3FF0A

Crystal structure of a phenazine biosynthesis-related protein (phzb2) from pseudomonas aeruginosa at 1.90 a resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
162
structure length
162
Chain Sequence
GMLDNAIPQGFEDAVELRRKNRETVVKYMNTKGQDRLRRHELFVEDGCGGLWTTDTGSPIVIRGKDKLAEHAVWSLKCFPDWEWYNIKVFETDDPNHFWVECDGHGKILFPGYPEGYYENHFLHSFELDDGKIKRNREFMNVFQQLRALSIPVPQIKREGIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of protein PhzB2 with cystatin-like fold and unknown function in phenazine biosynthesis (NP_250591.1) from PSEUDOMONAS AERUGINOSA at 1.90 A resolution
rcsb
source organism Pseudomonas aeruginosa
molecule tags Biosynthetic protein
molecule keywords Phenazine biosynthesis protein phzB 2
total genus 44
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03284 PHZA_PHZB Phenazine biosynthesis protein A/B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3ff0A01
4WYKB 5CLKA 3SOAA 4HKVB 3UNLA 3KKGA 4N3VA 1NWWA 2K54A 2GEXA 2GEYA 3VGNA 2GBWB 1AR0A 4PEJA 3DUKA 3G8ZA 2B24B 3DXOA 1DMQA 1ASKA 1OF5B 3FSDA 3I0YA 2HMLB 3D9RA 3OX9A 2F98A 1ZO2A 4HM3B 4HM1B 5BVBA 6STDA 3FF2A 3BLZA 4HM5B 3ECFA 4HZ9B 3EHCA 5AEWB 1GYBA 1E3RA 1E97A 1GS3A 2BMOB 5JPPA 1BUQA 4HM0B 4KVHA 3NM2A 2R4IA 5AIIA 3EN8A 2CKFB 3GWRA 2I9WA 4H3UA 3B8LA 1C7HA 1W00A 3MG2A 3B7CA 3MKIA 4HJLB 4XBYA 3F14A 3NV0A 1K41A 5STDA 3CPOA 2GBXB 2INXA 3F7XA 3CU3A 1Q40A 1OUNA 3LYGA 3KZTA 5AI1A 4FCJA 5D81A 3SOYA 4WP5A 1OHPA 1S5AA 3EC9A 1OHOA 2PZVA 3EQQB 1O7GB 2HMJB 3EN1B 3MG1A 3OWUA 5JPUA 4CDLA 3F9SA 4WWUC 3STDA 1EG9B 1TP6A 1CQSA 3DM8A 3FH1A 4GB5A 3F40A 3T8NA 1Q40B 1OH0A 5IG3A 1OGXA 1UUWB 2BMRB 5IG5A 5TGNA 1W02A 1OCVA 3FLJA 1OF5A 1JKGA 2BMQB 2BNGA 3GRDA 4XBTA 3UJMA 4OVMA 3MHEA 3SEDA 4HM6B 4J8TA 3RGAA 2RCDA 1ULIB 2RFRA 1ZX2A 3LZAA 4K1UA 1O7NB 3VSYA 4Q53A 2RGQA 2YFIB 3FGYA 2QIYA 1O7HB 3NXJA 3EJVA 3OWYA 2F99A 1JN5A 1OGZA 2Z76A 1JKGB 5CXOA 5KP1A 4HM7B 4X2HA 3S5CA 4XDVA 5AIGA 3K7CA 1GY6A 5BXQA 3MG3A 4HM4B 5AIFA 2W2CA 1O7PB 3B4OA 5IG0A 2XR8B 3B4PA 1SJWA 3DZLA 4J9AA 5CF2A 3CNMA 3EF8A 3GZXB 4RZMA 1ULJB 1JN5B 3A76A 4STDA 4U13A 8CHOA 3DMCA 1Z1SA 5IEOA 5AEUB 1W6YA 1DMNA 2YFJB 1JB5A 2QGUA 4HM2B 3GZRA 3OXAA 3ER7A 3FZWA 5KP3A 3H3HA 3GZYB 2HMNB 5IF6A 2YFLB 3Q90A 2IMJA 4LMIA 1U5OA 2XRXB 3EX9A 2GXFA 2Z7AA 3NUVA 4LGQA 3EBTA 4MJDA 5G2GA 3NBRA 3ROBA 1OPYA 1Q42A 3NHXA 4FCMA 3FF0A 4HVNA 1W01A 3E99A 3MYTA 3RGRA 5IERA 1QJGA 1UUVB 1NDOB 3EBYA 2XSHB 2XSOB 3JUNA 3OWSA 4IIAA 5DRVA 4L8PA 3HZPA 3JUQA 4R1KA 2F86B 4X2OA 2HMMB 3JUMA 3H51A 4L7KA 5IENA 5EVHA 2A15A 2B1XB 1VZZA 2UX0A 3MSOA 5D83A 2JQ5A 1JB2A 5DREA 3JUPA 3HX8A 2STDA 1ISKA 1E3VA 4OUQA 5D82A 3T8UA 1IDPA 4ORLA 1TUHA 2CHCA 2HMKB 5KP4A 5IEPA 4HM8B 5IG4A 5CF1A 4HZBB 3F8HA 3NV0B 4XDWA 4R9KA 3JUOA 1DMMA 1GY7A 1A2KA 4L8OA 1OHSA 3BB9A 2OWPA 3KE7A 3FKAA 2Z77A 3F7SA 1NU3A 3OV4A 3M8CA 4I4KA 3CNXA 4XB5A 1O7MB 1O7WB 3G16A 3HK4A 3KSPA 1STDA 3G0KA 3GZBA 4WYKA 4R9LA 4XBXA 4XM4A 5CK6A 1EA2A 1WQLB 3IPTA 4LEHA 1QMAA 5FW5A 5HGRA 1GY5A 3WMDA 3F8XA 1HKXA 2HMOB 3K0ZA 5AIHA 1JB4A 7STDA 4K1VA
chains in the Genus database with same CATH superfamily
2L1SA 1VQP3 3LT8A 4HKVB 1IQYA 2L4VA 1B2UA 4PEJA 3AHWA 1BANA 2AADA 2B24B 1DMQA 1OF5B 2BIRA 3DXOA 3HI7A 3OX9A 3DGLA 3U1WA 2P05A 4HM1B 6STDA 1LNHA 1LQMB 1DVCA 5LC6A 1IVWA 3EHCA 3URPA 1E3RA 1E97A 1EQKA 1BSAA 4JF8A 3X40A 1YIT3 1LOWA 3NM2A 3D4AA 4BU4A 5HOHA 3EN8A 2CKFB 3KSED 4RNTA 1TFKA 1UW1A 1RGHA 1C7HA 1FW7A 4HJLB 1WMOA 1IT8A 2INXA 3F7XA 1YHQ3 1BAOA 1KQS2 1DETA 3NM7A 4BIRA 3EQQB 1O7GB 2HMJB 1HYFA 3PYJA 3PXMA 4CDLA 1RHLA 1IVVA 4FCZA 1GOUA 2P0MA 1BRGA 1KSIA 1DE3A 1MWSA 3FG4A 5FGOA 4XBTA 2BMQB 3GRDA 2W9PA 3HIIA 3LTBA 1B2SA 2F5WA 4CCVA 3MHEA 1MNLA 6GSPA 3SEDA 1N8R4 3SXXA 1IQXA 2C10A 2OQEC 3LZAA 4Q53A 2YFIB 3LH4A 3X3ZA 3CC73 1BGSA 1B20A 1IV7A 1O7HB 1BIRA 2E2TA 2F99A 1JN5A 2Z76A 3OWYA 4O3VA 4O2HA 4HM7B 4X2HA 4XDVA 4N6OB 1GY6A 3SVAA 3HIGA 3NX0A 2OCTA 2D1WA 1RN1A 2XR8B 1BVIA 3DZLA 1PY3A 1ZS7A 1I3IA 2RSXA 1JN5B 1BRIA 2IUJA 3DMCA 1LOXA 1W6YA 1LRAA 1A90A 3CCM3 3FZWA 1V58A 1B2XA 1AVLA 3GZYB 1F8NA 2HMNB 3GAXA 3Q90A 4LMIA 4FR9A 4BTYA 1K9M4 2XRXB 1TTOA 3EX9A 4NREA 1TRPA 3NBRA 1BNFA 4FCMA 1N5PA 1W01A 3E99A 3MYTA 1Y4KA 3SYUA 2GU1A 1RGKA 3S27A 1NDOB 3U97A 3X3YA 5DRVA 5M18A 3K63A 1RTUA 6RNTA 3BU4A 3DGMA 3H51A 2P0XA 1CEWI 4H61A 5EVHA 2A15A 2B1XB 1VZZA 4DKIA 2UX0A 3MSOA 1ISKA 2W0QA 