTWA 3EN8A 1O7HB 4K1VA 4IIAA 3FG4A 1PFPA 5AYRB 3G6E3 1FGOA 1VZZA 3DMCA 2XR8B 3UNLA 3SLUA 2KCDA 1N5HA 3NX0A 3MG2A 4N6UA 2WO0A 4FMAA 3FF0A 4R9LA 1VQM3 4XBTA 3MSOA 2QA43 2LQVA 1Q40A 3EX9A 1AV4A 2BHMA 1VQN3 3LH4A 2ML5A 3T8UA 3H3HA 3NBRA 4H61A 3SEDA 4EYCA 1ULJB 1N8QA 2XEPA 2XSOB 3GZBA 1QALA 1QAKA 3BB9A 3I553 1ISKA 1F8NA 4JRFA 2XGLA 3N9HA 4KZ1A 1OGXA 3CU3A 1K734 3N8BA 2OQEC 3HIIA 4WWUC 5KP3A 1KWIA 5CK6A 5IW9A 1EKMA 3EBYA 4HZBB 2HMNB 2RCDA 4N6TA 1JRQA 3HI7A 1VQ73 2RGQA 1PU4A 1ZX2A 3FGYA 3GZYB 5AIHA 2E2TA 1STDA 2FXTA 1M1XB 4O02B 3OX9A 1NB3I 2D1WA 3DM8A 4HYZA 1M904 3CCR3 5AYSC 2ZDJA 5D82A 3Q2PA 3GZXB 3V92A 2BNGA 1UW1A 3BNCA 3N54B 4AKYA 2XRXB 4CCVA 4N6NB 2OOVC 3LTDA 3EE1A 3HZPA 4X2HA 4EV2A 2B1XB 1NU3A 1NDOB 1UUWB 2MF7A 5AEWB 1LOXA 2P05A 1E3RA 4K1UA 2Y74A 2HMMB 1WNHA 4R1KA 3F8XA 1YIJ3 1A2KA 2SBLA 1D6ZA 3L0RA 2GU1A 3RGRA 3CNMA 3D9RA 3D3LA 5BVBA 3V98A 2Z7AA 1JV2B 1E97A 5KP4A 4MMZB 3LTBA 4R4KA 7STDA 2XFSA 1AR0A 4XB5A 1N9EA 2WOHA 3CCM3 3CCQ3 3FG3A 4HM8B 2CFWA 2XF3A 1IV9A 3FH1A 3K7CA 3WA2X 1CYVA 4HM6B 3T8NA 1W6GA 3WA3A 3EQQB 1SJWA 1DVCA 4LZIA 1Q7Y4 3S5CA 1V74A 1VQ83 2UX0A 8CHOA 3X40A 1TFOA 4Q53A 1OGZA 5AIFA 2XSHB 1W00A 3BNBA 2E2VA 3G16A 1YJ93 3IPTA 3EJVA 1MNLA 1FGMA 4R9KA 5CF2A 3EC9A 2OCTA 1HKXA 1C7HA 1GY6A 1DMNA 2IUJA 4L8PA 4OUQA 2W0QA 4FMCA 1OACA 2OTL3 1O7WB 1M9GA 1HU9A 1W01A 5IEPA 3FCSB 1VQ43 1QJGA 1Z1SA 2YFIB 3GRDA 2CW9A 2CWTA 3Q1CA 4LSOA 4HZ9B 4HKVB 3X42A 3CCU3 1JN5B 2GU3A 2Q07A 2L4VA 5A0OB 1YIT3 3BLZA 1N5PA 5JPUA 1KSIA 3RDEA 1TIJA 5D83A 4HM2B 4L7KA 3WODG 1YI23 4ORLA 1U5OA 3LMLA 2KRTA 4IPBA 4BTYA 4L8OA 1GYBA 3S29A 1IVUA 3JUMA 5IF6A 3OWSA 1OH0A 3NBBA 3GZRA 1YJN3 1JJ22 2WGQA 2CFLA 2GBXB 3NBJA 1Y4KA 5ELJA 2OTJ3 3LT8A 3NUVA 3TDGA 2CFGA 4O3VA 4NREA 1JB2A 1JNQA 1ZO2A 2E2UA 2INXA 1YHQ3 1RJOA 3PZWA 2QEX3 2CWVA 4LMIA 3SOAA 4HM7B 1CYUA 3M8CA 1E3VA 2JQ5A 4CDLA 4KFEA 3EB8A 4GL6A 4HM5B 2IUKA 3EN1B 3B4OA 3KIIA 2HMOB 3ALAA 3WMDA 5EQLA 2BT3A 3LYGA 2CG0A 1UI8A 1JN5A 1IVVA 1RRHA 3ECFA 3H51A 4HBRA 3IJEB 3V99A 3CD63 2W6JH 1EQKA 1O7PB 2D42A 2IA7A 4MMYB 1VQ93
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3V A;  1OUN A;  5HGR A;  3JUO A;  1OPY A;  2CKF B;  1O7G B;  3FZW A;  3FF2 A;  5EVH A;  3STD A;  5G2G A;  5IEN A;  3FKA A;  2CHC A;  4XBY A;  3G0K A;  5BXQ A;  1JB4 A;  5IER A;  5D81 A;  5KP1 A;  3K0Z A;  3MHE A;  5CXO A;  3A76 A;  3JUP A;  1OF5 B;  4HJL B;  1UUV B;  2STD A;  1W6Y A;  5AII A;  2BMQ B;  1QMA A;  2GEY A;  2I9W A;  3KSP A;  2W2C A;  4H3U A;  3ER7 A;  4GB5 A;  3ROB A;  3MYT A;  4HVN A;  3KKG A;  3B8L A;  2IMJ A;  4XDV A;  1EA2 A;  1TP6 A;  4HM4 B;  2HMK B;  3G8Z A;  1S5A A;  3SOY A;  2BMR B;  1GS3 A;  3GWR A;  3NXJ A;  4X2O A;  5AEU B;  5TGN A;  1CQS A;  5IG5 A;  4OVM A;  2Z76 A;  3Q90 A;  3OV4 A;  3CNX A;  3EF8 A;  1OF5 A;  