3FFDB

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMDLKQDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAMYICGVGDTIKEQFVYVFGGGTKVTVLGEPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hormone
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB01
1FFNB 4I77L 5E1HB 4RIRB 2YWYA 5BRZB 4Y8DC 1Q9LB 4GAJH 4JRYE 4S1QL 5IF0B 4RGOL 1YZZA 2D03L 1MUJA 1Y18B 3MBXH 1A3RL 1JPGB 2GITB 4PYGA 2UYLB 4TTGA 4UNTA 2ZG2A 1INDL 2Q20A 2E3VA 4K8RL 2DQEL 4H5SB 1D5ZA 3ZE1E 1K85A 4XXDB 4UBDD 5D7LE 4GKNA 1AQDA 4A6YH 3KPSD 4MNGB 1FGVL 4ENEC 3S36L 1V3KA 4WWKB 1NCWL 2F5BH 1CGSH 3VA2C 5L88L 2HN7B 4HS8L 4Z7OE 4FQHB 5ESVA 3AY4A 3RPIB 1K3IA 3FHQA 4NWTH 2DBLL 3BMWA 3TO4D 3DTXB 1V3MA 1G9MH 2FX9H 1KIQA 4V2BA 1I4FA 3F5WA 4HD9A 2IAND 3VWKD 1SY6H 1F3RB 3NCEB 3L5IA 2HVJB 5I1IH 4OCRH 4K55A 1OTTC 1KEGL 3IDNA 1H5BC 1DQQB 2Z92B 3JZ7A 4I48B 1I7UB 4ZD3H 4MXVF 3DBXA 5I1LA 2BNRA 4UU9A 1MRDL 4K2UH 4LGSB 1P9MC 3ARBD 2BVEA 1FP5A 2EIZB 4OCSH 4QYOA 1EGJA 3Q3GB 2VXTH 1MHHB 3MLUH 2EDXA 3GGWB 5B22A 3DV4A 3DMMD 1KLGA 2QEJA 7CGTA 1CL7H 2NY6D 4XHJC 1U92A 3LEXB 2OXHA 3L3KA 2AEPH 2ZUXA 5H2BA 5JDJA 4JZOB 5JHLL 2V2TA 5IROC 3T4YB 3HPJB 4GRLC 1VA9A 3V5DB 2WUBH 4DWHA 5EO9B 1BJ1H 3M17A 1YYLL 3RY4A 1R3LB 2EECA 1WWCA 5E6IB 4GG6B 1AGBB 5DMKA 3STLB 1CCZA 3MLTA 4P48A 4G6JL 3EFFA 1GZPB 2AJUL 4ZXBC 5D1QB 1UWEH 1CD0A 1I85A 4X7CC 5CHNB 3WS3B 4QHKI 4GXVH 3PHSA 1RZGB 1QSZA 1Q8MA 2PYEB 3FJTA 3QIUA 3UDWC 5C0NC 1HQRA 1BLNB 2ICEB 3CFKA 2RCSL 4KTEH 1FDLH 4HQQL 2V5SA 3MV9D 3U9PL 4AM0B 3U2SB 3F62A 2V7HA 4F58L 4NO3A 3MJ7A 5E2JA 4QRSB 4Q2ZB 4P0DA 3EDFA 4C59B 5T3ZD 1MHEA 1BQLL 2C3WA 3KXFD 2AXFA 4PJXF 5FM4A 1ZHLB 1MCEA 4YLQT 5DK2B 3LZFL 3MRGB 2BY3A 1RZKH 3LY6A 3CIQA 4WWID 1ZLUK 3SDXE 1J11A 1NFKA 4KI1A 2ZUQB 5IV2A 5HI4D 1WFOA 3EHBC 2VQTA 5FHAH 4I4WA 4EQ2A 1EBPA 3LRSB 5HI3C 5DS8B 1RHFA 3L95B 5FF6B 5FIEA 3TT3H 2A6KB 4JDZA 3FOMB 1WIUA 5KVEH 3UAJC 4TNWF 1T1WA 1U8MB 4EI5D 3QEQD 3TH2T 5DRWA 2X4PB 3F7YB 3K1KC 5TPWL 3U46A 1PZ5B 1PYWA 1RJZB 5IBLD 3LN4A 4GW5B 3K8KA 1QRNB 3PIQA 1OP5K 5CILH 4MD5A 3MTRA 2EYRB 2VWEE 3P4OB 2OTWA 4UOJA 5LAXA 5HHQB 2EDBA 4L9LB 5I1DA 3V6FA 1F42A 2FSEB 3W5NA 4WW2F 4Y16D 2W38A 5C0JB 3LKPB 3D85B 3ES6A 4DOHE 1YN6B 1OTUD 3TEUA 2OP4L 3D69B 3L5XL 4RX4A 4UNUA 4F80A 1JN6B 4Y5VA 3ARDD 3G9AB 4UOW0 3CLFH 4NBXB 2R8SH 1WIPA 3MR9B 3D1MC 1DBJH 3PL6A 2F8VA 2VR9A 3T2NL 4C56B 5B38A 3CSBA 4JFFD 2YA2A 4NQSB 5EO0A 3Q6FB 4R4FH 1OLLA 4S10A 4RMQA 5D72H 4CN4A 3ULSA 4WIQA 4P2RA 3IVKA 4Y4FA 4PRHD 5DHYB 3QXDB 1TMCB 3ARGC 4KKAC 3W5MA 3WFDH 1I9RL 3S4SG 1TLKA 1HILA 2EXYC 2HKHH 4JRWA 3ZE0E 1LO5B 2MQCA 1K3ZA 2VLKA 3G08B 5D2NB 2R9HD 4YHMH 5BZDA 4HG4K 1YMMA 4NSKB 1D5XB 3HI5L 5C07D 3HCVB 5B8CB 4Z7NE 4JY5L 1F58L 1RUML 5DLMH 2VDML 4UIKL 3QXAA 4X6DA 3GMMB 1XF3A 4FQ2H 4JKPH 4W6YB 3PV7A 2CRIA 1QBBA 3GJFK 1F4WL 1M71A 4KRPC 2ZUUA 3WFEH 3E0GA 1ZEAL 4GT7A 2PR4L 1MY7A 4J8RA 3P0VL 5EZIH 5HBBA 3O8XA 3WUWG 1A1MA 2H1PH 4OZFB 2VLRE 3PWUB 3MRNA 4ZFZB 3C9NA 2QADB 3O6KL 4G5ZL 4BQBA 1MFCH 2DRUA 2Y07H 4JFYB 1IAOB 2BRQA 2Y7QA 4PR5B 5L8LB 1G7MA 3VFPA 1MIEL 4R7NB 4L4VE 2DI8A 1JHKL 1RIUL 4FFWC 3T0DA 2HG5A 5SX5K 1JWUB 3ARFB 1NCUA 1BZ9A 2UUDK 1A7NL 1UADC 2XTJE 1NCBL 1T0PB 1L7TL 3DX8B 1MVFA 5F89A 2NY5H 4HMEA 4GW1A 3SOBH 3WFBH 1T3FB 1G6RA 1UJ3A 3LQZB 4N5UA 2L7JA 3BKJL 2VXQL 4PJ8B 2FX7L 4HT1H 4FP8H 3RBSA 4EN3A 3G5YB 2A77H 3QIWB 2JB5H 5KVMC 1RK1A 1T22B 4IRZH 5MENB 2NY2B 4PJ5E 4X4YB 2EC8A 1NFDB 1VACB 1LP9E 4JO4H 1QYGL 1L6XA 1G0YR 2X4UA 2YSSB 4K3JH 3GI8L 5MERA 1ZE3C 1I3GH 2KPNA 2XA8H 1JZ6A 4WDIB 3KYKL 2ZOKB 3D9AL 1WITA 2CKNA 3BMVA 1EXUA 2HFTA 1H0DB 5IFAL 1U8JA 1W0WB 2A9MH 5HDLA 3IJSB 1WEJL 4O51B 1GJIA 4HXBL 4PGEB 3UX9B 4LFHG 1QA9B 5DA4A 4RAVA 5DJCB 3M8OH 4IOFC 2A6DA 1CIUA 2WIIA 1ZLSH 4BH7A 5C0CB 3ZO0A 1Q38A 1DN2A 5DVOA 3P9WB 2NW2A 2FNBA 4S1DC 4LIQE 5BO1H 2C3VB 1RZFL 3LQAL 4LP4A 5HYEA 3RWJA 4KRMB 4XCFH 2AV7B 1YEJH 5JUEL 5IT2L 4XMLH 1CBVH 1REIA 3K74B 4NWUL 4PJXB 2R0WL 4PUBL 4JKKA 4QOKA 4BZ2L 3NIGF 1OTSD 1A2YB 1GGBH 2R69L 3BHBB 2CJUH 3FB8A 3BKCH 3SQBA 5ISZA 3QFJB 1U41A 5CKGA 3V5KA 4M7LL 4YXHH 2WLYA 4MNHA 3O45A 4KZDL 4HC1A 4R0LB 2DM2A 3RDTB 1PBYA 4HUNB 2ORBH 3QP3A 2GW5A 3GJEB 3BPOB 3C8KA 3MBXL 1NAML 4X0KA 3ZKXC 3DUUA 5FYKH 5F6IB 1MJ8L 1KN4H 3EZJB 3QG6B 1BVKA 2BFVH 3LKNB 5BOZG 5IP4A 1CD8A 1WT5A 1EH9A 3IDJB 5BXFB 5K9KA 4A6YL 5CP7B 4LEOB 4XZUA 1A4KA 4V1DA 2F5BL 5L9DH 1I85C 4KUCF 3RKPA 1AY1H 3OG4B 2IPTH 4U1NB 5I8CA 2DIJA 3QIUC 4AEIL 1IILE 3QDMD 5HYJD 4AEHH 2IALA 5D7KE 4M6MH 2ARWA 1SY6L 2VN4A 4I9WE 4M1GL 4K7FB 2FECL 3QZWA 5I1IL 4ENED 5T1KD 1EEUA 4JHWH 2OYPA 5EBLA 4M9PA 4RMVA 1D5MB 43CAA 1DP0A 4JVUA 4ZD3L 4LLWB 4R26H 4GBXA 3HFML 4K2UL 3VJ6A 3QUMH 4H0IA 4PRBB 2FO4B 1WLHA 3RVUC 4HPYL 2MNUA 4JG0L 4MMXC 2Z31A 4LPYA 4NQED 2VXTL 1FCGA 3C6LC 1A1NB 3PDOA 1RQ5A 5ACZB 3FTGA 1CL7L 3O11B 3UPCA 3L3DB 2MKLC 4ZOAA 2C4FT 5JOEA 3AB0B 3CLEH 3REVB 2A73A 5TDPA 1TPXB 2GJ6B 2X4RB 3BSZH 3T0EA 3IFOA 2FJFA 1QFPA 3E1F1 4OUUA 2WUBL 3KLAA 4JDTH 3MODH 4FFYL 1EEZA 1NCCH 2JCCF 3U9UB 3D3VE 3D39B 4E5XA 4BUGA 3VWJB 2YEZA 3BW9B 4OGYH 3SJVD 4I2XE 5I19H 4RAUA 