1RKYA 3WOEB 1JB2A 1M9GA 2STDA 2K3DA 4BTWA 1UUGB 3D79A 3WR2A 3T8UA 2CHCA 2HMKB 5IEPA 4HM8B 5IW9A 1Q814 3F8HA 4R9KA 1IQ8A 2C11A 1RLSA 3V98A 3BB9A 2CX1A 3OV4A 1VQ83 2BHMA 1U8CB 4OK0A 4J5GA 3HK4A 5CF1A 1STDA 1M904 4RNZA 4XBXA 1CYVA 4LEHA 1QMAA 2CFKA 5HGRA 2CFWA 1B2ZA 1TFOA 1HKXA 2HMOB 5EEOA 1JB4A 1FZUA 1K8A4 4K1VA 3CMA3 3WA3A 3KKGA 3DGYA 4N3VA 3PCRA 1I0XA 3BNBA 3GSPA 2KF3A 2GBWB 4O02B 1BUJA 4BTXA 3G8ZA 3FSDA 4BL2A 5BVBA 2F98A 1ZO2A 3FF2A 1JBTA 1AV4A 3BLZA 4HM5B 5JPPA 3QRDA 3IJEB 2BMOB 3WA2X 1BUQA 4HM0B 4KVHA 1T2IA 3GWRA 2FGTA 1EUIC 2CFGA 4H3UA 3B8LA 2CX0A 3MKIA 3B7CA 4MMZB 5JBSA 4CJNA 3NV0A 1NO3A 4EV2A 7RNTA 1I2GA 1M1K4 5M19A 2Z6BA 3AHSA 1BRNL 1IVXA 1RGFA 2SBLA 2YX9A 2Y74A 3KZTA 2H0HA 4FCJA 4N6V0 1Q7HA 3N54B 4KFDA 1W7CA 3HOHA 3SOYA 3V92A 1EEJA 1S5AA 4FMDA 1G0TA 1TJDA 1RMSA 1W4NA 4WWUC 3S67A 1KD14 2JDIH 3WHOA 1FUTA 1GMRA 3DM8A 1W6CA 4GB5A 3F40A 3CME3 3CCU3 1OH0A 2CG1A 2BT3A 2BMRB 3CCS3 3CC43 5TGNA 1FGTA 2OQEA 3S28A 2W9QA 1WMNA 4EXRA 3RGAA 1UCJA 4K61A 1I2EA 1ZX2A 1O7NB 1LVNA 2RGQA 1ZGXA 4HYZA 3CXC2 3EJVA 1FGMA 4R80A 4WHAA 1VQO3 1K28A 1JNQA 1LOVA 2MF7A 4KFFA 3LT9A 3K9MC 1YIJ3 3A5EA 2MC8A 4TX4A 3T0UA 3WODG 1BRSA 3OW22 2UGIA 1LQGC 3CNMA 3EF8A 3GZXB 4STDA 2OTL3 4MMYB 1I3FA 1T2HA 1UGHI 4LZIA 5IEOA 2QGUA 1RJOA 1YVSA 5KP3A 3CCL3 1X1WA 1A67A 3Q2PA 1BNJA 2XGNA 1UDII 1UCLA 2IUKA 3WDGB 1WTHA 1U5OA 3D5GA 4BL3A 1VQQA 2Z7AA 4LGQA 2Q07A 4KZ1A 1Q42A 3FF0A 1X1XA 3SLUA 1QVF2 2LQVA 5IERA 1SPUA 1J2BA 1RSNA 2OOVC 2XSOB 2CW9A 3JUNA 2WO0A 3OWSA 1FGRA 2XGLA 1STFI 3HZPA 3JUQA 1W2B2 1BSEA 1JV2B 9RNTA 2F86B 1W5ZA 2F56A 4IT7A 3AGNA 2IY2A 1SARA 1SIIA 4AEQA 3K5TA 3KN4A 5DREA 3HX8A 1VQN3 3L0RA 5D82A 2UUGC 1WNHA 1AQZA 3LTDA 1DVDA 1UGIA 4HZBB 1KC84 2KCDA 1W6GA 4XDWA 1GY7A 1UCKA 1A2VA 4EC6A 2F5MA 5I97A 3IMAB 3KE7A 3FKAA 2SARA 1YVBI 3ZG5A 4XM4A 1GMPA 3GZBA 1T5YA 4WYKA 1QAFA 1VQ43 1EA2A 1WQLB 1WMPA 4HBRA 2KF4A 5FW5A 3DGOA 1VQ73 3F8XA 1FA3A 1RRLA 1BNSA 1V74A 2KAAA 5AIHA 1MGWA 4EV5A 1JRQA 2ML5A 5CLKA 3SOAA 1MWTA 3ZG0A 5RNTA 1VQL3 4N6TA 7GSPA 3J7Yd 2K54A 2R41A 2AAEA 1NB3I 2ZDJA 4HOHA 3NQZA 1B27A 3VGNA 1NB5I 1GOYA 1ASKA 4ORLA 3MWZA 3I0YA 2HMLB 3D9RA 1X1YA 2OOVA 1MWUA 2WOHA 1C54A 5AEWB 2OTJ3 1GS3A 1BSCA 1YJW3 1VQ93 1MOLA 2R4IA 5AIIA 5ELJA 2CWTA 1ROVA 4EYCA 2ML6A 3D5IA 2WGQA 1W00A 4KFEA 1DYUA 4K90B 4XBYA 2O9UX 2XH9A 3CPOA 1BRJA 2GBXB 3CU3A 1B3SA 1Q40A 3LYGA 1UCIA 5AI1A 1OACA 1QAKA 2O3OA 3AGOA 4WP5A 2PZVA 5JPUA 3EN1B 1RNBA 2LYXA 2W56B 3F9SA 1I70A 3JVCA 1I0VA 1EG9B 3UL6A 1CQSA 2K0MA 2ZL8A 3CCV3 4QWTA 1UUWB 1BU4A 5BU4A 1W02A 1N5HA 2Y73A 1BSBA 3I553 1W2ZA 4HM6B 3LOYA 4J8TA 1US1A 4ZM8A 4J5KA 1RGCA 1ULIB 2RFRA 3VSYA 3X41A 3I563 1GD4A 3CD63 2ZA4A 1GD3A 2QIYA 1CYUA 5G1LA 1OGZA 4GHOA 5EQLA 3S5CA 1RGAA 5AIGA 1FYSA 1I2FA 3MG3A 5AIFA 2J8XB 3PZWA 1RN4A 3B4OA 2KXGA 5IG0A 2WOFA 3B4PA 1SJWA 1B2MA 1CH0A 3TDGA 4ILFA 5CF2A 1D6YA 4RZMA 3V99A 1TIJA 1Z1SA 1FGQA 1DMNA 1BSDA 1JZOA 4HM2B 1Q824 2KF5A 3GZRA 1BRKA 1R4YA 8RNTA 3G6E3 3UL5A 1V57A 1T3BA 3G713 2GXFA 3NUVA 5G2GA 1QALA 3NHXA 1AVKA 4HVNA 1RNTA 3KIIA 2W03A 4MMXB 2HOHA 1UUVB 1VQ53 2XSHB 4L8PA 1D6UA 1PYLA 1IU7A 4R1KA 5M1AA 1JBRA 4X2OA 3PS8A 4G1MB 1X1UA 5IENA 1LXEA 1KWIA 1YGWA 1TRQA 1FUWA 2FXTA 3KCHA 1MGRA 1G02A 1GMQA 1BNEA 1YNVX 2H0GA 3EB8A 3DY5A 3JUPA 1E3VA 1D6ZA 3Q1CA 4OUQA 3X3XA 3SX1A 2GSPA 1IDPA 4EBGA 5IG4A 1ROAA 2BU4A 1Q864 1BNRA 3JUOA 4L8OA 1A2KA 1OHSA 1K734 3CC23 3F7SA 4I4KA 1JBSA 4LSOA 1O7MB 1RRHA 3DGNA 3FCSB 3G0KA 1IVUA 5CK6A 4R9LA 2CC3A 2H0IA 2CIUA 3DH2A 1JJ22 3WMDA 1N8QA 3QK9A 7STDA 1LOYA 1Q9EA 4HAAA 4WYKB 1HZ1A 3NBJA 4N6NB 3UNLA 3BNDA 2E2VA 3RNTA 1NWWA 2GEXA 2GEYA 2PNCA 5BIRA 1AR0A 1IYYA 3AMOA 3DUKA 1PU4A 4HM3B 4EW5A 2P38A 2XFTA 4HZ9B 3ECFA 1GYBA 4MEIA 4FMCA 1A2PA 1RN7A 1NJI4 1R4CA 4I5QA 4FMAA 2E2UA 2I9WA 4GSPA 1L5GB 2C4BA 1JZDA 3BNCA 2XF3A 3MG2A 1I8VA 1VQ63 2WGOA 3F14A 2P09A 1K41A 3MPHA 1RGGA 5STDA 1MWRA 1OUNA 4N6UA 4NHFA 5LC7A 5D81A 5A0OB 4R4KA 2IYJA 1OHPA 3EC9A 1OHOA 3MG1A 3KFQC 5G1KA 3OWUA 3STDA 2CG0A 1SQWA 1TP6A 3FH1A 3T8NA 5IG3A 1Q40B 1OGXA 5IG5A 2QEX3 1OCVA 3FLJA 1OF5A 1JKGA 2BNGA 3UJMA 3CCQ3 4OVMA 2RNTA 2W56A 1UI7A 3FG1A 2CFLA 1VQK3 2RCDA 4K1UA 4O8SA 3FGYA 2ZHXB 2M7OA 3NXJA 1YI23 3BIRA 1JKGB 4RNYA 1M1XB 4JRFA 5CXOA 1SIHA 5BXQA 3LTCA 3K7CA 5KP1A 4HM4B 3EE1A 4KT3B 1UI8A 3N8BA 2W2CA 2W04A 1O7PB 3PGBA 1Q7Y4 2KRTA 1QVG2 3G4S3 3UB1A 4J9AA 1BNIA 1ULJB 2XEPA 1N9JA 