3LZA A;  3FSD A;  4LGQ A;  5JPP A;  3VGN A;  5FW5 A;  2B24 B;  1WQL B;  4U13 A;  3DZL A;  3NV0 B;  5IG4 A;  5IG3 A;  1O7M B;  1K41 A;  2HMJ B;  5AI1 A;  3UJM A;  1JB5 A;  2YFL B;  3EBT A;  3JUQ A;  4PEJ A;  4FCM A;  1ULI B;  4MJD A;  2Z77 A;  5STD A;  4KVH A;  4WYK B;  4FCJ A;  1JKG A;  3DXO A;  3F7S A;  2R4I A;  1TUH A;  3B4P A;  4HM0 B;  2F99 A;  1OHP A;  3VSY A;  2GEX A;  1BUQ A;  2RFR A;  2BMO B;  3HX8 A;  4HM1 B;  3FLJ A;  3MKI A;  3CPO A;  3NV0 A;  5AIG A;  4J9A A;  2K54 A;  4XDW A;  1Q42 A;  3DUK A;  3OWU A;  2F98 A;  4STD A;  3RGA A;  2A15 A;  3KZT A;  2QIY A;  5CF1 A;  3I0Y A;  1EG9 B;  1OHO A;  3MG1 A;  4WYK A;  2GBW B;  1DMM A;  3KE7 A;  3EHC A;  2QGU A;  4XBX A;  4LEH A;  2PZV A;  3NHX A;  1GY5 A;  4HM3 B;  1NWW A;  2YFJ B;  3F8H A;  3OWY A;  4RZM A;  3HK4 A;  3MG3 A;  5DRV A;  2OWP A;  4WP5 A;  5IEO A;  3F40 A;  3F9S A;  1IDP A;  5DRE A;  3JUN A;  1Q40 B;  1OCV A;  1O7N B;  5CLK A;  3F14 A;  1GY7 A;  1W02 A;  5IG0 A;  3OXA A;  2GXF A;  4J8T A;  3B7C A;  3F7X A;  1ASK A;  4I4K A;  2HML B;  1JKG B;  4XM4 A;  1OHS A;  3NM2 A;  1DMQ A;  2F86 B;  6STD A;  3E99 A;  3EN8 A;  1O7H B;  4K1V A;  4IIA A;  1VZZ A;  3DMC A;  2XR8 B;  3UNL A;  3MG2 A;  3FF0 A;  4R9L A;  4XBT A;  3MSO A;  1Q40 A;  3EX9 A;  3T8U A;  3H3H A;  3NBR A;  3SED A;  1ULJ B;  2XSO B;  3GZB A;  3BB9 A;  1ISK A;  1OGX A;  3CU3 A;  4WWU C;  5KP3 A;  5CK6 A;  3EBY A;  4HZB B;  2HMN B;  2RCD A;  2RGQ A;  1ZX2 A;  3FGY A;  3GZY B;  5AIH A;  1STD A;  3OX9 A;  3DM8 A;  5D82 A;  3GZX B;  2BNG A;  2XRX B;  3HZP A;  4X2H A;  2B1X B;  1NU3 A;  1NDO B;  1UUW B;  5AEW B;  1E3R A;  4K1U A;  2HMM B;  4R1K A;  3F8X A;  1A2K A;  3RGR A;  3CNM A;  3D9R A;  5BVB A;  2Z7A A;  1E97 A;  5KP4 A;  7STD A;  1AR0 A;  4XB5 A;  4HM8 B;  3FH1 A;  3K7C A;  4HM6 B;  3T8N A;  3EQQ B;  1SJW A;  3S5C A;  2UX0 A;  8CHO A;  4Q53 A;  1OGZ A;  5AIF A;  2XSH B;  1W00 A;  3G16 A;  3IPT A;  3EJV A;  4R9K A;  5CF2 A;  3EC9 A;  1HKX A;  1C7H A;  1GY6 A;  1DMN A;  4L8P A;  4OUQ A;  1O7W B;  5IEP A;  1W01 A;  1QJG A;  1Z1S A;  2YFI B;  3GRD A;  4HZ9 B;  4HKV B;  1JN5 B;  3BLZ A;  5JPU A;  5D83 A;  4HM2 B;  4L7K A;  4ORL A;  1U5O A;  4L8O A;  1GYB A;  3JUM A;  5IF6 A;  3OWS A;  1OH0 A;  3GZR A;  2GBX B;  3NUV A;  1JB2 A;  1ZO2 A;  2INX A;  4LMI A;  3SOA A;  4HM7 B;  3M8C A;  1E3V A;  2JQ5 A;  4CDL A;  4HM5 B;  3EN1 B;  3B4O A;  2HMO B;  3WMD A;  3LYG A;  1JN5 A;  3ECF A;  3H51 A;  1O7P B; 
#chains in the Genus database with same CATH topology