3B8YA 1UWEL 4ODTH 1Q1JH 4Y8AA 4QCIB 2F54D 4M6NH 1T0NA 3CFBA 1A4JB 2OL3L 2Y1VA 2R15A 2JJWA 3D2UB 5HGAA 2HYMA 4NN6B 3GMPB 2RB8A 3BZEB 4ZYKA 5D96B 4Z7VE 4G8FA 4KTEL 1FDLL 4KGJA 2LFGA 2XNAA 4WNQA 1YEIL 3MRLB 1FZOA 4KXZH 3ROLA 1HN1A 1INEH 1XCQA 1D6EB 1UCTA 2ICWA 1JWMB 5HHVH 2V17H 4EUPA 5EOTA 1GPOH 1RURH 4PJAA 3ULUC 2OTPA 1MRCL 1LEIA 5C0ND 4Z7OF 1W2KT 4HMDA 4Y5VC 5I9QB 3QIBB 3CNKA 5CEZD 4NHUB 5JHDA 2BSSB 4N0FA 4JM2A 1IGJA 5JIPA 5D93B 1RZKL 1AGCA 3QBTB 1AO7B 4DJMA 4PY8J 2WUCH 3QQ9C 4NZDA 1LWRA 4NHCH 1YNKH 3EJYD 4JPWH 5FHAL 4BK5A 5HHNA 1J1PH 2Q6WA 4Y4FC 3DVIA 3X3FH 4GSDH 1D5IH 3QUMB 3RGVB 3SE8H 2P7TA 3PWJB 1JMXA 3TT3L 1XF4B 1FVDA 1D6VH 5H35A 1Z2KA 2X89A 3Q0HA 1N2RA 4Q97A 3EDKA 4OQTL 4DVRL 5T3XL 5IOPA 4U0RB 3SE3C 2AJXH 5D5MF 1NGYB 4HGWA 4D9QE 4Y1AD 2O93L 4U1MA 3K2MC 4U1GC 4JHBA 5CEYA 3B5HA 1GSMA 1ZVYA 3UTQB 4JGJA 5HDBE 1NDMB 1I8IB 2MJWA 3DYOA 5DJAA 1KCSH 4HJJH 3BQUC 4LCCC 4KROC 1PJ9A 1NGQH 3QI9B 1LO2H 3L3OA 4YIQB 4D9RD 1JUFB 2Z4QB 3GRWH 5FA4B 1S7UA 4QHUA 4JPKH 2VZOA 4JY6B 4Q7DA 5J1SC 1F3JB 5FYJU 2MSPA 3B9DA 3TH3T 2YK1H 4PLJD 4P9HH 1K4CB 1RZ7H 1U8HA 3MREA 1ONQA 2R8SL 1DBJL 2VLME 4FFZH 5D9SB 4EXPX 1UJ3C 3HKFA 4YE4L 1V3LA 2PYFA 5DEGB 1TTUA 1VFUA 3TZVB 2FRGP 3UC0L 2LQRA 5CSZA 3BP5A 4EQ3A 4GUPA 2D4DA 4R4FL 4OFYD 1CFSB 5D72L 4MNQD 2P5EE 5BVJA 5EUKB 4QRPE 3P4NA 4I18A 3AS1A 3G04B 2B1HH 2BVOB 5HHXH 4S11A 4JPVL 3GSRB 2PCPA 3NFNB 3F7PC 4KTYA 5F6HJ 4GKSB 3C60A 3GO1H 2NY7H 4RWHA 2NX5B 1CFVL 3WNMA 5IVXA 2PTTA 4F7CB 4OZGE 5DVKA 2BOBB 5F72S 5MP6H 3SDXF 1UXWA 1U93A 3OKOB 4X98B 1IM3A 1RJLB 1KCUH 1PX4A 4OLWH 4Z7WE 5DLML 3AM8A 4YHPB 3QNXB 1VFOA 3CDFA 4FQ2L 2O61B 4GAYB 3F7RA 3SY0A 3W11C 4CVZA 1GGYA 4F9LA 4CDHA 3L3JB 2V7NA 3QO0B 2FH6A 3QEHB 4FQXA 4TSBL 1NC2B 1UH2A 3IKCA 3MA7A 1OP3H 4Z7UB 3QJFA 1W0YT 3UZQA 5JW5A 4RFOL 4OAWA 1BFVH 3FCTB 5ELIA 2HKFH 2ATPA 5DJ0B 3B3IA 1HSAA 1DL7L 3FHAA 4HWBH 3WS6A 4LKCA 1QPPA 2Y5TB 3NCJH 1MFCL 3BIBX 1Q0YH 3PP4H 4IS6A 4ELME 3OR7A 4R8WH 3EGSB 4KRPD 3BYYA 2EIBA 1SJVA 2R2EB 1I1FB 3Q1SL 1TJHL 2NY5L 2XRAH 4JR9H 1Z0MA 2FX8H 3WFBL 3SOBL 3GKZA 4X9FA 1S7WB 4TTDC 4N8VG 4NJ9H 4HT1L 5DUBB 12E8H 1L6ZA 2MTPA 3MNVA 2A77L 2L0DA 2JB5L 4D8PA 5HYIA 5JLZB 3HNSH 4UB0H 3CU7A 3VG9B 1ND0B 1F4YH 3WDIA 4JO4L 1UQSB 3EUUA 4K3JL 3BXNA 4ONOA 2XPGB 5CEZE 5I1JH 5DJ6A 2EKJA 2FATL 5A40E 1ZHNB 1M7DB 2PXYA 2YBRA 2A9ML 4F7TB 4H88L 5E9DA 3OSKA 5C08A 3BP7A 3R1GH 1EFXB 2WK2A 4IBLT 2YD3A 4WW1B 5FGCB 5JNYB 4U3CA 4MS8D 2EDQA 4HKBB 4O4YH 2ARJQ 3ZE0F 4KHTL 5FOBB 1MVUA 5IMMB 4JANA 3VFUA 4PTUA 1ZLSL 1RU9H 4YQXH 4L3AA 5E8PA 4PJFF 5EFIB 3RIAF 2VXVH 5IHUL 2JELL 5DEFA 5FCSH 1OM3H 4J3SA 4Z7NF 5D7IA 3P9MA 1PLGH 1YEJL 1MJ7H 4Y1AE 1X5IA 3UBXA 1KYOK 1NGZA 3O3AB 3U4BH 1YC8A 1DBMH 3DOSA 4QXTA 1RUPH 1QVOA 2DLFH 4JHZA 4DZ8B 3RWEB 3RWFB 1C5DB 5DQDL 2CJUL 3DSFL 4JGUA 5F7EH 5F88B 5ICYA 1JZ3A 3V5HA 4XNMB 2PF6A 4YXHL 4XWGH 3O3DB 1JPFB 3DXAA 4IDJH 4JRXB 2I26N 1ZTXH 2Q8BL 4L3EE 2D31B 4ALAH 2ERJB 2BNRD 2EH8H 2ORBL 3OB0K 3VRIB 5B39A 1YECH 3L1OH 4MAUH 2JE8A 3VFSB 5JMOC 3V9FA 3SGDI 1OSPH 3SO5A 4WV1B 4FMFA 1I7RA 1MELA 4Z0BH 5D5MB 4A2MA 1KN4L 4N9GA 2ZPKH 2XQYK 2ADJA 4V2CB 1XGUB 2AEQH 5DSCB 3GB7B 3RJQB 2R2HB 4PJDB 4TQEH 3ZKNC 3U0PB 5EZJB 1U8QB 5T33H 4KPHH 4QHLB 2BCKA 4WFGD 5JQ6H 1WISA 3SCMA 3P3YA 1AY1L 3VXUE 5IB3B 5EU3B 3R4DA 4MX7A 2IPTL 4RDQG 1P7QA 4N1HB 2O5YH 4RGNC 3KHQA 4LK4A 5DJYB 2UVFA 4M6ML 1IAIM 1BEYL 1ADQH 4HPOH 1KIPA 3MUJA 4TPRL 5JOFA 1SJEB 4HIHA 3MLZH 4X7TA 3BESR 3GNML 3ZT7A 2DWDB 2V5TA 4Z0XB 4PLNC 3QIUD 5EC1B 4R26L 4XC3H 3INUL 4GXUN 4U1JB 4F3FA 3QO1B 1MCQA 3MRRB 1T1YA 4LSTH 4Z8FH 3C08H 3MNZB 3O6FB 3L9RB 1T1XB 5E7BA 4YO0B 4IRJA 4MSWB 1KJMA 2ADIA 3EOAA 5KAQG 4JFDA 4BFGA 3CLEL 4YHIB 1EX0A 1ZK9A 1BBJA 2BNQA 3RVUD 3FO9B 1YUHA 3Q5YA 5IMOA 3S37X 1MCCA 4POZC 3MODL 3MRIB 2VZUA 2J8HA 3FFCA 1S7XA 2CDEB 3CFCH 1CFNB 2NY1B 1OD9A 1PKQA 3R8BB 3JTTB 1XGTB 3IDMA 1ZSDA 3MCG1 4LHJB 4CNIA 5JW4Q 1ZANH 4ESKA 1J8HA 4G9DA 4ODTL 1Q1JL 5DRZB 4M6NL 2AJSL 1MFNA 4HHAA 4YHZL 5LGJA 1LNUA 1P7KB 4ONFL 1XR8A 1T20A 4HLJA 5ID1B 4LLVB 3WIFA 4NM4H 3I6KB 4Q0XH 1LEKB 1IT9H 3PDGA 2V17L 5EO1B 1GPOL 1DSFH 4YR6B 1RURL 1JP5A 3LKSA 3VD3A 5DMGC 4S1RL 5DYOA 2GFBB 3NMEA 4JFHD 3BN9C 4UNVA 3RWCA 4G8EB 5EG6C 1KELH 1YEDA 5C0BE 2DJSA 1J88A 3GDBA 2VOTA 2YUXA 5IHZA 4O00A 3RI5K 2NTFB 5GIRB 2HFFB 1IVLA 5F1IA 2WUCL 3KPSB 2H8PB 4LSUH 1P6FA 1FN4A 4HF5L 3EIFA 1YNKL 5CJ5A 3ULUD 4RX4D 1BF8A 3S35X 4RIRA 4PGCB 1ACZA 2EKSA 3CD4A 1D5IL 3TO4B 5T3ZH 5IF0A 1D6VL 3ZDXE 3PL6D 3C60C 2IANB 2V2XA 2BSED 1JRHH 3VWKB 4I3SH 3QQ9D 1P4LA 3KPNB 1UZ6E 3CX5K 1FL3B 3TO2B 4P2RD 4Y4FD 2AJXL 3C5ZA 3HZKB 5J11C 5ANMB 4F2MB 3RX7A 4TNVF 2F58H 4NUJB 3ZDZE 2YD6A 4OM1H 4F9LC 2VLKD 4PJFB 3ARBB 3MLWL 4QHMA 5DD5H 3QA3B 3OJ2C 1YMMD 2DQDH 1U91A 1KCSL 1ZOXA 3NCBB 4HJJL 3DMMB 4ONHB 5BW7C 4ELKA 2NY6B 1NGQL 2AK4E 1DCLA 1U8IB 2AJ3B 4D0BA 4JFQB 2ZP0T 3KLDA 4PGDB 3WS6C 5C7XH 4HEME 2OR9L 2ZJSL 5FGSA 1DQJA 3EOBA 4PJ7B 4JPKL 4XPGH 1WF5A 5CGYC 1OQXA 5CGMA 2D4FA 3I75A 4HZLA 3QSKB 4WFGE 4P9HL 1OWRM 3IDUA 4PJGA 1AD9B 1FC1A 3N1MC 1R5IB 4Y5YA 3O8XD 1BD2E 1E4XI 3L3IB 2RIKA 