3FFDB

Structure of parathyroid hormone-related protein complexed to a neutralizing monoclonal antibody
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKYVMDLKQDGSHSTGDGIPDRFSGSSSGADRYLSISNIQPEDEAMYICGVGDTIKEQFVYVFGGGTKVTVLGEPKSTPTLTVFPPSSEELKENKATLVCLISNFSPSGVTVAWKANGTPITQGVDTSNPTKEGNKFMASSFLHLTSDQWRSHNSFTCQVTHEGDTVEKSLSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for antibody discrimination between two hormones that recognize the parathyroid hormone receptor
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hormone
molecule keywords Monoclonal antibody, heavy chain, Fab fragment
total genus 48
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ffdB01
1SEQL 3G6AA 4FQPA 3GMRB 2MHAB 4JZNB 4JO4H 2HJFA 1T1WA 2CR6A 3MLXL 4NFDA 3TBSA 5CFHA 3LKPA 4M7ZB 3EKCA 1AXSB 3MA7B 3LRGA 1OB1B 5IBLC 3VFUA 5C0ND 4UOW0 3T1WA 5E08L 4A2LA 4OZFB 3LV3B 4H8WH 4PJ7E 4OF3A 1MFAH 4GRLC 1U8MB 1NBZB 1G6RH 2XTJD 5F3HA 3QI9A 4OZIE 2DWDA 5KS9B 3EYUL 3FO1B 4U0RB 4WY7H 1INQB 1RULH 2IALA 5IVXB 4UOW1 4L4VB 2ICEB 5GRYA 2E6PA 5JOEA 5H8DA 3S36X 5J13B 2VDOH 3QNYB 5J3HD 4YC2B 4K3DH 4X6DE 4QHKJ 2IANE 5DD5H 1A22B 1OWRM 5DWUL 1NEUA 1REIA 2VQTA 4MDJA 4Q58C 2Y36H 1P5VA 2G5BA 1CT8B 4WFHD 3FB7B 4I0PA 4N1CA 4NC1E 1ZHKA 5I30L 4HS3B 4P2OD 1F8TH 4JFDD 4XP4H 1GZQA 1DBBH 3LRSB 1T03H 5HHOE 1M6OB 2VC2H 4ZQKB 4ZXBA 4MXVF 4NP4H 3SDCA 3PWVB 1HH9A 1G7HA 5FIEA 3MJGX 1S78C 3ARPA 5K33A 4YHOH 5F70A 2GT9A 3RL1A 2G75A 3NCFB 1AJ7L 4F9PC 5H35A 3GHEL 3TBSB 4HUUB 3GHEH 2EC9U 5EOCL 5EWIL 2PYEB 2OZ4A 3IU4L 1B6UA 4KGJA 3ZE0E 3ARED 4R4FH 1NCTA 5DD1H 1NUFA 3BN9C 3P40A 12E8L 4IOFD 1CFVH 4QRRB 3TIDA 4KTDH 4KROD 4C57C 1ND0B 3IXTB 5KW9L 3TZVC 1NDGA 3HTLX 3VI4F 4Y4KA 2ENSA 4LVHB 3EW3B 5C6TH 2EXYC 3D18B 3OF6A 4F3FA 4XGZA 5CSBA 1FVDA 4TTDD 5JIPA 4RAHA 3L5WA 4PJ5E 4R8WH 1ZHBB 1FAIL 5DJYA 2HLFC 4RISH 5F7FA 3GSVB 4TUJA 1ZOXA 3O3EA 1HHGB 4OCMC 3TPUB 3MQIA 2NYYC 4JFDA 3IFLL 5BRZB 3TO4D 4NQCD 2FHFA 4P2QA 1JYVA 1YN7A 3NABH 4EUPA 2X7LB 4A6YL 4GG6F 5DK0A 4D9RE 2AEQH 1T22B 4XCNA 1EEYB 4HFUH 2IH1A 3RNQB 5FM5O 1PKQB 1KJ3L 2ZPKL 4G8IB 3O8XB 3T4YA 2E5EA 1BZQK 2G75B 1X7QB 3BUYB 4HKZB 1MVUB 1U92A 3QPQC 3RVUC 4HJJH 2FATL 4CW1B 3O0RL 4MQTB 1CFNB 2IPTH 4KRLB 2YMXH 1EO8H 1H15B 3GJFB 4O2FA 4Z95L 2VLMD 3GGWB 1I3VA 3VXQB 4YFDB 2GQHA 4L1DA 3DUUA 5IEKA 4YE4H 3MLVH 5F7LB 5D7LE 1G9NL 1K2DB 5E99L 4DFIA 1Q94B 2AP2A 1F2QA 2IBZX 1WZLA 3WNLA 1C1EL 5LCVH 5CILH 1IM9A 3MUGA 4KDTA 5ECJE 1SM3H 4NBYB 3EOTL 1S7QB 3KPRD 5HI4C 2KH2B 2NY6D 4LCUA 4MAUL 5DJAA 2VTFA 5CJQL 3HI6L 4M7KL 4WU7A 5FCUH 