3A76A 4U13A 8CHOA 1EKMA 4GL6A 3LTAA 2YFJB 1JB5A 3X42A 5ELUA 2GU3A 1GSPA 3ER7A 3OXAA 2V1LA 3H3HA 1NNVA 3Q3FA 3WOFB 5IF6A 2YFLB 3CPW2 4LYLB 1GOVA 2IMJA 1YJN3 2KF6A 2QA43 4MJDA 4FMBA 3ROBA 1RCLA 3N9HA 3EBTA 1B21A 1BNGA 1OPYA 2RBIA 4NPBA 3FG3A 3RGRA 1QJGA 3EBYA 4N6MA 4IIAA 1LNIA 3NQYA 5AYSC 2CWUA 1IV9A 2F4YA 1BRHA 2XFSA 2BO9B 5AYRB 4WFOA 2HMMB 3JUMA 1RGLA 2CK3H 2IA7A 3BNEA 4L7KA 2CFDA 5D83A 2JQ5A 4AKYA 1TU5A 1IT7A 1VQM3 4RBNA 4IPBA 2D42A 4N6LA 1BOXA 1AY7A 1TUHA 1YGEA 5KP4A 3CCR3 3O8YA 3CCJ3 1FUSA 1RGEA 1YJ93 3NV0B 3ALAA 1DMMA 2W6JH 2FNQA 3RDEA 2OWPA 3AMOB 3PCSA 2Z77A 3VF1A 1NU3A 3NBBA 3M8CA 1N9EA 1S723 3CNXA 4XB5A 3CCE3 1O7WB 3G16A 5AEUB 3KSPA 1PFPA 1IK3A 3S29A 3LMLA 1RCKA 3D3LA 4CPKA 3IPTA 1RDSA 3LXUX 1GY5A 2CH9A 4AKZA 5GSPA 3K0ZA 1HU9A 1FGOA 1G96A 2CWVA 3ZFZA
chains in the Genus database with same CATH topology
1VQP3 3LT8A 4HKVB 1IQYA 2L4VA 4PEJA 2B24B 3DXOA 1DMQA 1OF5B 3HI7A 3OX9A 3DGLA 3U1WA 2P05A 4HM1B 6STDA 1LNHA 1DVCA 5LC6A 1IVWA 3EHCA 1E3RA 1E97A 1EQKA 3X40A 4JF8A 1YIT3 3NM2A 3EN8A 2CKFB 3KSED 1TFKA 1UW1A 1C7HA 4HJLB 1WMOA 1IT8A 2INXA 3F7XA 1YHQ3 1KQS2 3NM7A 3EQQB 1O7GB 2HMJB 3PYJA 3PXMA 4CDLA 1IVVA 4FCZA 2P0MA 1KSIA 3FG4A 5FGOA 4XBTA 2BMQB 3GRDA 2W9PA 3HIIA 3LTBA 4CCVA 3OW22 3MHEA 1MNLA 1N8R4 3SEDA 3SXXA 1IQXA 2C10A 2OQEC 3LZAA 4Q53A 2YFIB 3LH4A 3X3ZA 3CC73 1IV7A 1O7HB 3OWYA 2E2TA 2F99A 4O3VA 1JN5A 2Z76A 4O2HA 4HM7B 4X2HA 4XDVA 4N6OB 1GY6A 3SVAA 3HIGA 3NX0A 2OCTA 2D1WA 2XR8B 3DZLA 2RSXA 1JN5B 2IUJA 3DMCA 1LOXA 1W6YA 1A90A 3CCM3 3FZWA 1AVLA 3GZYB 1F8NA 2HMNB 3GAXA 3Q90A 4LMIA 4FR9A 4BTYA 1K9M4 2XRXB 3EX9A 4NREA 3NBRA 4FCMA 1N5PA 1W01A 3E99A 3MYTA 1Y4KA 2GU1A 3S27A 1NDOB 3U97A 3X3YA 5DRVA 3K63A 3DGMA 3H51A 2P0XA 1CEWI 4H61A 5EVHA 2A15A 2B1XB 1VZZA 2UX0A 3MSOA 2W0QA 1RKYA 3WOEB 1JB2A 1M9GA 2STDA 4BTWA 3T8UA 2CHCA 2HMKB 5IEPA 4HM8B 5IW9A 1Q814 3F8HA 4R9KA 1IQ8A 2C11A 3V98A 3BB9A 3OV4A 1VQ83 2BHMA 1U8CB 4OK0A 3HK4A 5CF1A 1STDA 1M904 4RNZA 4XBXA 1CYVA 4LEHA 1QMAA 2CFKA 5HGRA 2CFWA 1TFOA 1HKXA 2HMOB 5EEOA 1JB4A 1K8A4 4K1VA 3CMA3 3WA3A 3KKGA 4N3VA 3PCRA 3BNBA 2GBWB 4O02B 4BTXA 3G8ZA 3FSDA 5BVBA 2F98A 1ZO2A 3FF2A 1AV4A 3BLZA 4HM5B 5JPPA 3QRDA 3IJEB 2BMOB 3WA2X 1BUQA 4HM0B 4KVHA 3GWRA 2FGTA 2CFGA 4H3UA 3B8LA 3MKIA 3B7CA 4MMZB 5JBSA 1M1K4 3NV0A 1NO3A 4EV2A 2Z6BA 1IVXA 2YX9A 2SBLA 4N6V0 2Y74A 3KZTA 4FCJA 3V92A 3N54B 4KFDA 1W7CA 3SOYA 4FMDA 1S5AA 1W4NA 4WWUC 3S67A 1KD14 2JDIH 3DM8A 1W6CA 4GB5A 3F40A 3CME3 3CCU3 1OH0A 2CG1A 2BT3A 2BMRB 3CCS3 3CC43 5TGNA 1FGTA 2OQEA 3S28A 2W9QA 1WMNA 4EXRA 3RGAA 4K61A 1ZX2A 1O7NB 1LVNA 2RGQA 4HYZA 3CXC2 3EJVA 1FGMA 4R80A 4WHAA 1VQO3 1K28A 1JNQA 2MF7A 4KFFA 3LT9A 3K9MC 1YIJ3 2MC8A 3T0UA 4TX4A 3WODG 3CNMA 3EF8A 3GZXB 4STDA 2OTL3 4MMYB 4LZIA 5IEOA 2QGUA 1RJOA 5KP3A 3CCL3 1A67A 3Q2PA 2XGNA 2IUKA 3WDGB 1WTHA 1U5OA 2Z7AA 4LGQA 2Q07A 4KZ1A 1Q42A 3FF0A 3SLUA 1QVF2 2LQVA 5IERA 1SPUA 1J2BA 2OOVC 2XSOB 2CW9A 3JUNA 2WO0A 3OWSA 1FGRA 2XGLA 1STFI 3HZPA 3JUQA 1W2B2 1JV2B 2F86B 1W5ZA 4IT7A 1SIIA 4AEQA 3K5TA 3KN4A 5DREA 3HX8A 1VQN3 3L0RA 5D82A 1WNHA 3LTDA 1DVDA 1KC84 4HZBB 2KCDA 1W6GA 4XDWA 1GY7A 1A2VA 4EC6A 5I97A 3IMAB 3KE7A 3FKAA 1YVBI 4XM4A 3GZBA 4WYKA 1T5YA 1QAFA 1VQ43 1EA2A 1WQLB 1WMPA 4HBRA 5FW5A 3DGOA 1VQ73 3F8XA 1FA3A 1RRLA 1V74A 5AIHA 4EV5A 1JRQA 2ML5A 5CLKA 3SOAA 1VQL3 4N6TA 3J7Yd 2K54A 2ZDJA 1NB3I 3VGNA 3NQZA 1NB5I 1ASKA 4ORLA 3MWZA 3I0YA 2HMLB 3D9RA 2OOVA 2WOHA 5AEWB 2OTJ3 1GS3A 1YJW3 1VQ93 1MOLA 2R4IA 5AIIA 5ELJA 2CWTA 1ROVA 4EYCA 2ML6A 2WGQA 1W00A 4KFEA 1DYUA 4K90B 4XBYA 2O9UX 2XH9A 3CPOA 2GBXB 3CU3A 1Q40A 3LYGA 5AI1A 1OACA 1QAKA 2O3OA 4WP5A 2PZVA 5JPUA 3EN1B 2LYXA 2W56B 3F9SA 3JVCA 1EG9B 3UL6A 1CQSA 2K0MA 2ZL8A 3CCV3 4QWTA 1UUWB 1W02A 1N5HA 2Y73A 3I553 1W2ZA 4HM6B 3LOYA 4J8TA 1US1A 4ZM8A 1ULIB 2RFRA 3VSYA 3X41A 3I563 1GD4A 3CD63 1GD3A 2QIYA 1CYUA 1OGZA 5EQLA 3S5CA 5AIGA 3MG3A 5AIFA 3PZWA 3B4OA 2KXGA 5IG0A 2WOFA 3B4PA 1SJWA 3TDGA 5CF2A 1D6YA 4RZMA 3V99A 1TIJA 1Z1SA 1FGQA 1DMNA 4HM2B 1Q824 3GZRA 3G6E3 3UL5A 3G713 2GXFA 3NUVA 5G2GA 1QALA 3NHXA 1AVKA 4HVNA 3KIIA 2W03A 4MMXB 1UUVB 1VQ53 2XSHB 4L8PA 1D6UA 1IU7A 4R1KA 4X2OA 3PS8A 4G1MB 5IENA 1LXEA 1KWIA 1FUWA 2FXTA 3EB8A 3DY5A 3JUPA 3Q1CA 4AKYA 1ISKA 1E3VA 1D6ZA 4OUQA 3X3XA 3SX1A 4EBGA 1IDPA 5IG4A 1ROAA 1Q864 3JUOA 4L8OA 1A2KA 1OHSA 1K734 3CC23 3F7SA 4I4KA 4LSOA 1O7MB 1RRHA 3DGNA 3FCSB 