3FFDB

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
b'QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMDLKQDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAMYICGVGDTIKEQFVYVFGGGTKVTVLGEPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hormone
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB01
1T4KB 3O11B 2J4WH 2PTVA 1JV5B 5DVOA 4I4WB 1IVLA 5BOPA 3C60A 2ICWB 1KIUA 5KS9B 2NX5B 2XI9A 4PUBL 4DZBA 5BQ7A 3Q6FA 1QYGL 1WBXA 1WJ3A 3QB7C 1KIRB 4PRPA 3OGCB 3V7AE 1C7SA 1J8HA 4RFNB 4RA0C 4F7MB 5ITBL 1MRDL 5I0DA 5E8OA 4I0PD 3C5ZB 1L0YA 4QY8A 4OM0H 4PGDB 4BUHA 1ZLUH 4PLNC 4LCYA 2X4TA 2Y06L 1QFWH 1FFPB 1U6AH 4HUNB 4LLUA 4G43B 5DD6A 5SWQB 3WUWA 3BX7C 4MJ5B 5C9JA 3C60D 2EDBA 3HRPA 4KFZC 1CFTA 4R7NB 3MCKB 5DD0L 3RIFF 2Y25A 1NKOA 3CMOH 4CMHB 5DURB 1FL3A 3NZHH 3P9LA 4GAFB 1A6UH 5I1DB 1MJJB 1WK0A 2VISB 1FFNB 4QYOB 4GBXA 4X9HA 5TE4H 2X9WA 3QUXA 3REWA 5HHMB 4TVPE 5GZOD 1A7RH 4TUKH 1HYSC 1J8HD 4NPYB 3LV3B 2NY2D 1QACA 3K74B 5IJKA 2ADGB 2C3VB 3TIEB 1MCJA 1KPVB 2BSTB 1OTUD 2I9LA 3HG1A 3WBDA 1JZ4A 3VI4E 2ENSA 4H25B 2FX7H 1DBBL 3O2DH 3RL1A 4M5YL 3HAEA 1QSFB 3MROB 5HYSA 5JPNB 1T66C 3BFOA 2NY7L 2OJZL 5JW4N 1URLA 1D6EB 1PG7W 1QSZA 4YGAB 1HIMH 4U0RB 1DTUA 5GJSH 3FQWA 4XTRD 1QBLL 3THMH 4J3WA 1LO4H 2IPUG 3QUXD 4OCRL 1BIIB 4Y4HD 1BF8A 1NCTA 3WNMA 1PY4A 1IM9D 3TT1H 1E4XH 2YN5A 1P2CB 4YBLB 4ZTOH 4GLRH 3ARGB 1NUGA 4P57B 5B4MC 1H5BA 4F80A 3DHJA 1XIWC 3GJEA 5CJQL 3ALPA 1G9ML 1S7SB 1ZMYA 1INEH 2VLRA 4IRZH 4UQ3B 5K59E 2BJML 2DD8H 5MEPA 2DKSA 4EDWH 1UXWA 4Y1AA 5DJXB 2OTWA 2Q7NA 2WBJC 4JRYA 5ACMA 4ZOAA 4KVNH 1ZOXA 3FT2B 3K4ZA 3VFNA 4ZO6A 4WJ5A 1S7VA 1R5VB 4Q2ZA 1WV7T 5EA0L 4H26A 2VDML 3T4AB 2VXSL 3NA9L 2R9HC 2G75B 2E8ZA 2GJ6D 3RA7L 3U0WL 4DVBA 1IMHC 4XI5C 3MXWH 4ALAH 4MJ6A 4MNGB 5F89A 1S9WB 1RJZA 1YUHA 1G6RL 5EC1A 2VLRD 3UPCA 1KCRL 4LLWA 4MA1B 1G9EA 5CMAB 4E42B 3RX8A 3GI9H 4N1HB 3IDNB 2V17L 4LU5L 2X4OA 3QO0B 2X7LA 2OTUA 4ODSH 3WJLC 3CU1A 3VH8B 5TF1H 2G9HB 1DQJA 1NEZA 1IC5H 3S37L 4FQ1H 5F9JB 2MFNA 4OF8A 5C0BB 5T1DL 3QDJB 4JDTH 2Y23A 2VLKA 3X13A 4FFWD 4NKOA 1KN4H 2GSIB 3MRKA 4U1SB 1U3HC 1JNLH 4ELKB 2DM4A 1IILE 1UM6L 3VRJB 4UDTA 5EB9A 5L7XH 1CD1B 4NZRL 2F58H 1WTGT 1H3XA 1MQ8A 1I4FB 4GUPA 5F7LB 3K4DA 3RWFB 3GKWH 3Q1SL 1JUFA 1T7ZA 2I5YH 1DCLA 1CR9L 1X5YA 4PBWD 5IQ9A 4WO4C 4OZHF 4KROD 5FYJL 4K07A 1YEFH 4UUJB 4I9WE 5BRZE 4G8EB 5FKPB 3OJVC 3TBVA 3I2CL 4OLYH 4RSVA 3FQRA 5IW1A 4I2XB 3SDYH 2YUWA 4HXBH 2UYLB 5C0JA 3EGSB 3SDXF 5JORB 1NCDH 2CDFB 3ULVL 1A0QH 5CGYC 4ETYA 3LQAL 3FB7A 4FRWA 1PDKA 1TNNA 3GMRB 5JMRA 1KJ3H 1RK0B 4HC1H 3JV0A 4ONHB 3HLAB 4G6AC 3UTTE 3GFUA 2BNRE 4K7FA 2L7UA 5TQ2H 5FO9B 3E6FB 4OJFH 5JNYB 4KC3B 4O2EA 4I0PB 4KJYB 4ZS7H 2DIJA 4KV5F 1H0DA 1NC4D 4RGOL 1EMTH 4O00A 4DKEL 3CXDH 4V1DE 4KK9C 4F15B 3ZE1E 5EBGA 4P48A 1BF2A 4DOHE 5AG8A 1FYTD 2VE6A 4JQVC 3C60B 1AJ7L 1HKFA 5HD8C 4OLXH 1KJ2A 3G6JF 5BQ7B 4DZBB 2IH1A 3Q6FB 1WBXB 2J8UF 5CBEA 3NBNA 3WFEH 4AIXA 4LGRB 4PRPB 1CN4A 1J8HB 4X7CC 4D0BA 5E8OB 25C8H 4LSVL 4FQ2L 5E2JA 1MFDL 5J89A 4QY8B 3QNXA 4K3JL 1R3JA 5D2NA 2HJKA 4LCYB 2X4TB 3HE6D 1EUUA 4JO4L 1HNGA 4LLUB 5DD6B 5DXWA 2P47B 3PHSA 3WUWB 4AL8L 3UPAA 5C9JB 1PX3A 4YEEA 1CFTB 4PJ5D 2VDLH 5I15H 3LSOA 1FL3B 3P9LB 2KH2B 1OSZA 4GBXB 5J1TC 1XGYH 1R24A 2I26N 5D1ZD 3QUXB 3REWB 4X80H 3M8OH 1BP3B 2EIBA 5K9JH 1BJMA 2I9LB 3FQUA 5AZEL 1GYAA 3HG1B 1TJIL 2IANE 4GKNA 5GGVY 3DMMA 3F5WA 1WFUA 1UWXK 1NFDE 3RL1B 3HAEB 5IEKA 5HYSB 1BVLA 2BSSA 3NH7L 2XTJD 3QO1A 4PLJC 5D71L 3WHE1 1YECH 3BHBB 3PXHA 3KWWB 1FYHB 3RVXD 1BHGA 4H8WH 3BN3B 5FYLH 1MCWW 4F57L 5CS7A 3FQWB 3QIBA 3FZUD 4Q6IA 5DJYA 2FO4A 3G5YA 5IHBA 4XT1C 1VGEL 2ZUUA 2EDHA 1H5BB 3IB4A 4S1SL 2E9BA 5KBNC 3GJEB 5I9QC 2HTKC 2VLRB 1G9NC 2D7QA 4ODVL 1AC0A 1KUMA 2R23A 5MEPB 3P77A 1UXWB 1JF1A 2R2EA 2A1WL 4Y1AB 3VH8G 1EGJH 2OTWB 4JRYB 2XXCB 4CDHA 1PFCA 5EU6E 3VFNB 2BVTA 4P59H 3NFSL 4FFYH 4P2QD 4WJ5B 1U8OA 5D8JL 5D6DC 1OM3H 3QIBD 4Q2ZB 4JPWH 5KSBA 1FNFA 2Z92A 4H26B 3D87B 3GSXA 5FM8A 4DVBB 1P4IH 2VDRL 1II4E 1AY1L 1L6XA 4MJ6B 5F89B 2CIIA 1CLZL 1J1XL 3T0EE 2A9MH 1RJZB 1YUHB 2YXMA 5EC1B 4LLWB 2E9JA 5EO0A 4YHZH 3U83A 1MCPH 1RIHH 1TITA 5BCAA 2X4OB 1MAJA 2X7LB 2OTUB 3U79A 3C87A 4MAYC 1DQJB 1M7DA 1NEZB 4TSBL 1QBBA 5D2LE 4ZPVA 5C1MB 5C0CE 1NGYA 1WZLA 1LK3H 1T04A 2VLKB 3NCBB 4KROB 3X13B 4PJAE 3NIDE 3L7FA 4NKOB 4WI4A 1RZKL 5IKCA 4OZHA 3CLFL 3MRKB 1RULL 4Z7UF 2OXGA 3NIGF 1R6VA 3LRGA 4AQOA 5GS0H 1ERNA 4XP5L 3ORJA 6FABH 4X4XA 3JBG7 3EFDL 4P49A 2R2BA 4UDTB 3JWDC 1WCBA 3SDXA 3U30B 1CDBA 1S78D 3QWQB 4GUPB 3VXSA 1LO3L 1MWAH 1OQXA 5FGSA 1JUFB 3WIHH 3U2SB 4WI2A 5IQ9B 3DO7A 4ZDHA 3B9KD 3FB8A 5EIVA 3DPBA 2AW2A 3TBVB 4JQIL 1OLZA 3IJYA 4KPHL 4LVNC 3O2VL 3FQRB 5D72L 5IW1B 1YZZA 1FGNL 4OCXH 5EU7C 5C0JB 4JZNA 4IIQC 4J1UA 5CFHA 4HULB 3QISA 3ULUL 3FB7B 5C0RH 3LHPL 5LG1A 5HDQH 3VXSD 5CZVL 2B5IB 3RUGA 2F19L 3D3VA 4K7FB 2Q8AL 1KXVC 4HMDA 3G6JA 4XP6H 4AQ1B 5GS0C 3S98A 2J8UA 5MERA 4O2EB 1HINL 4ZO7A 1Y0LA 3BD4A 1H0DB 4BZ1H 5E6ZA 5D6CA 2ERJB 3WUWG 2YMXL 4LRIA 1RD6A 4V2CB 1KCKA 4J23A 2VE6B 5HI3D 4U1KA 1ZT1A 2C1PA 3O6FC 3RVUC 2APWA 1KJ2B 