1NCNA 1CGWA 5FHBH 3ULUL 4LLYB 5D71L 2YSSA 4ZSOB 3K2UH 3VDBA 2VLKB 1LILA 5J1SC 3I6KA 3QEHA 1UB6B 5D7IF 4MD5B 2X40A 3QISA 3I3BA 1KEGL 4U6VL 2HJLB 4EQ3A 1BEYH 1HIMH 4UTAH 2NY6C 3H9SD 1IKFL 1CXIA 3WYRA 1RMFL 3RL1B 4WY7L 3HS0B 2BSSB 5GJTL 5L2KD 2R0ZL 3MNWB 1MIEH 4U6YB 3KYNB 1I1AB 1OTUD 3FL7A 9CGTA 3SPVB 5JPNA 3BI9X 4K7PX 1I1YA 5AYQA 3ULVC 4AEHH 1BQUA 2IPUK 2DL2A 2C3GA 4XNYH 1VESA 2FX9L 3ZKMD 5D4QA 4L4TB 1XEDA 4XC1L 1HQ4A 3SE8L 4J3UA 3W11C 5JMOC 4LCUB 4XGZB 2P42B 2E7CA 2BERA 5E8EB 3TN0A 5DFVD 4HFWB 4KJYB 1EJ6A 4M00A 1AGFA 2VDMH 3VXUD 2GJ6B 3C2AL 5DA0B 3QUYB 5AD0A 4XC3H 1OF2A 3WXWL 3SQOL 1G1CA 3GJEB 3GMLA 3KPNA 1HXYA 3TO4C 5E2JA 3DETD 3MRMB 1BOGA 1FN4A 3CVHL 3QEHB 2WLZA 4MJ6B 1EEUA 5IBTL 4JFHD 5B38B 4G8FB 2K3TA 4JM2B 4HZAA 2ED9A 3S88L 3MYJA 5ABDE 3FFDA 3VXTB 4JY6B 1BGXH 5IQ7L 1ZE3C 4YR6A 3QUXA 3K8KA 1OAYL 1YYLL 1Q38A 1JGDB 2JJSA 2VR4A 4OD3L 4OZGF 3QCUL 5FOBB 3OGCA 5BV7H 1AKJD 4PRNB 5ID1A 3HZVA 2LU3A 3BW9A 4BZ2H 2R9HD 1MHCA 2BJML 3TGXA 4OBSA 5SWSB 3CFDB 3HMWH 4JPKH 3L5XH 1NGXB 5BS0B 3F65A 2VLRA 4E5XA 4Y4HB 4G43B 3D85A 3QUZC 3VA2C 4K2UL 1A2YA 1M1SA 1I4FA 4PJAE 3QHTC 3CSBA 4MA7L 3LKQA 5JIIA 5EZOL 3UJTL 3ROLB 2HG5A 4Y19D 5CIPB 1TIUA 4LLAA 1RZJH 2D0FA 1A5FL 3CK0L 1GIGH 4NJAL 1KBGL 5D1QD 5E8EA 3VRIB 4HQQL 1S7QA 1QACA 2NTSP 4F58L 5MERB 5FV1L 5EBWB 4RFOH 4KRPC 3FO0H 4BZYA 4LU5H 2ZG1A 3UJJL 5ALCL 4I3RL 4YPJA 4G9DB 1HHHB 2IANA 2PTUA 1OF2B 5EB9A 5I1GH 3KPTA 3QXDA 1I8IA 3MV7E 3TH4T 3SCMD 4Y4KC 3DV6A 2N7AA 4LLMB 5IQ7H 2XWJA 4FXLA 3I6KB 4NWUH 1J87A 1XCQB 1FNSL 1EFQA 1MJ7H 2CK0H 4QHLB 4M6OL 1J1XH 5FYLE 4OLZL 3SGDI 1V7ML 4Z7UB 5IF0A 3JTTA 4NWTL 4ODUA 3UMTA 2Q8BL 5CUSH 1MIML 3RAJH 3WFDL 1SMAA 4XVTH 2Q76B 2VLJD 1Z9LA 1MJUL 3PXHA 3EFDH 3DXAE 2J88L 5IG7B 1OAQL 5FUCE 3HUJE 5D7KE 1QBMH 4DKAA 4LDLB 1CDUA 2P5EB 3QRGH 1F4YH 1A2YB 4XHQA 5EZOH 2QTEA 3B3IA 4M7KH 1QLRA 2XA8H 5CJXC 5HHMB 4B50A 4NM8H 3LKQB 4L3AA 1IAKA 2GJ6D 5HYSB 4Y5XC 43CAB 4NQSA 5DQDH 2AKRA 3EO0A 1TZIB 3P4LA 3TZVB 5HD8C 3BAEH 2JE8A 5BRZE 3FFCE 4NZUH 4ZAKC 3EYFB 1BZ9A 1IGJA 3VXUE 4N9GA 4CVXA 2XQYK 4NT6B 4G3YH 4PRHD 2B4CL 4HT1H 1AGFB 2CLRA 4LVOC 1FNSH 3FAWA 4R90L 5BZWA 3T4AA 3LQZB 4HUWB 2DQIL 1GGTA 1OAYH 4QOKE 1OCWH 1JWSA 3BIAX 5DMYA 3BD4A 2UZXB 3KPNB 3GJEA 3GMLB 3P0YL 1S7VB 4HH8A 3OAUL 4QY8A 5D7LA 3BEVA 4KI1A 2LU4A 2YWZA 4WDIA 4Z7WA 2FATH 3MLWH 2GHWB 2WMPA 5CD3A 1CFTA 3DO7A 1PZ5B 2FLBT 3FOMB 1WIOA 3SE4C 1DP0A 5L8LB 3GBLA 2MSPA 3PWLB 3BPNC 3VG0L 3THML 1I8KB 4IMLB 1T80A 4NO5A 2EDKA 3WKNA 3BW9B 4M1GH 4NOBA 3FRPA 5EUOE 4D9QD 4M6NL 2Q3ZA 5E5UB 3TIEB 3WUZA 5C0FB 4LLUA 