 2F5W A;  1FGR A;  4ZM8 A;  4N3V A;  3O8Y A;  1LNI A;  1OUN A;  5HGR A;  3JUO A;  1OPY A;  1RGE A;  1O7G B;  2CKF B;  2GSP A;  2L1S A;  3FZW A;  3PCR A;  2CC3 A;  1DVD A;  1G02 A;  1TJD A;  3D79 A;  3FF2 A;  3LOY A;  5EVH A;  1W2Z A;  4FMB A;  3CME 3;  4NPB A;  5ELU A;  2XH9 A;  5FGO A;  3STD A;  4CPK A;  4AKZ A;  1ROV A;  3LT9 A;  5G2G A;  5IEN A;  1WMN A;  3FKA A;  2CHC A;  3HOH A;  4XBY A;  4N6M A;  4ILF A;  3S67 A;  4WHA A;  1QVG 2;  1SIH A;  5G1K A;  3DGO A;  1TU5 A;  1FYS A;  1LXE A;  3PXM A;  3D5G A;  3QK9 A;  2CFK A;  3K5T A;  3X3Y A;  1WMO A;  3G0K A;  2ML6 A;  1UCL A;  1MWU A;  4KFF A;  1D6U A;  1R4Y A;  1FUT A;  1UUG B;  1W7C A;  1I3I A;  1YVS A;  1B3S A;  5BXQ A;  1BRG A;  1JB4 A;  3MPH A;  5IER A;  4DKI A;  3DGY A;  4N6O B;  5D81 A;  1VQQ A;  5KP1 A;  3OW2 2;  1RDS A;  1RKY A;  3K0Z A;  3MHE A;  1Q82 4;  3AGO A;  2KXG A;  5CXO A;  1K9M 4;  1RGC A;  1UGI A;  3A76 A;  3JUP A;  7GSP A;  3AMO B;  1EEJ A;  1AY7 A;  1OF5 B;  1US1 A;  4HJL B;  1K8A 4;  1UUV B;  3BNE A;  1NNV A;  2STD A;  1W6Y A;  3G71 3;  4MEI A;  4TX4 A;  2WOF A;  5AII A;  2C4B A;  7RNT A;  2P38 A;  2BMQ B;  3WOE B;  1QMA A;  2CIU A;  2UUG C;  1UCK A;  1GOV A;  1BRJ A;  2W03 A;  1LNH A;  3GAX A;  4N6L A;  3ZFZ A;  3CCS 3;  2GEY A;  3LTA A;  4I5Q A;  2I9W A;  1MOL A;  3KSP A;  3S27 A;  3ZG5 A;  4EC6 A;  2W2C A;  1I2F A;  1YJW 3;  2OQE A;  4H3U A;  3FG1 A;  3ER7 A;  4GB5 A;  1IQY A;  3ROB A;  2CG1 A;  3MYT A;  4HVN A;  3KKG A;  3B8L A;  2H0H A;  2IMJ A;  1BUJ A;  1FUW A;  3X3X A;  2CFD A;  2XGN A;  4XDV A;  1NO3 A;  3UB1 A;  1EA2 A;  4N6V 0;  1TP6 A;  4HM4 B;  1IVX A;  2HMK B;  4IT7 A;  6GSP A;  1A2V A;  1FZU A;  4FR9 A;  4AEQ A;  1YVB I;  2W04 A;  3G8Z A;  1VQO 3;  3RNT A;  1RGH A;  4BU4 A;  1B27 A;  1TTO A;  1GS3 A;  1S5A A;  2BMR B;  3GWR A;  2O3O A;  3NXJ A;  3SOY A;  1AVL A;  1RN1 A;  1N9J A;  1SQW A;  3CXC 2;  1B2M A;  4X2O A;  5AEU B;  1JZO A;  1CQS A;  5TGN A;  5IG5 A;  3WDG B;  3WHO A;  1BRH A;  1BU4 A;  2M7O A;  2F4Y A;  1BIR A;  1MGW A;  2UGI A;  3DH2 A;  2Z76 A;  4OVM A;  3AHS A;  1U8C B;  6RNT A;  5LC6 A;  4JF8 A;  3SX1 A;  3X41 A;  3Q90 A;  3AMO A;  3OV4 A;  1IT8 A;  3CNX A;  1OF5 A;  3EF8 A;  4OK0 A;  4EXR A;  1L5G B;  1KQS 2;  1FGQ A;  3LTC A;  2OOV A;  3LZA A;  3VF1 A;  2YX9 A;  3FSD A;  3G4S 3;  4LGQ A;  5JPP A;  3NM7 A;  3VGN A;  2BIR A;  1FGT A;  3PYJ A;  5FW5 A;  2B24 B;  3CCJ 3;  1WQL B;  4U13 A;  3DZL A;  3CMA 3;  1GD4 A;  1RRL A;  3NV0 B;  2O9U X;  4K90 B;  1A90 A;  3IMA B;  2FNQ A;  5IG4 A;  1GOU A;  5M19 A;  5IG3 A;  1O7M B;  2W9P A;  1WMP A;  3T0U A;  1K41 A;  2HMJ B;  1I8V A;  3LXU X;  3URP A;  1M1K 4;  1JBR A;  2WGO A;  1BRN L;  1SPU A;  2RNT A;  2PNC A;  5AI1 A;  1R4C A;  1JB5 A;  2YFL B;  3EBT A;  3JUQ A;  4PEJ A;  5GSP A;  3UJM A;  4FCM A;  3DY5 A;  1ULI B;  4MJD A;  1WTH A;  1RN7 A;  3SVA A;  3UL6 A;  2Z77 A;  3CC2 3;  1IVW A;  5STD A;  1VQ6 3;  4KVH A;  4MMX B;  4WYK B;  4FCJ A;  1BSB A;  2P09 A;  1BSD A;  1JKG A;  1IU7 A;  1RGA A;  1RMS A;  1LOW