4QXUH 2AXHA 2IH1B 2Y4SA 2DTMH 5CBEB 3CIQA 5FGBA 1VEOA 5TQ0L 5D1ZB 4PJ9C 2FEEL 4D0BB 5E56A 4I18A 1WF5A 4YPJA 4JFDE 2VXTL 3VGHA 4LOUC 4ZNEA 4PRNA 3DLQR 2DQHH 3VXME 3HAEG 1M05A 3QNXB 1T03H 1R3JB 5D2NB 2HJKB 5HYSG 2E7LA 2OK0H 2AGJH 5DD1H 3RVTC 1I1AA 1YMHA 4KHXH 2FEEI 4YUEH 4ZUUA 4FMFA 4CJ1A 1AFVH 4HAGA 5I8OL 3U9UA 5ISZD 3LSOB 4YHIA 1UCBL 2CKBA 4H0GA 5GZND 4YDLB 1MFNA 1OSZB 3EOYG 1R24B 2CK2A 3SHSA 2VRAA 3EYFA 5E99H 4LPWA 2QKIA 3BE1L 3FQUB 4GKNB 4Q97A 5IMLA 3DMMB 3F5WB 2NW3A 4HUMB 5IEKB 1RUAH 2R4RH 3FO0H 5F7DA 1BVLB 2BSSB 2O26U 5J4MA 3QO1B 1CFVL 4U1GC 5JXAH 1MRFH 2QBWA 5EOCL 3L95A 3EZJB 3QIBB 1A47A 1JZ5A 3CFDB 4YNYA 2DWEA 1HXMA 4CDGC 5DJYB 2GY7B 2FO4B 1OP3K 4JFFA 3G5YB 4X0KA 2ZCHL 5L9DL 1SM3H 3LKPA 2D9CA 4KQ3H 3TVMD 5IGXH 1GIGL 5D1XC 3KJ6H 1I9EA 3VWKA 3O3AA 3BW9A 2V9RA 5EFIA 2DI8A 3TJHC 3WNOA 3E8UH 2R0LL 2R23B 3P77B 4FQHA 2EDQA 5JW3H 5LCVL 1JF1B 1TENA 2R2EB 1NEZG 1K9TA 2BOBA 3B9VA 1TQBB 1UM5H 2F15A 2BERA 1SJVA 5E5UB 3S3JA 4P9HC 1U8OB 2EDLA 3SO5A 3VI4F 4PRIE 3G6AA 4WTZA 2WUBL 2EE9A 1CFQA 3UXFA 4M48H 5KSBB 5AWNH 3OF6A 5HI4D 4K8RD 4WFFD 5C6TL 3FOMA 3MLZH 3T2NL 1J5OL 4JFFD 3GSXB 4WRLA 3V6FA 3BKJH 1OAZH 3BKCL 5I8CA 4B53A 2BZDA 2CIIB 3IU4H 1GHFL 3TIDA 4OD1L 4LCWA 5CZKA 5FCSH 3U0TA 5EO0B 1T6WA 2BNQD 3TBYA 2M26A 1D9KA 1K8IA 2P5WA 4CVZA 1RZIA 2DBLL 2ED9A 4GH7B 3MLYL 5GHWL 4AEEA 3R0MA 1M7DB 4ZPVB 2NYYC 4GXVH 3EYOA 4Y2OA 1NGYB 3FT4A 1T04B 2EECA 4G6KH 1JL8A 3AVEA 3L7FB 4EJ1C 5IKCB 1FQ9C 4OZHB 1ADQL 2Y6SC 4R3SA 2NQCA 4EBQL 1OAQH 3RWIA 5EZLA 4LCWD 4J3OC 1DQDH 5C3TA 3B6SA 4X4XB 1IE5A 3FQTA 2CLRA 2R2BB 2AABL 2O5YL 3NGBB 1WCBB 2P5WD 3SDXB 3V4UL 1R3IH 1KPUA 1FVCA 3VXSB 1YNLL 4LCIH 2R0KH 4K3GA 4OF3A 2R0WH 4WGWB 2QQKH 3DO7B 1N5AA 4RGNB 4L4TE 4ZDHB 4KKCC 4OZ4A 1SBSH 3FB8B 4JEGB 5SWSE 2AJXL 3GSUA 3IJYB 3JV6A 1I1YA 2BY3A 4Z76A 3L3KA 3GNML 1JGLH 2GJJA 4RGMC 4BH7A 5GISH 3K4AA 4JZNB 2IQAA 4J1UB 1BGXL 2CIKA 4FFZH 4M93C 1ZVSA 3PP3K 4GMSH 2Z31C 2ZOLA 5MEQA 4HPOH 2NY0D 4IRJA 3HN3A 6CGTA 5I1JL 3QEQD 3RUGB 4OIIH 2P42B 5T33H 3D3VB 5C09A 3SDCD 3HMXL 3G6JB 3GIVA 2R2CA 4IHOA 5MERB 2J8UB 2P4AB 4DVRH 3FN9A 4Z18A 3BSZL 3P0VL 1AD0A 5FYKL 3EJYD 3T3ME 3B8YA 1Y0LB 4K3EH 4XVJH 5DMIH 2UV3A 5D6CB 3ARVA 2L7JA 3KG5A 3DUUA 5JIIA 5SWZE 1H8NA 1AE6H 5HDOA 2ILLA 3GGWA 1QSEA 4IRJD 4U1KB 1ZT1B 4YX2L 2C1PB 1KC5L 2JE8A 1MCQA 5TE7H 1IAIL 2IADB 5CGTA 1YEKL 1CICC 1JNNH 2QHRL 4HF5L 4JM2F 4DN4H 2IAMC 4I18B 2EIDA 5IROC 4PRNB 4N8CH 1OGAD 3QQ4A 1IAII 5DGQA 3MNWA 1M05B 3KHQA 5H37G 1RZFL 1LK2A 1T22A 4OM1L 3OKNA 1I1AB 1YMHB 1QFWI 3LS4L 3OR7A 4ZUUB 3GM8A 2NY1C 4DGIL 2E7MA 3KYOA 4L8SA 1NMCB 1TXKA 3U9UB 3VD5A 5IFHH 2DQFA 1CD0A 4YHIB 3L7EA 5C0ND 2CKBB 3SO3C 4QXGL 4NQTA 3L5XH 1CIDA 3AS1A 1NLBL 1WBYA 4PB0L 4MXQC 3ZE1F 4XPBL 5I1CL 3EYFB 3QA3B 2A0LD 3OJDA 2FCBA 4KAQH 3KPTA 2QKIB 3O9WA 1I8LC 2PYEA 4S1QH 4XPHH 1DLHA 1CGWA 5IMLB 4RFOL 2CJUL 2NW3B 5FDWA 2X1XR 4R7DA 2E7HA 1IEBA 5F7DB 4X9IA 4GW5A 5BXFA 3CDCA 3WHE0 3GO1L 2ZJSH 2FJHA 2HG5A 3BMVA 1OCWL 4AEIH 2H26A 5DLML 4AG4H 3V4PH 3L95B 4P2RE 4UZGA 4L4VA 4K3DH 3MXVH 2Q86A 4YNYB 2DWEB 2AEPL 1HXMB 1OB1A 5E08L 2WIIA 4NNPL 5IWLC 4JFFB 4X0KB 4M1GH 3LKPB 4DN3H 1NBVH 5I1GL 4OV6F 2GCYA 2HAZA 3DVFA 3MYJA 4LPCA 3VWKB 3VXTB 3O3AB 3BW9B 2ARJA 5EFIB 3TCXA 1YEEL 5T3ZL 43C9A 4FQHB 2X09A 4WFHE 5KJRL 4TVPD 2BOBB 5EUOE 5CIPA 3MOBL 5FUCC 4NT6A 5GGTL 1NGZA 5DWUH 5I8KH 1MY7A 2IG2L 3G6AB 4HIJA 4NQCA 1CFQB 1DFBH 3CVHA 3PHQA 2B0SH 3C5ZC 2D2OA 2XPGB 3FOMB 1D5XA 5E7FA 5HJ3A 1EO5A 2ZCKH 5BOZG 1KTLA 4GSDL 1Q72L 1DL7H 3V6FB 5I8CB 1F97A 2EC8A 4WWID 3TIDB 4LCWB 2Z4QA 1FDLL 1MHPH 3DGGA 2W91A 3U0TB 3TBYB 2UZYB 1D9KB 4CBPA 1K8IB 4PRHE 2P5WB 4CVZB 4CMHC 5FYKE 4NQDD 1RZIB 1UACL 4DQOL 1WZ1H 4R90L 5T1KD 3CGTA 4L5FL 2D0FA 4MA8L 3NCJL 3EYOB 3FT4B 4MNHB 4ENED 4YFEA 2CO7B 2OL3A 2MCPH 1OGTA 5CUSL 5I66A 3S35X 2KKQA 1QA9A 1YQVL 1A1OA 4G7YH 4OT1L 2C9AA 4XP1L 4R3SB 4KK6D 4YFDB 3RWIB 3ES6A 5EZLB 4YWGL 2NCMA 3B6SB 3OG6B 3FQTB 4A2MA 2CLRB 1P69B 4EQ3A 3GRWH 5ADPL 4ZXBA 4PP1D 3RKDC 2NY0B 1H3TA 5CD5C 1KPUB 4HLZH 4LQFH 5D70H 5D7SL 3TZVD 1CXLA 1FVCB 5M7QA 2DQGH 5B3JE 3QUYD 4GAJL 2YHGA 1A3LL 5DGRA 4LRNL 5DJ2A 1N5AB 4ORZC 1JMXA 3LZFH 4LLVA 4OFVA 3LPWA 3RY4A 1A3QA 2XA3A 3GSUB 1KEGH 3CNKA 4P2YA 3JV6B 5EOQL 1I1YB 5F7MC 4Z76B 1FJ1A 3L3KB 3LEVL 3VMNA 4M4RA 4EOWL 4BH7B 5D2LF 5L2KD 1HN1A 2IQAB 4OB5H 2YUVA 4TQEL 2CIKB 3K8MA 1ZVSB 3CAFA 3OJ2C 4JKPL 4L3AA 2X70A 3KLHD 4ZXBD 2ZOLB 4PJAF 3NIDF 3STZA 5MEQB 5KSUA 4POUB 3VFWA 4IRJB 1LWRA 5BRZA 2PNDA 1MELA 3WXWL 1A1NA 3CLEH 1AP2A 1I8IA 1KCSL 4XAKE 4PP2A 1RZ7L 3H7BA 4JZJC 5C09B 2R29L 2XY2A 3SKUD 3EO0A 3GIVB 1CGSH 1VFBA 1DDHA 1AXTL 4IHOB 1AD0B 1LO2H 2WP3T 3MUY1 2CK0L 1RIVL 4MA1C 2W92A 4YHOL 3DUUB 3GSWA 1AXIB 4XC1H 3ROLA 2PXYC 4YDKH 2AV7A 1UWEL 4IEFB 3GGWB 2BNRA 3O6MH 3ILQD 1QSEB 1IFHH 2B1AH 5E70A 4I9WD 3BPNC 1IC7H 2V2WA 3SGJA 4WFED 1J12A 5DK3A 1H8SA 2ZPKL 3RWCA 2AK1L 5IFJA 4V1DA 4P5MA 4O02L 4JM2D 1TETH 4MYWB 4BK5A 4JDVA 2CSPA 2OX5A 3QQ4B 3MNWB 3QQ9D 2ZUYA 1G7JA 1G9NL 1LK2B 1T22B 1FZKA 4WWKC 3ARDC 3OKNB 2MKLC 4WENB 3UTTD 3MLTB 3OR7B 1N6VA 2UWEE 4LLDA 3KYOB 4L8SB 