3G0KA 1IVUA 5CK6A 4R9LA 2CC3A 2CIUA 1JJ22 3WMDA 1N8QA 3QK9A 7STDA 4WYKB 3NBJA 4N6NB 3UNLA 3BNDA 2E2VA 1NWWA 2GEXA 2GEYA 2PNCA 1AR0A 3AMOA 3DUKA 1PU4A 4HM3B 2P38A 2XFTA 4HZ9B 3ECFA 1GYBA 4MEIA 4FMCA 1RN7A 1NJI4 1R4CA 4FMAA 2E2UA 2I9WA 1L5GB 3BNCA 2XF3A 3MG2A 1VQ63 2WGOA 3F14A 2P09A 1K41A 3MPHA 5STDA 1OUNA 4N6UA 4NHFA 5LC7A 5D81A 5A0OB 4R4KA 1OHPA 3EC9A 1OHOA 3MG1A 3KFQC 3OWUA 3STDA 2CG0A 1SQWA 1TP6A 3FH1A 3T8NA 5IG3A 1Q40B 1OGXA 5IG5A 2QEX3 1OCVA 3FLJA 1OF5A 1JKGA 2BNGA 3UJMA 3CCQ3 4OVMA 2W56A 1VQK3 1UI7A 3FG1A 2CFLA 2RCDA 4K1UA 4O8SA 3FGYA 2M7OA 3NXJA 1YI23 4RNYA 1JKGB 5CXOA 1M1XB 4JRFA 5BXQA 1SIHA 5KP1A 3LTCA 3K7CA 4HM4B 3EE1A 1UI8A 3N8BA 2W2CA 2W04A 1O7PB 3PGBA 1Q7Y4 2KRTA 1QVG2 3G4S3 3UB1A 4J9AA 1ULJB 2XEPA 1N9JA 3A76A 4U13A 8CHOA 1EKMA 4GL6A 3LTAA 2YFJB 1JB5A 3X42A 5ELUA 2GU3A 3ER7A 3OXAA 2V1LA 3H3HA 3WOFB 5IF6A 2YFLB 3CPW2 2IMJA 1YJN3 2QA43 4MJDA 4FMBA 3ROBA 3N9HA 3EBTA 1OPYA 3FG3A 3RGRA 1QJGA 3EBYA 4N6MA 4IIAA 3NQYA 5AYSC 2CWUA 1IV9A 2XFSA 2BO9B 5AYRB 4WFOA 2HMMB 3JUMA 4L7KA 2CK3H 2IA7A 3BNEA 2CFDA 5D83A 2JQ5A 1TU5A 1IT7A 1VQM3 4RBNA 4IPBA 2D42A 4N6LA 1YGEA 1TUHA 5KP4A 3CCR3 3O8YA 3CCJ3 1YJ93 3NV0B 3ALAA 1DMMA 2W6JH 2FNQA 3RDEA 2OWPA 3AMOB 3PCSA 2Z77A 3VF1A 1NU3A 3NBBA 3M8CA 1N9EA 1S723 3CNXA 4XB5A 3CCE3 1O7WB 3G16A 5AEUB 3KSPA 1PFPA 1IK3A 3S29A 3LMLA 3D3LA 3IPTA 3LXUX 1GY5A 2CH9A 4AKZA 3K0ZA 1HU9A 1FGOA 1G96A 2CWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WYK B;  5CLK A;  3SOA A;  4HKV B;  3UNL A;  3KKG A;  4N3V A;  1NWW A;  2K54 A;  2GEX A;  2GEY A;  3VGN A;  2GBW B;  1AR0 A;  4PEJ A;  3DUK A;  3G8Z A;  2B24 B;  3DXO A;  1DMQ A;  1ASK A;  1OF5 B;  3FSD A;  3I0Y A;  2HML B;  3D9R A;  3OX9 A;  2F98 A;  1ZO2 A;  4HM3 B;  4HM1 B;  5BVB A;  6STD A;  3FF2 A;  3BLZ A;  4HM5 B;  3ECF A;  4HZ9 B;  3EHC A;  5AEW B;  1GYB A;  1E3R A;  1E97 A;  1GS3 A;  2BMO B;  5JPP A;  1BUQ A;  4HM0 B;  4KVH A;  3NM2 A;  2R4I A;  5AII A;  3EN8 A;  2CKF B;  3GWR A;  2I9W A;  4H3U A;  3B8L A;  1C7H A;  1W00 A;  3MG2 A;  3B7C A;  3MKI A;  4HJL B;  4XBY A;  3F14 A;  3NV0 A;  1K41 A;  5STD A;  3CPO A;  2GBX B;  2INX A;  3F7X A;  3CU3 A;  1Q40 A;  1OUN A;  3LYG A;  3KZT A;  5AI1 A;  4FCJ A;  5D81 A;  3SOY A;  4WP5 A;  1OHP A;  1S5A A;  3EC9 A;  1OHO A;  2PZV A;  3EQQ B;  1O7G B;  2HMJ B;  3EN1 B;  3MG1 A;  3OWU A;  5JPU A;  4CDL A;  3F9S A;  4WWU C;  3STD A;  1EG9 B;  1TP6 A;  1CQS A;  3DM8 A;  3FH1 A;  4GB5 A;  3F40 A;  3T8N A;  1Q40 B;  1OH0 A;  5IG3 A;  1OGX A;  1UUW B;  2BMR B;  5IG5 A;  5TGN A;  1W02 A;  1OCV A;  3FLJ A;  1OF5 A;  1JKG A;  2BMQ B;  2BNG A;  3GRD A;  4XBT A;  3UJM A;  4OVM A;  3MHE A;  3SED A;  4HM6 B;  4J8T A;  3RGA A;  2RCD A;  1ULI B;  2RFR A;  1ZX2 A;  3LZA A;  4K1U A;  1O7N B;  3VSY A;  4Q53 A;  2RGQ A;  2YFI B;  3FGY A;  2QIY A;  1O7H B;  3NXJ A;  3EJV A;  3OWY A;  2F99 A;  1JN5 A;  1OGZ A;  2Z76 A;  1JKG B;  5CXO A;  5KP1 A;  4HM7 B;  4X2H A;  3S5C A;  4XDV A;  5AIG A;  3K7C A;  1GY6 A;  5BXQ A;  3MG3 A;  4HM4 B;  5AIF A;  2W2C A;  1O7P B;  3B4O A;  5IG0 A;  2XR8 B;  3B4P A;  1SJW A;  3DZL A;  4J9A A;  5CF2 A;  3CNM A;  3EF8 A;  3GZX B;  4RZM A;  1ULJ B;  1JN5 B;  3A76 A;  4STD A;  4U13 A;  8CHO A;  3DMC A;  1Z1S A;  5IEO A;  5AEU B;  1W6Y A;  1DMN A;  2YFJ B;  1JB5 A;  2QGU A;  4HM2 B;  3GZR A;  3OXA A;  3ER7 A;  3FZW A;  5KP3 A;  3H3H A;  3GZY B;  2HMN B;  5IF6 A;  2YFL B;  3Q90 A;  2IMJ A;  4LMI A;  1U5O A;  2XRX B;  3EX9 A;  2GXF A;  2Z7A A;  3NUV A;  4LGQ A;  3EBT A;  4MJD A;  5G2G A;  3NBR A;  3ROB A;  1OPY A;  1Q42 A;  3NHX A;  4FCM A;  3FF0 A;  4HVN A;  1W01 A;  3E99 A;  3MYT A;  3RGR A;  5IER A;  1QJG A;  1UUV B;  1NDO B;  3EBY A;  2XSH B;  2XSO B;  3JUN A;  3OWS A;  4IIA A;  5DRV A;  4L8P A;  3HZP A;  3JUQ A;  4R1K A;  2F86 B;  4X2O A;  2HMM B;  3JUM A;  3H51 A;  4L7K A;  5IEN A;  5EVH A;  2A15 A;  2B1X B;  1VZZ A;  2UX0 A;  3MSO A;  5D83 A;  2JQ5 A;  1JB2 A;  5DRE A;  3JUP A;  3HX8 A;  2STD A;  1ISK A;  1E3V A;  4OUQ A;  5D82 A;  3T8U A;  1IDP A;  4ORL A;  1TUH A;  2CHC A;  2HMK B;  5KP4 A;  5IEP A;  4HM8 B;  5IG4 A;  5CF1 A;  4HZB B;  3F8H A;  3NV0 B;  4XDW A;  4R9K A;  3JUO A;  1DMM A;  1GY7 A;  1A2K A;  4L8O A;  1OHS A;  3BB9 A;  2OWP A;  3KE7 A;  3FKA A;  2Z77 A;  3F7S A;  1NU3 A;  3OV4 A;  3M8C A;  4I4K A;  3CNX A;  4XB5 A;  1O7M B;  1O7W B;  3G16 A;  3HK4 A;  3KSP A;  1STD A;  3G0K A;  3GZB A;  4WYK A;  4R9L A;  4XBX A;  4XM4 A;  5CK6 A;  1EA2 A;  1WQL B;  3IPT A;  4LEH A;  1QMA A;  5FW5 A;  5HGR A;  1GY5 A;  3WMD A;  3F8X A;  1HKX A;  2HMO B;  3K0Z A;  5AIH A;  1JB4 A;  7STD A;  4K1V A; 