3BESR 3SJVD 2MNUA 1JGLL 4LSUL 1ZLUK 1KJ2H 1JYXA 2DQGL 2Z8VC 4U6TA 1A3LH 3CFIC 3RUGF 5IB4A 3MNVB 5E6IB 3BZEB 3U6RB 3WFEL 4MNGE 1TMCB 3IDJB 4M8VA 1A1NA 4Z7VA 4HK0B 1WBZB 4Z6AT 3KPPB 1A9BA 3D6GA 4X6BA 1YC7A 2W60B 4M6OH 3MLWL 2FEDC 4M93C 3VG9C 5H94B 1NC4B 4OLEA 2G60H 1CGSH 3UXFA 5FUZH 1Z3GL 3MOBH 3WS3A 4PJGF 3WV0A 4PJDF 1YNTB 2YS4A 3LH2H 4U1JA 3WHE1 2FO4B 1D5BA 2A9MH 4YDVB 3PL6A 4X6FB 4XPFH 1CXEA 5F1KC 2P8LA 1Q9WA 4OT1H 5I1LA 4QRSB 1IAIL 2FGWL 3BIBX 5F7MC 2VLKD 5HVHB 4FFYL 4XBEH 2XZQH 4LVOB 3FB8B 4PTTB 5EN2A 5GZOD 2GAZB 3N1QC 4P2QD 4RISL 3W5NA 5F7WC 25C8L 4P4KA 5IG7A 1RZFH 4YDIL 5F9JB 3RU8H 3HI1B 4BZ1L 2ZUXA 1T83A 5ISZA 3L3HB 2HWZH 2OTPA 1YN6B 5DHVH 1N6QH 2UWEE 2AERT 3P0GB 1N6QL 2Z92B 2JKXA 5TDNA 5GPRA 2FR4A 1NFDF 3CVHB 5CSZA 4G5ZH 3MRIA 3VFRB 4J23A 4O9HL 3QDMA 5BQ7B 5F7DA 3SDXB 4HIEA 3OAUH 1TPXB 3QZWB 3MV8D 4NBZB 2IPUG 4JVPA 3ULVF 3VGEA 3CZJA 3KPRE 1IGJB 2WIMA 1RULL 3RWHB 4NO3A 5EOTA 5ELIA 2P43B 4OLXH 1A7NH 5GS0H 4HJJL 4Z7OE 2D03L 5HDQL 3MRKB 4ZPTB 2A74A 4W6WB 4QNPE 1ROWA 1N3NB 3PNWB 3FT3B 3O9WB 1DUYA 2WLYA 1N5AA 4PRHB 3BEVB 4Z7WB 2I5YH 1XGRB 1JNNL 5DR5L 5DJCA 1PZ5A 2VL5A 5D96B 5HYJA 5I66B 3DLQR 3GBNH 3KYAA 1U9KA 1RHHB 5CJBA 3FB5A 2H9GB 1INEL 3CLFL 5J6GA 1TQBC 5I15H 4NM4L 4CMHC 2BOCA 4JPWH 1HXMA 2YD6A 4GMSL 2VDLH 2SEBB 2VAJA 3KS0H 2AK4A 4S2SB 1UACH 1YY8B 4UT9H 2OQJA 4M61B 3KHOA 4Z7NE 2P5WD 4JG1H 5B3NA 3G6DL 1J1XL 2GUOB 3S97C 3RZCB 4WVRA 4J2XA 2AJVL 1LK3H 4F7CA 4JVUA 2RJMA 4M48L 3REWA 5B4MC 5DT1H 3HC4L 4AEFA 3T65B 4EN3C 3X3FH 4OIBA 1JRHH 1SJVA 1ZHNB 4Y19B 4ACPA 1S7SA 3HAEB 4IOIA 4JKMA 1P7QD 2ATKB 5MI0B 1WC7A 1FYHB 4ETQB 4WFGD 4L8DA 2VITA 5KSUA 2DDQH 1T2QL 2V9QA 2GJ6E 2D7TL 4ZPTA 4U6HA 4ZD3L 2QKIB 2YPLD 5JHDB 3O9WA 5ADPL 5CS7A 2OP4L 4PBVC 3SKOA 1U41A 4YXHH 3HZMB 1RZFL 1KPVA 2WBJB 3MR9B 3OV6A 1KCRH 4GG8A 3O2DA 3PL6B 5J8OA 1F58L 1HSAB 1G0YR 5T1DL 1KJMB 5A2FA 3QNYA 4GMSH 4NGHH 2XFXA 2IFFH 1FJ1B 3PQYD 1A64A 1D5ZB 1PW3A 2YR3A 4FQ2L 5JXAH 3CC5A 4JPVH 4IRSC 4Q6IA 4JPVL 3C6SB 5EOQH 1DQLH 3TPUA 2Z8WC 4OQTL 3U9UB 4ZO7A 5BRZA 3VWKA 1T4KA 1UQSB 1JNHB 3H3PL 2XKSA 2YKLH 3H7LA 5JLZB 3EFFA 4UQ3A 4XCNB 4RFEB 5SWZB 5DZOA 2VOTA 3RZCA 3AREB 2RCSH 5JW5A 4JDZA 5B22A 1J12A 3AGVA 1I3GL 1NC2A 4JHWL 3R4DA 4Q2ZB 1U3HD 5E2VH 1U8KB 4H0IA 3QXTA 1H9VA 3DGCR 1P6AB 4NFBA 1OAXL 3WDIA 5DRXB 5EA0H 1QSFB 1SBBA 2R0WL 2OL3L 5EPMA 3AS1A 3IXAB 5BVJB 3QO0B 4OZFH 1VEPA 4Q9RL 4JFYA 5HDBE 1HE7A 5DJ8A 3C09C 3MXWH 5C0AA 4TOYL 5LQBH 2HFEB 3MRCA 3BISA 5DXWA 2B2XH 1GGUA 4KDWA 2VDLL 2BVQB 4TVPH 3BYYA 4EQ2A 1NGZA 3MBXH 3O2VL 3IJSA 5CEZH 3ARDC 4P46B 