3N06B 1QZ1A 2BHZA 1OARH 1YYML 2DQFB 4W6WB 3L7EB 1WVZA 5HDLA 5DDHA 3FFCA 5CSBA 4AIZA 3RZCC 4LLMA 4KY1H 4OGYH 1WBYB 2ED8A 5GJTL 4V1DD 2EC9U 3F58H 4PTUA 3OJDB 1E6OL 3O9WB 2PYEB 4XNYH 1DLHB 1OSPL 1SQ2N 4O4YH 5FDWB 3QXWA 3SE8L 4R7DB 1IEBB 1G6RA 4GW5B 5BXFB 1UH4A 2FJHB 2HG5B 3FQXA 2VH5L 2H26B 4P5TA 3LN4A 4HCRA 4WTZG 4PJBF 4L4VB 2VSDA 1MSPA 3VXRD 1JPST 5BW7A 4GXUM 4OFIA 2IANA 1IAIM 4KQ4L 5EORL 5GGQH 2Q86B 5CZXC 4YLQT 4MLIA 1OB1B 4Y5XA 2WIIB 1CWVA 4WVRA 1NFDA 3WNNA 2EXWD 2VDPL 4JM4L 5IESH 4BZ2H 1QFWM 2YOCA 4PTTA 1BQUA 1MRCL 5B39A 1BQHA 2GCYB 3MYJB 4EVNA 4F15C 2ARJB 3N1QC 5HHPA 2X4PA 3D85A 4FOMA 1Q9OA 2YA1A 5DRWA 43C9B 3K2UL 5CILL 3HAEH 4PR5A 5BV7L 5IP4A 2X2YA 5CIPB 4NT6B 1AI1H 5JQ6H 3D2UD 1NGZB 3U82B 4WTXA 2DI7A 5CJ5A 3QPQD 4HIJB 4NQCB 4YEFA 4XMKH 3CVHB 3PHQB 3BQUA 1N6UA 5HJ3B 1D5XB 3BGFB 1KTLB 1I75A 2IMMA 3IKKA 3MLUL 2IC2A 3HA0A 1JZ6A 4MQSB 2HFGL 4HWBL 1T21A 4ZD3H 3VD4A 2Z4QB 1MAMH 5EU6A 5FDYA 1A7OH 3DGGB 3D9AL 3D85D 1U8HA 2XZCL 1MFCL 4FQCH 4LASH 4QRTA 2HKFH 4NP4H 2NY5L 1QLEL 2SEBA 3CFJA 3EOAA 3U1SL 1TCRA 4KTYA 3SPVA 3TNNA 1YPZE 4FS0A 5KTEH 4U2YA 2WV3A 4V2BA 1CYGA 3QUYB 3T0EA 2EO9A 5AZ2L 1BWWA 2OL3B 3MMEA 2DOCA 4HT1L 1OGTB 5I66B 1QA9B 4Y2DA 1A1OB 1NAML 4ZO8A 5EU4A 1B4JH 3ES6B 1FL6A 3CPLB 4FG6C 2HFFA 5TGBA 2FRGP 5D2LA 3HI6H 3MV7E 3SE4A 3TFKC 5C0CA 4ZXBB 1RHHA 1AHWC 4EZMA 3N0PB 1FNHA 2JELH 4PJAA 1A6WL 4XP9L 1N7ML 1FLRH 3T0ED 3S8WA 5EBMA 5DJ2B 3MOAL 32C2A 4YDJA 4LLVB 3VA2C 4K23L 4Y2DD 3KPOA 1NCBL 1PSKL 1Y18A 3GHEH 1FJ1B 2CMRH 1I9IL 3QUZD 3H7LA 2GTZA 4NNYA 5INCA 4DK6A 1GPOH 2PETA 4JQXC 1JF5A 2A6DA 4HAFA 2CUIA 4YHML 2X70B 4YQXL 1INDL 3STZB 2QADD 5KSUB 4KDWA 3VFWB 4EXPX 4Y16D 4JY5L 4M5ZH 3ZKSD 5BRZB 1A1NB 4U3HA 1AP2B 1I8IB 1U9KA 4PP2B 3H7BB 3PHOA 3ZTJG 1A64A 3EO0B 1S9YA 1VGKA 4HQQL 4XMPH 1VFBB 1DDHB 3NAAH 3VMOA 2EH8L 3SBWA 2X4NA 2XT1B 1ZLWH 5L6YH 3GSWB 4KJQD 3ROLB 1BFTA 1RHFA 5A2LH 2AV7B 3BAEL 4LDEB 4C56E 4DUWA 4APQC 2BNRB 1NL0L 2GEEA 5FHBL 3LKRA 3KPMA 1C7TA 1PGRB 1DVFA 3MREA 2NY6C 2V2WB 5F8QC 4XPFL 3O4LA 1ZTXL 3QG7L 3DV6A 5E2UH 1BJ8A 1BD2E 2VKWA 2Y72A 3MLXL 3RWCB 3DSFH 3GBML 5IFJB 4V1DB 1R3LA 4P5MB 1YN6A 1OTTD 3L9RA 4JDVB 4NM8L 5JOPE 4MHHI 4DOHB 1HWGB 3ZYIA 1G7JB 5I1AA 3G5VA 1T2QL 1FZKB 2VMFA 3QPXH 1G7LA 3UDWA 4HHAA 1NUDA 1E6JH 3H42H 2Y36L 5EU7E 4P9HL 1ITBB 3T3MF 2WZPD 4JFDA 2MCG1 4Y7MA 4XCYA 2O5XL 4OLWL 5DDHB 1FHGA 3FFCB 4AIZB 1KJ2H 2C4XA 4LLMB 2LE9A 2I25N 1J87A 3D69A 4YXKL 1KN2H 1QLRA 2CQVA 5EUKA 3UO1L 2MKWA 3VFTA 2VITA 2DLHA 3MGAA 2F53E 5E7BA 3AXLA 1DEEA 1TJGL 4GG6F 4X6BA 5TPWH 1GCFA 1G6RB 3BRGC 4WHDA 3S34H 3LN5A 4GAGH 3OPZH 1MFBH 2VQ1A 2VNCA 3CMGA 3FQXB 4N0CC 2B5IC 3TH2T 4P5TB 3SGEH 3LN4B 4JFDD 2LFGA 1AO7D 4H0IA 1JPTL 2DQUL 4LAJH 5A3ID 3TNMA 4L9DA 3VXMD 2IANB 4JO3H 3V6BR 4NWUH 3U7YH 4MCZA 4Y5XB 1NFDB 1L7TL 5E4EB 5FYJU 2IWGA 4HUUA 4PTTB 5B39B 1BQHB 2A6IA 3U9PH 3SJVE 4EVNB 4I3GA 1R0AL 2EXYD 2HT4C 5HHPB 2X4PB 3D85B 4GW4A 1Q9OB 1IGIH 1S7TA 1N4XL 2X1WL 12E8H 3OZ9L 4PR5B 4XH2A 5H37H 2CR6A 3CX5K 2VDQH 4HIHA 2YZ1A 5FUZH 4RAVA 4U6VL 4MVBD 5TFSH 3SDAC 5IG7A 2DIAA 4N5UA 3BQUB 2R0ZH 3FT3A 4Y4KA 2D9QB 4XCEA 5LBSH 1MFEH 4GFTB 4QOKE 3FTGA 3NCEB 3T77A 2DB8A 3J8F7 1T21B 3TO4D 4LSSH 5EU6B 1FP5A 1U8HB 4LCCA 3SGKA 4QRTB 5LGHH 4PRIA 3H9SA 2SEBB 3OR6A 3W2DL 3CFJB 4F58L 1JHKL 1TCRB 3SPVB 4ERSH 4ACPA 1NGQH 1JF6A 3TNNB 4G6FB 4UINH 3A0OA 3W5NA 2DBJA 3T0EB 4XP4H 4QHKI 3MMEB 2QL1A 1TJHL 3HZVA 3P9MA 3QRFM 1IC4H 1NGPH 2B20A 5CINH 3TN0D 4Y2DB 5E2WL 1IL1A 2LTQB 5EUOF 4JG0L 5EU4B 2Q8BL 4WI5A 4JLRA 1FL6B 1A4KA 3DGCR 3S35L 2WQ8A 5JZ7C 2HFFB 5HVFB 5TGBB 1CDHA 5D2LB 3T2OA 5DJAA 4YO0A 3VI3E 3FFDA 5C0CB 2DQEH 3TJEL 4YR6A 1B88A 4U4BA 4PJAB 2UUDH 3ARWA 4X5WA 3WDIA 3MLPA 1U3JA 1RSFA 2Q20A 4MD0A 4Q6IC 4KTEH 5EBMB 3FO1A 32C2B 4L9LA 4YDJB 3N1MC 5T3XL 1QFUH 4FNLH 3OKDA 1CFNA 3KPOB 3U4EB 1JJUA 4NN7B 5C0AE 1Y18B 3TYGL 3KYKL 1NKRA 3ZKNC 1OD9A 2GTZB 2IGFH 4NNYB 5INCB 4AEHL 3A67H 2FO1A 1NQBA 2A74A 1UFUA 5ERWA 1L0XA 3V4VL 3V95A 4L4TA 1Y6MR 5SWSA 2ZSWA 5E9DE 2YD4A 2VXUH 2ADIA 4UAOC 2O5ZH 1B4RA 5LQBL 2EO1A 3PHOB 3OG4B 4R4ND 4X7TA 1FSKC 1S9YB 4AENA 3DUHA 1QG3A 2NY4C 1T0PB 2FB4L 1LD9A 5DMKA 1KNOA 4WY7H 2X4NB 4QHUB 5B3JF 3ALWA 4RWYL 5IB1A 2VABA 1KSRA 3I6LE 4POYA 1GC1H 5HTSA 4JR9H 4OCYH 4L4TD 3RFZC 1C5DA 4ZODA 4HUXA 3LKRB 3KPMB 3MUGA 1DVFB 3MREB 5DUPL 4D3CL 2D0HA 2LQRA 2YS4A 3O4LB 3ZSSA 2RFXA 3DV6B 1CL7H 2O93L 2E9WA 4G9DA 4WU7A 3OAYK 3HC4L 5SWZA 1YN6B 2FECL 5D7JA 3L9RB 1PG7X 4OLEA 5J7CC 3AU1A 3KYAA 3ARBD 1FORL 4M7JH 1DBAL 2KZ1B 5I1AB 3G5VB 3S36H 1P7HL 1PZ5A 4G7VH 4Y4FD 1G7LB 3WSQL 1CI5A 3GM0A 2DF3A 1C5BL 4HHAB 5I74B 5JW4M 4D0DA 3KPSA 4P2CG 5ETUA 4OCWH 5ABDE 1HEZA 3QFDB 4RWHA 2A9NH 4TRPH 4JFDB 3EHBC 4UTBL 4RGNC 4XCYB 1G7HA 1WIPA 2HLFC 3D69B 3W81A 1QLRB 3W11C 4WU5A 5EUKB 5B39G 4Y88A 1BEYL 3VFTB 2VITB 1GC1C 2FATH 1CLYH 3HCVA 4WCYH 1FPTH 3AXLB 1DEEB 5I76A 4X6BB 3JWOL 3MLWL 5IBTH 3ZHKA 3LN5B 4KI5D 1S7WA 1KPRA 5JPMA 1WEJL 2VQ1B 4NSKA 4Q9QH 2MMXA 2C3XA 1KBGL 3C08H 2YBRA 3VG9C 2EDYA 3ARPA 1BM3H 3TNMB 3V6ZA 1FIGH 1JGDA 2CKBH 1EX0A 4OFKA 4JN1H 5GRVL 3NCCB 4MCZB 1J10A 