A;  3DXO A;  5LC7 A;  3CC4 3;  1W4N A;  3BU4 A;  3HIG A;  3U97 A;  3F7S A;  3PGB A;  4L8O A;  1STF I;  3NQY A;  2R4I A;  4BL3 A;  1D6Y A;  4FMD A;  3SYU A;  1TUH A;  3B4P A;  1VQP 3;  2CX0 A;  3ZG0 A;  4HM0 B;  2F99 A;  1OHP A;  1PYL A;  1W5Z A;  5EEO A;  1KC8 4;  3VSY A;  2CK3 H;  3QRD A;  3BND A;  2GEX A;  1RCL A;  2JDI H;  4RNT A;  2XFT A;  1CEW I;  3D4A A;  1BUQ A;  1AQZ A;  1LVN A;  2RFR A;  3WOF B;  2BMO B;  1DET A;  1IQ8 A;  1MWT A;  3HX8 A;  4HM1 B;  1EUI C;  3FLJ A;  3KSE D;  3MKI A;  3CPO A;  2MC8 A;  3KFQ C;  1A2P A;  2RSX A;  1B2S A;  3NV0 A;  1UI7 A;  1VQL 3;  1ZGX A;  1RCK A;  4EBG A;  1PY3 A;  1TRQ A;  4FCZ A;  5AIG A;  4J9A A;  3K63 A;  3KN4 A;  3NQZ A;  1Q86 4;  1NJI 4;  1YGE A;  1KD1 4;  1SII A;  2AAE A;  2K54 A;  1BRS A;  4J5G A;  4XDW A;  1Q42 A;  2P0X A;  3WR2 A;  3JVC A;  4KFD A;  3PCS A;  3DUK A;  3OWU A;  2F98 A;  1GD3 A;  4STD A;  3RGA A;  3SXX A;  1BSA A;  1K28 A;  2A15 A;  3KZT A;  4G1M B;  1VQ5 3;  1BNI A;  1TFK A;  2LYX A;  5I97 A;  2QIY A;  5CF1 A;  3UL5 A;  4O2H A;  1NB5 I;  3I0Y A;  1EG9 B;  1OHO A;  4QWT A;  3DGL A;  1DYU A;  3MG1 A;  4WYK A;  1RTU A;  3K9M C;  2P0M A;  2W9Q A;  4LYL B;  2W56 B;  1Q81 4;  2CWU A;  2AAD A;  2GBW B;  1DMM A;  3KE7 A;  4BTX A;  1X1X A;  3EHC A;  1I2G A;  1RGL A;  1X1U A;  2QGU A;  3CCL 3;  4XBX A;  4LEH A;  3BIR A;  2PZV A;  3NHX A;  1GY5 A;  3Q3F A;  2Z6B A;  1CH0 A;  2KAA A;  1NWW A;  2YFJ B;  1FUS A;  1T3B A;  2FGT A;  4HM3 B;  1T5Y A;  4R80 A;  5BU4 A;  1G96 A;  3F8H A;  2C11 A;  1W2B 2;  1QVF 2;  3OWY A;  2CH9 A;  3PS8 A;  4RZM A;  2K0M A;  3HK4 A;  3MG3 A;  1IV7 A;  1LOY A;  4RNY A;  5DRV A;  2OWP A;  1SAR A;  3DGM A;  1UGH I;  4O8S A;  4WP5 A;  5IEO A;  3F40 A;  3X3Z A;  4BIR A;  3F9S A;  3U1W A;  3AHW A;  1IDP A;  3I56 3;  1FA3 A;  1IQX A;  1VQK 3;  3CC7 3;  3S28 A;  5DRE A;  3JUN A;  4K61 A;  5HOH A;  1Q40 B;  1QAF A;  1OCV A;  2CX1 A;  8RNT A;  3J7Y d;  1O7N B;  5CLK A;  3F14 A;  1GY7 A;  1W02 A;  5BIR A;  1ROA A;  1IT7 A;  1HYF A;  3OXA A;  2GXF A;  5IG0 A;  1DE3 A;  4J8T A;  2BO9 B;  3B7C A;  2R41 A;  1W6C A;  1ASK A;  2Y73 A;  3F7X A;  1S72 3;  2KF6 A;  2ZL8 A;  3MWZ A;  4I4K A;  1N8R 4;  2HML B;  1IK3 A;  3CPW 2;  4RNZ A;  1JKG B;  3CCE 3;  4EV5 A;  2KF4 A;  4NHF A;  4XM4 A;  2HOH A;  1OHS A;  3NM2 A;  1DMQ A;  2F86 B;  2W56 A;  2V1L A;  1RNB A;  5JBS A;  4WFO A;  3CCV 3;  1A67 A;  6STD A;  3DGN A;  1BOX A;  1J2B A;  1AVK A;  2C10 A;  3E99 A;  4RBN A;  4BTW A;  3EN8 A;  1O7H B;  1I0X A;  4IIA A;  4K1V A;  3FG4 A;  1PFP A;  5AYR B;  3G6E 3;  1FGO A;  1VZZ A;  1G0T A;  1V58 A;  3DMC A;  1LQM B;  1I0V A;  1BGS A;  2XR8 B;  3UNL A;  3GSP A;  1B2U A;  2IY2 A;  3SLU A;  2KCD A;  1N5H A;  2SAR A;  1T2I A;  3NX0 A;  3MG2 A;  4N6U A;  1FW7 A;  