4FFZL 4LLMB 4R97B 3QUXD 1FO0H 4Z7VF 4Z76B 1HZHH 1OVZA 4Z5RB 4K9EH 2W60A 1RHHB 4YDLC 1FFRA 5EU6E 3VFGH 1NUNB 5IHBA 5IESH 3X14A 2B1HL 1FC2D 1N59A 2J7LA 2RJMA 1G0XA 4KKNA 4JZOA 1KCKA 5E4IA 3OL2A 3L3GB 5HHOA 4M6OH 4HFWA 1F4XL 3TBTA 3UJIH 2IAMB 3GO1L 2NY7L 5F9OH 4U1IB 3E8UH 3ESUF 1EO5A 1FG2B 2QBWA 4XNYH 3P9LB 4L8SA 32C2B 3FQNB 4NO2A 3MV9B 3RIFK 4WVRA 2AW2A 5MP6L 1R3LA 4EN3D 5J1TC 4BQCA 1II4E 1MH5A 1MLCB 1MNUL 4LPXA 5JDSA 1B4RA 5EIIB 4XMKL 3HAEG 2FEDD 1TFHA 2A6JA 2QQLH 2B1AH 5KVGH 4G6AD 4RFEB 3WS3A 3O0RL 1B3JA 4JZNB 3ULVH 5TE6L 4U6XB 1PQZB 5EOQH 3KXFB 1K5NB 3U6RB 1FFQA 2PYEA 3DX9A 3NAAH 1NAMA 1A3LH 4NNYB 5EBWA 2AAVA 1BLNA 3IXAB 4HWBL 4XP9H 5I75C 4LAQH 3PP4L 1Q0YL 2NY0C 2FWOA 5AWNH 1SYVB 4A6YA 4LPWA 2GJJA 4OZHF 3HI6H 4R8WL 3MRMA 1RV6X 3PGDB 1WZKA 2XRAL 2YD8A 4Q2ZA 4PV8A 5LCVH 2CKBH 4JR9L 3NN8A 4EI5B 3QWQB 3QEQB 4Y2OA 1ORSB 3MUZ1 3S97C 3A6CH 4U1LA 1QZ1A 4NJ9L 4WO4D 4DFHA 5DK2A 3MRGA 1BOGB 1SY6A 2J6EL 1NJ9B 3DURB 3FAWA 2HP4A 1CDCA 4PG2A 3VCLB 3HNSL 5E1AB 4QOKD 1F4YL 5EBMB 4F7MB 4I5BB 3QEUB 4P2YA 2H9GA 4H0GA 2E6JA 2IFGA 5F44A 5HDOA 4M6AA 5E08L 5DMYA 4PJIA 4TTDD 3N06B 1JK8B 4IJ3B 2Q86B 5I1JL 2E6QA 4NRYB 2DS4A 4BSWB 2V2WA 4Y16B 2QTEA 1JFQH 2X7LB 1KBGL 5BQ7A 3HAEH 5ICZA 5JXEC 4P4RB 4LCWA 3DX7A 3REWA 3R1GL 2P42B 3ARDB 1RJZA 5KOMC 3VH8B 2FHCA 1KTDA 4PB0L 1WTLA 3BPLC 5FB8B 3UZVB 5KSBE 1A0QL 1BF2A 1RU9L 1T6VN 4JFFB 3P4OA 1Z9LA 3P11H 5HHQA 4P2OA 5GSRA 5D71H 3NZ8A 4PRHB 4TVPE 2EC9U 1RIVH 1JGLH 4V1DD 3O2VH 1PLGL 1MJ7L 4JFXB 3GSXB 3VXSA 2QR0A 3GM0A 1DBML 2GTZB 3VGEA 3NCYS 2OL3A 2DLFL 2G2RB 3O2DH 2DDQH 5C07B 3U83A 3GSQB 2C1PB 3VFMA 2D7MA 1JPTH 3KPLA 4UT6L 5F7EL 3TF7C 2IC2A 2OSLA 5F3HB 4UT7L 5I30H 1NAKH 2DLHA 2WSKA 3QDGA 4XWGL 4C56A 4IDJL 3VMOA 3LPFA 4XBGA 3CVHH 1HWGB 4NQSA 4MXQC 4ELMF 5JZ7C 2H3NA 3PQYE 2JKXA 1WVZA 3NOIA 4GBXD 3B4NA 2GUOA 3L1OL 4MAUL 5FKPA 4FABH 4PRIA 4X80H 2CKBB 1HHGA 1OSPL 2Z31D 1KT2A 2MMXA 3HZYA 3G08A 3QYCA 4P57B 1FNEA 5INCB 1NBVH 2BVQB 4ZUWA 3SO3B 4E42B 1U8NB 1D5XA 3ZKMC 3WO3B 4JN2B 5KS9A 3F8UB 1GC1H 3UYOD 3SDAA 5ICXB 1XT5A 3HB3C 2DB8A 2PO6A 5T33L 3T0ED 2P5WD 1U8OA 2LTQB 2YD9A 3R06B 3RX8A 1CG9B 3JSSA 2MHAA 2XZCH 3O4OB 3OJDB 1UXSA 3UTOA 3HR6A 3OKEA 4KMTL 5E6YA 5J1AA 1FHGA 5AD0B 3MRKB 3PWVB 3NGBB 3MXVL 4OQTA 3FZUD 1MCPH 1W0VB 3GSUB 5EOCJ 3BUYA 3Q2CA 1ADQL 3X12A 4HPOL 1KPRA 1IAOA 3G6DH 1IEAB 4NKIH 1MRFH 1IC1A 4R7NA 5D6CA 1E27B 3KNBB 1CK0H 2VDLL 2W9EH 4R2GD 3SKMB 1JWUA 2JIXA 4XC3L 1JTOA 4Z7VB 1U3YA 4JQVA 3OXSA 3F12B 3UPAA 1EZVX 4LSTL 4Z8FL 3C08L 1JF1A 3WIIL 5C92A 3CSYB 2YPVH 1O7SA 4KJYA 4O5LH 2VLJE 3IETA 3S6CA 3HE6B 4YUEL 3IDGB 1T22A 2VISB 5FK9B 4NUGH 4M61B 2I5YH 5JHDD 4NNPH 5MEPB 1EAPB 4NKDB 5F1NB 3NPZB 2ITCB 4XWOD 4JM2D 4Y4KA 3BH8B 3TIEB 1QSEA 3GSWB 4WTZA 4MDJA 5EBGA 1EFQA 1TCMA 2AK1L 3CFCL 4BKLA 4WDIA 1HYRC 1F11B 1IGMH 2DM7A 2R39A 5H8DA 1N8ZB 1ZANL 1PZUB 1FYTA 3IJSA 2COQA 4O51A 1SQ2N 3FFDB 4FQQB 4PJ9A 4PGEA 4QOKE 4WWKC 3G9VA 2IEPA 2X89D 1BAFH 2WWMD 2D7TH 1BGXH 2YKLL 1AFVH 5C0DA 5I0DA 4M5YH 5ISZE 1DUYB 3CH1B 4KV5E 1Z3GH 4OLEA 3VDAA 4MD4A 4MMZC 4OZHB 4NM4L 5GGTH 4APQA 1QSFE 4HS6A 1Q9WB 3LPWA 4YDVA 3JV0A 1IT9L 4YK4B 4S1SH 1HHHA 2C3VA 2OQJA 4LPUA 1HK6A 1IGFH 1S7RA 3CX2A 1DSFL 3CFJB 5FHBH 2VAJA 2A1WH 1ZS8A 5CBAB 3T0VA 3OKLB 3NA9L 5DK0B 1JNLL 1IJ9A 5FV2A 1CR9H 3TCXA 4F8QA 3GMRB 1WAAE 1T21A 4UINH 2DQFA 5GHWH 5B21A 2Q7YB 4NQXB 4POYA 1WCQA 4DGYH 3LQAC 2CSPA 2OR7A 5FYJD 4OGAC 5DMGD 1D7FA 1DEEA 1V7NH 4HLZG 3OR6B 3LS5H 5GRZA 3C5JB 3QDMB 2D9QB 4S0SD 4UIMB 5HYJB 2YMXH 1CE6B 4KI5D 4X6EA 1JRHL 4I3SL 4EI6A 2CLZB 5BV7H 3QG6A 5T1KB 3BH9B 5E6IC 3RUGA 3BD5A 5SV4A 1P5VA 3IDJA 3PWNA 2A74A 5IW6B 1MCKA 2F58L 2C1OB 1EK3A 5CP7A 4RNRB 1VEOA 4OM1L 2ICCA 4M93B 5ESAB 4WUUE 5D1QC 2YHGA 3C60D 1CXLA 3STBA 5L8KB 1H3PH 5L2KE 2DQDL 4U1NA 5ALCL 1T4KA 3MGOB 4NQEB 4PRDA 4BSVA 4OLXH 1XIWA 3LCYA 5IMLB 1NCDH 1VGEL 3V52H 3KYOA 4TNWK 1U2CA 5GRJH 4N0YH 4R7DB 3TGXA 4OKVB 2Y06H 5D2LE 3GBLA 4XPGL 4FQXD 4YNYB 2H41A 3KAAA 5IB5B 3TA3A 2A2QT 2QSVA 2YPLE 3L7FA 1QFWH 1HHKB 5E2UL 4PRBA 1U8LB 1TVBA 2FO4A 1KXQE 5E99L 5FUZH 4HH9A 1G9MC 4K8RD 3WUWA 1FO0L 3QHTC 3OGCA 5ILTH 3SJVB 2N1KA 4K9EL 3IGAB 2ZUQC 1HQ4A 5ACZA 4DW2H 1N3NA 3O11A 4CW1A 2F54B 4PG2C 5F9AC 5HYQB 4ONGH 5ADOH 1ZHKA 1QQDA 1HEZB 4W4OC 5I1GH 4B5EA 4LL9A 1OW0C 4RGNE 5F9OL 3E8UL 1WBZA 4XNYL 4NCC2 4AL8H 2LAAA 1Z5LA 5DVMA 4MQXC 4Y4HA 4KMQA 3U9UA 4AQ1B 3A67H 3LV3A 1QR1B 1GZQA 2FZ3B 2QQLL 1RJCA 2B1AL 3CDCA 4QCIA 3ULVL 1S5IH 5I76A 5EOQL 3TJHD 4JVPA 1CVRA 5J6HA 1CDHA 3NAAL 1A3LL 2ESVE 2VDQH 2CPCA 5E95B 1WBXA 3IDYB 3ZDXF 3S7GA 1W72H 1B2WL 5BV7B 4QRRE 1RZ8B 5TE7L 5C0EB 3ILQD 1LD9B 3T65A 4FQCH 2PXYD 5I2IB 1UZ6F 4L9LC 4QO1A 4LAQL 5E9DD 5F6HI 5C08D 5FYLE 2I27N 2BX5A 1NDGB 3IF1B 5D6DA 3HI6L 4HWUA 1DR9A 3ARED 1UEYA 2EYTB 1W8OA 1P84K 3ZDZF 1KCRL 2C5DC 2DOCA 3JVGA 1AP2B 2UWEE 5LCVL 3GIVB 1IQDA 2D7PA 3T8XB 1A14H 4BFEA 2FGWL 3A6CL 1A5FH 3M45A 2WV3A 2NY0D 1G7JA 1DEDA 5C9JB 1JIBA 4FN0A 4Y1AB 3NACL 1K4DA 1KFAH 3S37H 2Y23A 4WEMB 3O6MH 1CT8A 4WJ5B 5GRUH 3K8MA 2HA1A 1G9NL 1KEMH 2YXFA 4FFVC 3WSQL 4TSAL 3IFLH 3JUZA 3QUMA 