3A6CH 3QEGH 2UWEF 2DQCL 3ARFD 4TN9A 4HUUB 4LF3A 4K7PY 3EJZD 4YE4L 1ADQA 3O8XD 2A6IB 4PJFE 1JYNA 4XMLL 4MJID 1MJUH 4EN3D 1ED3A 2P5EE 4P2RA 1S7TB 3DXAE 3OX8A 2AKRA 5FOBA 4XH2B 5I1IH 3FN0H 5E1HB 4G6JH 3WMSA 4KRPC 4GQPH 1RU9H 1TTUA 2EZ0D 4HIHB 3FCTA 7FABL 3IDYB 3FOLA 4RAVB 5DQDL 1JWUA 5DJDA 2DQIH 5IG7B 4Z8FH 3VFMA 3FT3B 5D93B 3HC3H 4F9PC 3DRQA 2ZUWA 1DBJH 1UC6A 3MRJA 1EHNA 3RPKA 1RMFL 1B6DA 3FTGB 4K8RH 4PB9L 3JZ7A 1J1OH 4IOFD 3ETBF 3T77B 3IDXL 4M7KH 1JHTA 5EUOA 1IQWL 4LCCB 4P2RD 2YPKA 4PRIB 3OR6B 3VRIA 1EJOL 1UB5A 5E2TL 4IMLA 4RX4A 3DRTA 3QDMD 2JIXD 1KTRL 4DAGL 3GBNL 3N1PC 4QLRA 4HWEH 2B1HL 3R06A 3HZVB 4ZPTA 3P9MB 1WT5A 4P9ML 5K9QI 1Z9OA 4DEPB 3BDYH 3HMXA 5BVPL 1U36A 3HE7C 3RDTD 1IL1B 1BQSA 4WFHD 5I73B 4PRHA 4JLRB 3KHOA 1A4KB 5C86A 3MV9D 4K9EH 2QV2A 4UOJA 3WNKA 3C09C 1NCWL 3O4OC 5DJAB 4PRDA 4YO0B 1GJIA 3FFDB 1YNKL 3IFNH 1MREH 5I75B 1XGPA 3HS0A 4RX4D 4LCUA 4YR6B 3NMEA 1UYWL 4X5WB 3U36A 1NGWA 4MD0B 1QD0A 3OWEA 5KS9E 3FO1B 4YFLI 1HYSD 4L9LB 1MNUH 2VDKH 3OKDB 5ANMA 3IXTA 1AIFA 1CFNB 5FUCE 3VD9A 1RUKL 4Q7DA 3AUVA 1KF9B 1WFTA 1YPZF 5D5ME 4G8GD 4ODHL 3LMJL 3BDXA 4KJWD 1U3YA 4R2GC 1KXQE 4P3CL 4N8VG 2HKHL 4OUUA 2A74B 4KHTL 1T66D 1YEGL 2QEJA 4LAQL 5ERWB 3QCTL 4XWOD 1YEIL 2AI0L 4L4TB 1C8PA 1EPFA 2VIRA 3VCLA 3LEXB 1V3KA 1Z9SA 1QLFA 1CE1H 2FBJH 3I85A 2ZSWB 4YXLH 5SWSB 2PW1A 3V0WL 1A4JA 2ADIB 3A6BL 4DJMA 1GAFL 2HRPH 4OIAA 2P7TA 5E6IA 1DZBA 4X7TB 4AENB 3BI9X 4K9EC 4QRSA 4O5LL 3KPRA 5EG6C 5DMKB 4J4PC 4U7MA 1XIWD 5F7YC 5KANG 1KNOB 3PF2A 5IB1B 2VABB 5F7EH 3KPNA 3H3KA 1YY9C 4Y4FB 3VXUE 5KVGH 1P84K 2BY2A 5EBWA 4OQTA 2DL9A 2WBJD 4UT9L 1C5DB 3ZDYE 1EHXA 4PS4L 5E4IA 1Z3GH 4HUXB 3MUGB 3QI9A 3LB6C 1MLCA 4ZUSA 3IAGC 3EFFA 5IB5B 2PYFB 2RFXB 3BPCA 1KENH 4G9DB 1JYWA 5L0QB 4WU7B 2R9HD 5KW9L 3WN5C 2P24A 3AREA 5SWZB 2AP2A 1JPSH 1I9RH 5D7JB 4E41A 1DUZA 3AU1B 2VUYA 3HNVH 2M2DA 5BO1H 5I17A 3SQOH 4DUXA 1U3HA 5MENE 2ORBH 4L29A 3AROA 1BVZA 5DD5L 3HI5L 2R56H 1PZ5B 3BO8A 4FZ8H 4LSUL 5D1QA 4XAKD 4NGHL 1VFAA 1MCHA 4D0DB 5E6YA 5ETUB 1YQ2A 1HEZB 1KELL 1JRHH 4M6AA 1V3LA 3N9GL 1G7HB 3UJTH 5GGTA 5I1KH 4PD4K 4MA7L 5DC9B 5F8RC 2V7NA 4X5XA 3BH9B 1TLKA 4WU5B 2IPTH 3CX2A 2P8PA 2DQTL 3ARFB 3UTOA 3M1BA 3F12A 3HCVB 2UWEA 4P46C 1CCZA 3ZTJH 4X98A 3W9EB 2RR3A 3O8XB 4GJTB 1GH7A 1NMAL 3LIZH 3PV7A 5I76B 5I1HH 5ALCH 5J9PA 3HMWH 1S7WB 1FAKT 1KPRB 3WD5H 5JPMB 4Q9RH 3O6KH 3WXVH 4ZFGH 2EDKA 4TTDC 4NSKB 4C59B 3KJ4C 1YJDH 4FN0A 2YBRB 4OM0L 3MCLH 2AV1A 1MPAL 2HT2C 5HHXH 2Z0BA 1U6AL 3V6ZB 1CQKA 2E27L 5CAYB 1JGDB 4WFGD 4WO4D 1G1CA 4I3SH 2PR4H 4PGCA 4I3RH 3ZT7A 1EBAA 3K1KC 4LSRH 4RBPH 1V7MH 4W4NA 5C0BE 2JF1A 1RJLA 4OCSH 4N68A 4YHKH 3WIIL 3WE6A 4LF3B 2H2SC 4M7LT 5HVGB 4GRLA 1BBDH 4QHKJ 4MB5A 4TSAL 3WJJA 5BJTB 1IGCL 4HIXH 1ED3B 5CGYD 3P0YH 4P2RB 4FTVE 5JIPA 4Z0BL 3OX8B 4X99A 2NLJA 2AKRB 2HT3D 3HHRB 2WWMD 4N9GA 4OTXL 5FOBB 1MJ8H 3QWRD 3TPKA 2HJFA 3FCTB 1WQVT 4RFEA 4G6AD 2FX7L 3MTRA 3FOLB 1PKQE 4F9LC 1JWUB 1VACA 5T5NF 3V5HA 1T0NA 5DJDB 1EIBA 4PJXE 4JFEA 2W60A 3ALXA 3VFMB 5D4QA 2QTEA 3DRQB 3MRJB 2ICEA 1DANU 3WS6C 2D7PA 3VFUA 4B41A 3D0LB 1NH6A 3GMPA 3H9HA 3C8HA 1LO4L 1YJDC 1A7NL 5FYKU 1JHTB 4KK9D 5EUOB 3X12A 1H3PL 2H3NA 4X6DF 2YPKB 3TT1L 4ZTOL 5I8EA 1I3RB 5EZIH 4PJIE 3GMQA 3CD4A 4KXZI 2W0LA 1HZHL 1UB5B 3VRIB 3WKMH 5HD8D 4IMLB 1XH3A 1C16A 3DRTB 3GK8H 4O9HH 1RUQH 1INEL 5HYJE 4IRZL 1Y6NR 5CIPH 3R06B 4F7PA 1NFKA 4EDWL 4ZPTB 5B8CC 3O9WC 5GGRY 1F4YH 3MV8E 1F8TL 1D5ZA 4XWGH 3CVHH 5T5FH 4LLQA 3X3GH 4S11A 4PRHB 1OHQA 4XXCC 4DCQA 4KK8C 3MLVH 3D0VA 3GEWB 5JHDD 1MIMH 1P4BH 5E24E 1X5KA 3IVKA 1YPZA 4M03A 3GHBH 1T7YA 3FO9A 4PRDB 3ULSA 1MAKA 1EZVY 1V8HA 4ALAL 4OLUL 2JCCE 1XGPB 3HS0B 4LCUB 4ZFZA 3U36B 1ZGLM 4M62H 3UTPD 4MJ2A 4NJAL 1W0WB 1KGCE 5ANMB 3IXTB 1AIFB 2OL3H 4PRPE 3MV7A 1U8NA 3Q2CA 3VFGL 2HA1A 5BZDA 3C5SA 5DFVC 2Q3AA 4YXHL 4JVUA 4OUUB 4PLJD 4L3ED 1KN4L 5HSFA 4NO3A 2VIRB 3VCLB 5GQBA 1QLFB 4XAWL 2PW1B 3K81A 3E3QE 4HGKC 3RX7A 1A4JB 3VW3H 1DLFH 2P7TB 2R1XA 4CADA 2AJVH 4PG9A 5IBUB 1S8DA 3VI3F 4QRSB 3KPRB 1ZV5A 3NABL 1QYGH 5DS8B 4POZD 5EWIL 3GJFK 1V7NL 1A9EA 2HTKD 3KPNB 4N0YL 3HG1E 2DKUA 4NQEA 5C0IA 5EBWB 1MCNA 1HK6A 4PJ8D 2Y06H 3I9GH 4NKMA 4MAYA 3RY6C 3QI9B 1MLCB 4ZUSB 3EFFB 1NCDL 1KLUA 3BPCB 2NR6C 1A0QL 1K4CA 4RMRA 2EH7L 5DD0H 1ZKAA 4F3FA 5EU5A 3J7HA 5KSAA 2P24B 3AREB 1KJ3L 4HC1L 4E41B 1DUZB 1MHCA 4C56A 5I17B 1YYLL 4HV8A 1U3HB 4L29B 2NY3B 5FYLD 3BO8B 4LLYA 5BS0E 1PG7L 5D1QB 5F93C 4EQ2A 2FZ3A 1VFAB 1BD2A 1DBBH 2W0FA 3LQZA 3MJ9L 2Y1VA 4J8RA 1XF5A 3PWPA 4LHUA 2NY7H 3ARZA 2WBWB 1U3ZA 2V7NB 4X5XB 3CC5A 1U8IA 2P8PB 4YHLL 1QBLH 3M1BB 3S4SA 3F12B 1CDCA 2UWEB 1TVHB 4NUGH 4X98B 5A43C 2D03H 2VJXA 4HK3J 3WFEL 4IIQA 4HWBA 5C0EA 3ARQA 5J9PB 2AJZA 1C08A 1G9MH 3OKMA 1H15A 2XKNA 2AV1B 2BJMH 4HIEA 5JOPD 4JZOA 3WDJA 2F53A 1KB5A 1A7QH 4PGCB 2IBZY 1XF3A 2AS5M 3MV01 1RJLB 2EDEA 5I15L 1PLGL 2VLKE 3MODH 3WE6B 1IKNC 5IW6A 2OS7A 1NAMA 5EA0H 2VDMH 2GW5A 1YMMD 3RA7H 5FIEA 3U0WH 5F9AC 4G3YL 5H35A 4Z95L 5MI0C 4U1HA 2VKXA 4X99B 2NLJB 5IEHA 1G6RH 4N9GB 1MFAL 1NMBH 2VDNH 2HJFB 3S97C 3L3OA 2GFBA 4RFEB 2NW2A 3UZVB 3RQ3A 5HGGS 