#chains in the Genus database with same CATH topology
 2L1S A;  1VQP 3;  3LT8 A;  4HKV B;  1IQY A;  2L4V A;  1B2U A;  4PEJ A;  3AHW A;  1BAN A;  2AAD A;  2B24 B;  1DMQ A;  1OF5 B;  2BIR A;  3DXO A;  3HI7 A;  3OX9 A;  3DGL A;  3U1W A;  2P05 A;  4HM1 B;  6STD A;  1LNH A;  1LQM B;  1DVC A;  5LC6 A;  1IVW A;  3EHC A;  3URP A;  1E3R A;  1E97 A;  1EQK A;  1BSA A;  4JF8 A;  3X40 A;  1YIT 3;  1LOW A;  3NM2 A;  3D4A A;  4BU4 A;  5HOH A;  3EN8 A;  2CKF B;  3KSE D;  4RNT A;  1TFK A;  1UW1 A;  1RGH A;  1C7H A;  1FW7 A;  4HJL B;  1WMO A;  1IT8 A;  2INX A;  3F7X A;  1YHQ 3;  1BAO A;  1KQS 2;  1DET A;  3NM7 A;  4BIR A;  3EQQ B;  1O7G B;  2HMJ B;  1HYF A;  3PYJ A;  3PXM A;  4CDL A;  1RHL A;  1IVV A;  4FCZ A;  1GOU A;  2P0M A;  1BRG A;  1KSI A;  1DE3 A;  1MWS A;  3FG4 A;  5FGO A;  4XBT A;  2BMQ B;  3GRD A;  2W9P A;  3HII A;  3LTB A;  1B2S A;  2F5W A;  4CCV A;  3MHE A;  1MNL A;  6GSP A;  3SED A;  1N8R 4;  3SXX A;  1IQX A;  2C10 A;  2OQE C;  3LZA A;  4Q53 A;  2YFI B;  3LH4 A;  3X3Z A;  3CC7 3;  1BGS A;  1B20 A;  1IV7 A;  1O7H B;  1BIR A;  2E2T A;  2F99 A;  1JN5 A;  2Z76 A;  3OWY A;  4O3V A;  4O2H A;  4HM7 B;  4X2H A;  4XDV A;  4N6O B;  1GY6 A;  3SVA A;  3HIG A;  3NX0 A;  2OCT A;  2D1W A;  1RN1 A;  2XR8 B;  1BVI A;  3DZL A;  1PY3 A;  1ZS7 A;  1I3I A;  2RSX A;  1JN5 B;  1BRI A;  2IUJ A;  3DMC A;  1LOX A;  1W6Y A;  1LRA A;  1A90 A;  3CCM 3;  3FZW A;  1V58 A;  1B2X A;  1AVL A;  3GZY B;  1F8N A;  2HMN B;  3GAX A;  3Q90 A;  4LMI A;  4FR9 A;  4BTY A;  1K9M 4;  2XRX B;  1TTO A;  3EX9 A;  4NRE A;  1TRP A;  3NBR A;  1BNF A;  4FCM A;  1N5P A;  1W01 A;  3E99 A;  3MYT A;  1Y4K A;  3SYU A;  2GU1 A;  1RGK A;  3S27 A;  1NDO B;  3U97 A;  3X3Y A;  5DRV A;  5M18 A;  3K63 A;  1RTU A;  6RNT A;  3BU4 A;  3DGM A;  3H51 A;  2P0X A;  1CEW I;  4H61 A;  5EVH A;  2A15 A;  2B1X B;  1VZZ A;  4DKI A;  2UX0 A;  3MSO A;  1ISK A;  2W0Q A;  1RKY A;  3WOE B;  1JB2 A;  1M9G A;  2STD A;  2K3D A;  4BTW A;  1UUG B;  3D79 A;  3WR2 A;  3T8U A;  2CHC A;  2HMK B;  5IEP A;  4HM8 B;  5IW9 A;  1Q81 4;  3F8H A;  4R9K A;  1IQ8 A;  2C11 A;  1RLS A;  3V98 A;  3BB9 A;  2CX1 A;  3OV4 A;  1VQ8 3;  2BHM A;  1U8C B;  4OK0 A;  4J5G A;  3HK4 A;  5CF1 A;  1STD A;  1M90 4;  4RNZ A;  4XBX A;  1CYV A;  4LEH A;  1QMA A;  2CFK A;  5HGR A;  2CFW A;  1B2Z A;  1TFO A;  1HKX A;  2HMO B;  5EEO A;  1JB4 A;  1FZU A;  1K8A 4;  4K1V A;  3CMA 3;  3WA3 A;  3KKG A;  3DGY A;  4N3V A;  3PCR A;  1I0X A;  3BNB A;  3GSP A;  2KF3 A;  2GBW B;  4O02 B;  1BUJ A;  4BTX A;  3G8Z A;  3FSD A;  4BL2 A;  5BVB A;  2F98 A;  1ZO2 A;  3FF2 A;  1JBT A;  1AV4 A;  3BLZ A;  4HM5 B;  5JPP A;  3QRD A;  3IJE B;  2BMO B;  3WA2 X;  1BUQ A;  4HM0 B;  4KVH A;  1T2I A;  3GWR A;  2FGT A;  1EUI C;  2CFG A;  4H3U A;  3B8L A;  2CX0 A;  3MKI A;  3B7C A;  4MMZ B;  5JBS A;  4CJN A;  3NV0 A;  1NO3 A;  4EV2 A;  7RNT A;  1I2G A;  1M1K 4;  5M19 A;  2Z6B A;  3AHS A;  1BRN L;  1IVX A;  1RGF A;  2SBL A;  2YX9 A;  2Y74 A;  3KZT A;  2H0H A;  4FCJ A;  4N6V 0;  1Q7H A;  3N54 B;  4KFD A;  1W7C A;  3HOH A;  3SOY A;  3V92 A;  1EEJ A;  1S5A A;  4FMD A;  1G0T A;  1TJD A;  1RMS A;  1W4N A;  4WWU C;  3S67 A;  1KD1 4;  2JDI H;  3WHO A;  1FUT A;  1GMR A;  3DM8 A;  1W6C A;  4GB5 A;  3F40 A;  3CME 3;  3CCU 3;  1OH0 A;  2CG1 A;  2BT3 A;  2BMR B;  3CCS 3;  3CC4 3;  5TGN A;  1FGT A;  2OQE A;  3S28 A;  2W9Q A;  1WMN A;  4EXR A;  3RGA A;  1UCJ A;  4K61 A;  1I2E A;  1ZX2 A;  1O7N B;  1LVN A;  2RGQ A;  1ZGX A;  4HYZ A;  3CXC 2;  3EJV A;  1FGM A;  4R80 A;  4WHA A;  1VQO 3;  1K28 A;  1JNQ A;  1LOV A;  2MF7 A;  4KFF A;  3LT9 A;  3K9M C;  1YIJ 3;  3A5E A;  2MC8 A;  4TX4 A;  3T0U A;  3WOD G;  1BRS A;  3OW2 2;  2UGI A;  1LQG C;  3CNM A;  3EF8 A;  3GZX B;  4STD A;  2OTL 3;  4MMY B;  1I3F A;  1T2H A;  1UGH I;  4LZI A;  5IEO A;  2QGU A;  1RJO A;  1YVS A;  5KP3 A;  3CCL 3;  1X1W A;  1A67 A;  3Q2P A;  1BNJ A;  2XGN A;  1UDI I;  1UCL A;  2IUK A;  3WDG B;  1WTH A;  1U5O A;  3D5G A;  4BL3 A;  1VQQ A;  2Z7A A;  4LGQ A;  2Q07 A;  4KZ1 A;  1Q42 A;  3FF0 A;  1X1X A;  