2WO0 A;  4FMA A;  3FF0 A;  4R9L A;  1VQM 3;  4XBT A;  3MSO A;  2QA4 3;  2LQV A;  1Q40 A;  3EX9 A;  1AV4 A;  2BHM A;  1VQN 3;  3LH4 A;  2ML5 A;  3T8U A;  3A5E A;  3H3H A;  3NBR A;  4H61 A;  1BNE A;  1RGF A;  3SED A;  4EYC A;  1ULJ B;  1N8Q A;  2XEP A;  2XSO B;  3GZB A;  1QAL A;  1QAK A;  1BSC A;  3BB9 A;  3I55 3;  1ISK A;  1F8N A;  4JRF A;  2XGL A;  3N9H A;  4KZ1 A;  1OGX A;  3CU3 A;  1K73 4;  3N8B A;  2OQE C;  3HII A;  2F5M A;  4WWU C;  1KWI A;  5KP3 A;  5CK6 A;  5IW9 A;  1EKM A;  3EBY A;  4HZB B;  2HMN B;  2RCD A;  4N6T A;  1BNS A;  1JRQ A;  3HI7 A;  1VQ7 3;  2RGQ A;  4HAA A;  1PU4 A;  1ZX2 A;  1B2Z A;  3FGY A;  3GZY B;  1BNF A;  5AIH A;  2E2T A;  1STD A;  1TRP A;  2FXT A;  1YGW A;  1M1X B;  1RNT A;  1JBT A;  4O02 B;  3OX9 A;  1NB3 I;  2D1W A;  3DM8 A;  4HYZ A;  1I70 A;  1M90 4;  3CCR 3;  5AYS C;  1UCI A;  2ZDJ A;  5D82 A;  3Q2P A;  3GZX B;  3V92 A;  2BNG A;  1RGG A;  1B21 A;  1UW1 A;  3BNC A;  3N54 B;  4AKY A;  2XRX B;  4CCV A;  4N6N B;  1BSE A;  4BL2 A;  2OOV C;  3LTD A;  3EE1 A;  3HZP A;  4X2H A;  1RSN A;  9RNT A;  4EV2 A;  1RHL A;  2B1X B;  1NU3 A;  1NDO B;  1UUW B;  2MF7 A;  5AEW B;  1LOX A;  2P05 A;  1E3R A;  4K1U A;  1LOV A;  2Y74 A;  2HMM B;  1WNH A;  4R1K A;  1IYY A;  3F8X A;  1YIJ 3;  1A2K A;  1GMR A;  2SBL A;  1D6Z A;  3L0R A;  2KF3 A;  2GU1 A;  3RGR A;  1MGR A;  4CJN A;  3CNM A;  3D9R A;  3D3L A;  2ZA4 A;  1GSP A;  5BVB A;  3V98 A;  2Z7A A;  1JV2 B;  1E97 A;  5KP4 A;  4MMZ B;  3LTB A;  4R4K A;  7STD A;  2XFS A;  3D5I A;  1BAO A;  1AR0 A;  4XB5 A;  1N9E A;  2WOH A;  3CCM 3;  2K3D A;  3CCQ 3;  3FG3 A;  4HM8 B;  2CFW A;  2XF3 A;  1IV9 A;  3FH1 A;  3K7C A;  2KF5 A;  3WA2 X;  1CYV A;  4HM6 B;  3T8N A;  1W6G A;  3WA3 A;  1RLS A;  3EQQ B;  1SJW A;  1DVC A;  1I3F A;  4LZI A;  1Q7Y 4;  3S5C A;  1V74 A;  1VQ8 3;  2UX0 A;  8CHO A;  3X40 A;  4EW5 A;  1TFO A;  4Q53 A;  1OGZ A;  5AIF A;  1B2X A;  1BRI A;  2XSH B;  1GOY A;  1W00 A;  3BNB A;  2E2V A;  3G16 A;  1YJ9 3;  1BNJ A;  2IA7 A;  3IPT A;  3EJV A;  1MNL A;  1FGM A;  1B20 A;  4R9K A;  3EC9 A;  5CF2 A;  2F56 A;  2OCT A;  1JBS A;  1HKX A;  1C7H A;  1GY6 A;  1UCJ A;  1DMN A;  2IUJ A;  4L8P A;  1HZ1 A;  4OUQ A;  2W0Q A;  4FMC A;  1BRK A;  1OAC A;  2OTL 3;  1O7W B;  5IEP A;  1HU9 A;  1W01 A;  3FCS B;  1VQ4 3;  1BAN A;  1QJG A;  1Z1S A;  2YFI B;  3GRD A;  1MWS A;  2CW9 A;  2CWT A;  5RNT A;  3Q1C A;  4LSO A;  4HZ9 B;  5M18 A;  4HKV B;  1C54 A;  3X42 A;  3CCU 3;  1JN5 B;  2GU3 A;  2Q07 A;  1YNV X;  2L4V A;  5A0O B;  3BLZ A;  5M1A A;  1YIT 3;  1N5P A;  5JPU A;  1KSI A;  3RDE A;  1TIJ A;  5D83 A;  1BVI A;  2IYJ A;  4HM2 B;  4L7K A;  3WOD G;  1YI2 3;  4ORL A;  4GHO A;  1U5O A;  3LML A;  2KRT A;  2H0I A;  4IPB A;  4BTY A;  2RBI A;  1I2E A;  2BU4 A;  1BNG A;  1GYB A;  1LRA