3BUYA 2IH3A 1VACB 2V17H 4LU5H 2DWDA 1T0NB 4HCRH 3V5HB 3LH2L 5AYQA 2GITA 4JFEB 5GS0D 2W60B 1ZS8A 4PJ9A 3SJVA 3QRGH 3UTSA 4TVSa 2V5YA 3S37H 3ZSTA 3QZWA 2ICEB 5FYLL 5T1DH 1OAYL 2X4QA 3GMPB 3H9HB 3MBEA 1G9MC 5F9WC 3MZTA 5GSRA 3X12B 4HUVA 2H3NB 3B2UC 4OD3H 5I8EB 1VDGA 2ZUSA 3GMQB 3O6FD 2APFA 4OAWA 3AM8C 4ONGL 1W72A 1KXTB 3RVUD 1XH3B 1C16B 1UM6H 1VEMA 3TLRA 4PJFF 5KVMC 2X4RA 3S6CA 4QOKA 1BAFH 4MAUL 2DLFL 4NZRH 4BQ8A 4KWUA 4F7PB 3SJVD 5F1KC 1BQLL 4Y19E 1JBJA 1UT9A 3Q1SH 1D5ZB 4LLQB 4FFYL 4DCQB 2RBLA 2PW2A 3D0VB 5J11B 5I30L 4KTDL 4HJ0C 2CKNA 3RVTD 3IVKB 1YPZB 5L8LB 3I2CH 1U92A 3FO9B 4P5TC 3ULSB 5LJYH 2G2RA 4EEEA 1P4IL 3O0RH 4ZFZB 3ULVH 1VESA 4F7CA 2Q6WA 3QBTB 3LQAH 4QOKD 2NY2C 5F6HI 4J3TA 2WANA 5E4EC 2C4FU 3T0WA 1MF2H 2XG4A 3L3DA 5MP6H 3O2WL 4EI5A 3MV7B 1EH9A 1R5WA 1U8NB 3E2HC 5BZDB 3C5SB 1IARB 5I9QB 4DGVH 1SBBA 2J88H 4XBGA 5HHVH 3QDGA 1FG2A 4NBZB 4XTRC 1F6FB 1Q94A 3IDJA 4NO3B 1KB9K 1KTKE 4Y4HC 6FABL 5ITFA 1EAPA 1ZWIA 2R1XB 3UPRA 2XV6B 3B5TA 4XVTL 4CADB 3CFKA 4PG9B 1S5IH 1S8DB 1VA9A 5LGJA 2P45B 4RMSA 5D1XD 3WIHL 4HJJL 1A9EB 4M6MH 1C1EL 4WI8A 5KS9F 5E9DA 3ULVC 4ODTL 2FJGA 4LSVH 4FQ2H 1JP5A 3LQAC 1MFDH 4NQEB 5DUBA 3HB3D 5GRXG 5C0IB 1CF8L 1MQKL 3D5OF 4G80A 4NKMB 4MAYB 1O7VA 4JDZA 4OCXL 3SE9L 5D5MF 5C0AD 4AL8H 3NFNA 1M4KA 1KLUB 3PGCA 1K4CB 1QBAA 3PQYE 4F3FB 5J8OA 5EU5B 1Q38A 2G5BA 2LTQC 3G9VA 3SKJL 5C0RL 5KSAB 1NSNH 1YNTA 1IZJA 5HDQL 1MHCB 1MCRA 4C56B 3V5DA 3WLWC 1P7QA 4HV8B 3SE4C 3ZTNH 4XP6L 2QQNL 3KYNA 4GT7A 4LLYB 4FQIH 2HTLC 3MRMA 5AZEH 3U7WL 2FZ3B 2BRRL 1BD2B 2W0FB 1SEQL 1B2WL 3LQZB 3DYOA 3MZGB 1LEIA 3SGDI 1LO0L 2NYYD 1I3GL 4J8RB 1XF5B 3PWPB 1CGVA 1RIUH 4LHUB 4WEMB 4Y89A 1HSAA 1QRNE 1LVEA 3I6LD 4D9LL 1GSMA 5D96C 3CC5B 1U8IB 3ZDYF 5C08E 3FRPA 5KSBE 1NDMA 3S4SB 1JPGA 3IDUA 1DN2A 4LVNB 1CD8A 3TP4A 4Z7WE 4IIQB 1FO0L 2YRZA 5C0EB 3G08A 1VGEH 2AJZB 4G9FE 5DFTA 3DURA 4S1SH 1LILA 5CEZE 5J56B 2Z31A 2YPLE 1C08B 3BRDA 3CX5J 3OKMB 4M02A 1H15B 2XKNB 3QHFL 4A6YA 2X1OA 3LPFA 3I84A 4HIEB 4JZOB 2WUCL 1DQTA 4UIKL 1TPXC 2AGJL 2F53B 1KB5B 3PL6D 2A1WH 4RISH 2X4UA 4LFHG 1AGFA 2YA0A 3H9ZA 4YUEL 1S9XA 1L9MA 1XF3B 2IFGA 3JXAA 3NFSH 3NIFE 5D8JH 1KTDA 1WWAX 4J3SA 2XXMB 2I07A 3K8LA 4HXAL 5IW6B 4AMKL 1NAMB 4MCYA 4NWTH 3GKZA 2YD8A 4KUCF 3VGGA 3WL9A 1CLZH 1J1XH 3IDMA 4U1HB 5E99L 4L3CA 5IEHB 1DVFC 3L3OB 3DROA 2GFBB 5GS1A 2NW2B 2IH3B 1HNFA 1RUAL 2DWDB 3FO0L 4FHBD 4X7SH 3CFIC 5E8NA 1BZ9A 1CICA 2GITB 2HJLA 1ZS8B 4PJFA 4PJ9B 3SJVB 4QCIA 3UTSB 1FAIL 2NXYB 2IAMA 3IFLL 1ZHKA 4TSBH 5JXAL 2P5EA 4GRWE 3QZWB 4RGNE 3DXAA 3G04A 2X4QB 1XMWA 3MBEB 4WV1C 1FNEA 3O3EA 5GSRB 1RZKH 2PUQT 4YFLF 4HUVB 1JTOA 3CLFH 1RULH 5EC2A 1Q8MA 1LHZA 2QQLL 4FZEL 4KQ3L 3ZDZE 4OAWB 3RAJH 4C83A 1W72B 5IGXL 3C5JA 3Q0HA 2F5AH 3V52L 4YK4B 3EFDH 1UWGL 5GGSA 1HSBA 1MOEA 4TNWK 2X4RB 2DMCA 4QOKB 4NKQB 1CICD 3KXFE 3PWVA 3RUGE 5JW3L 2IAMD 1EHLL 1LO3H 3D3VE 2A6JA 4KMQA 3VRLE 1EFXD 3B2VH 3VFRA 1KYOK 1UM5L 3UZQA 1N64L 3DXAD 4I5BA 1I8LA 1QFHA 3S88L 2PW2B 4U1NA 1TTGA 4ZNCD 4D0CA 5AWNL 1ZGLP 4PJXF 1TTFA 3MLZL 4KDTC 2NY1D 4KPHH 1DQLH 3BKJL 2G2RB 4BFGA 3O2VH 5D72H 5L2JA 1FGNH 4U1GB 5EH1A 2OLDA 2RJMA 3NPZB 3IU4L 4W68A 1F02I 1F4AA 4LPUA 1OQOA 4F7CB 2Q6WB 3ULUH 3N50A 4KJPC 3TA3A 3LHPH 5DC0A 1DBMH 4ODUB 4MXQD 4YC2B 4K94H 4KGLA 1RZKC 4PJIF 5CZVH 5IWLA 1S3KH 1RAMA 3L3DB 4R8WL 2F19H 2K7PA 4EI5B 2Q8AH 1R5WB 2UVEA 4OGXH 4QRPE 4GXVL 1N0XH 5AD0A 1F58L 3RVXC 4XBGB 1O7SA 1NBQA 1FG2B 2YD7A 4HH9A 3IDJB 3IDYC 5F6IC 2YMXH 4UTAH 4XRCA 3CDGA 3KS0J 4GAYA 2X1QA 4ZUWA 3SEPA 4F8TA 5ITFB 1EAPB 5D93C 4Y4KC 1ZWIB 3UPRB 5JUEL 1RUML 3EDFA 3CFKB 1NCAL 5D5MA 1HILA 5LGJB 3DVGA 1Z0MA 2JCCF 2VR9A 1GGUA 2R0KL 5TQ0H 2BVQA 1D5MA 4K3HA 1JZ7A 1YDPA 2R1WA 5E9DB 1ORSA 2FJGB 4KKBC 4MDJA 3UC0L 3ULUC 3PJSA 5DUBB 2R8SL 3AY4A 3RWGA 3ZZ1A 4ETQA 2ZG2A 5IHZB 3EDDA 2WWKT 4G80B 4YBQC 4JDZB 4LHUG 1P6FA 1ZANH 2J1KA 2YPVL 3NFNB 2YWZA 3UMTA 2AJUL 3PGCB 4M6OL 3VE0A 3S9DB 3C5ZD 1NDGA 3RI5K 2G5BB 3S4SG 1UCBH 1YNTB 2E3VA 3BGMA 1UQSA 3Q48A 3VXUA 1A5FH 4FQLL 1IRAY 4KKLD 5ID0A 3V5DB 1P7QB 5DA4A 5T33L 3KYNB 4RMQA 4X9BA 4M7LH 3MRMB 5IW3A 5DR5L 1X5FA 5DURD 2HH0H 3QDAA 5DMIL 4XVJL 1ZGLA 1LEIB 1L9NA 1W0YT 3BEVA 2JB5H 2BXYA 1JRHI 4ISVA 5T5NG 3HUJE 2ZZUT 1AE6L 2ESVA 5MENA 1HSAB 5HBBA 5EOCH 1HCVA 1KCUL 1NDMB 5TE7L 1JPGB 3OAZK 3IT8D 4M4PA 1QSFD 1A6ZA 3NCMA 4RGMB 1S78C 2XACC 1JNNL 2G60H 5L9DH 3G08B 2ZUVA 1MY5A 5GGUA 4D9QE 3DURB 5DVNA 1D7FA 1GIGH 5FECA 2Z31B 2YKLH 5CD5D 4OCLC 2XQBL 4A6YB 1SYSA 4GMTH 2ZCLL 2MTPA 5LCVH 2X4UB 1AGFB 4JZJA 2LU7A 5MEND 1S9XB 3ARGD 3QZWG 5JDSA 3QSKB 1S9KC 1KTDB 5A1AA 5IFHL 1NJ9A 2WUBH 4ODBD 2I07B 2VTFA 4L8BA 4WGVB 5IT2L 3H0TA 1A1MA 1GRWA 4MCYB 5DFWH 3T2NH 1J5OH 3K8KA 3ZDXE 2PXYA 5CKGA 3WL9B 5B22A 2Z8VC 4KUCD 8CGTA 3IDMB 4L3CB 4KAQL 4PJCE 3K1DA 4OD1H 1MCWM 3JTSA 4XPHL 1A8JH 1RVFH 3DROB 2X41A 3VDAA 5GS1B 1P5VA 4OFPA 3LCYA 5EZOL 1A7PL 1J0YA 1BZ9B 1CICB 5E8NB 2HJLB 3MLYH 4PJFB 1VFUA 4QCIB 3OB8A 2IAMB 1ZHKB 3VD3A 4AEIL 2P5EB 2AEQH 3OBAA 4FTVA 3DXAB 5AAWA 5TDOA 1S7XA 3G04B 5F6HJ 1HHKA 1FNEB 3O3EB 4NZUH 2PXYD 4WWKA 3ARDA 1ADQH 3ARYA 5EC2B 4WEBL 