1IC5L 3PWJA 5SX4H 3GMNA 2DM3A 1CGWA 1UEMA 2K1MA 4ZOBA 5D2NC 4M4RA 3DXAD 4PP2B 2HLAB 5IB4A 1RZIB 5JORA 1JFQL 4OI7A 3FT4B 5MEQA 5B8CC 4RMRA 3SDAC 3IXTB 1MLBA 1XFPA 1IGYB 1KNOA 2E7MA 5DVNA 5CMAB 2V9QA 2IH1B 4S2SB 5JPNB 1M7XA 1T2QH 1HKFA 1ZT7A 3P11L 5AYQA 3JWDC 4ZFOL 1OT1A 2Q8AH 3TNNB 4L8CB 3FONB 4LLYB 1EHAA 4MNQB 3HUJE 3L3HB 3VFVB 1RIVL 3GBMH 3S96A 4W6WB 4TN9A 15C8L 4YIQA 2QADC 4MJIE 3O2VL 4XPFH 1J1OH 3EDDA 5GS1A 4NRXB 4ZFFA 3SCMD 2ZG3A 1OD7A 2KL6A 1P7QD 2DI7A 3AU1B 3PV6A 3ZHKA 3ARFC 5DQ9B 5GGSY 5L0QC 5LKNA 3A6OA 2DDQL 5HGDA 1HDMA 2XY1A 3J8F7 4HWZA 5E8NA 1FJ1A 3S35H 1NAKL 3VI3E 3TYFB 5T5NF 2E7HA 4PJ8C 3CVHL 5AUMB 3BIKA 4XH2A 3I6LE 2EE3A 1F2QA 1SEQH 2DQGH 2NY2C 1NEZB 4FABL 1MCWM 4X80L 1BFOB 2P49B 4GKSA 2EIDA 5FDWB 4XPHL 1U3JA 4X6CE 4IRJD 3MC0A 5FA3B 4IIQA 4MXQD 5E00A 2CRMA 4JFDD 4CJ1A 1GC1L 2VQ1B 3OKOA 1RJLA 4IMLB 1MFEH 4KRPB 2BNQD 3P40A 4ODVL 4J3WA 1TCRA 4JFZH 5F96L 2ZG1A 2PW2B 3RX5A 3S36X 4BFIB 5F7HA 3HE7A 1SYSA 2RGSA 1MHPH 2BNUA 4GKZB 2ITDB 4JN1L 3LKOB 1Y0LB 1MCPL 2HJKA 3QDJA 3VFRB 4KDVA 1IAII 4NBYB 4XB8A 1J8HD 3FT2A 5C86A 1SBSH 3KWWA 5CD3B 3EYVB 3H42L 2K7QA 3NZHH 4NKIL 1MRFL 4UDUB 2I07B 4NT6A 1CK0L 4MJ6B 3ULUF 3EFDH 1N6UA 4I13B 3BDBA 3JWNC 4G6FD 4LCYB 3IAPA 3KPRE 3UTSA 3UTTD 2ICES 5B4MC 4X4ME 2NYYD 3O6LH 2M1KA 1BQUA 2YPVL 2I60H 4O5LL 1M7IA 1MUJB 3K46A 4R0LC 4Z95H 5IK3A 3MCLH 5JLZA 3RDTC 4Y2DD 3X3GL 3CSGA 1URLA 3KDMB 4Q9CA 4XP1H 3BPOC 1UQSA 4BZ1H 3V0VA 2NY5C 3HG1E 1D5ZB 2XPGA 1CQKA 1A7OH 1BX2A 1L0XA 4GKNB 1AQDB 5F6IC 3F6LA 1B6UA 2BRRL 4N9OB 4AEFA 1ZHNA 4LCIH 5ESVB 2C3HA 1M7DA 4JEGB 2VL5A 5D1ZD 5F7DB 2ZCHH 4X6DF 2YD7A 1I1CA 1EFXA 1KIQB 4RMTA 1I4FB 2EO9A 1CIDA 3F5WB 1BAFL 4PJBA 2VUYA 1AFVL 1CGUA 2FL5A 3B6SA 4M5YL 5GGUA 4CAGA 3DV6A 4QWWC 2BJMH 4FQJH 2C3GA 3IDNB 3VRLE 3C5ZD 1FNAA 1KIUA 1G9EA 4HJ0C 1EHNA 3DBXB 4H1LG 5TFSL 2BNRB 4S1SL 4UU9B 4RRPG 5IGXL 2YA0A 4DTGH 1IGFL 3KVQA 1YEEH 1C5BH 4KDTA 1FPTH 2A1WL 4QYOB 4MLSA 1J18A 4AK1A 1HYSC 3RVVD 3RA7H 2EO1A 3DV4B 2YD2A 4MZ2A 1MCNA 1C5DA 1UGNA 5CCKH 1KACB 3L3KB 4URTB 2LVCA 3O4LA 4HWBA 3QXWA 1CR9L 5H2BB 3QUKA 4GQ9L 3O3DA 2DQIH 2V2TB 1QLRA 5GHWL 1IGCH 1NFIA 1TIUA 2R0LL 5CKAA 3GM8A 1V7NL 5DDHA 5TF0A 3LS5L 5GJTL 3RVTC 3AB0C 1EV2E 5CUSH 3OBAA 1TPXC 5DMKB 1WC7A 2YS4A 3B8SA 6FABH 4U05A 2FYYA 4DUXA 4MA1B 1NMAH 3EFFB 2OMNA 1UB5A 4P46A 2V5YA 2J6EA 1XGUA 5H94B 3BZFB 4N5EC 3VWJC 4U6YA 4HIIA 1I9JH 3TV3H 2Q3AA 5FGBA 1I8KA 3MV7A 1I9EA 4CADA 5DFWH 5HHOD 1X4XA 4YHYB 1R5VA 3CFKB 4L1HA 4FQ1H 4F9PC 3K4AA 4XPBH 2N7AA 2XWBA 4P5MA 4OLXL 4DKEL 5CJQH 4G9FE 4NN6C 2V7HB 3V52L 5D96C 1ZLWK 3ARSA 4NO3B 2CQVA 4QTHA 1DJSA 1CDYA 4BYHA 2E7BA 5IJKC 3RL1A 5D6DC 3MACH 2BNQE 2AXFB 4KK9C 2DWDA 4HK0A 4F33A 4UV4H 4DAGH 4H26A 1QFWL 1JHTA 5IV2B 3HZMA 3QIBC 3QO1A 1BVLA 3MRRA 3FFCE 4HIJA 3T08A 4I4WB 5D93C 1CDUA 4PJEE 4YO0A 3RZWA 4K7PX 5FOJA 2KZ1B 4CKVX 4TUOA 4JDZB 1CLOL 4ONGL 5ADOL 3RWGA 4PP1C 4TUKH 5I1KH 1AH1A 1T1WB 3UJJH 5I1GL 3FO9A 5DRWB 3EJZC 5EIVA 3RGVC 4AL8L 1QRKA 4HWEL 3P30L 3U46B 5CGTA 1CFNA 4KTDH 4M48L 5ADPH 4YXKL 2HMIC 3A67L 1WAAF 3JTTA 1XGTA 3LN4B 3PIQB 4P49A 4U0RC 1DDHA 3EYSL 4ZO9A 4P5KA 1C5CH 2VR5A 5IM7A 4PJHE 3ARXA 5LAXB 4WFHD 1RUKH 5I1DB 1IL1A 4MQXD 3V6FB 4DKAA 4QXUL 1AE6L 4NC1C 3LKRA 5BS0A 1W72L 4OKDA 3RHWF 1XF2A 4FQCL 4XNQA 4O58H 4LCWD 2OK0L 3QI9C 4KFZC 3S8WA 3VGAB 4WTWA 5GS1C 3JWOH 1ZT1A 3FRPG 4OD3L 3R0MA 3PL6B 5KW9H 1L9NA 5B38B 4LSQH 5E4EB 2GFBA 5IIEB 4PJCA 2XG5A 5EO0B 4P2OD 4XPTH 5AAMA 4ZDHA 3ULSB 4AJ0A 2FO1A 4P2RB 4Y4FB 1Q9KA 3BZDA 1ETZA 3CFEA 3OKMA 3HLAA 1LO0L 1ADQA 5GSVA 4Z6AT 3TZVC 1HILB 3NIFE 3KPSA 3VXSD 5D1XA 2VXUH 1AI1H 2VLKB 3ZHLA 3O6ML 3T2OA 4NQCA 4MNGE 3VD5A 3OX8B 5BZDB 5C0GA 1I7ZA 4WFFD 1KEML 1YMMB 1LVEA 2HT3C 1FRGH 1YC7A 3BGMB 4NZUL 3AS3A 1G7HA 2IANA 3QDGD 1UT9A 2O5XH 4C56D 1NLDL 3PWPB 4HULB 3VWKA 1JNJA 3NABL 3QXAB 4X6DB 1IAMA 1XF3B 3GSOA 4IIQC 4K23H 2OXGA 5CZXD 5A2JH 1KLUB 1UB6A 5KSUB 1UC6A 1QNZH 4FFVD 1M71B 4CBPA 4UV7H 4PRID 3QCVH 4HJGA 4GAGL 4J8RB 5J0BA 4FZ8H 5LQBL 3O8XB 4YBQD 1A1MB 1AD0A 2KKQA 3C9NB 1FL6A 3BT2L 3QUXB 4OFDA 1WCBB 4YHOL 3GSVA 1BZ7A 2Y7QB 5E8DL 3VFPB 4ONHA 2DKUA 2HG5B 3SDAD 1U8IA 2DMCA 3GBML 2PO6D 4I1NB 1GAFH 5F89B 1FE8L 4GW1B 4YDJB 5KSVB 4PJAF 2X9WA 1NANI 5HVFB 3F7VB 4K07A 4ISVA 1VSCA 3S34L 1AD9A 1KTKE 1R5IA 4H8WH 4EN3B 5T3XD 4JM2F 1AKJA 3L3IA 2APBA 3S35L 1RK1B 1T89A 3H9SA 4LLMA 4JO3H 4GG6E 4WGVB 3VFNA 1MIMH 3RIAK 3SKUD 4Z5RA 1RVFL 2X4UB 3QXTA 3VMPA 4D0CA 1DLFH 2JIXD 3SN6N 5JW4N 1NGPL 1KSRA 5FO7A 3BZ4A 3VG9C 1P1ZB 2UZIH 2ICWI 2PYEE 3L3GA 4OT1L 2IH3A 3C87A 3WO4B 1XGYH 1F6AA 2UWEF 4BA8A 1TITA 2VR4A 2IAMA 1EXUB 1LO4H 1U8JB 2XYCA 3DVFA 4NO0D 2MWCA 32C2A 3FQNA 2FD6L 3WNOA 1BPVA 4OIIH 4KDWA 4AIZA 3MLVH 4Y19D 4HIEA 4BM7A 3KLHC 2NY2D 1MFEL 4RAVB 2NW3A 4Q9QH 2VC2H 2A6DB 4UDTA 2WIIB 4Y4KD 3J7HA 4BH7B 3H8NA 4KWUA 1QSED 1PQZA 3CH8A 2NW2B 3LRHA 3RAJH 4WO4B 4JO2H 5C0RH 5I66A 2YOCA 2W92A 1NMBH 1Q72H 1FYTD 1YPZA 1I3RA 3MFFA 4QOKB 5IWLA 3NZHL 3UYRH 4PJ9D 4GMSH 3FB8B 1BZQK 3KJ4C 3V5KB 4B7IA 2BXYA 4OV5A 3ILPB 2VXSH 1KUMA 3V8OA 4MNHB 3O45B 4ZSOB 1T0MB 3VXMA 4YHLL 