A;  1IVU A;  1GMQ A;  1MWR A;  1RGK A;  3JUM A;  3OWS A;  1JZD A;  3S29 A;  1OH0 A;  3NBB A;  5IF6 A;  2J8X B;  3GZR A;  1Q7H A;  4KT3 B;  2H0G A;  1YJN 3;  1JJ2 2;  2WGQ A;  4GSP A;  2CFL A;  2GBX B;  3NBJ A;  1Y4K A;  4J5K A;  5ELJ A;  3LT8 A;  2OTJ 3;  3NUV A;  3TDG A;  2CFG A;  4O3V A;  4NRE A;  2ZHX B;  1JB2 A;  1JNQ A;  1ZO2 A;  2E2U A;  5G1L A;  1Q9E A;  1T2H A;  2INX A;  1RJO A;  1YHQ 3;  1RN4 A;  3PZW A;  2QEX 3;  2CWV A;  4LMI A;  1V57 A;  3SOA A;  4HM7 B;  1CYU A;  3M8C A;  1E3V A;  2JQ5 A;  1BNR A;  4CDL A;  4KFE A;  3EB8 A;  4GL6 A;  4HM5 B;  2IUK A;  1GMP A;  3EN1 B;  3B4O A;  3KII A;  1X1W A;  3KCH A;  1ZS7 A;  2HMO B;  3ALA A;  4HOH A;  1X1Y A;  3WMD A;  5EQL A;  2BT3 A;  3LYG A;  1LQG C;  1UDI I;  1UI8 A;  2CG0 A;  1JN5 A;  1IVV A;  1RRH A;  3ECF A;  3H51 A;  4HBR A;  3IJE B;  3V99 A;  3CD6 3;  3AGN A;  2W6J H;  1EQK A;  1O7P B;  2D42 A;  1M9G A;  4MMY B;  1VQ9 3; 
#chains in the Genus database with same CATH homology
 1FGR A;  4ZM8 A;  4N3V A;  3O8Y A;  1OUN A;  5HGR A;  3JUO A;  1OPY A;  2CKF B;  1O7G B;  3FZW A;  3PCR A;  1DVD A;  2CC3 A;  3FF2 A;  3LOY A;  5EVH A;  3CME 3;  1W2Z A;  4FMB A;  5ELU A;  2XH9 A;  5FGO A;  3STD A;  4AKZ A;  1ROV A;  3LT9 A;  5G2G A;  5IEN A;  1WMN A;  3FKA A;  2CHC A;  4XBY A;  4N6M A;  3S67 A;  4WHA A;  1QVG 2;  1SIH A;  3DGO A;  1TU5 A;  1LXE A;  3PXM A;  3QK9 A;  2CFK A;  3K5T A;  3X3Y A;  1WMO A;  3G0K A;  2ML6 A;  4KFF A;  1D6U A;  1W7C A;  5BXQ A;  1JB4 A;  3MPH A;  5IER A;  4N6O B;  5D81 A;  5KP1 A;  3OW2 2;  1RKY A;  3K0Z A;  3MHE A;  1Q82 4;  1K9M 4;  2KXG A;  5CXO A;  3A76 A;  3JUP A;  3AMO B;  1OF5 B;  1US1 A;  1K8A 4;  4HJL B;  1UUV B;  3BNE A;  2STD A;  1W6Y A;  3G71 3;  4MEI A;  4TX4 A;  2WOF A;  5AII A;  2P38 A;  2BMQ B;  3WOE B;  1QMA A;  2CIU A;  2W03 A;  1LNH A;  3GAX A;  4N6L A;  3CCS 3;  2GEY A;  3LTA A;  3S27 A;  2I9W A;  1MOL A;  3KSP A;  4EC6 A;  2W2C A;  1YJW 3;  2OQE A;  4H3U A;  3FG1 A;  3ER7 A;  4GB5 A;  1IQY A;  3ROB A;  2CG1 A;  3MYT A;  4HVN A;  3KKG A;  3B8L A;  2IMJ A;  1FUW A;  3X3X A;  2CFD A;  2XGN A;  4XDV A;  1NO3 A;  3UB1 A;  1EA2 A;  4N6V 0;  1TP6 A;  4HM4 B;  1IVX A;  2HMK B;  4IT7 A;  1A2V A;  4FR9 A;  4AEQ A;  1YVB I;  2W04 A;  3G8Z A;  1VQO 3;  1GS3 A;  1S5A A;  2BMR B;  3GWR A;  2O3O A;  3NXJ A;  3SOY A;  1AVL A;  1SQW A;  1N9J A;  3CXC 2;  4X2O A;  5AEU B;  5TGN A;  1CQS A;  5IG5 A;  3WDG B;  2M7O A;  4OVM A;  2Z76 A;  1U8C B;  5LC6 A;  4JF8 A;  3SX1 A;  3X41 A;  3Q90 A;  3AMO A;  3OV4 A;  1IT8 A;  3CNX A;  1OF5 A;  3EF8 A;  4OK0 A;  4EXR A;  1L5G B;  1KQS 2;  1FGQ A;  3LTC A;  2OOV A;  3LZA A;  3VF1 A;  2YX9 A;  3FSD A;  3G4S 3;  4LGQ A;  5JPP A;  3NM7 A;  3VGN A;  1FGT A;  3PYJ A;  5FW5 A;  2B24 B;  3CCJ 3;  1WQL B;  