3VFSA 1PKQA 2NY1B 4EBQH 4M1GL 3BT2L 1RQ5A 4PJXA 2NXZC 4C83B 3HFML 4MHHG 1MUJA 3C5JB 4NUJA 5C0BD 4DK3A 4Z7VE 2AABH 3QDJD 5GGSB 3SO3B 2O5YH 1HSBB 1ACZA 1JGUL 1HYRC 1NANI 5TDPA 3BP7A 3V4UH 3RZCA 4S2SA 3PWVB 2CGRL 2O61A 2J6EA 1YNLH 3O6LL 1ZVYA 4W6YB 2A6JB 5C09E 4DTGL 3VFRB 1P53A 1U91B 3CK0H 4I5BB 5I8KL 5DWUL 4PJIA 2KUTA 3DI3B 3WKNA 4WWKD 2C3WA 4D0CB 1DFBL 2AJXH 3ARDD 4LQ1A 3UAJC 5HYJA 3M17A 5L2JB 4JO1L 2P46B 3KPQA 5JO5A 4UBDD 3TV3H 4J7RA 1XR9A 3MV8A 5DHYB 3BXNA 4XPGL 1QSEE 4NO2A 3GSNL 3WFDH 5LXGL 3G5XA 3TA3B 4S1DC 4P5KA 3CZFA 1GGBL 5DZNA 1WISA 1HXYA 5I1JH 3BH8A 5JA8B 1DQQA 1WWCA 4LARL 1WZ1L 3HMXH 2JCCA 5AD0B 1TVDA 5DMGC 2HWZH 4HS6A 1UZ8A 2WW8A 1P84J 4FQPA 5FYKH 4QHNA 5HYJD 2HFTA 4G7YL 2M1KA 4X6CA 4HH9B 4UNUA 2AJSL 1FG9C 3MV8D 3OAUL 2Q3ZA 4XRCB 3CDGB 4CUCA 4GAYB 4ZUWB 3SQBA 3LD8C 5ALBL 4YX2H 3QUKA 1KC5H 5D5MB 1HILB 3LKSA 3DVGB 1B9ZA 1IAIH 2EEBA 3T08A 2V2TA 2QHRH 2DQGL 4HF5H 2PTUA 1D5MB 4HWUA 1YDPB 2OP4H 2PYEE 2R1WB 1R3KA 4PLKC 1ORSB 1R3HA 4MDJB 4NQSA 3PJSB 3O81A 3RWGB 4ETQB 1KEGL 3DUSA 4NN5C 4OM1H 4EUPG 1XGTA 1KGCD 2H2PD 1F2XK 3LS4H 4PRPD 4PD4J 1U2HA 4DGIH 5E8PA 1WT5C 4RAHA 4RRPG 3VE0B 3FRPG 1NDGB 4L4VE 4QXGH 3VDBA 3BGMB 3P4OA 2E7BA 1UQSB 3HPJA 3VXUB 4BSVA 3S96A 1Z0NA 1NLBH 5ID0B 4PB0H 2FBOJ 4XPBH 2XZAL 2IALA 3MRCA 3MRRA 2VC2H 4X9FA 1LO2L 4ZYKA 2CUMA 1AHWA 4OQTH 2GI7A 4GBXD 1ZGLB 1UWXH 1UA6L 3BEVB 2WM0A 3SKOA 3GO1H 4C4KO 4ISVB 2XA8H 3O3DA 3L1OL 2DQDL 3LVEA 5DLMH 1X5LA 2ESVB 5MENB 2D4DA 2VUOA 1IFHL 3HG1D 4NQCE 5BS0A 4Y8DC 4TSCL 1A6ZB 3B9EA 5EO9A 1XGRA 4NNPH 4JQXA 5GGUB 5I1GH 3DARA 1FFOA 3NCYP 2V5SA 4QGYA 4W6XB 5FECB 1WUNT 4LEXH 2DLIA 2LU3A 2W9LA 4LP5A 5E6IC 2EDFA 1SYSB 1YEEH 5T3ZH 5KJRH 5LKNA 3H6JA 4JZJB 2IF7A 3V79C 1RJYA 1DEDA 5JDSB 1VKXA 3BZFA 5GGTH 4MMZC 2VQUA 2IG2H 3ZYJA 4ZQKA 4RDQF 5EOTA 3TGXA 1NJ9B 1RV6X 4L8BB 5D7KD 1JFQH 4MZ3A 1XT5A 2DYPA 3H0TB 4OI7A 1A1MB 3PWLA 5DQJA 2A83A 1N6QL 1Q72H 4HUWA 4OGYL 4KY1L 4Y1AD 5I71C 1P4LA 2N56A 2PXYB 2GAZA 4JRYD 4KZDH 4OZIE 3F58L 3MRNA 5C71A 3ARTA 4APQA 1MHHA 1UVQA 3QI9C 2XG5A 5KSBF 1B0GA 1NBYA 3JTSB 3SDCC 3BPNB 2DMKA 4Z7WF 2WSKA 1J0ZA 4JREB 1YC8A 3AREC 3VMPA 3GMLA 1UACH 1SVCP 4DQOH 4R90H 4L5FH 4KI1A 3FMGL 1EERB 3NCJH 4FTVB 2NY3C 3H2WA 3CDYA 1S7XB 5TDOB 2FL5A 2YD5A 4JAMA 1HHKB 5CUSH 1Q1JL 4OIBA 4JFYA 5D1QC 1YQVH 4WWKB 4J3UA 5GGQL 3ARDB 1SY6L 1U8MA 4OT1H 3BYTA 5E5MA 1QBML 4XP1H 1ZLVK 3VFSB 2NTFA 1PKQB 4APQD 3V0VA 3NIFF 3BP4A 4BZ2L 4PJXB 3ZT5A 4M7ZB 1WSST 3PDDA 1XZ0A 1MUJB 4NUJB 2NY6D 3TT3L 5HGHA 2VLKD 5FOJA 5ADPH 3IF1A 4IDLA 5DK0A 5TDPB 2BOCA 3BP7B 3MRLA 4K2UL 4S2SB 3RZCB 3ESVF 5D7SH 2O61B 2H9GA 3EYQC 4GAJH 4NJ9H 4XNQA 5FM4A 3BKYH 1A3LH 1AI1L 4LRNH 4PJIB 4I0CC 3UX9B 1H3WM 2EEDA 4BZYA 4ZMAT 1T3FA 5EOQH 2R39A 4TOYH 5HYJB 3M17B 3LEVH 4EOWH 5IMKA 2WINA 1FNGA 4GRWF 3LKQB 3OTTA 5JO5B 4Y19A 1XR9B 3MV8B 3BXNB 4ZD3L 2RQ8A 1MAML 2E8YA 4NO2B 3L5WA 5F1OB 3G5XB 4XCNA 4LASL 4D94A 4P5KB 2HKFL 3CZFB 4NP4L 1HXYB 4X4MA 5SX4H 3BH8B 3WXWH 3MFGB 1DQQB 4U2ZA 3ZDZF 4GRLC 1RZ7H 2ARJQ 3WJJC 5GGVL 5KTEL 3QCVL 3NCYS 1I7ZA 1HOCA 4YZFE 2JCCB 2ZKHL 4QNPE 4HS6B 1UZ8B 5GXBB 1OPGH 1E4KA 4PJEE 5J3HC 4QHNB 3RUGF 1V3MA 1RIVH 2CK0H 5GRUL 2FIKA 1JZ2A 3WUZA 4N0CD 3O45A 3VRLF 4TNVK 4Y19D 1RJCA 4YHOH 5K9OA 1B4JL 3UBXI 2UY7A 4MNQE 3CFEA 1NGXA 4LIQL 3MJ9A 3QUKB 3HI6L 3SDAA 3LKSB 4UOW0 1WLHA 2EYSA 5DEZA 3UJJL 3FFCE 4UV7L 3C6SA 4R4FH 1X4YA 2JJTC 2V2TB 2ZPKH 1I3UA 2DJSA 5DEGA 3GDBA 2AK1H 1CLCA 3EYUL 4O02H 1R3KB 4CN6A 1I7UA 1R3HB 4NQSB 3IFPA 5L8KB 3TBWA 1G9NH 3DUSB 1XGTB 4JFPA 1BJ1J 5IOPA 2X05A 2ZP0T 1JWMA 4B7LA 5E8PB 5KZCB 3AB0C 3H8NA 4MJ4A 3GI8H 1S7UA 3T1WA 1YYMH 3HZMA 3SKMA 2DLGA 3P4OB 5C2BL 3HPJB 5J11C 4Y5VC 4BSVB 4WNQA 3D39E 1WFOA 4HFWA 3S96B 2DRUA 1OP5K 5GJTH 1Z5LA 2MNUA 4UDUA 5F96L 2IALB 3MRCB 2DI9A 3L3JA 5K9QG 3MRRB 3FRUA 4X7FC 3NPSC 4ZYKB 2VL5A 3PQYA 5IUSA 3SE8H 1AHWB 1T1WA 4YHYC 1QP1A 2WAHA 1KIQA 2ATKA 4MQXD 2K3TA 3SKOB 4R6UA 1EUTA 1X4XA 3O3DB 5KVFH 2VH5H 4K71C 3TWCL 2FGWL 5BS0B 3DMMD 2W65A 4JHAH 4KQ4H 5FYJE 4E0RA 4HW6A 5EO9B 1XGRB 4JM4H 3DSFL 5DO2D 1OP3H 1FFOB 3TZVC 3OB0K 1MRCH 3RWDA 5JW4R 1HHHA 3PQYD 3F8UB 5KANI 1NAKL 5LWYH 1QRNA 3DIFA 3JWDH 3RGVC 1S7VB 3ULVE 1JIBA 5C08A 3K2UH 5CILH 5I18L 1E28A 1T89C 5BV7H 1RJYB 4M1DL 4Z7WA 1VKXB 3RVVC 3BZFB 2RB8A 2EE6A 3BUTA 1CLOH 1WCQA 4G9FA 4ZQKB 5EOTB 2GJ6E 4IJ3C 2IEPA 2YPLA 1MCBA 3KGRA 2DYPB 1LDPH 4XC3L 5DQJB 4HKXA 4YIQA 1HH9A 2A83B 2GSGA 4HUWB 5HPMA 3HUJF 4P2OA 1P4LB 4DKFL 2GAZB 1HKLH 2YD9A 1ZT4A 1KN2L 3MLUH 4G6ML 3MRNB 4HWBH 4APQB 1YY8A 3G5ZA 1MHHB 1UVQB 1B0GB 1NBYB 5TDNA 3D9AH 1MFCH 2FSEA 2NY6B 1HHJA 2NY5H 1QLEH 5KSAC 1FFQA 1WIOA 1CD9B 3GMLB 2GY5A 1I9JH 3OPZL 1KB5H 2VAAA 4R97C 3Q5TA 2FJFA 2YZ8A 1E4WL 5CEZD 3AS0A 1AGCA 1Q9WA 3VWJC 2YPLD 4YHNA 4HT1H 4Z77A 1F2QA 5I19L 2FL5B 4JAMB 4JFYB 3ILQC 3MACL 1H9VA 1BECA 1NAMH 1U8MB 4HG4K 5E5MB 1AKJA 2WLZA 2NTFB 3V0VB 3BP4B 5JDJA 3W5MA 2W07A 5BV7C 1W0VA 1XZ0B 4H1LG 2LU4A 2W9DH 1C5CL 5HGHB 2Y07L 1J05A 3IF1B 5DK0B 3ZDXF 2BOCB 2EKJA 4C54A 3MRLB 2JJSA 1A6WH 4PJCF 1LP9A 2H9GB 3MCG1 4HPYL 4KDVA 1RK1A 4XNQB 3T04D 3NTCL 4BSWA 2AK4E 