3PDDA 4APQD 2CRZA 2Z91A 3O6LL 2VL4A 4OV6F 1AXTL 1MWAH 3RL2B 2I60L 2XT1B 2NY4D 1YEGH 3C8KB 3PG2A 3FB6A 5F3BA 1EIBA 4U1SA 3MCLL 2XICA 3VCLA 3I6GB 3K4ZA 4X0KB 3DUUB 2ERJC 3I9GH 1JPSL 1BVKB 1QRNE 5GGSA 1T5WB 5IVZA 3CXHK 3B9VA 1DVFA 3Q6GH 4WV1C 5IVXF 1A7OL 5K9KB 1IC7H 1N64L 1KENL 1FO0A 2AQ3A 4EUPH 4XZUB 1UWGL 1A4KB 4RBPK 4V1DB 1DUZA 2X7LA 1MFBH 4LCIL 4OUOA 5DC4B 3VI3F 3N1PC 5IFHL 2GQHA 3VXSE 2R1YB 2ZCHL 4MA8L 4QRQA 5DMJB 1DQMH 4B41A 3PP3H 4G3YH 3WL9A 2IALB 2W9LA 3P0GB 3ZZ1A 1IC4H 3AMKA 3QULA 1IM9D 2BY1A 2BJML 5DUMH 1UJTA 3P77A 4JFFA 5EBLB 3QDGE 4C56E 4HUVA 43CAB 3RY6A 4X6BB 4GBXB 3HRZA 1NC4A 3VJ6B 3FL7A 5GRVK 4HK3J 1YEEL 3WKMH 1JVKA 2CLVA 3FO0H 2Z31B 3BE1H 4P4KA 1MFAH 3MLXH 4ODSL 3RA7L 1XIWD 4ZS6D 5D2NE 3FTGB 5CCKL 4XX1E 4R4BA 1E4XH 5KS9E 3V6OC 2DQIL 2A73B 4F7PA 3UMTA 1H3XA 1GHFL 3B2VH 4HUXA 1IGCL 3T0EB 2P5WB 3IFOB 2FJFB 4FQIH 4OUUB 5L6YL 3TA3D 5IFJA 3QCTH 1HYSD 4J3UA 5CUSL 5I18H 1DZBA 5FCUH 3KPTA 3WFCH 4E5XB 2CKBA 2R4SH 2YEZB 3ZYZA 4YX2L 1JF6A 5EOCH 4RAUB 1NMAL 2IQ9H 2ED7A 3B9EA 1MJJA 2J8UA 1HNGA 1B4JL 1I1AA 2NY1C 3HI1A 3NCCB 1GGIH 1ZVHA 1I9JL 5FYJH 3CFBB 4R2GB 3S88L 4XNUH 5HGAB 2EE6A 1RY7B 3S3JA 2HTKC 4WFEE 1TETH 4G8FB 4FQ1L 3OJDA 2AGJL 2XNAB 3MJ8A 4WNQB 1IFHH 1FZOB 3ROLB 3IFNH 2P24A 4Y4HD 1XCQB 5CJQL 2IPKA 3MRKA 1HH6B 3C6SA 4EUPB 3GFUA 5EOTB 2BP3A 2E9JA 4KH2A 3U0TA 4DKDC 5J7CC 4PJAB 2CR6A 1CFQA 3HAEA 1LEIB 1V8HA 5D7IF 1ZKAA 5JHDB 5MENE 1KPVA 3WKNA 2BC4A 4N0FB 4JM2B 3QDHA 1IGJB 1NFDE 1RULH 4TNVK 5I1CH 4DAGL 3LEYH 2YZ1A 1AGCB 3GHEH 1BIIB 1MHCA 3IDXH 3QNYA 3P73B 5HHNB 3OAZH 4ZFOA 2Q6WB 3LAFA 4I77H 3VRLF 2IQAA 3MRQA 3TPUA 4UBDC 3DGGB 3DX6A 2JJSA 4U31A 4JO1H 2X40A 2P7TB 1UH3A 4LFHD 1FVDB 1P2CA 3HE6A 5H35B 3BD4A 4PBXA 1A3RH 3CFDA 5I1KL 1B0RA 2W0LA 1N2RB 2UVEA 3D18A 4NKDA 3TO4C 1INDH 3NH7H 5IOPB 3TIEA 4K8RH 2DQEH 2VJXA 1CTNA 4HGWB 4WI2A 3P4LA 4U1MB 5C0CE 1G7PA 5SV3A 3VWKC 5CEYB 1K2DA 1FGVH 4FTVD 3CVHA 5BZWA 5L88H 3BDXA 1X4ZA 5J12B 2X09A 5DJAB 3MYJA 4M7ZC 1KB9J 1FH5L 2Y6SD 1QBMH 3ARBC 1XR9B 1XZ0A 2DL2A 2CDGB 4XMPH 1IGIH 1VFBA 3KYMA 2QSTA 3CDYA 2HMID 1S7UB 3JUYA 4DQOH 5F7UA 3DMMC 4QHUB 2NY6C 3AROA 3UJTH 4Z9KB 1LDPH 4K3GA 3EAKA 1MRDH 1U8HB 4C54A 5FM8A 1N0XL 3MREB 1ED3A 4XP6H 2FBJH 2OBGA 1Z9MA 3SDYL 1FAIH 3BP5B 3BO8A 4GUPB 4XPTL 3FN9A 5IBUB 3G5ZA 5BVJB 3P4NB 4I18B 1N5AA 5DJ8A 1T89C 1XGQA 4R97C 1UM5L 1R24A 2PUQT 3GMRA 2PCPB 5DXWA 5JHLH 3DHMA 5DA0B 1AI1L 2G9HA 2W1NA 3C60B 1CI5A 5IVXB 2PTTB 1YYLH 4HKXA 1TZHA 3RWDB 1U93B 3C2SA 3IFPA 2E7LA 2IAMC 1IM3B 4JREC 3MBEA 3HNVH 4CVZB 4K23L 1W8NA 3PGCA 4GLRH 2V7NB 3DUHA 3FN0L 5HGBB 2EE2A 5C3TA 4FQXB 5ALBH 4UV7L 3MA7B 4EIZC 3QCVL 3QJFB 1FNHA 5JW5B 3H2WA 4FZ8L 4OAWB 3FQRA 4PLOB 3B3IB 1CS6A 1HSAB 1MCHA 2YUWA 4XBPA 2RCSH 2EE9A 2XN9A 4LKCB 5FO9A 4QTIL 1OB1A 4IS6B 4NQEA 3VXRA 2AV1A 1B0GA 5HYSA 5HI4C 5I74B 5T1DL 1LEGA 2CLRA 4F58H 4PRAA 5C2BL 5IWLC 4OKVA 5DC0A 3E2HB 4TRPH 2OJEA 2GJ6E 3HE7D 3WIHH 4AENA 3RVXD 4KKLD 2CXGA 1RJYA 2DQUL 5TDNB 4H8WL 1GXEA 3QDJD 1CDIA 3MNVB 4EI5C 3U4EA 4D8PB 3HZVB 4JO3L 3D39E 1TNMA 2P46B 1MIML 4ZAKA 3PF2A 4LSRH 1L9MA 2YC1A 2NZ9D 3IGAA 3BXNB 1DLFL 3ARUA 1BOYA 2F54A 2IADA 4NQDA 4CVXA 5ETUA 4PG9A 3B9AA 5DJ6B 3UTSD 2UZIL 2C7UB 4YAQA 3H9YA 3LB6D 5FYKE 1A3QA 2X4OA 2PXYB 2YBRB 1YEHH 4L3CA 3MRPB 5TPWH 4DEPB 4IJ3C 4YXLL 4HCRL 5E9DB 3U4AA 5C08B 3BP7B 4FXKB 3MLVL 4Y16C 3TBSA 2OI9B 3LS4H 3AREB 4K9EC 3NIFF 4ZTOL 5DD1H 1OTUC 2VC2L 4IM8A 1QR1A 3U7AA 4Q9QL 1MVUB 4JANB 3VFUB 2I9TA 4PTUB 1HSBB 2P44B 3PXJA 4HUMB 5E8PB 3ARDC 4U0QB 5GISL 1AR1D 5DEFB 4LIQL 1IBGH 3RAJL 2NY0B 1A7QH 4JO2L 3WXWL 3TVMA 5C0RL 5IB1A 5D7IB 3P9MB 2W07A 3ZTJG 1RZ8A 1AO7E 3UBXB 5I2IA 1NGZB 1Q72L 1B6DA 1WV7T 1B0WA 5HYFA 1QVOB 1EZVY 1NDGA 2ZNWA 4G8IA 5ICYB 3V5HB 1KCVH 1E28A 4P4KC 3T2NH 5GRVL 2VXSL 4U2ZA 2R9HC 3DXAB 4K7PH 2NXYD 4OCLC 3GIVA 3D0VA 2UV3A 3BWUC 3IS0X 4M8QA 3TJEH 5FUOH 3OAUL 3RVWD 2ADGA 2ED8A 5B39B 5EH1A 1MWAL 2DKSA 3SDCA 2KBGA 1YEGL 2XWJA 3TIDA 2DMBA 3IJYA 1ERNA 3C5SB 4ZFGH 2MPAL 2V5MA 2YWZA 3O81A 4OCXL 4N9GB 4NC1E 2ADJB 4R90L 1MCOH 2CRYA 3Q6GL 3O4LD 4JY5H 1RUMH 1IC7L 1M1SA 2EZ0D 5A2KH 1XEDA 4H20H 2HLAA 1DE4A 5DGRA 3SO3C 2YD1A 4UIKH 5C0AA 2BCKB 1LGVA 1NKRA 2WBJA 4GG6F 3SCMB 4GO6B 1P7QB 1EJ6A 2CGRL 3SGEI 2A0LD 1RZJC 3ZLQC 2LTQC 1EUUA 3P0VH 2WP3O 1J0IA 4KK8D 4LPVA 1IC4L 1MCBA 5CJOL 2IH1A 1SVZA 3O4OC 3JV5A 3NVQA 4NPYA 4TUJA 1KIPB 4P46D 4XXCC 2XZQL 5JOFB 4HIHB 1R3HB 1KIRA 3E6HA 1N26A 3NGBC 5AG8A 2D3VA 1JHKH 1RIUH 5HGHA 3CPLA 4MNQA 3MV7D 1EPFA 1A7NH 1ZLVK 1NCBH 4F3FB 1L7TH 2E27L 5I1HH 3WKML 4JFEA 1M6OA 3BE1L 1MFAL 3AU1A 4MA3A 3BKJH 2DMKA 4LSDA 4G7VL 3FQUB 4JZJA 4IRJB 2NX5E 1KJMB 1E0OB 2ADIB 3AUVA 1T7ZA 4H0HB 3V4PH 1W72A 1RD6A 1PG7W 4JFDB 2FR4A 4GMTH 1J0JA 1E4XL 2DL9A 2BNQB 1AGDA 2XWTA 1YUHB 4FQIL 5EUOA 2VAAA 5IMOB 4Y5XA 3HE6C 1YNTA 3GI8H 4OCYH 4EVNA 1A7BA 4NGHH 4RMUA 4GW4A 1S7XB 5I18L 1LO3H 3ELAT 3DWTA 3D9AH 4LLQA 1PKQB 1MEXH 3IDMB 4XAKD 4Z7UE 1JI1A 1KB5L 1ZSDB 4CNIB 1J8HB 4G9DB 5DQJA 2IQ9L 1YN7A 3GMOA 4N0UB 1CF8H 2R56L 3BKMH 1S9KC 2H6PA 5FYJL 3A0OA 1LNUB 4G6FB 4XNUL 1J86A 5IEHA 1XR8B 4OLVH 2FECI 