4U13 A;  3DZL A;  3CMA 3;  1GD4 A;  1RRL A;  3NV0 B;  2O9U X;  4K90 B;  1A90 A;  3IMA B;  2FNQ A;  5IG4 A;  5IG3 A;  1O7M B;  2W9P A;  1WMP A;  3T0U A;  1K41 A;  2HMJ B;  3LXU X;  1M1K 4;  2WGO A;  1SPU A;  2PNC A;  5AI1 A;  1R4C A;  1JB5 A;  2YFL B;  3EBT A;  3JUQ A;  4PEJ A;  3UJM A;  3UL6 A;  4FCM A;  3DY5 A;  1ULI B;  4MJD A;  1WTH A;  1RN7 A;  3SVA A;  2Z77 A;  3CC2 3;  1IVW A;  5STD A;  1VQ6 3;  4KVH A;  4MMX B;  4WYK B;  4FCJ A;  2P09 A;  1JKG A;  1IU7 A;  3DXO A;  3CC4 3;  5LC7 A;  1W4N A;  3HIG A;  3U97 A;  3F7S A;  3PGB A;  1STF I;  3NQY A;  2R4I A;  1D6Y A;  4FMD A;  1VQP 3;  1TUH A;  3B4P A;  4HM0 B;  2F99 A;  1OHP A;  1W5Z A;  5EEO A;  1KC8 4;  3VSY A;  2CK3 H;  3QRD A;  3BND A;  2GEX A;  2JDI H;  2XFT A;  1CEW I;  1BUQ A;  3WOF B;  1LVN A;  2RFR A;  2BMO B;  3HX8 A;  1IQ8 A;  4HM1 B;  3FLJ A;  3KSE D;  3MKI A;  3CPO A;  2MC8 A;  3KFQ C;  2RSX A;  3NV0 A;  1UI7 A;  1VQL 3;  4EBG A;  4FCZ A;  5AIG A;  1NJI 4;  1Q86 4;  4J9A A;  3K63 A;  3KN4 A;  3NQZ A;  1YGE A;  1KD1 4;  1SII A;  2K54 A;  4XDW A;  1Q42 A;  2P0X A;  3JVC A;  4KFD A;  3PCS A;  3DUK A;  3OWU A;  2F98 A;  1GD3 A;  4STD A;  3RGA A;  3SXX A;  1K28 A;  2A15 A;  3KZT A;  4G1M B;  1VQ5 3;  1TFK A;  2LYX A;  5I97 A;  2QIY A;  5CF1 A;  3UL5 A;  4O2H A;  1NB5 I;  3I0Y A;  1EG9 B;  1OHO A;  4QWT A;  3DGL A;  1DYU A;  3MG1 A;  4WYK A;  3K9M C;  2P0M A;  2W9Q A;  2W56 B;  1Q81 4;  2CWU A;  2GBW B;  1DMM A;  3KE7 A;  4BTX A;  3EHC A;  2QGU A;  3CCL 3;  4XBX A;  4LEH A;  2PZV A;  3NHX A;  1GY5 A;  2Z6B A;  4HM3 B;  1NWW A;  2YFJ B;  2FGT A;  4R80 A;  1T5Y A;  1G96 A;  3F8H A;  2C11 A;  1W2B 2;  1QVF 2;  3OWY A;  2CH9 A;  3PS8 A;  4RZM A;  2K0M A;  3HK4 A;  3MG3 A;  1IV7 A;  4RNY A;  5DRV A;  2OWP A;  3DGM A;  4O8S A;  4WP5 A;  5IEO A;  3F40 A;  3X3Z A;  3F9S A;  3U1W A;  3I56 3;  1IDP A;  1FA3 A;  1IQX A;  1VQK 3;  3CC7 3;  3S28 A;  5DRE A;  3JUN A;  4K61 A;  1Q40 B;  1QAF A;  1OCV A;  3J7Y d;  1O7N B;  5CLK A;  3F14 A;  1GY7 A;  1W02 A;  1ROA A;  1IT7 A;  3OXA A;  5IG0 A;  2GXF A;  4J8T A;  2BO9 B;  3B7C A;  3F7X A;  2Y73 A;  1W6C A;  1ASK A;  1S72 3;  4I4K A;  2ZL8 A;  3MWZ A;  1N8R 4;  2HML B;  1IK3 A;  3CPW 2;  4RNZ A;  1JKG B;  3CCE 3;  4EV5 A;  4NHF A;  4XM4 A;  1OHS A;  3NM2 A;  1DMQ A;  2F86 B;  2W56 A;  2V1L A;  5JBS A;  4WFO A;  3CCV 3;  1A67 A;  6STD A;  3DGN A;  1J2B A;  1AVK A;  2C10 A;  3E99 A;  4RBN A;  4BTW A;  3EN8 A;  1O7H B;  4K1V A;  4IIA A;  3FG4 A;  1PFP A;  5AYR B;  3G6E 3;  1FGO A;  1VZZ A;  3DMC A;  2XR8 B;  3UNL A;  3SLU A;  2KCD A;  1N5H A;  3NX0 A;  3MG2 A;  4N6U A;  2WO0 A;  4FMA A;  3FF0 A;  4R9L A;  1VQM 3;  4XBT A;  3MSO A;  2QA4 3;  2LQV A;  1Q40 A;  3EX9 A;  1AV4 A;  2BHM A;  1VQN 3;  3LH4 A;  2ML5 A;  3T8U A;  3H3H