3SLU A;  1QVF 2;  2LQV A;  5IER A;  1SPU A;  1J2B A;  1RSN A;  2OOV C;  2XSO B;  2CW9 A;  3JUN A;  2WO0 A;  3OWS A;  1FGR A;  2XGL A;  1STF I;  3HZP A;  3JUQ A;  1W2B 2;  1BSE A;  1JV2 B;  9RNT A;  2F86 B;  1W5Z A;  2F56 A;  4IT7 A;  3AGN A;  2IY2 A;  1SAR A;  1SII A;  4AEQ A;  3K5T A;  3KN4 A;  5DRE A;  3HX8 A;  1VQN 3;  3L0R A;  5D82 A;  2UUG C;  1WNH A;  1AQZ A;  3LTD A;  1DVD A;  1UGI A;  4HZB B;  1KC8 4;  2KCD A;  1W6G A;  4XDW A;  1GY7 A;  1UCK A;  1A2V A;  4EC6 A;  2F5M A;  5I97 A;  3IMA B;  3KE7 A;  3FKA A;  2SAR A;  1YVB I;  3ZG5 A;  4XM4 A;  1GMP A;  3GZB A;  1T5Y A;  4WYK A;  1QAF A;  1VQ4 3;  1EA2 A;  1WQL B;  1WMP A;  4HBR A;  2KF4 A;  5FW5 A;  3DGO A;  1VQ7 3;  3F8X A;  1FA3 A;  1RRL A;  1BNS A;  1V74 A;  2KAA A;  5AIH A;  1MGW A;  4EV5 A;  1JRQ A;  2ML5 A;  5CLK A;  3SOA A;  1MWT A;  3ZG0 A;  5RNT A;  1VQL 3;  4N6T A;  7GSP A;  3J7Y d;  2K54 A;  2R41 A;  2AAE A;  1NB3 I;  2ZDJ A;  4HOH A;  3NQZ A;  1B27 A;  3VGN A;  1NB5 I;  1GOY A;  1ASK A;  4ORL A;  3MWZ A;  3I0Y A;  2HML B;  3D9R A;  1X1Y A;  2OOV A;  1MWU A;  2WOH A;  1C54 A;  5AEW B;  2OTJ 3;  1GS3 A;  1BSC A;  1YJW 3;  1VQ9 3;  1MOL A;  2R4I A;  5AII A;  5ELJ A;  2CWT A;  1ROV A;  4EYC A;  2ML6 A;  3D5I A;  2WGQ A;  1W00 A;  4KFE A;  1DYU A;  4K90 B;  4XBY A;  2O9U X;  2XH9 A;  3CPO A;  1BRJ A;  2GBX B;  3CU3 A;  1B3S A;  1Q40 A;  3LYG A;  1UCI A;  5AI1 A;  1OAC A;  1QAK A;  2O3O A;  3AGO A;  4WP5 A;  2PZV A;  5JPU A;  3EN1 B;  1RNB A;  2LYX A;  2W56 B;  3F9S A;  1I70 A;  3JVC A;  1I0V A;  1EG9 B;  3UL6 A;  1CQS A;  2K0M A;  2ZL8 A;  3CCV 3;  4QWT A;  1UUW B;  1BU4 A;  5BU4 A;  1W02 A;  1N5H A;  2Y73 A;  1BSB A;  3I55 3;  1W2Z A;  4HM6 B;  3LOY A;  4J8T A;  1US1 A;  4ZM8 A;  4J5K A;  1RGC A;  1ULI B;  2RFR A;  3VSY A;  3X41 A;  3I56 3;  1GD4 A;  3CD6 3;  2ZA4 A;  1GD3 A;  2QIY A;  1CYU A;  5G1L A;  1OGZ A;  4GHO A;  5EQL A;  3S5C A;  1RGA A;  5AIG A;  1FYS A;  1I2F A;  3MG3 A;  5AIF A;  2J8X B;  3PZW A;  1RN4 A;  3B4O A;  2KXG A;  5IG0 A;  2WOF A;  3B4P A;  1SJW A;  1B2M A;  1CH0 A;  3TDG A;  4ILF A;  5CF2 A;  1D6Y A;  4RZM A;  3V99 A;  1TIJ A;  1Z1S A;  1FGQ A;  1DMN A;  1BSD A;  1JZO A;  4HM2 B;  1Q82 4;  2KF5 A;  3GZR A;  1BRK A;  1R4Y A;  8RNT A;  3G6E 3;  3UL5 A;  1V57 A;  1T3B A;  3G71 3;  2GXF A;  3NUV A;  5G2G A;  1QAL A;  3NHX A;  1AVK A;  4HVN A;  1RNT A;  3KII A;  2W03 A;  4MMX B;  2HOH A;  1UUV B;  1VQ5 3;  2XSH B;  4L8P A;  1D6U A;  1PYL A;  1IU7 A;  4R1K A;  5M1A A;  1JBR A;  4X2O A;  3PS8 A;  4G1M B;  1X1U A;  5IEN A;  1LXE A;  1KWI A;  1YGW A;  1TRQ A;  1FUW A;  2FXT A;  3KCH A;  1MGR A;  1G02 A;  1GMQ A;  1BNE A;  1YNV X;  2H0G A;  3EB8 A;  3DY5 A;  3JUP A;  1E3V A;  1D6Z A;  3Q1C A;  4OUQ A;  3X3X A;  3SX1 A;  2GSP A;  1IDP A;  4EBG A;  5IG4 A;  1ROA A;  2BU4 A;  1Q86 4;  1BNR A;  3JUO A;  4L8O A;  1A2K A;  1OHS A;  1K73 4;  3CC2 3;  3F7S A;  4I4K A;  1JBS A;  4LSO A;  1O7M B;  1RRH A;  3DGN A;  3FCS B;  3G0K A;  1IVU A;  5CK6 A;  4R9L A;  2CC3 A;  2H0I A;  2CIU A;  3DH2 A;  1JJ2 2;  3WMD A;  1N8Q A;  3QK9 A;  7STD A;  1LOY A;  1Q9E A;  4HAA A;  4WYK B;  1HZ1 A;  3NBJ A;  4N6N B;  3UNL A;  3BND A;  2E2V A;  3RNT A;  1NWW A;  2GEX A;  2GEY A;  2PNC A;  5BIR A;  1AR0 A;  1IYY A;  3AMO A;  3DUK A;  1PU4 A;  4HM3 B;  4EW5 A;  2P38 A;  2XFT A;  4HZ9 B;  3ECF A;  1GYB A;  4MEI A;  4FMC A;  1A2P A;  1RN7 A;  1NJI 4;  1R4C A;  4I5Q A;  4FMA A;  2E2U A;  2I9W A;  4GSP A;  1L5G B;  2C4B A;  1JZD A;  3BNC A;  2XF3 A;  3MG2 A;  1I8V A;  1VQ6 3;  2WGO A;  3F14 A;  2P09 A;  1K41 A;  3MPH A;  1RGG A;  5STD A;  1MWR A;  1OUN A;  4N6U A;  4NHF A;  5LC7 A;  5D81 A;  5A0O B;  4R4K A;  2IYJ A;  1OHP A;  3EC9 A;  1OHO A;  3MG1 A;  3KFQ C;  5G1K A;  3OWU A;  3STD A;  2CG0 A;  1SQW A;  1TP6 A;  3FH1 A;  3T8N A;  5IG3 A;  1Q40 B;  1OGX A;  5IG5 A;  2QEX 3;  1OCV A;  3FLJ A;  1OF5 A;  1JKG A;  2BNG A;  3UJM A;  3CCQ 3;  4OVM A;  2RNT A;  2W56 A;  1UI7 A;  3FG1 A;  2CFL A;  1VQK 3;  2RCD A;  4K1U A;  4O8S A;  3FGY A;  2ZHX B;  2M7O A;  3NXJ A;  1YI2 3;  3BIR A;  1JKG B;  4RNY A;  1M1X B;  4JRF A;  5CXO A;  1SIH A;  5BXQ A;  3LTC A;  3K7C A;  5KP1 A;  4HM4 B;  3EE1 A;  4KT3 B;  1UI8 A;  3N8B A;  2W2C A;  2W04 A;  1O7P B;  3PGB A;  1Q7Y 4;  2KRT A;  1QVG 2;  3G4S 3;  3UB1 A;  4J9A A;  1BNI A;  