1CLYL 1T20B 3UTTB 4LU5L 1OTSC 1TETL 2PTVA 3VMNA 4AEEA 3WIFB 4LQFH 2D0GA 3UXFA 3IFNL 5DD3H 5DFVD 5F7MC 3MV11 2HWZH 2NY1D 2ITDA 2H32H 2AQ2A 3FQTA 2VITA 5JUEH 5IT2H 3A6BH 4NWUH 3LKSB 3CX5J 4X9GA 4PUBH 2X10A 2E5EA 4Y2DB 5DYOB 1GC1C 4YK4C 2H26A 3RWCB 4BZ2H 2HTKD 1YEDB 1CVSC 1OL0A 2I07A 3DRTA 1PX3A 4QRUA 2ZSWA 3LEYL 3L5JA 5E2WH 3TBVB 5IHZB 3GHEL 4LCYA 4M7LH 4NKOA 5BS0D 3IDXL 2VSDA 5CAYB 1M05A 5DHXB 5F1IB 2BMKB 1CWVA 3BJ91 1ZVSA 1EEQA 5AG9A 5D1ZB 2VERN 4KJQD 1CZ8H 2EKSB 4PV9A 4DK6A 4JO1L 2ILLA 2F74A 2V2XB 2ZUVA 1NAMH 5J3HD 3GBNH 5FGCE 1MJ8H 1P4LB 3I3DA 3KDMA 1HHIA 2YN3A 5C09D 5F9JA 3NH7L 2VLLA 5HDQH 5BCAA 4E0RA 2AJYH 3C5ZB 2E7LC 4L8BB 5A1AA 4Q6IA 1CLZH 1NMCB 5D1XD 2W9DL 5KS9F 1VPOH 4WHTA 4NQCD 4QHMB 4U4BA 5I16A 1ZHBA 4X4XA 2HRLA 5F7DA 1MPAL 1U91B 4LF3B 5KANI 4AEIH 5KOVC 1QBML 4ELKB 3GHBH 4M93C 5GGRY 4D0BB 3RPKA 2IGFH 4GQPH 5T5NG 5CJXA 4XMPL 1IGIL 4M1GH 5SWQA 4DKFH 4ZNCD 3HN3A 4OBRA 1DQJB 3EOBB 4X99A 4DQOL 3EYUL 3IU4H 4JRXE 3UJTL 2EYSA 4JAMA 5A2FA 4GRMB 3I75B 4HZLB 1LDPL 3VXOB 1S78C 4PJGB 3S5LB 3HFMH 1TJGH 4Y5YB 4NZRH 3MSPA 4XP6L 1GOFA 5C71A 4HPYH 2VQUA 4JG0H 2FBJL 4LBEA 4LLDA 4D2NA 1FAIL 4JDVA 3MOQA 4O2EA 2GSGA 2W60B 2RR3A 4W6XB 5D5ME 2EDDA 1VB9A 2FBOJ 2H32B 2IMMA 4XNZB 3X14B 1N59B 1ZLUH 1H8NA 4XCYB 2WW8A 4AH2A 3QQ4A 3PHOA 5HHOB 3LD8B 4PJDE 4PY7A 4HFWB 3TBTB 4QXGH 4JLRA 1ORQA 2R0KL 4L8SB 2JCCA 4NO2B 5D7SL 4FFYH 3SPVA 1NFDF 1F3DJ 1AKJD 1MH5B 5JDSB 4W4NA 5K9JL 3H9SD 4PGBA 4XVSL 2EDNA 2RAMA 4LVHB 5A2LH 1GRWA 2A6JB 3HNVL 2VDPL 1YY9D 2APFA 4JRYA 2AEIT 1C7TA 2W59A 3BZFA 5H94A 5CINL 5ALBL 2OL3H 3DX9B 4G80A 1NAMB 3O2WH 2IG2H 4ETQA 4ZNEE 1SM3L 4R9HA 5EBWB 4KZEH 2QKIA 3KPOA 2IAMD 3WCYA 5B38G 1OP5H 3I2CL 4J4PA 3BOVA 2DKMA 5DMIH 1YEIH 1T03H 2FWOB 4MVBD 3NIDE 5D7LA 3IDYC 4A6YB 3V6OE 1AXIB 3T1FA 5BV7C 3EJYC 3MRMB 3TWCH 1MRCH 1KJ3L 4PV8B 1JZ4A 4J3TA 3NN8B 4D3CL 1VADA 3IJHA 4TRPL 2PETA 3QXUA 5T1LA 3WIHL 4U1LB 1DBKH 2X6MA 1V7MH 4NCC1 3WJJC 2V5RA 3WNLA 1AC0A 2CXKA 4LSRL 1XGRB 5A3ID 3HR5A 2H9GB 1TZIA 2LU4A 1HXMA 1B90A 4PJIB 4FZEH 3OGOE 4MCZA 3LIZH 1BQHA 2V2WB 3VXMD 4OQTH 4DVRH 5IKCA 5T3XH 4ZMAT 5BQ7B 3F58H 1YEHL 2GK0A 5ICZB 1NCNA 4LCWB 3DX7B 4FQLH 1C16B 4KVCH 3REWB 2WBJC 3LS4L 4L4TD 1S9VA 1KTDB 2OJZH 2BVTA 5DD1L 3LN9A 5EA0H 3H0TA 4PLJC 2QJDA 4M5ZL 4P2OB 1DVFD 5GSRB 2ATKA 2IF7A 4PJCE 3GJFH 3PWLA 2B5IB 1IBGL 3NZ8B 4TVPH 1A7QL 1U0QA 5ITFA 4MAYA 1RFDL 3DYMA 3VXSB 1DANT 2GY5A 4I0PA 3BKYL 3KPSE 2QR0B 3OKKB 3MFGB 1V05A 2OL3B 2VMFA 5SX5H 3VFMB 4XHQA 4LRNL 2D7OA 3KPLB 4JY4A 5GS3A 4UQ2A 2OSLB 2UUDH 3DVGB 1KCVL 3F7QA 3FB5A 4YE4H 3QDGB 2GHWB 4K7PL 5IIEA 4XBGB 5L2JA 4PLKD 2IANE 3UC0H 3TJEL 2H3NB 5FUOL 4MA7H 4P5TA 1NC4D 3WV0A 1VEPA 2GUOB 5FKPB 4JPVH 4RRPA 4PRIB 2X4NA 5ANME 1HHGB 4ZFGL 1KT2B 4YHNA 4P4KD 3ULVD 3HZYB 3RFZC 1FNEB 2DIAA 1CFVH 2K7PA 3FKUS 3OX8A 4PJFE 4ZUWB 4MD0A 4E41A 3SDXA 4GAFB 5IBTH 1MCOL 5TDOA 3AS0A 5KS9B 4LASH 3BGMA 4X9HA 3BDYH 3SDAB 5DJZA 3PWPA 4H20L 2PO6B 2X4TA 1U8OB 1LK3H 2MHAB 1UXSB 1KLUA 4TSBH 1C7SA 5KSUA 3OKEB 4PJ7E 3KS0H 5J1AB 2A83A 3V6ZA 3SGKA 5I8KH 4RFOH 2C3XA 1K8IA 1DL7H 5DJDA 3BUYB 3X12B 1OPGH 2NR6D 3QUXA 4QHNA 1L7IL 1WCBA 1KPRB 1I1AD 4M3JA 5D6CB 1TZGL 3OKNA 1AR2A 1IAKA 5L0QB 4LAJH 2JIXB 4OZIB 4WRLA 3MJ9L 3GSNL 1OQOA 3MXWL 3Q1SH 3RTQA 5I1HL 1TJHH 3OXSB 4J1UB 4JFPA 4QRTA 2CDFB 4YDJA 1L0YA 1JF1B 5KSVA 4QHKJ 3NFPA 4YJZL 2G75A 4MQTB 2W65A 3F7VA 2EDRA 4NO0B 1UH4A 1O7VA 4O2FA 4KJYB 3V4PL 3IETB 3DJ9A 3FN3A 2Y4SA 1G1YA 3MV9E 4Y19B 4GMTL 5DD0H 2Y36L 1F97A 5E70A 1GOHA 4XBEL 3SE9L 3BPCB 4Y4KB 3ISWA 1RIHH 1QSEB 4OCYL 1A6VH 4MDJB 3H7BA 3F6IA 4NGHL 4MS8C 2HJLA 4W70A 4XI5D 5T3ZE 4BKLB 1LO3L 3KXFE 1P1ZA 3WE6A 4G7YL 4HMCA 2FATH 3DHJA 4UUJA 3I3EA 1MEXL 3FB7A 3QZWG 5TGBA 5K33A 1MAMH 3VU2A 1FYTB 3MJ6A 3PJSA 4H88H 1CF8L 3GMQB 4EDXA 3BKML 4PJ9B 3HE6D 4OFPA 4PD4K 3WDJA 1R0AH 1C08A 3AY4C 5C0DB 5FV1L 4OLVL 1WZ1H 4KHTH 1TENA 5J4MA 4WI5A 4MD4B 5I71B 4LQFL 4APQB 4HS6B 5IHUH 2JELH 2VZ1A 5DD3L 3QEQE 4YDVB 5DGQA 5B3JE 4WO4A 1D9KA 1HHHB 1NUGA 2OQJB 1BIHA 2HWZL 3JBG7 2NY4B 3O9WA 1S7RB 2OR8A 4DGIL 3CMOL 3A6BL 3EYQD 4XCNA 1ZS8B 2BOCB 1OAKH 2ZZUT 3N1QC 3V2AR 4C83A 5E8OA 2NPLX 4N8CL 5DQDH 5C0FA 3DSFH 3UZEA 4HAFA 4JQIH 4HBCL 5D8JH 5E2WL 1LQSR 2DQHL 4KKCD 4K7PY 5CIPH 1PG7L 2VLRA 3CC5B 3ILPA 1T21B 3DETD 2DQFB 1JF5A 1P4BL 4ZSOA 5F9WB 1C1EH 1T0MA 2Q8BH 4ODWB 4QLRA 3I84A 1DEEB 1JGUH 4HXAH 1CZ8L 1I75A 4K94H 3RL2A 4DK3A 1YEFH 3L6FA 5I8EA 3QHFH 3TBYA 2ZUWA 1U36A 3FRPA 2R2BB 1YMHA 4X6EB 4P99A 3FT3A 3I6GA 4IRSA 3GBNL 1TQBB 4EI6B 2Q76A 1IM9B 4JVWA 4NYLA 5IW1B 5HDQL 5IR1B 1T5WA 2AJYL 3RUGB 4L29B 1WWAX 1H15A 4JFFE 3PWNB 1UKQA 2HT4C 2R2CA 2A74B 4ZUVA 4PJ5A 1CLZL 1HKLH 1HE7A 4MA1C 2NMSA 2MCPH 5DK3A 4PRHE 1VPOL 1LP9A 5JR1L 1T4KB 2R1YA 3I50L 4PRDB 1H9VA 4BSVB 4KXZI 1XIWB 1A47A 5FFLA 1HIML 3GHBL 3RZCA 3SKJL 4YHYC 3KYOB 2IGFL 3QWOA 5C07E 1KC5H 3CDGA 3MBED 4HKJA 4J4PC 4OZ4A 4DKFL 1BEYH 3W9EA 3N1GC 4Z7UF 1KXTB 4TPRH 4HCRA 2M2DA 3KPQA 4HZAA 3GNMH 3IU4L 3M07A 4X6BA 4JFOB 3TA3B 2NCMA 3SGJA 3L7FB 3INUH 3O3BA 1CDBA 3IDIA 3AFLA 1TJGL 4NZRL 1TVBB 4HH9B 1WBYA 4ZOEA 3WUWB 