4KY1H 3SOBL 5E2UH 2X89A 1LVEA 5C8JA 1BAFL 1UH4A 5IOPB 2VLJB 1A6WH 4X99B 2DTMH 1T21A 2FIKA 4HLJA 3MCKB 3TF7C 4XB7A 2FB4L 3G5VA 3WEXA 4L8SA 3HMXL 1AR1D 1T5XB 3CFBA 5TE7L 1W8OA 5ESAB 1HHGA 4MX7A 4ONFH 2BRRH 2AXGA 3SO5A 5C1MB 2CJUH 3D0LB 1AQDA 2DQUH 4LSRL 3MNZA 4M43H 1GPOH 1PEWA 1MFNA 3C5ZC 2HKFL 4XPFL 3BKML 3T3PE 1A6PA 1AHWA 1T22A 3V0WL 2A6JB 2AXFB 1WQVT 3HE6A 4N0UB 5IWLC 1TXKA 1U6AH 3F58H 1NMAH 4S1RH 1OAZH 2AJYL 3QFJA 3L3IB 4HCRL 5A43C 1Y6KR 1JV5A 1ETZA 1HILA 4UT7H 3RPIB 4MWFB 5MEOB 5T1KA 1MQKL 5DT1L 1I1AC 1OGAD 3CDGA 4KRNA 4H25A 4JANB 4JPIB 3GJFA 4O2FB 3ILQC 4NUGL 4JFYB 3L95A 3CUPA 4EI5C 3NACL 5B4MD 3G6JA 3S3PA 5KVGL 5IEKB 1F4YL 2EEAA 5CP3H 2CKBB 1AD0B 5SWSE 3IAGC 4KXZI 2FWOB 5C92A 3AU1B 3QIWA 5C07B 1BAFH 3SQOH 1RFDL 4TQEH 2Z31A 5D70L 4Y4FA 1X44A 4WU5B 4N8CL 1D5ZA 4XBGB 5D2NE 4MQ7B 4M3JA 4JN1L 2AK1H 2VSCA 4MS8C 1FVCA 1NBYA 1K4CA 2QSQA 3PWUA 2MCPH 4LRNL 2ZCKL 1QBBA 3WCYA 3ZKQD 2FECL 5BMFH 4RZCA 3MROB 4QRPB 5L88L 2AJYH 5DJDA 3RVXD 1KCKA 4P2RB 1OP5K 3O3AB 1TVHB 1I8MA 1KOAA 2OSLA 3CSYA 3T77A 5F7HA 4RFEA 5SWZA 3EYOB 3TYFB 3VFWA 2YUXA 3QFJD 4E42A 4OZFG 1E4JA 5HDQH 5IW6A 1EBPA 3LQAC 5BV7B 4KKCC 2XZZA 4J3VA 1HILB 2AI0L 4S1DC 2MKWA 4OI9A 3MNWA 4OUOA 1C5CH 1QSFA 4KRMB 5A2JH 3D85B 3KHQA 4PRPA 4PGJA 1ZHLB 2DQJH 1I4FB 1IEBB 5DUBA 3WBDA 4X6DB 3IDNA 3ROLA 5FYJH 1INEH 1IGCL 1MCLA 2NY0B 2IPKA 3QUML 4J1UB 5SX4I 2B0SL 1CD1A 3ZHDA 5KVDL 1LDPL 2WINA 2VN7A 2A73B 2HTLD 1T21B 5C9KA 3H9SB 4KV5E 3P9MB 4R3SB 4PJXF 1VFAB 5DTFA 4Z8FL 1AR1C 1I7TB 1R5VA 1NCCH 1V3JA 1YYML 2VXSH 2BNQB 4YGAB 1CGSL 5E99H 4F33B 5HYJE 3QIBB 3S36L 3T77B 3KPSD 3HLAA 5DJ0B 1XF1A 4DVBA 1YYLH 4U1LA 2QBWA 1CDIA 1VACB 4FQXA 1IGML 2IQAB 2UUDH 4LBEA 5FUOL 1AGCB 2VAAA 5CP3A 1X5GA 4BK4A 4PJ5D 5TE4H 1A3RL 1UCTA 3OJDA 1QRNB 2V7HA 3B9VA 3VXRE 5LAXB 2DYPA 3AAZB 5INDB 1ETZB 3LS5L 2V5MA 4X7SH 1QSFD 3GSUA 3QQ4A 2V7NB 1PVHA 4KKCD 3FZUD 1QPPA 5L2JA 3M1BA 4R9HA 3M45A 4LLWA 5I76A 1YUHB 3C5ZA 3MRHA 4N68A 4NGHL 4AT6A 1MRDL 4POZC 3FB6A 1KLGB 3C8DA 2BVEA 4WTWA 4YO0A 3BSZL 4P9ML 5C2BH 1KB9J 3QQ3B 4L5FH 1R5WB 1MVFA 2ICES 4PRAA 4AG4H 1PX3A 2Z31B 3PF2A 1X5LA 3G5XA 3QQNA 4ZOCA 5HHNB 1CLOH 4HAGA 1GC1L 3CFCL 3K81A 4PV9B 3LEVH 4X80H 2BOBA 5JXEC 2R4RL 1V3LA 1URLA 1FVCB 1NBYB 3W2DL 1WBYB 4KJQC 4HUVA 2PYED 3EZ8A 4HIJA 3PWUB 4WWKD 2D03H 2MHAA 4HXBL 1MCWM 2O26U 4X7TB 4M7LT 5HGHB 4OB5L 4DUWA 5FYLH 4LRNH 1I3RA 2BVTA 3HZKB 3LVEA 4JRXB 1HSBA 4U6VH 2H2SD 3HB3D 1NANI 5IV2A 1A6WL 4O51B 4TVPE 3BPLB 5IKCA 3GKZA 4PRBA 4ZUTA 1DBMH 3MV9B 4XC3L 3QEQA 3RQ3A 4YHPB 1DEDA 4X6EB 1MCPH 3L5HA 2DWDB 