1ULJ B;  2XEP A;  1N9J A;  3A76 A;  4U13 A;  8CHO A;  1EKM A;  4GL6 A;  3LTA A;  2YFJ B;  1JB5 A;  3X42 A;  5ELU A;  2GU3 A;  1GSP A;  3ER7 A;  3OXA A;  2V1L A;  3H3H A;  1NNV A;  3Q3F A;  3WOF B;  5IF6 A;  2YFL B;  3CPW 2;  4LYL B;  1GOV A;  2IMJ A;  1YJN 3;  2KF6 A;  2QA4 3;  4MJD A;  4FMB A;  3ROB A;  1RCL A;  3N9H A;  3EBT A;  1B21 A;  1BNG A;  1OPY A;  2RBI A;  4NPB A;  3FG3 A;  3RGR A;  1QJG A;  3EBY A;  4N6M A;  4IIA A;  1LNI A;  3NQY A;  5AYS C;  2CWU A;  1IV9 A;  2F4Y A;  1BRH A;  2XFS A;  2BO9 B;  5AYR B;  4WFO A;  2HMM B;  3JUM A;  1RGL A;  2CK3 H;  2IA7 A;  3BNE A;  4L7K A;  2CFD A;  5D83 A;  2JQ5 A;  4AKY A;  1TU5 A;  1IT7 A;  1VQM 3;  4RBN A;  4IPB A;  2D42 A;  4N6L A;  1BOX A;  1AY7 A;  1TUH A;  1YGE A;  5KP4 A;  3CCR 3;  3O8Y A;  3CCJ 3;  1FUS A;  1RGE A;  1YJ9 3;  3NV0 B;  3ALA A;  1DMM A;  2W6J H;  2FNQ A;  3RDE A;  2OWP A;  3AMO B;  3PCS A;  2Z77 A;  3VF1 A;  1NU3 A;  3NBB A;  3M8C A;  1N9E A;  1S72 3;  3CNX A;  4XB5 A;  3CCE 3;  1O7W B;  3G16 A;  5AEU B;  3KSP A;  1PFP A;  1IK3 A;  3S29 A;  3LML A;  1RCK A;  3D3L A;  4CPK A;  3IPT A;  1RDS A;  3LXU X;  1GY5 A;  2CH9 A;  4AKZ A;  5GSP A;  3K0Z A;  1HU9 A;  1FGO A;  1G96 A;  2CWV A;  3ZFZ A; 
#chains in the Genus database with same CATH homology
 1VQP 3;  3LT8 A;  4HKV B;  1IQY A;  2L4V A;  4PEJ A;  2B24 B;  3DXO A;  1DMQ A;  1OF5 B;  3HI7 A;  3OX9 A;  3DGL A;  3U1W A;  2P05 A;  4HM1 B;  6STD A;  1LNH A;  1DVC A;  5LC6 A;  1IVW A;  3EHC A;  1E3R A;  1E97 A;  1EQK A;  3X40 A;  4JF8 A;  1YIT 3;  3NM2 A;  3EN8 A;  2CKF B;  3KSE D;  1TFK A;  1UW1 A;  1C7H A;  4HJL B;  1WMO A;  1IT8 A;  2INX A;  3F7X A;  1YHQ 3;  1KQS 2;  3NM7 A;  3EQQ B;  1O7G B;  2HMJ B;  3PYJ A;  3PXM A;  4CDL A;  1IVV A;  4FCZ A;  2P0M A;  1KSI A;  3FG4 A;  5FGO A;  4XBT A;  2BMQ B;  3GRD A;  2W9P A;  3HII A;  3LTB A;  4CCV A;  3OW2 2;  3MHE A;  1MNL A;  1N8R 4;  3SED A;  3SXX A;  1IQX A;  2C10 A;  2OQE C;  3LZA A;  4Q53 A;  2YFI B;  3LH4 A;  3X3Z A;  3CC7 3;  1IV7 A;  1O7H B;  3OWY A;  2E2T A;  2F99 A;  4O3V A;  1JN5 A;  2Z76 A;  4O2H A;  4HM7 B;  4X2H A;  4XDV A;  4N6O B;  1GY6 A;  3SVA A;  3HIG A;  3NX0 A;  2OCT A;  2D1W A;  2XR8 B;  3DZL A;  2RSX A;  1JN5 B;  2IUJ A;  3DMC A;  1LOX A;  1W6Y A;  1A90 A;  3CCM 3;  3FZW A;  1AVL A;  3GZY B;  1F8N A;  2HMN B;  3GAX A;  3Q90 A;  4LMI A;  4FR9 A;  4BTY A;  1K9M 4;  2XRX B;  3EX9 A;  4NRE A;  3NBR A;  4FCM A;  1N5P A;  1W01 A;  3E99 A;  3MYT A;  1Y4K A;  2GU1 A;  3S27 A;  1NDO B;  3U97 A;  3X3Y A;  5DRV A;  3K63 A;  3DGM A;  3H51 A;  2P0X A;  1CEW I;  4H61 A;  5EVH A;  2A15 A;  2B1X B;  1VZZ A;  2UX0 A;  3MSO A;  2W0Q A;  1RKY A;  3WOE B;  1JB2 A;  1M9G A;  2STD A;  4BTW A;  3T8U A;  2CHC A;  2HMK B;  5IEP A;  4HM8 B;  5IW9 A;  1Q81 4;  3F8H A;  4R9K A;  1IQ8 A;  2C11 A;  3V98 A;  3BB9 A;  3OV4 A;  1VQ8 3;  2BHM A;  1U8C B;  4OK0 A;  3HK4 A;  5CF1 A;  1STD A;  1M90 4;  4RNZ A;  4XBX A;  1CYV A;  4LEH A;  1QMA A;  2CFK A;  5HGR A;  2CFW A;  1TFO A;  1HKX A;  2HMO B;  5EEO A;  1JB4 A;  1K8A 4;  4K1V A;  3CMA 3;  3WA3 A;  3KKG A;  4N3V A;  3PCR A;  3BNB A;  2GBW B;  4O02 B;  4BTX A;  3G8Z A;  3FSD A;  5BVB A;  2F98 A;  1ZO2 A;  3FF2 A;  1AV4 A;  3BLZ A;  4HM5 B;  5JPP A;  3QRD A;  3IJE B;  2BMO B;  3WA2 X;  1BUQ A;  4HM0 B;  4KVH A;  3GWR A;  2FGT A;  2CFG A;  4H3U A;  3B8L A;  3MKI A;  3B7C A;  4MMZ B;  5JBS A;  1M1K 4;  3NV0 A;  1NO3 A;  4EV2 A;  2Z6B A;  1IVX A;  2YX9 A;  2SBL A;  4N6V 0;  2Y74 A;  3KZT A;  4FCJ A;  3V92 A;  3N54 B;  4KFD A;  1W7C A;  3SOY A;  4FMD A;  1S5A A;  1W4N A;  4WWU C;  3S67 A;  1KD1 4;  2JDI H;  3DM8 A;  1W6C A;  4GB5 A;  3F40 A;  3CME 3;  3CCU 3;  1OH0 A;  2CG1 A;  2BT3 A;  2BMR B;  3CCS 3;  3CC4 3;  5TGN A;  1FGT A;  2OQE A;  3S28 A;  2W9Q A;  1WMN A;  4EXR A;  3RGA A;  4K61 A;  1ZX2 A;  1O7N B;  1LVN A;  2RGQ A;  4HYZ A;  3CXC 2;  3EJV A;  1FGM A;  4R80 A;  4WHA A;  1VQO 3;  1K28 A;  1JNQ A;  2MF7 A;  4KFF A;  3LT9 A;  3K9M C;  1YIJ 3;  2MC8 A;  3T0U A;  4TX4 A;  3WOD G;  3CNM A;  3EF8 A;  3GZX B;  4STD A;  2OTL 3;  4MMY B;  4LZI A;  5IEO A;  2QGU A;  1RJO A;  5KP3 A;  3CCL 3;  1A67 A;  3Q2P A;  2XGN A;  2IUK A;  3WDG B;  1WTH A;  1U5O A;  2Z7A A;  4LGQ A;  2Q07 A;  4KZ1 A;  1Q42 A;  3FF0 A;  3SLU A;  1QVF 2;  2LQV A;  5IER A;  1SPU A;  1J2B