4R3SA 2XN9D 3OGCB 3VXRD 1VERA 5CWSA 4MB3A 4J23A 4MJ5A 1HQ4B 3I85A 3X11A 1N3NB 4CW1B 3QUZA 2ZOLB 1N5YH 2KZWA 2IMNA 1S78D 1ZHKB 1QQDB 4NN7C 3RHWK 1MFDH 4G8GA 4ORGA 5DVLA 2P5WA 3V4UL 5CD5D 1C12A 4QXGL 3EDJA 4WUKH 1WBZB 1DN0A 3KPMA 1Z5LB 2KQMA 5M7QA 4Y4HB 5CIPB 1P84J 1I7TA 1X7QA 2Z8WC 4EEEA 2D0HA 3MROB 8FABA 4OD1L 3LV3B 5EORL 1GZQB 2VDRH 1DQLH 4ZAKD 3CCHA 5J56B 1KGCD 1XGPA 3ARWA 1MWAA 1UVQA 4WU5A 3T77B 5I76B 1J0ZA 3B83A 4NQDD 5J6HB 2VTFA 1F90H 2AJSH 1F5WA 4YHZH 3O2WL 5J6GA 2IG2L 1WBXB 1MOEA 1CXKA 4ONFH 3N85L 1PEZA 4KZEL 2R29L 2AQ1A 1VEMA 1R3KB 1F00I 4O9HL 3T65B 5C70A 4PJBF 3VDCA 3GZKA 2BK8A 2FJGA 5DMIL 1UWXK 2GEEA 1T03L 5DO2D 4X9BA 5FYLH 2GT9A 1HH6A 1QFWM 4MAYC 2YR3A 4PRPD 1ES0B 1RMFL 3WBDA 1HOCB 2VH5L 3KHOA 3TWCL 2XFXB 1F8TH 2ZCKH 5DRNA 1IAIL 4S1RH 5I0ZA 1IQDB 2CUIA 3VGAC 2IBZX 4OF6A 1DBKL 1NUDA 1G7JB 1V7ML 3PL6C 2YN5A 3TVMD 5GGRA 1BIIA 1K4DB 3OKYA 5E4EC 4EBQL 4HF5H 4FTVB 3P73A 2XXMB 3BX7C 1CT8B 4P5TC 1U95A 4KUZL 3DGGA 3V95A 1KG0A 4LP5A 1FVCA 1F6FB 4XP4L 5C8JA 3GMNB 1AIFA 4AYFA 5AZ2H 4K3EL 4FZEL 2IFFL 4N90D 4S0TD 5JW3L 1SJHA 4BELD 3WJLA 1JZ5A 4Z18A 3SBWA 3LIZL 3MGAA 1OF2B 2P43B 5IB4B 3LN5A 5JORB 2Q3ZA 4KMLB 4MB4A 4RQQB 3JV4A 1A9EA 5MEQB 3B2UD 2R1WA 3F58L 2VDNH 4GH7B 3SDCD 1BM3H 4FQLL 1MLBB 4OZHE 4KVCL 1A6UH 3L5WB 4C55A 1KNOB 4XCEA 1C8PA 3BUTA 2OJZL 3MLWH 2YRZA 1G6VK 4PJDF 3WEXA 5EA0L 1ODAA 1ZT7B 3SGKC 3EO1B 3D3VA 3KPPA 1TQCC 3O8XC 4TVPL 4LHUA 1XR9A 3S96B 3HPLA 4KY1H 2CDGA 5EZLA 4I2XA 3QUXC 5L7XH 5C0AD 2WBJD 2OR9H 2ZJSH 2A9NH 5GS1B 2XV6B 4ZFFB 1NKOA 5I73C 3LH2L 3PV6B 3UO1H 2CIKA 1VFAA 1HWHB 2P48B 4JHAH 5HGDB 1HDMB 4FG6C 1EJOL 4HWZB 5E8NB 1FJ1B 5TQ0L 3QDME 1OCWH 5HYJE 3OTTA 4GRWH 1L0QA 2HVKB 3KYAA 4YBLB 1P69B 4LSVL 3BIKB 4XH2B 4EN3C 4MA7L 1ZGLA 3NIDF 2QHRL 1RUAL 2FEDC 3QUYD 4JFED 1F4XH 3UYPA 4G6AC 5F93C 5KJRH 3WLBA 4DZBA 3JWOC 5DJXB 1JTPA 2Z93A 4IIQB 2FH8A 3VI4F 3MLSH 5E00B 5IBTL 3EDEA 4NQEE 3RWDA 4LASL 1MNUH 3WO4C 3BDYL 1LHZA 3BEVA 3QRGL 1MQ8A 3D25A 3OAYK 4XMKH 2P8PB 1TCRB 3PHQB 1UACH 1K8DA 2XQYG 4RA3A 3VXNB 1JGEA 1LK3L 3O0RH 3Q5TA 5DHVH 5TE6H 5HGBA 2EDKA 1ZV5A 3HE7B 4HEPG 1SYSB 4DUWA 5KTEL 1UA6H 5ECJE 2J1KA 2BNUB 1UENA 2QHLA 3HC3H 1MCJA 4YPGA 3BPNB 5I8KL 2HJKB 3QDJB 1OPGL 1QBAA 3OKDA 3FT2B 3KWWB 4WO4C 2DF3A 3SJVE 1JBJA 4NT6B 5MEOB 1FIGH 4KQ3H 3QPQD 1FAKT 2F54E 3UTSB 4RMSA 4NQDE 4UT9H 3MLRL 4M00A 5I17A 1M4KA 3NFSL 3TN0B 4CU7A 5IVOA 4MQ7B 4PJCF 1PY4A 2J6EH 5TDNA 1TJIH 3CZFA 1M7IB 3BP4B 1SHMA 4RISH 4F37F 3FRUA 5IK3B 3HZVA 5DD0L 3FMGH 3GMLA 2XKNA 4Z77B 3ZT6A 3V0VB 1RIHL 3OB0H 1A6VL 5E08H 2VRAA 5GGQL 1BX2B 3ZSSA 8CGTA 1TVHA 3AAZA 4GRWB 1R6VA 2C7UA 3BP6A 1KBGH 3U79A 4CN1A 2VL5B 5SWZD 4QRPA 3MRPA 1WT5C 1MAML 4IOSD 5E2VH 1MQKL 2NZIA 1GOGA 4OLUH 2WZPD 4QY8A 4FXKA 2XQBH 5EN2A 3AREA 4OIAA 4PB0H 1R0AL 4PJBB 2FL5B 3B6SB 5FO8A 4J6RL 4R4NC 1A0QH 1WZ1L 5GGUB 2Q1EA 3DV6B 3VD4A 1JYWA 2NXYB 1HSBA 4OZGA 3WLWD 3EO0A 3ZDYF 5IJVA 4MWFA 4E9LA 2E8YA 4AIOA 2ARJA 3LRGA 3BGFB 1J87A 1H5BA 4KUCD 4LEXL 4Z7WA 1T66D 1CXFA 3N9GL 1MCDA 3KJ4B 5DHVB 3IAGC 5HHMD 1OAKL 4GBXC 4PJ7F 3HS0A 2LABA 4JQIL 1EVUA 4UT6H 5D8JL 3O4LB 2Z31C 3ARTA 4LGPB 1GH7A 4UT7H 3QUKB 4ELMA 1QLRB 1NFIB 2NTSP 1C1EL 2WINA 1OAQL 4D9RE 2DLEA 3P2TA 5IROA 5DDHB 1JGUL 4HXAL 3GI9L 3CGTA 4NDMB 4GRLA 1G7IB 4K94L 1AHWA 3UPRA 1YEFL 1CFTA 3C5SA 3T0EC 3QHFL 3DIFA 4Q74A 4Z78A 1J7VR 1WC7B 4X8XA 1U8KA 2FYYB 3WIHA 1RSFA 1UB5B 4P46B 3MNWA 4ZUTA 2Z8VC 4K3HA 4KK6D 3TBWA 4U6YB 4HIIB 4ZXBA 3S9DB 4JCMA 3FZUC 1I8KB 3MV7B 5KG9A 1QO3A 1HKLL 4CADB 4MNQE 1HINH 2MCPL 5J8OA 1MCFA 2F15A 1R5VB 3UDWA 2UZXB 4Q9RL 2F5AL 3DI2B 4ODXA 2YPKB 2XWBB 4R2GC 4P5MB 4KMTH 2G5BA 5GS0H 5HI5C 4CVWA 3DVNA 3MXVH 4G43B 2HT4D 3SKOA 1KC5L 3QFDB 4QTHB 4PYHA 3O41A 2A38A 1DFBH 4JRYD 3DARA 3RL1B 2ZCLH 1R3HA 3MJGX 4XVTL 5DTFA 1YDPA 1J5OH 5JOPD 2OM5A 4HK0B 2VDLH 4F33B 4TOYH 5A16A 1FORH 1UM4L 4H26B 1JHTB 3HZMB 3G5VA 3VFOA 1BVLB 1OAUH 2AI0L 4HIJB 4J4PD 3CZJA 4JM2C 4XWOC 3WIIH 5J13C 4YBHA 2VKWA 4OD2A 4NKMB 4NC2B 5D7LD 3FQUA 5D7JA 3RQ3A 1QFUL 5B3JF 5ABDE 1X3DA 4TUOB 1N5YL 1UG9A 1AGEA 4YUEH 4WHYG 3RWGB 5BMFH 5JIKA 3MRCA 1XH3B 1MFDL 2B0SH 1EO7A 4DVBB 5T1LD 4WUKL 5KN5A 1LE5A 3ALWA 4ZUUB 4U3HA 2VZSA 4N8VB 3WJLC 1IEHA 2WWMC 3LQMA 2AK1H 3MX0A 4JGMA 2XKSA 3SBWC 4LDOB 3GIZL 1S7TA 5CSBA 4L3EA 3K4DA 3W39A 1DDHB 2VDRL 1A9BA 2M26A 1DQLL 4OGXH 4JB9H 4P5KB 3TC9A 1QP1A 3MUGB 3PNWA 2P8LA 4N0UA 2OZ4H 5IM7B 4NBZB 1HH9A 4LKXA 1SBBA 2Z35A 1CD9B 3QG7L 3KR3L 1T7YA 1F90L 3Q5OA 4XT1C 1IL1B 5J12C 1JGVL 5JPMB 2YKLH 3LKRB 5BS0B 4UAOB 1XF2B 1R3IL 3UTTA 4XNQB 2BERA 1OARH 2BSTA 2DYPA 4M02A 5FYLL 5SWSA 1KJ2H 2AXJA 5AAWA 1NCTA 3KYNB 3FO2A 1ZT1B 3WHE1 4OLZL 2E6PA 4X7EC 3VXUA 1F8TL 2ZCKL 4Y2DA 4PJCB 5C09B 1A6PA 3NA9H 4ZDHB 3ULVF 4NP4L 2EDEA 1JNLH 1Q9KB 1ETZB 2XTLA 3CFEB 3OKMB 4KI5C 3TBVA 4MAYD 1MY5A 3HLAB 5GSVB 4ZOCA 3U36A 5CFHA 2BMKA 2HFEA 4TYUA 3ARGA 5D1XB 1P53A 4I0PD 1T6WA 4NQCB 4I18C 1KPUA 2EEBA 5C0GB 1I7ZB 2HJFA 5D1ZA 1JHLL 3MJ9A 3WDHA 4N0CD 4X8JA 3GSNA 4AMKL 5AZ2L 1G7HB 5TF1H 4MHHI 3GSOB 1DQTA 4XTRD 1X5LA 2B2XL 1IEBA 1SEBA 2VDNL 4P5TD 3MLYH 4RMWA 1UB6B 