3QNXB 2E9BA 1NCDH 2EDTA 3CLFH 1A7QH 3WD5H 4O2EA 4UB0L 4XXCA 3O2WL 3I02A 2DRUA 2X1PA 2DYPD 2C4FU 4LL9A 1WISA 3GBML 3FTGA 3TWCH 4GG6A 2X05A 5J12C 3B2VL 4WO4C 3RZCC 1KV3A 1Y0LB 4NBXB 2HYMA 3FQTB 2CGRL 43CAA 3NCMA 5ACLA 4EOWL 1D5MB 1R5WA 3S96A 3FB7A 3MLRH 1JVKA 3L3DB 3IDJA 1J5OL 1ZANL 3QO1A 4BZ2L 1G7PB 3FKUS 4RGNB 1S9WB 3L9RA 1CGXA 4HIHB 5I6XC 3V6ZB 3RWEB 3O6ML 1MY7A 5K9QG 1LO0H 5D7IE 4ZQKA 4WWKA 3U48A 3ZDZF 4V2CB 1BLNA 3P9MA 3HAEH 1JWSB 1RV6X 1UJ3A 3ULVH 4UUJA 2X70A 4HCRH 3OBAA 5E4IA 2CLVB 2CRYA 4Y5YA 1WZ1H 4GKNA 3OG4B 1C16A 5HYQB 3B5TA 5IHUL 1ZTXL 4FQIH 3KXFB 5E8OA 3ARSA 1LQSR 5K9QI 1KELL 3WDJA 4FG6C 4L8SC 3SGDH 4KZEH 2JIXB 5CINH 3TVMB 1MCBA 4LSRH 3HI6H 1KFAH 2YN5A 5IVXE 1IQDA 5GS3A 4HZLA 1JWUA 1UYWL 3NAAH 3D85D 4LEOB 4KKAD 4KKBC 4P5TA 1YN6A 2CO6B 5JHDD 4HIIB 1CI5A 5EUKA 4I0PD 1RZKH 4UQ2A 3NVQA 1B0GB 3DHJA 1KLGA 4K7FA 3GSVA 3VE0B 3P9LB 4OZIF 3MLSH 3SEPA 2HN7B 2EDWA 5ANMB 3ZT6A 5ITBL 5LWYH 3VFVB 5L0QB 3NMEA 3F7YB 4PRIA 3IU4H 5IMKA 1T89A 1T1WB 1TPXC 2G60L 3SDCD 4KVNL 4PP1D 1F6AA 1I3GH 4UNUA 1WBZA 2H2PD 2H45A 3QDJB 3CPLB 4JO1H 5FO9B 2WM0A 3LKRA 3BT2L 1V5JA 4PV9A 3QULB 4FXKA 2EH7H 5D1ZC 3FOLB 4IOSD 3TA3B 5D72L 4LARH 5H94A 3RNQA 2P45B 1WCBB 3SCMA 1E6JH 3LB6C 4UUJB 5TDPB 4HKZA 3UJIH 3VGBA 5JIKA 4X7TA 2R56H 4KKAC 1IZJA 1UGNA 2VXVH 4XVJL 5EUOB 2DD8L 5EO0A 4POUB 3QIUA 5T3ZD 2EDEA 1X9QA 2Y36L 2CRMA 5E8OB 1CFQA 3T2NL 4OSUL 4N5EC 2AK4E 4FG6D 1A7PH 3S4SB 2ESVB 4HWEH 3QH3A 1H3GA 2VDML 1B2WL 3VXUA 3QG7L 1NC4D 4GRWF 1IQDB 3O4OC 3FQXA 3QNXA 4QRRD 1NCWL 5BJTA 3HE7D 3DUHA 3TN0C 2OXHA 4EUPH 2AJXH 2VIRA 4QRUB 1LDSA 4TSBL 4WW2A 1QA9A 2C5DC 4PRPD 4URTB 1QFPA 1DBKL 3P9LA 1K4DA 1H5BC 5C9JB 4U4BA 4OV6F 4P9HL 2YEZB 2Z93B 1OSZB 2D0HA 3OHXA 1LE5B 4HDIA 1U3JA 5DUMH 3S7GA 1F6AB 4TUKH 4R90H 3AY4A 3ZHLA 1UB6A 1R3LA 1F4HA 2QL1A 4B7LA 5KJRL 1PD6A 3OKDB 5HTSA 5CEXA 1MWAH 3KXFD 3BX7C 3IXTA 4CJ0A 3N85L 5JDJA 3RGHA 4OQTA 1IGYA 1T03L 1A4JA 1S9XA 5FOJA 1BJ1J 1KJMA 3WJLC 3ZKND 2JJWA 5HYQA 4OF5A 3IT8D 4YFLI 2OZ4H 2X5PA 3DV4B 5F9OL 3NIFE 3FCTA 2CKNA 5DJYB 4CUCA 4XPAL 3GSNL 2H9GA 3TVMA 3GSNH 4G9FD 2CDEB 2K7PA 3U9UA 1IC4H 4HK3N 5IFHL 3EOBA 4RDQF 5E2VL 5ACMA 3IFOA 1TJIH 4UTBL 2X7LA 4KJQD 5I73C 3GMMA 3TBYB 3WIHL 1KJ2A 3A0OA 2HVJB 1CICC 2BY2A 3OKNA 4FQHA 2UUDK 3L7FA 3GRWL 3MOQA 4UIKL 4GUPB 1XGUB 2EE2A 1DE4B 5HGDB 1QLEL 4K8RD 2DWEB 4U1HB 3TH2T 1WC7B 5LJYH 4JFEE 1I1YB 3ULUE 1WV7T 2DJ4A 4PTUA 4QCIB 2X4SA 3WE6A 5HGBB 1WZMA 4YWGL 1KFAL 3C09B 5SWSD 4JVWA 1FBIH 1NFKA 2QV2A 3HB3C 3BXNA 3EOYG 2ZOLA 3HZVB 3EYQC 3BVNB 4M6AA 4OLYL 3SGKC 5EBLB 4IMKC 5GZNC 