3QQNA 1A7BA 5L8JB 1K8DA 4JGJA 1UJ3A 1T3FB 1NCBH 1PSKH 1T83A 1U2CA 1I1CA 2NY5C 1I9IH 2E6PA 3QG6A 5LBSL 5TE6H 1MFEL 2JJWA 4M9OA 4DKAA 2WINB 2AEIT 1FNGB 3KXFA 1KB9J 1J1PL 1X3DA 4Y19B 4S1RL 3FQNA 1O5DT 3GSRA 4LSQL 4HEME 4LSSL 4RGND 4YQXH 4XNMA 3L5WB 2R4SL 3PGDA 1W72H 3PP3H 4HS8H 4EI6A 4M6NL 4XCNB 2HLFD 4HZLA 5LGHL 4HJGA 2VWEE 4JY5H 5ICYA 3O4LE 3W11D 3NACL 5SX5K 1NGQL 4Z9KB 1TNMA 4UINL 3VFVA 2W0PA 4HQQH 1I7ZB 1HOCB 5EDXA 1GOHA 3OKOA 4P0DA 1IC4L 1NGPL 2EH8H 3KNBA 2FIKB 3O45B 3C8KA 5F7WC 1AGEA 5K9OB 1FYTE 4JFZL 1ZEAL 5FHAH 3D3VD 3G6DH 3QEUA 4NFDA 4NN6C 3IAQA 4QTIL 4QWWD 3BAEH 3CFEB 2VDOL 1NGXB 2OM5A 1NL0H 2NXYC 1AQKL 4QRPA 3DETC 5FHBH 3SDAB 1ACYL 3L5JA 4PJHA 4J12A 4KUZL 2EYSB 2DQEL 5E0QA 4F9PA 2R1YA 4FXGA 3MBEC 1ZTXH 3QG7H 1J9CT 4XB8A 2X5PA 3MLXH 4G8FA 5SV3A 5DEGB 2V9TA 1PEWA 1I7UB 4NM8H 4FNLL 3IFPB 1GXEA 1FO0A 3QAZB 1XF1A 3TBWB 4W4OC 4OUOA 4YK4C 1VFMA 5DJ8A 1T2QH 4MDIA 4NRZA 4NHCL 4JFPB 5IOPB 3QXAA 2ZSVA 1QQDA 4NC0B 1MCOH 4RMVA 4AZ8A 1JWMB 5KSVA 1IGFH 4CVUA 2Y36H 4P9HH 5C07E 5GS3A 1S7UB 3HZMB 4HFUH 3CJJA 3SKMB 2COQA 3HE7A 5ESQA 4WNQB 4HFWB 2VXUL 1I1AD 4P3DA 2O5ZL 4YXKH 1U8PA 1Z5LB 1V3JA 4UDUB 3UO1H 3L3JB 4EKXA 3ET9F 3FRUB 3JUYA 5IQ7L 2VL5B 3PQYB 5JOFA 2B8OT 1T1WB 2CLZA 1KIQB 5MHSE 2OI9C 3B9AA 2ATKB 4P23C 3CH8A 4YC2C 4Q6IB 1A6TA 4MLSA 4OCYL 5JIHA 2VR4A 4EI5C 4B7IA 3HE7D 1CGXA 5C0FA 1JPTH 2DQUH 2W65B 4E0RB 4CU6A 1T7XA 1L7TH 1HQ4A 5IJVA 1TZGL 3DWTA 3RWDB 3I3DA 1HHHB 1JGVL 3HUJA 1YEJH 2BX5A 1QRNB 3DIFB 5KOMC 5IV2A 2Z35A 3H9SE 5C08B 4CU7A 3ULUE 1N4XH 2Z92B 4G7VL 4LKXA 4UAOB 3RU8H 3OZ9H 1E28B 2OR9L 3WFBH 4Z7WB 1FSKB 1FFRA 3FO2A 3QUZC 2NY4B 1VEPA 4G9FB 1CQYA 3VWKD 4J4PA 3VG0L 3FHAA 2YPLB 1NEUA 4HKXB 2QADC 1HH9B 2GSGB 5HPMB 4P2OB 1H8OA 4Y16C 1ZT4B 1SVZA 2FIRT 1YY8B 4PY7A 3G5ZB 3ZE0E 5TDNB 4WCYL 1BPVA 1MI5A 2FSEB 2P48B 4JB9L 1HHJB 3OF6D 3R0NA 1FZMA 5K59F 5IBTL 3W2DH 1U8QA 4F58H 1JHKH 4A6YH 2VAAB 3WN5A 1KYOJ 2FJFB 4D9QD 1AGCB 4WI7A 1EJ6A 4YHNB 4PJCA 4Z77B 4HK0A 4NRXA 1D9KD 1FIGL 4ZG1A 2CKBL 1BLNA 2QSVA 2IQ9H 1YY9D 1AKJB 3P73A 4JG0H 2Q8BH 4Q0XH 3HNSH 3S35H 3LQMA 1W0VB 1CS6A 5BMFL 3LB6D 5FK9A 4GRWB 3LAFA 4AYFA 1J05B 1X5GA 3R1GL 1FCCA 3TJEH 1A21A 2F74A 1TMCB 4OZIF 4PGEA 5I1IL 1LP9B 4G6JL 4NFCA 3MRIA 2KL6A 3HKFA 1RK1B 2BCKA 2VLJE 5D7LE 4P46A 1WZKA 2WNGA 4BSWB 3IYLW 5T3XH 1K8DB 5BZWA 3MRBA 4QT5A 1VPOL 3DI2B 1UJ3B 4Z7VA 3GJFA 3BPOC 3QG6B 1DBJL 3KXFB 5J12C 3C2AL 4K8RL 1FNSL 3FQNB 4XGZA 3L6FA 3VG9B 4AEHH 3F7YA 2CH8A 2M8XA 4FQXC 3CZJA 4M7KL 2DQJL 4EI6B 3ZE2E 3PGDB 4ZOCA 3V4VH 4HZLB 2GK2A 2JK5A 4HJGB 5HI5C 5ICYB 1N3NA 3Q6GH 5E8EA 2UVFA 2ZUQC 3VFVB 5ICXA 4ODWA 4JKKA 3MUZ1 3OKOB 4XB7A 4G5ZL 3KNBB 1UZ6E 5A3IC 4RWYH 5GS1C 3C8KB 1AGEB 4KRPB 3WFCH 5GRYA 1IGMH 5C09D 3WYRA 4NOFA 3QEUB 1T20A 3KPSE 4F9LA 1W8NA 1JNJA 5DVMA 3VXQA 4JY4A 3I6KA 4QRPB 5C9KA 4P3WA 5CEXA 4PJHB 3IFNL 4LKCA 4UT6H 5DUPH 1MREL 1WWWX 4D3CH 2R1YB 4FXGB 1IZKA 4HBCH 3WS6A 2H2SD 2E9IA 1UENA 3VFPA 1F6LL 4G42A 4Q74A 5KVEL 2VZSA 1MNUL 1QSED 5HHOE 4UB0L 2VDKL 1F90L 3UEZA 1FO0B 3ZL4L 1FORH 1L7IL 1DBAH 5B38A 5DJ8B 4MDIB 4NRZB 1RZJL 4MVBC 1NCUA 1U95A 4WW1A 1Y6KR 3WSQH 3EW3B 3QXAB 1C5BH 1QQDB 2ZSVB 4YZFF 5KSVB 1IEAA 4QNPF 3O41A 1GVIA 2DDQL 3MUJA 4JHBA 4PJEF 1AR1C 5B8CA 4OF5A 1HI6A 3DHMA 1RFDH 4UTBH 4IBLT 3HE7B 5GSVA 2P44B 5ESQB 4RDQG 2J2ZA 4YXLL 3D25A 4XXCA 4I4WA 4D8PA 2HRPL 4P3DB 1U8PB 5DZLA 3IETA 3RIAK 2PN5A 1BEYH 3C09B 3O4OB 4DUVA 3QEHA 4WI9A 4XNXL 5JOFB 3JWOH 4BQCA 3TA3C 2CLZB 2H6PA 4UV4H 1OP9A 3ZKXC 4F33A 1CU4L 1JNHA 5F7EL 3TN0C 1A6TB 1G7IA 5KVGL 1KBGH 3F7RA 2HYMA 3O9WD 1JGEA 2PYED 2NZIA 2CDEA 2N4IA 5TF0A 2XKSA 4U1IA 2YD3A 4UILH 3STLA 4R96A 3MR9A 3KVQA 4WUKL 4QRUA 4R2GB 2DQCH 1DJSA 2XTLA 4FABL 1HQ4B 2ARWA 1Z2KA 5IJVB 1ZSDA 4YE4H 1JPSL 3HUJB 4O58L 5IB4A 4P4KC 4XMLH 3TH3T 3VGFA 4L4VD 5IV2B 4LGSB 2E6QA 2Z35B 4X6FA 5BO1L 1NFDF 2KQNA 2R56L 4LKXB 3LEYH 1K5NA 1I1FA 2PCPA 4N0UE 2FWOA 3FO2B 1D6VL 4KZEL 3QP3A 4WFFE 4HEPG 5DQDH 1P5UA 3MA9L 1VCAA 3JUZA 4MX7A 1Q0XL 5DJZA 5IVXE 3PGFL 3JWOC 4BSJA 4LP4A 3AY4C 1ZK9A 3NCFB 1FV1A 3PE9A 1TVBA 1RMFH 3WFHA 4JG1L 2BNQE 2EDJA 1T5WA 4PY7B 3IDXH 1IQWH 1CDJA 4JRXA 4R9HA 5AYUL 5DF0A 3RY6A 1MI5B 4NQCD 4MWFA 5C70A 1TQCC 3LIZL 4TNWF 1FZMB 5I1HL 2NNAA 2YK1H 1U8QB 3HMWL 3IKCA 4F7EA 3GSNA 4GKSA 3O6KL 2I60H 3WN5B 1FL5A 4OCMC 3GBNH 4DAGH 1MVFA 2A77L 3MO1A 4OZIA 4LMQI 2B1HH 4PJCB 3MBXL 5ANME 2K7QA 3ULVF 3C2SA 4HK0B 4KK5C 4P9MH 4NRXB 5F3HA 5BVPH 1BLNB 1YEHH 2GT9A 2PR4L 3Q5OA 4I3RL 3EAKA 3PP4H 3KLDA 4Z7UE 1AR2A 1V7ML 3P73B 4JHWH 4NNXA 4OCSL 2FEDC 15C8L 4M61A 4KH2A 3I50L 4JHZA 4NFBA 4TPRL 2QHLA 5FK9B 1NCWH 1BBDL 3P4LA 1FGVH 3DJ9A 2LABA 3INUL 3QWOA 1YNKH 4P4RA 4OZ4B 2AQ3A 2NR6D 1RURL 2F74B 3ARBC 4PGEB 1UYWH 1VSCA 4AEFA 2BY0A 3MRIB 2BCKB 2EYRA 3SOBL 4P46B 4TVPL 1CBVL 3EKCA 3GSOA 3KPRE 4KKAC 5BZWB 3MRBB 3AAZA 1A6PA 1KJMA 4QT5B 4Z7VB 3GJFB 4QHLA 2PTTA 3KJ4B 4ODHH 3LMJH 4KMTL 4OSUH 5KVDL 4XGZB 3L6FB 3F7YB 2HKHH 1NLDL 4KHTH 1G7PA 1QOKA 2AI0H 2JK5B 3QFJE 3UTQA 1N3NB 4CKVX 3BN9C 5F9OL 5SX4I 5E8EB 1ZA6A 4YDIL 5IHUH 5A2JH 2J6EH 3IDIA 4KI5C 5ICXB 1IKNA 2R15A 1VENA 2EICA 