1X9QA 2VNCA 4L8BA 1BM3L 4TULH 3X17A 4WEUD 1A6UL 5EDXA 4M7ZB 1WFNA 2J8UF 3AM8C 4HJGB 5T1MA 1UYWL 5C6WH 2BNRE 5AZEH 5DZOA 2EDYA 2AKRB 1AD0B 4FQXC 1FL6B 2FHFA 2E7CA 5ALCH 4E41D 3GSVB 1BZ7B 3KJ6H 4LF3A 3BVNA 4PB9H 5JIIA 1VGEH 3PWPD 4K8RC 2Q7NA 4KY1L 5L7XL 2A9NL 5HVWA 2VKXA 4OM0H 3RU8H 1PD6A 2D0FA 5I74C 5HD8D 3MRHB 3UO1L 4GRMA 4ISVB 2X05A 3VXOA 5J57B 4JHAL 3S5LA 1A21A 3WXVH 4EZMA 5E2UH 1F3DH 1FFPA 5IMKA 1AKJB 5E99H 3E2HC 3ZE2E 3H9SB 1OCWL 3GK8H 1QBLH 1L4IA 2FHBA 5MI0B 3VFNB 3LHPL 4D0CB 1INQA 2H32A 3DNKA 4LMQE 5DZNA 3S98A 5BOPA 3BRGC 5FO7B 5KSAA 4FG6D 3BZ4B 3RTQD 4XCYA 5JOPE 4U3XA 1DLHA 4NRZA 2IH3B 4ORZC 1F6AB 5DEZA 5KJRL 2B4CH 1U2HA 5C0BA 1EEYA 5CJ8A 4JREB 3LKQA 1MCIA 3MOAL 1XCTA 5FUCC 3H9ZA 3TJHC 3MLSL 1N7MH 3U7YL 4AIZB 4HIEB 1FZKB 4N1CA 3MCKA 1EERB 2CR3A 3MRFA 3ILQC 2PXYC 2NW3B 2KH2B 4DEPC 1U3HD 1A02N 4UDTB 1UACL 4XGZA 1YNLH 1A6WH 4XVJL 2BHYA 2OI9C 3AREC 3SE4A 1UA6L 3TCLA 1UM6H 1CQYA 3HC3L 2VO5A 4L8DA 1JL8A 4WTXA 2ZWLT 5I66B 1B2WH 5TE7H 1FLTX 5KANG 1YPZB 1I3RB 3MFFB 4HKZA 2WAHA 3CXHJ 1FIGL 2RQ8A 4KQ3L 1GGCH 2X41A 1KCRH 1YYMH 4OV5B 4PREA 4UT9L 2GCYA 3VXMB 5DJ2B 3MA9L 2Z91B 1Z0NA 2FGWH 4XX1G 2AK4A 4OF7A 1D9KD 1QEWA 4NQVB 3O9WD 3V6BR 3NACH 1TJIL 3FB6B 4LVOB 5F3BB 4RISL 2C4XA 4U1SB 4YDIH 4L4TB 1FGNL 3BEWA 2F19H 3FMGL 5CJBA 1G9NH 1QHOA 1XGRA 1AHWC 3WSQH 4TSAH 5GGSB 5IVZB 4NN5B 5EWIH 1IC5H 1OGAA 4N0RA 1BD2A 1DVFB 4JFHE 4JPIB 5EPMB 5B3NA 2FDBP 2VLRD 4C58B 4RWYL 2EXWC 1FO0B 1XF5A 1AJ7H 3K3QA 3ECBA 2P47B 1DUZB 4OZFG 4L4VD 1U6AH 4Z7QF 5EU6A 3TNMA 3BYTA 2FIKA 4IOIB 5E2VL 3T4AA 2XTJD 1C16A 4QRQB 3ULUE 4OLUL 25C8H 2XQBL 3WL9B 2X1PA 1OGTA 1OSZB 3ARVA 3OHXA 3RKDD 3SCMC 1JNHB 4IRSD 4NKQB 3QULB 3MOBH 2HTLC 3P77B 3P0YL 3SHSA 4HUVB 4FMKA 3RWIA 3NBNA 4PJ5D 3HRZB 1NC4B 2JTDA 15C8H 1S9WA 4P9MH 4P2RE 1EUTA 1FNSL 4R96A 4YPJA 2CLVB 5FEBA 3BI9X 4P4KB 4R4ND 3OKKA 5FKAA 2VLKE 1X5YA 4WTZG 1IE5A 3RZCD 1YMME 2DBJA 1KV3A 3SEPA 4R4BB 3C6LA 4E41E 4RFNB 3DVGA 2QQNL 4R6UA 1JV5A 3W9DB 4F7PB 2R1XA 4X7SH 4HUXB 5D7JC 2QL1A 4IRJC 1QOKA 3TLRA 3PWPE 3G6AA 3EZ8A 4X6DE 5IFJB 5IEKA 5I8OL 1JGDB 1BMGA 2D7QA 2BSRB 5IG7A 4NJAL 3JWDH 1WIOA 4XPHH 2C4FU 4AZ8A 5BJTA 1MAJA 1MJJB 2J8UB 4OZFH 1T5XA 1I1AB 3QUZD 3HI1B 3AS2A 4B7LA 4X6FA 4HUWA 1E4JA 3VGFA 4G8GD 4ODVH 1HINL 4J12A 5F96H 3MMEA 2EDFA 5E03A 4ACPA 3MJ8B 2JK5A 1P5UA 3E6FA 4KGLA 2P24B 1F4AA 1J0KA 4ZPVA 5GS0L 2IPKB 3C6SB 3QCUL 4F15B 2HT2D 4N68A 4QEGA 4DN3H 5HVHB 3O3EB 4JN1H 3U0TB 4U1KA 1CFQB 3HAEB 1IZKA 2NYYC 1DFBL 2ZCLL 1KPVB 3H42H 3QEGH 2BC4B 1J5OL 1AQKH 1CFBA 2VDKL 3CK0L 4TOYL 2DLTA 4LNVA 1FORL 4OZIA 5EB9A 1MHCB 5KSBA 5HI5D 3QNYB 4Y2DC 5IQ7H 3H9HA 4J1UA 2CDFA 1OAUL 4PFEA 1X5AA 3K2UL 3ZYOA 4ZFOB 3GJFA 2IQAB 3MRQB 3TPUB 1G84A 4NO0A 1MI5A 3FOLB 5CBEA 3DX6B 1FZMA 3JV6A 3HRPA 3RP1A 1P2CB 4Y19A 5BMFL 1F45A 3CFDB 4ZTPH 5HPMB 1B0RB 1EMTL 1NQBA 3X3GH 2EDOA 5D1ZC 3D18B 2B0SL 3BPCA 3EOYG 1F6LL 5D7KD 3OZ9L 2JJVA 2G5RA 2JF1A 4I9WD 1G7PB 1YEKH 4M7JL 1TXKA 3SE3A 4LVEA 1CGTA 2APWA 1K2DB 2X4QA 2M8XA 2BRRH 2X5PA 3CVHB 1XAUA 5BZWB 4D94A 3PQYA 3C5ZC 4OGXL 1BFSA 4JB9L 3VXPA 2OZ4L 3MYJB 4AT6B 2KDGA 2NLJB 3GMQA 1NMCC 1ZGLM 2IBBA 3BQUA 4LCCA 1XZ0B 1BBDH 4WEBL 1VFBB 3KYMB 1WTGT 1N0LA 4O2CB 3RVVC 3NPSB 1OARL 2D2OA 4ZSOE 3B9KA 5TFSH 2L7UA 1KJ2L 5IGXH 5EZOH 1QSVA 1QFWI 2RFXA 1ED3B 1CXHA 4NZTL 2APVA 2P8MB 1I8LA 5DRXA 7FABH 2X1QA 5ENWA 2BOCA 4K71B 4FXGA 3BO8B 3D3VD 1OY3B 4Y5YC 2GSIA 3G5ZB 4LHUD 1N5AB 5DJ8B 1XGQB 5JIHA 3K81A 1R24B 3CC5A 4GQ9H 1GCFA 3W2DH 3BRDA 4M7LT 3QT2A 2G9HB 4ODWA 2R0LH 4P23D 4V1DE 1LE9A 1P4IL 4XNZC 2J12B 5GJTH 2NNAA 5KSAC 3DGCR 5EUOF 4HKXB 1TZHB 3LD8C 4OCMC 3IFPB 4F57H 2H2PD 2R2BA 3ALXA 5TF1L 3MBEB 4L8SC 4KJWD 1IM9A 4TSCH 5IW1A 1FL5B 5IR1A 3PGCB 4LSPH 2VLJA 3MLYL 4TULL 4L29A 4ZUSA 4LVHC 3VE0A 5ID0A 3S4SA 3FQRB 1B88A 5CZVH 4F7EA 4PY8I 5AZEL 4XBPB 5K93A 3STZA 3WFHA 2XN9B 2BHZA 3T2PA 5FO9B 3SE4C 1OB1B 1YJDH 4BZYA 3QJHA 3VXRB 4YGVA 2AV1B 3KJ6L 1NH6A 2ADFH 4PB9L 4DKEH 1B0GB 5HYSB 5GZND 1CDGA 4RZCA 4HW6A 1LEGB 2CLRB 2B8OT 1CN4A 4PRAB 4P3CL 4DUVA 1Q0XH 5DFTA 4UTBL 5HJ3A 5KVFL 1T04A 4HIXL 1X5ZA 4OM0L 3RU8L 2R23A 2OJEB 4G8GE 3T0EE 4AENB 2P5WE 2QQQA 4JFOA 3C2AH 1H3GA 1BWMA 1RJYB 3WXVL 3G5XB 4HFUH 3U4EB 2DN7A 1KTLA 1J05A 3GK8L 1QBLL 1QSFA 4D9QD 3ARRA 4PGZA 4YHKH 4MJ2A 3MRJA 4ZAKB 3VFTA 2VIRA 2YC1B 3TFKD 2AJZA 1VKXA 3K80A 3HMXH 1FVEA 2IADB 4HLZH 4GAJL 3QNZA 2ZOLA 4NQDB 4CVXB 1CLOH 5SX4I 5ETUB 2UY6A 4PG9B 4OI8A 2C9AA 4YAQB 2NXZD 1S7VA 2B4CL 3UTPD 2B20A 2X4OB 2EEAA 4L3CB 1JJUA 2BVPA 4PIRF 4U1HA 5C0IB 4HWEH 1N7ML 3P30H 5I1EH 5CIPA 2G60H 1WAAA 5E0QA 4M48H 3WHXA 1VESA 4PRPB 4YXKH 3TBSB 4MDIB 3MROA 1ULVA 4ODUA 5IQ9A 5I6XB 4ZO7A 3T2QA 1CGSL 3EYSH 2I9TB 2EC9T 4PJAE 4CMHB 4MB5A 1CICA 1YNLL 4NWTL 1A6WL 3T77A 2VLMD 5JHDE 1G9ML 4WW2B 2FX9L 1UM6L 1D5BA 4QXUH 3TVMB 3RWHB 1AE6H 5IB1B 1I1YA 3VFWA 1R3KA 3SDDA 2P5ED 2OMBA 3G6JA 4OCRL 4P2OC 4QRPD 2B5IC 2LV4A 2K9UA 2OK0H 4IEFB 2X44D 4UTAH 1ES0A 4G8IB 1HOCA 1S8DA 4WUUA 1GGCL 1E28B 1YYML 4OD3H 2XFXA 2Q87A 5L2KA 4LLUA 4BH8A 5F7KC 3D0VB 4OCSL 3IRPX 4M8QB 1QACA 1OTTD 2AERT 4NZJA 2DQJH 5F8R