1F42A 5A2IH 5EOQL 3QIUC 5HHOB 5FYKE 1OTTC 2CDGA 4LOUD 3QUKB 5DWUH 3OKYA 1FO0L 1G9MC 2JELH 2XQBH 1QR1A 2AJ3B 4V1DA 5DMKB 3TFKC 1DUZA 3EHBD 3ROOB 5FYJD 4XP9H 3STBA 4HCRA 1NLBL 2HFFB 2PW2A 4KK5C 5FK9A 3MRMA 4MNHA 4LLYA 5BJTB 4UZGA 1IBGL 3Q3GB 3QYCA 1LD9B 4OI8A 3DVGB 4JB9H 4I2XE 1VSCA 5JLZA 3PGDA 2VR5A 1U3HA 3QA3B 4PJXA 5ILTH 3BGFC 1QRKA 3E2HB 4MD5A 3VGDA 4G6ML 3GMPA 1PG7L 2AGJL 3PG2A 5FECA 4YBQC 4MJ2A 3VD5A 3MOAL 5KZCB 3TBWB 5KN5B 4NKDB 4WUUE 5KVEH 1AE6H 3R0MA 1BP3B 5F96H 1I7RB 3MA9L 1S7WA 5TDOA 2GK2A 5C0CD 1GGIL 5MEOA 5DUPH 1OQXA 4G8EA 3QWOB 2F58L 4WI4A 4NCC2 4MJIA 1R24A 4QHLA 3D39B 5IW1A 4DQOH 4QCIA 1UVQA 1DL7H 5T1LB 5JW4N 5E0QA 1N6UA 3RY5A 1W2KT 2OK0L 1SBSL 3F7RA 3VU2A 5HI3D 1LO4H 1OT2A 1VB9A 2QADC 4WUUB 1AIFA 1F8TL 3UTSA 5BVPH 1KXQE 4L4VD 3UCRA 2XXCB 4I0KA 5EBWA 4N5UA 3QCVL 1IEHA 5GRJH 4NNPL 1CDBA 2OTUB 4GH7B 4KKLC 2D7TH 3QFDB 4X83A 5ETUA 5IJVA 1VCAA 1NUNB 2R0ZH 3RL2A 1P84K 1HEZB 2W07A 3R1GH 5KVFH 1CU4L 3G04B 4OCYL 4MX7B 1FPTL 4Y5YC 3HNTL 4I18A 1NAKL 1N8ZA 2EXWC 4PJ5A 3IJHA 5F7YC 4NQDB 3IFOB 3QDGE 4MJ6A 2Q8AL 4N90D 3BPLC 3OTTA 1IC5L 3CNKA 4UI2A 5E00B 3GMMB 3TBYA 5E4EC 1MI5B 1J86A 2XXMB 4AEIL 5D6DC 4NN6B 3ULUC 1A9EB 1GYAA 4JG0H 2QSVA 2DQTL 2GEEA 1DE4A 5JPMA 4OAWA 2W9EH 2BSRA 3FHQA 2WW8A 1N7ML 1ZS8A 4YBHA 3NN8B 1A02N 1HZHL 2OLDA 3VGFA 3WFCH 1WK0A 1QLFB 1KPUA 4JO3H 1QO3A 2AABL 5BVPL 3PGFL 5F9DC 4D94A 3ARGC 1AIFB 2FWOA 4IRZH 1WJ3A 3ZTJG 4J1UA 1NKRA 2F9BT 5I74B 4PJHE 4OLWL 3S35H 3U7WH 1YECL 1RJLA 5FGRA 1EDQA 6CGTA 3O4LA 1D6EA 4X9HA 2LTQC 3HPJA 2FL5A 2OTUA 1ODAA 2J6EL 2X4QB 3RL2B 3DYMA 4KHXL 4XPBL 4M7LL 3U0PA 1G9EA 4HXBH 4JQIL 4EJ1C 1R3IL 3OPZL 3UBXG 1MHHB 3MJ9H 1JE6A 4YZFE 4Z0XA 3QUYD 3V52H 4K9EL 4WJ5A 5J4MA 1M05B 3H42H 1BJ1H 3B8YA 5CD3B 1BM3L 1LD9A 5J1AA 1OB1A 5IGXL 4X7CC 3FOMA 3NIDE 3U30C 1K85A 1HOCB 3ALXA 4P2OA 4JFPB 3LV3A 3MCLL 4L3CA 1TETH 1S9VB 1SJEA 4NNXB 4H20H 4ODUB 5DJ2B 1NBZA 2CH8A 2BMKA 5IUSA 1ERNA 1I7RA 1AGEB 1D5BB 1BD2E 4J3OC 3OAZH 3NCYS 5HI3C 2FX7H 4TSBH 2ED7A 4JFDE 2XRAL 5I76B 1FNHA 2FBJL 4NQXA 1PSKH 1FO0H 3MRDA 1PYWA 1LO2L 3E3QE 3QPQD 5F9OH 1QBAA 4XT1C 1FFOB 3X3GH 3HE7C 4LHUG 1N4XL 4FZEH 1RIVH 3DETC 4XVUC 1YECH 3QG7H 4ZUWB 3UYPA 3SJVA 2ZCHL 5SWQA 5I75C 2RIKA 2F54B 3MREB 4P4KB 3CCHA 1IAOB 3G5XB 2VH5H 1NFIA 3BH8B 3F7QA 1U2CA 1KTDB 5IROC 1M6OA 1UZ8A 4JQIH 4OZFA 2AGJH 1AO7A 2PTTB 3FQRB 3MTRA 3GJFH 5JW4R 1T1ZA 2BY1A 3EDEA 1OTSC 5D7IA 3RA7L 2H1PL 4U0QB 5F88A 2C7UB 3V6OE 3TNNA 5B3JF 1KCSL 4NC0B 3NCEB 2Y72A 5FUOH 8CGTA 2NNAA 4FNLH 5H2BB 3KVQA 3PV6A 3BJLA 4NQCE 1H3PH 1IC1A 5IMMA 1L6XA 1MCEA 