3QIWC 4ODWB 4E41E 3LKNA 3HZYA 5GS2D 1G0XA 3ESUF 2FD6H 4ONFL 5DRNA 2NPLX 1CFBA 3P4MA 5BRZD 3P2TA 1K4DA 1GOFA 3RBSA 2BY1A 4JREC 1BWMA 3QUML 1T20B 5T3ZE 5FKPA 1ZA3A 2Y7QA 3MNZA 1F5WA 4UT9H 3VXQB 4X4YA 4LSTL 1GGYA 4JY4B 3I6KB 4PS4H 4XHJC 1A3RH 2MPAL 2X89A 3EJZC 5CEXB 2VO5A 4LKCB 3S7GA 4PJEA 2OMBA 4XBEL 4EN3C 4XCFH 1K2DA 1SJHA 4XVUC 3VFPB 1OGAE 5KW9H 2AVGA 4G42B 1SMAA 2DS4A 3LS5L 1FN4A 2BNRD 5FAAA 4MNQA 2EZ0C 4M7ZC 5EOCJ 2RAMA 2UY6A 1G84A 5E8DH 2OL3L 4RCAA 5B38B 3AM8A 4NKIL 1U95B 4WW1B 3SDDC 1K3IA 1IM3A 1QKZL 1IEAB 3O41B 3GZKA 1X5IA 1P1ZA 2X89D 4RMWA 5B8CB 1HI6B 3BKMH 1KELH 3IDGA 5JHLL 4NZTL 4XVSH 4HD9A 5GSVB 3N9GH 4JO2L 4LMQE 4N8PA 1F11A 4MA7H 2W9EL 3D25B 2RCSL 3VW3L 2FX9L 1DLFL 1SJXA 4D8PB 1DBKL 3IETB 3F65A 1MEXL 2AJVL 4MNQD 3QR2A 4WW2C 2DQTH 3B2UD 3DX6A 2APXA 4LSPL 4UT7L 3QEHB 1NMAH 1PW3A 2YN3A 2H6PB 3FFCD 5GRVK 4NQVA 3WNLA 4F33B 1JNHB 3RDTC 3D39A 1G7IB 1LMKA 3BEWA 5F88A 4BFEA 2BVEA 1JGEB 5DHVA 2CDEB 4OKDA 1MPAH 4HMCA 3I9GL 4JFEE 4U1IB 3STLB 2E27H 4R96B 2CRYA 3MR9B 4F37K 1Z9MA 4GW1A 4PJ7E 4U6HA 3RL2A 2OYPA 4HJ0D 4MGXA 3C6LC 3NZ8A 4QRUB 1BMGA 4JCLA 3WIIH 4P5TD 5CCKL 1G7QA 1S5HA 1ZSDB 2VXVL 1SY6A 5IB4B 5IFAH 4TSAH 1CT8A 5IBLC 4IOIA 1G0YR 1F3DJ 1IGCH 4X6FB 4Y4HA 2IAND 1M1SA 4X83A 1IM9A 3D39D 4OV5A 4Z0BH 3MJGX 1K5NB 3I02A 4N1CA 4OTXH 3BWUC 1I1FB 2PCPB 3UJIH 2FWOB 1JPFA 5LAXA 1FBIH 2UZIL 4KJWC 5IMMA 4FQQA 2OZ4L 1IC1A 2OCFD 3BP6A 4MXVE 4MX7B 4HDIA 4XWOC 5DJZB 3BHBA 3KWWA 5C6PB 3T0DA 4N9OB 3WEXA 1FV1B 4KXZH 1TVBB 3WFHB 3WFZA 1B3JA 1CZ8H 1TZIA 5FV1L 2DLTA 1T5WB 5IMOA 1A7NH 3UYRL 4JPVH 4JRXB 4LL9A 4NUGL 4NQDE 2D03L 1H3PH 3CVIH 4MWFB 4BM7A 3BQUD 1DUYA 2GJ6A 2NNAB 2D7TL 1PBYA 3IKCB 4F7EB 5FYJD 3GSNB 1HZHH 4GKSB 3WO4C 3FONA 1FL5B 2DM7A 1G6VK 3MO1B 5EU6D 4OZIB 4OCNC 3S5LA 1O0VA 1K6QL 3CFCL 3RKPA 1A7QL 3ULUF 5F3HB 3UBXA 4TULH 3U4BH 1F8TH 2GT9B 3ULVD 3RVWD 4NNXB 1QR1A 4G6FD 4M61B 3MODL 3KR3L 1FVEA 3EIFA 4Z6AT 4Y0GA 2MQCA 2EC9T 4GQ9H 2AQ2A 2FX8H 5FV2A 2B4CL 3QWOB 4P4RB 1X5AA 4OLUH 1TZHA 3IAPA 4KVCL 1QNZL 2A73A 2CRIA 2KZWA 1NMBL 2EEAA 2F8XC 2VDNL 1N5YH 3TCLA 3ZE0F 3TYFA 1X5XA 2EYRB 3O3UN 3WLWD 4NJAH 3GSOB 1RZGA 3MJ8A 4HCRL 3AAZB 5C0CD 1KJMB 3T2QA 1RZ8A 5L2KE 2HTLD 3QRGL 3CSBA 4QHLB 4MSWA 3RHWK 3VFGH 1XR8A 3OV6A 1KT2A 2PTTB 1JMZA 4YXHH 4NQEE 4JJ5A 2MQ0A 4PYHA 5FCUL 4MS8C 3UYPA 4X4ZA 3H9YA 1G7PB 1NBZA 2AK4A 1NUFA 4OD3L 2AJYH 2NZ9C 5B3NA 3UTQB 4XAWH 5C7XL 4OGAC 1GGCH 1ZA6B 4AM0A 1FCGA 3IDIB 1A6VL 1BAFL 3LKNB 3A6OA 3HZYB 3VXOA 3NABH 4N8VA 1KOAA 5B38G 5DRNB 5EWIH 3P4MB 5MI0B 3U2SA 1Q9LA 4PJDE 4CNIA 1JTTA 1V7NH 4PY8I 1D5IH 1K4DB 2XFXA 4N0YH 4BQ9A 1LEGA 2VB5A 1ZA3B 2Y7QB 3MNZB 3MRHA 4OGZA 4X4YB 2ADFL 1FH5L 2AK4D 4WFEE 4BFIA 3JVGA 4ZTPH 3MLSH 1NC4A 3PWPE 3P30H 3T0XA 4PJEB 2QLVB 3O0RL 3KS0H 3P11L 3ZKMC 1K2DB 1SJHB 2EH7H 4WV1A 5ILTL 3ZE2F 3OQ3B 4HZAA 1FYTA 2HT3C 1FN4B 2WWMC 5F9WB 3OAYH 4LLDB 2ITDA 4MNQB 4MQ7A 2PO6C 5JXEC 1MF2L 2P8MA 3HNTL 1DVFD 5MP6L 1OW0C 1YYLH 2ATPA 3TBSA 1BFOA 3O4LD 1IGTA 1PG7H 1IM3B 3MRDA 4DGVL 5HGDA 4NOBA 1PYWA 1JVKA 2J88L 1P1ZB 2MOVA 4PTUB 3TPUA 5HHVL 1F13A 3V6OC 1OAKL 3IDGB 1UZ6F 3MJ9H 4OFYA 3HE6A 1F11B 3SE3A 1SYVA 1FRGL 2FGZA 2BVYA 4YHLH 5J13C 4PJ5A 2DJ4A 1S5IL 4IDJL 4KDTA 1ZLUK 4F2MA 3DX6B 4NO5A 3GSVA 4XNZC 4OLVL 5C07A 1GOGA 2VR5A 2Z8SA 5D1ZA 5AUMA 1MIEL 3EO9H 4NQVB 4M6ML 2NY2B 5KN5A 4URTB 4JE4B 3D39B 5F88B 3BEWB 2XN9E 2V2XA 3VXRE 1X4ZA 4FFVC 5DHVB 4OFYD 1NCCL 1EDQA 3MJ7A 1KIPA 1JHLL 3UTSE 4GW1B 4P99A 2XYCA 3E2HB 5GIRA 1EZVX 5F1IA 1E4KC 1OTSC 4U6HB 3RL2B 5FFLA 1P9MA 2I24N 1J0KA 5DRWB 5HGBA 3NZ8B 1A02N 3RPIA 1PLGH 2V5TA 4GRMA 1NSNL 1G7QB 1S5HB 2YRLA 5C07D 1CT8B 4IOIB 1KFAL 4Y4HB 4G3YH 1C12A 4Z95H 1TDQA 3ZTNL 1IM9B 4KJPD 4OV5B 3PV6A 4FQIL 5EIIA 3I02B 1MFAH 3QHZL 1JPFB 5LAXB 3ZHLA 4OF0A 3EZ8A 1B0WA 4ZSOA 3X11A 5IMMB 2XQYG 4FQQB 5E95B 4M43H 3LH2H 5DT1H 2B2XH 3BP6B 5IIEA 1CXFA 3PWUA 4HDIB 4OLZL 1RIUL 4HG4J 3QAZC 5MHSD 3U7AA 3WEXB 5I16A 1RUPL 3EOAB 1OAYH 4P2QA 1TZIB 3FHQA 5IMOB 4U7KA 1OAXH 1T1XA 3CFDA 4MB3A 1QTYT 4Z7OE 1QR4A 1DUYB 2GJ6B 4Y4KD 3VXPA 4ONGH 4POZC 1IAMA 3FONB 4NQUA 3N85L 4HLZG 4WHCA 4BQ6A 1FE8L 4MAUH 2DLFH 1OWWA 3S5LB 3QIUC 1BQLH 4RISL 4PPTA 3UBXB 5CEZH 4MXWH 4PRID 2EDRA 3H9SD 4PJ8C 1I85C 4ORGA 4KKBD 3ULUD 1RHHB 1EK3A 1QR1B 2VZ1A 5I30H 4KTDH 1U93A 1ND0A 1FVEB 5H8DA 4YBQD 2VXQL 3QDGE 3BPLC 5DMJB 3D1MC 4NWTL 2IFFL 1CGUA 5IVXF 5HVHB 4H88L 4IOSD 1TZHB 2Z9TA 5DJ6A 7CGTA 1U58A 4J3XA 2A73B 4WI3A 1FNAA 2ZG1A 2I27N 5D96B 1CK0L 4H8WC 3TCLB 4IRSC 3VGEA 3TYFB 4B50A 1ZAGA 4YGVA 2HRLA 3IGAA 5CD3A 1RZGB 3MJ8B 1JCKA 4X7SL 2A6DB 1A9BA 1EA9C 2NTSP 3TC9A 4HX1A 1RZ8B 4LGPB 3O2WH 4MSWB 3LN9A 1XR8B 1KT2B 4XPAH 4TNVF 1U42A 9CGTA 4D2NA 4JJ5B 2RGSA 3OKYA 2LAGB 3B9KA 1TPXB 1VGKB 1NBZB 3HZKA 2VLJA 1KACB 5FUOL 5D7LA 2K1MA 5IVOA 1UADC 2AK4B 4GRWH 4NM4L 4PRBA 1VERA 4Y5YC 3RAJL 3PWNA 5FXCH 2F5AL 3VFOA 1J88A 4AM0B 4XVTH 4P2OC 4F8QA 4I77L 3VXOB 4N8VB 5CSGA 1X6NA 3TESA 2WP3O 1Q9LB 5SWSD 4CNIB 3B2VL 2OR8A 4HJJH 5A2FA 2IBZX 1C1EH 4ODTH 2XFXB 1LEGB 4ZS6C 4X8JA 4CW1A 1CF8H 4LVOC 3MRHB 1MQKH 2VLJD 5D7LD 3REVA 1D5BA 1J7VR 4XCCH 1R3LB