A;  3NBR A;  4H61 A;  3SED A;  4EYC A;  1ULJ B;  1N8Q A;  2XEP A;  2XSO B;  3GZB A;  1QAL A;  1QAK A;  3BB9 A;  3I55 3;  1ISK A;  1F8N A;  4JRF A;  2XGL A;  3N9H A;  4KZ1 A;  1OGX A;  3CU3 A;  1K73 4;  3N8B A;  2OQE C;  3HII A;  4WWU C;  5KP3 A;  1KWI A;  5CK6 A;  5IW9 A;  1EKM A;  3EBY A;  4HZB B;  2HMN B;  2RCD A;  4N6T A;  1JRQ A;  3HI7 A;  1VQ7 3;  2RGQ A;  1PU4 A;  1ZX2 A;  3FGY A;  3GZY B;  5AIH A;  2E2T A;  1STD A;  2FXT A;  1M1X B;  4O02 B;  3OX9 A;  1NB3 I;  2D1W A;  3DM8 A;  4HYZ A;  1M90 4;  3CCR 3;  5AYS C;  2ZDJ A;  5D82 A;  3Q2P A;  3GZX B;  3V92 A;  2BNG A;  1UW1 A;  3BNC A;  3N54 B;  4AKY A;  2XRX B;  4CCV A;  4N6N B;  2OOV C;  3LTD A;  3EE1 A;  3HZP A;  4X2H A;  4EV2 A;  2B1X B;  1NU3 A;  1NDO B;  1UUW B;  2MF7 A;  5AEW B;  1LOX A;  2P05 A;  1E3R A;  4K1U A;  2Y74 A;  2HMM B;  1WNH A;  4R1K A;  3F8X A;  1YIJ 3;  1A2K A;  2SBL A;  1D6Z A;  3L0R A;  2GU1 A;  3RGR A;  3CNM A;  3D9R A;  3D3L A;  5BVB A;  3V98 A;  2Z7A A;  1JV2 B;  1E97 A;  5KP4 A;  4MMZ B;  3LTB A;  4R4K A;  7STD A;  2XFS A;  1AR0 A;  4XB5 A;  1N9E A;  2WOH A;  3CCM 3;  3CCQ 3;  3FG3 A;  4HM8 B;  2CFW A;  2XF3 A;  1IV9 A;  3FH1 A;  3K7C A;  3WA2 X;  1CYV A;  4HM6 B;  3T8N A;  1W6G A;  3WA3 A;  3EQQ B;  1SJW A;  1DVC A;  4LZI A;  1Q7Y 4;  3S5C A;  1V74 A;  1VQ8 3;  2UX0 A;  8CHO A;  3X40 A;  1TFO A;  4Q53 A;  1OGZ A;  5AIF A;  2XSH B;  1W00 A;  3BNB A;  2E2V A;  3G16 A;  1YJ9 3;  3IPT A;  3EJV A;  1MNL A;  1FGM A;  4R9K A;  5CF2 A;  3EC9 A;  2OCT A;  1HKX A;  1C7H A;  1GY6 A;  1DMN A;  2IUJ A;  4L8P A;  4OUQ A;  2W0Q A;  4FMC A;  1OAC A;  2OTL 3;  1O7W B;  1M9G A;  1HU9 A;  1W01 A;  5IEP A;  3FCS B;  1VQ4 3;  1QJG A;  1Z1S A;  2YFI B;  3GRD A;  2CW9 A;  2CWT A;  3Q1C A;  4LSO A;  4HZ9 B;  4HKV B;  3X42 A;  3CCU 3;  1JN5 B;  2GU3 A;  2Q07 A;  2L4V A;  5A0O B;  1YIT 3;  3BLZ A;  1N5P A;  5JPU A;  1KSI A;  3RDE A;  1TIJ A;  5D83 A;  4HM2 B;  4L7K A;  3WOD G;  1YI2 3;  4ORL A;  1U5O A;  3LML A;  2KRT A;  4IPB A;  4BTY A;  4L8O A;  1GYB A;  3S29 A;  1IVU A;  3JUM A;  5IF6 A;  3OWS A;  1OH0 A;  3NBB A;  3GZR A;  1YJN 3;  1JJ2 2;  2WGQ A;  2CFL A;  2GBX B;  3NBJ A;  1Y4K A;  5ELJ A;  2OTJ 3;  3LT8 A;  3NUV A;  3TDG A;  2CFG A;  4O3V A;  4NRE A;  1JB2 A;  1JNQ A;  1ZO2 A;  2E2U A;  2INX A;  1YHQ 3;  1RJO A;  3PZW A;  2QEX 3;  2CWV A;  4LMI A;  3SOA A;  4HM7 B;  1CYU A;  3M8C A;  1E3V A;  2JQ5 A;  4CDL A;  4KFE A;  3EB8 A;  4GL6 A;  4HM5 B;  2IUK A;  3EN1 B;  3B4O A;  3KII A;  2HMO B;  3ALA A;  3WMD A;  5EQL A;  2BT3 A;  3LYG A;  2CG0 A;  1UI8 A;  1JN5 A;  1IVV A;  1RRH A;  3ECF A;  3H51 A;  4HBR A;  3IJE B;  3V99 A;  3CD6 3;  2W6J H;  1EQK A;  1O7P B;  2D42 A;  2IA7 A;  4MMY B;  1VQ9 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...