1Q1JL 2J4WH 4O58H 4DKFL 3IFNH 2Y07L 1U8HA 3VRJB 2P49B 1IC5H 5FA4A 4MDJB 1BBDH 5IFHH 4JZJC 5GZND 1YNLL 1JPSH 4EZMA 4G8GB 5I18L 4GBXC 3C08H 1MJUH 3DX7A 3ZT7A 1FNGA 3HRZB 1I9IH 4F7MA 3VFOA 2NXYB 5ICZB 3DO3A 3M1BB 4HSQA 3WJJC 2NW3B 5IB1A 3OKLB 4IEFB 3F6IA 4Q97A 5ADOL 1IAIM 2WWKO 3H9YA 1WFUA 1EUTA 2GKIA 4GOSA 4BJLA 4PJ7B 5C0CA 1UEYA 2E27H 1HCFX 2FLRT 1YNKH 4K94H 3EO9L 5E6IC 2OJEA 4EXKA 1BREA 1ZLVK 4ZYKA 4HH9B 2O5ZL 4JZNA 1KIRB 4FFWD 3SE9L 2QQQA 1S3KL 3JWOH 4P49A 1FFNB 1MREL 1G9ML 1UM6L 1C5CL 3HR5A 4PB0H 5J6HB 3IETB 1A7OH 5ICXB 4PR5A 4WWKB 1F3DJ 3ALWA 2GUOA 3OKEA 3QNZA 1VFOA 3VXOA 2O5XL 5JDSB 1E6OH 3CXDL 5A16A 1PLGH 1S5IL 3P0YH 3FO1A 4YAQA 3MA9H 4HUKB 1M05A 4OGAD 4ERSH 2X4UA 4PJDA 1UXWA 1NGWA 3SDXE 4JRXA 3L5WB 5CEZL 4CVUA 1AI1H 4O51A 1UT9A 2F5AH 2DQGH 1JPSL 4I4WA 2AV7A 4KQ3L 4X4ME 3T1FA 4HKBB 4OGXL 3QT2A 3QIWC 1NFDB 1HH6B 3G08B 3VFOB 1GOGA 3O11A 2DM4A 4YXLL 4P2CG 4PS4H 1JNLH 5E03A 1FJ1A 1KIQA 2VQ1B 2BNRA 4PJCF 4BYHA 4DN4L 4Y5XA 3VXNA 4LAJH 1JIBA 3UBXA 1ZV5A 4WU7B 1JUFA 1CIUA 1HH9B 3KPMA 2V5SA 3BKCH 3V6OA 4HHAA 1MJJB 1CE6A 1BX2B 1ZT4B 1FFNA 4NSKA 2WIIB 1BFOB 3CCHB 4Z7WE 1S7SB 4ZNEE 1BGXL 3V5DA 1V7MH 2VWEE 4NQED 3ZYIA 3I84A 2QQNH 4TTDC 5ADPH 2H2SC 5E56A 2F19L 4UDTB 1K6QL 1EZVX 4KTEH 3FT3A 4FXGB 4BUGA 4HKJA 4OCXH 1T66D 1NDGB 1VADA 4PJ8B 3QCVH 4K3GA 1I8LC 1WVZA 3QIUB 3KYNA 3O9WD 3M17B 5I0ZA 2FBJH 4Y4KD 5JTWA 3KPLB 5GXBB 4OKDA 5IMMB 5EPMB 1CLOL 1ZA6A 3QAZB 4MA7H 4G80A 3NAAL 3RWCB 2NLJA 1U91A 3FN0L 5I1JH 3P4MB 1RHFA 3WFBH 4FRWA 4L8BA 1FV1B 4XP1L 3X13A 4C58B 4NHUA 2FH8A 3MFFA 2NX5A 12E8H 1INDH 2F5BL 5JO5A 4HPOL 4HFWA 4KJYA 3S34H 4JY5H 1TVDA 1I85C 2H3NB 5C7XH 5C9JA 5IK3A 1X5FA 4GBXD 3WS6C 4ENED 4L8SB 3MBED 2OJEB 2BSSA 1ZT4A 4NSKB 1AJ7H 5BV7L 1N7MH 4XHJD 1TTUA 1A7RL 4U6YA 2IAMC 4JKKA 4TSCL 5F44A 5FGBA 3T65A 3RUGA 1QBLL 1ZHNA 4Y19A 1PY4A 2Q3AA 5CJOL 1H15A 2VDRL 2LE9A 3FOLA 3TA3A 1PGRB 2A6JA 4PJ7F 4I3SL 1UM6H 5IM7A 2WZPD 1N0XL 4HW6A 5KTEL 3U82B 3KXFE 3L3GB 4OF0A 3DUUB 3MLYL 4KKBD 3RX8A 4TUOB 4P57B 3U36A 1G84A 5FYJU 1UCBL 2W91A 3MGOA 1UM5H 4GQ9L 4DW2L 2WANA 1FQ9C 1F3JA 3ARFC 5EO0B 1JWMA 3PWNB 1GIGL 2DLTA 1JZ4A 1FP5A 3LEXA 4G43A 3ZYOA 4WW1A 4I48B 3TH3T 1HINH 4LVNC 4MJ5A 3W39B 4F15B 1B4RA 5D9SA 3QCTH 5KG9B 3TLRA 3DGGA 2BRQA 3L5JA 1QFWH 1UG9A 1ZT7A 5FDWB 5MEPB 4L8BB 1XGQB 4KUZL 2VZOA 3IRZA 3X13B 4UILH 5KANI 4CMMA 1MAJA 2DQFB 3CU7A 5F1SA 3IDMA 2YXMA 3Q6FB 4MXVE 5HDBF 2Z4QB 3CVIH 4C56D 3HG1A 4NQCB 1E4XI 2D31A 2WWMC 4RGMB 2HJLA 1AY1H 5T3ZL 4TTGA 5FOBA 2AK4D 4JM4L 5J57B 3U7AA 4EBQL 5B39B 3OHXB 1LE5A 4P2RA 4OV5B 