A;  2OOV C;  2XSO B;  2CW9 A;  3JUN A;  2WO0 A;  3OWS A;  1FGR A;  2XGL A;  1STF I;  3HZP A;  3JUQ A;  1W2B 2;  1JV2 B;  2F86 B;  1W5Z A;  4IT7 A;  1SII A;  4AEQ A;  3K5T A;  3KN4 A;  5DRE A;  3HX8 A;  1VQN 3;  3L0R A;  5D82 A;  1WNH A;  3LTD A;  1DVD A;  1KC8 4;  4HZB B;  2KCD A;  1W6G A;  4XDW A;  1GY7 A;  1A2V A;  4EC6 A;  5I97 A;  3IMA B;  3KE7 A;  3FKA A;  1YVB I;  4XM4 A;  3GZB A;  4WYK A;  1T5Y A;  1QAF A;  1VQ4 3;  1EA2 A;  1WQL B;  1WMP A;  4HBR A;  5FW5 A;  3DGO A;  1VQ7 3;  3F8X A;  1FA3 A;  1RRL A;  1V74 A;  5AIH A;  4EV5 A;  1JRQ A;  2ML5 A;  5CLK A;  3SOA A;  1VQL 3;  4N6T A;  3J7Y d;  2K54 A;  2ZDJ A;  1NB3 I;  3VGN A;  3NQZ A;  1NB5 I;  1ASK A;  4ORL A;  3MWZ A;  3I0Y A;  2HML B;  3D9R A;  2OOV A;  2WOH A;  5AEW B;  2OTJ 3;  1GS3 A;  1YJW 3;  1VQ9 3;  1MOL A;  2R4I A;  5AII A;  5ELJ A;  2CWT A;  1ROV A;  4EYC A;  2ML6 A;  2WGQ A;  1W00 A;  4KFE A;  1DYU A;  4K90 B;  4XBY A;  2O9U X;  2XH9 A;  3CPO A;  2GBX B;  3CU3 A;  1Q40 A;  3LYG A;  5AI1 A;  1OAC A;  1QAK A;  2O3O A;  4WP5 A;  2PZV A;  5JPU A;  3EN1 B;  2LYX A;  2W56 B;  3F9S A;  3JVC A;  1EG9 B;  3UL6 A;  1CQS A;  2K0M A;  2ZL8 A;  3CCV 3;  4QWT A;  1UUW B;  1W02 A;  1N5H A;  2Y73 A;  3I55 3;  1W2Z A;  4HM6 B;  3LOY A;  4J8T A;  1US1 A;  4ZM8 A;  1ULI B;  2RFR A;  3VSY A;  3X41 A;  3I56 3;  1GD4 A;  3CD6 3;  1GD3 A;  2QIY A;  1CYU A;  1OGZ A;  5EQL A;  3S5C A;  5AIG A;  3MG3 A;  5AIF A;  3PZW A;  3B4O A;  2KXG A;  5IG0 A;  2WOF A;  3B4P A;  1SJW A;  3TDG A;  5CF2 A;  1D6Y A;  4RZM A;  3V99 A;  1TIJ A;  1Z1S A;  1FGQ A;  1DMN A;  4HM2 B;  1Q82 4;  3GZR A;  3G6E 3;  3UL5 A;  3G71 3;  2GXF A;  3NUV A;  5G2G A;  1QAL A;  3NHX A;  1AVK A;  4HVN A;  3KII A;  2W03 A;  4MMX B;  1UUV B;  1VQ5 3;  2XSH B;  4L8P A;  1D6U A;  1IU7 A;  4R1K A;  4X2O A;  3PS8 A;  4G1M B;  5IEN A;  1LXE A;  1KWI A;  1FUW A;  2FXT A;  3EB8 A;  3DY5 A;  3JUP A;  3Q1C A;  4AKY A;  1ISK A;  1E3V A;  1D6Z A;  4OUQ A;  3X3X A;  3SX1 A;  4EBG A;  1IDP A;  5IG4 A;  1ROA A;  1Q86 4;  3JUO A;  4L8O A;  1A2K A;  1OHS A;  1K73 4;  3CC2 3;  3F7S A;  4I4K A;  4LSO A;  1O7M B;  1RRH A;  3DGN A;  3FCS B;  3G0K A;  1IVU A;  5CK6 A;  4R9L A;  2CC3 A;  2CIU A;  1JJ2 2;  3WMD A;  1N8Q A;  3QK9 A;  7STD A;  4WYK B;  3NBJ A;  4N6N B;  3UNL A;  3BND A;  2E2V A;  1NWW A;  2GEX A;  2GEY A;  2PNC A;  1AR0 A;  3AMO A;  3DUK A;  1PU4 A;  4HM3 B;  2P38 A;  2XFT A;  4HZ9 B;  3ECF A;  1GYB A;  4MEI A;  4FMC A;  1RN7 A;  1NJI 4;  1R4C A;  4FMA A;  2E2U A;  2I9W A;  1L5G B;  3BNC A;  2XF3 A;  3MG2 A;  1VQ6 3;  2WGO A;  3F14 A;  2P09 A;  1K41 A;  3MPH A;  5STD A;  1OUN A;  4N6U A;  4NHF A;  5LC7 A;  5D81 A;  5A0O B;  4R4K A;  1OHP A;  3EC9 A;  1OHO A;  3MG1 A;  3KFQ C;  3OWU A;  3STD A;  2CG0 A;  1SQW A;  1TP6 A;  3FH1 A;  3T8N A;  5IG3 A;  1Q40 B;  1OGX A;  5IG5 A;  2QEX 3;  1OCV A;  3FLJ A;  1OF5 A;  1JKG A;  2BNG A;  3UJM A;  3CCQ 3;  4OVM A;  2W56 A;  1VQK 3;  1UI7 A;  3FG1 A;  2CFL A;  2RCD A;  4K1U A;  4O8S A;  3FGY A;  2M7O A;  3NXJ A;  1YI2 3;  4RNY A;  1JKG B;  5CXO A;  1M1X B;  4JRF A;  5BXQ A;  1SIH A;  5KP1 A;  3LTC A;  3K7C A;  4HM4 B;  3EE1 A;  1UI8 A;  3N8B A;  2W2C A;  2W04 A;  1O7P B;  3PGB A;  1Q7Y 4;  2KRT A;  1QVG 2;  3G4S 3;  3UB1 A;  4J9A A;  1ULJ B;  2XEP A;  1N9J A;  3A76 A;  4U13 A;  8CHO A;  1EKM A;  4GL6 A;  3LTA A;  2YFJ B;  1JB5 A;  3X42 A;  5ELU A;  2GU3 A;  3ER7 A;  3OXA A;  2V1L A;  3H3H A;  3WOF B;  5IF6 A;  2YFL B;  3CPW 2;  2IMJ A;  1YJN 3;  2QA4 3;  4MJD A;  4FMB A;  3ROB A;  3N9H A;  3EBT A;  1OPY A;  3FG3 A;  3RGR A;  1QJG A;  3EBY A;  4N6M A;  4IIA A;  3NQY A;  5AYS C;  2CWU A;  1IV9 A;  2XFS A;  2BO9 B;  5AYR B;  4WFO A;  2HMM B;  3JUM A;  4L7K A;  2CK3 H;  2IA7 A;  3BNE A;  2CFD A;  5D83 A;  2JQ5 A;  1TU5 A;  1IT7 A;  1VQM 3;  4RBN A;  4IPB A;  2D42 A;  4N6L A;  1YGE A;  1TUH A;  5KP4 A;  3CCR 3;  3O8Y A;  3CCJ 3;  1YJ9 3;  3NV0 B;  3ALA A;  1DMM A;  2W6J H;  2FNQ A;  3RDE A;  2OWP A;  3AMO B;  3PCS A;  2Z77 A;  3VF1 A;  1NU3 A;  3NBB A;  3M8C A;  1N9E A;  1S72 3;  3CNX A;  4XB5 A;  3CCE 3;  1O7W B;  3G16 A;  5AEU B;  3KSP A;  1PFP A;  1IK3 A;  3S29 A;  3LML A;  3D3L A;  3IPT A;  3LXU X;  1GY5 A;  2CH9 A;  4AKZ A;  3K0Z A;  1HU9 A;  1FGO A;  1G96 A;  2CWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...