3EGSA 1Y18B 2A6IB 2DJSA 2XV6B 4OT1L 3BKCL 1IKFH 3P4NB 2YD7A 1RZ7L 3WXVL 3PP3K 3TA3D 4TPRH 5FAAA 4ZS7L 5JQHC 3KGRA 3VFTA 1MELA 4F15C 1J8HB 4ZFZA 4LFHG 4MYWB 2Q1EA 2NY5C 3QUZB 4U2YA 3GI9L 3LMJL 2O5YH 2X4PB 2BK8A 4MVBC 1NANH 5CIPA 5D8JH 2K7QA 2VDPH 3JUYA 4U1SB 4K23L 1XR9A 3QUKA 3ISWA 3S34L 2BSTA 1PSKL 4PJAB 5F9WC 2D2OA 3EOAB 1XR8A 4HF5H 4RMUA 5DJDB 4JFOB 2VLME 4KKLD 1NGYB 3FN0H 3CMOL 3EOBB 4ODVL 1Q1JH 3DIFB 4DCQA 1G7IB 2B8OT 3STLA 4KHTH 1DEEB 4X4XA 2YUVA 5JORA 1KT2A 1XIWA 4PB9H 3CDYA 4EI5A 2C1PB 2Y5EA 3ILQD 3BZ4B 4WFHE 1R5VB 2QADD 3NZ8B 3V7AG 1RZ7H 4NKDA 1FE8H 4OCXL 2FJHB 4JCLA 2FD6H 4R4BB 3F12A 3EGSB 2HAZA 4KRPB 4QXTB 1FZMA 1MCJA 2WWKT 4MJIB 4EIZC 1NGXA 1HHIB 5BS0A 3DO7B 1IE5A 1G6VK 4HFUL 3G6JF 1ZVHA 4OLYH 2GJZB 4OBRA 4ZFOA 4PTUB 2DQUL 3C6LD 1CICB 2HRPL 3IDXH 1CFBA 3IDNB 3EO0B 4M5YL 1I8KA 4QTHB 3GB7A 4YDLC 3BXNB 5INDA 2LQRA 2QLVB 4LCWD 5HHOA 1P5UA 2VXUL 4KQ4L 1RZIB 2ZP0T 3RJQB 1Q9LB 2CDGB 1GC1C 3BDBA 1E4WH 4AT6B 3VXRD 4MJ5B 1R5IA 3K8MA 4JFXB 4X7FC 3B2UC 4QWWC 3FQUA 1LO0L 4FS0A 4R4FL 4HG4K 5EO9B 4ERSL 1OTSD 4PRDB 2YC1A 4MAYB 4FABH 3MROA 4QRPA 1A7RH 2NMSA 3RVTD 1I1FB 3DXAA 5DRNB 5F71A 5SV3A 2R2HA 5IGXH 3KPPA 1RZGB 3FRUA 3VFPA 1JFQL 3CX5K 5D7JB 1MAMH 3TBVA 1AR2A 3S35X 1JHLL 6FABH 3LHPH 5T1LD 5MHSE 3WS6A 3QUZD 3O41A 2NX5D 4Y1AD 5KS9A 1KN2L 4YXKL 4M6ML 3W11D 2BSRB 4H1LH 1KSRA 3GSNA 4NJ9H 4L29B 2Z31C 4JM4H 1DANT 5I30H 3E8UL 1Q9WB 1ITCA 35C8H 3AS3A 1CTOA 4OLWH 5FYJL 1WEJH 5AZEH 3FN9A 1SY6A 1QLRB 5FCSH 2IGFH 4WFFE 3L6FA 3OR7B 1L9MA 2VXUH 5JNYB 3I3DA 3EO9H 2GYSA 2R2CA 4HS3A 5E5RB 5L6YL 1LO5B 3VWKC 1XF5B 3D3VA 2AW2A 3DVIA 3P77A 4LSDA 2GCYA 5MI0C 4CVXB 1UWXK 3NH7L 2QQKL 5BZWB 3IVKB 1CZ8H 5D7LD 1EK3A 3FQUB 3I9GH 5F7UA 3FQTA 3LEYL 2WSKA 3ME0A 1OARL 4OKVB 1FYTD 1MHHA 3G04A 4M62L 2IH3A 2QADB 1TJGH 4FNLL 1BBJA 1TTGA 3OKKA 2H41A 2PYEA 1YMMB 1BWWA 3RY6A 5I1LB 1B88A 3QUXD 5TE4L 2Q6WA 4G6KL 3IFNL 2XTJC 3TBVB 5IFJB 3U30B 3NTCL 4HUNB 2DBLH 1SVZA 2OTWA 4GW5A 4N8VA 2EKSA 4ZODA 3BO8A 3HZYB 5KVMC 5CJQH 5JPMB 1QVOA 2B4CH 3MBEB 1T7ZA 2ZUYA 4GXUN 4M93B 3VG9B 3BPOB 2AABH 4FQJH 3V0AC 4ONGH 2I25N 3ARZA 1X5YA 2GJJA 4BK5A 4P2YA 3SKMA 5TJWK 1S5HA 4CN1A 5DQDL 5JW3H 4KC3B 4PGBA 1QSEB 3QIBD 2Y23A 3IDYC 3C87A 2CO7B 4MMXC 3DYPA 4ZO6A 1FC2D 1I3UA 1U2HA 4R6UA 1YY8A 3KJ4C 3O0RH 2NY3B 5E95B 1CFVL 2XZAL 3LAFA 2MQ3A 1AO7B 1V3MA 1TZGH 2IH1B 2R29L 3LHPL 4K7FB 1SQ2N 5IFAL 4D0BB 4M1GL 2W9LA 5SV4A 3A67H 1GGYA 4PRIE 4NWTH 5F7EL 5GIRA 5C0BB 1BHGA 5F7EH 5IB3B 2WQ8A 3AC0A 5DFTA 1VENA 1UH2A 1I7UB 1QRNE 1QPXA 3KPOA 3FO0L 4JDTH 3GI8L 3UO1L 1NMBL 5FHAH 1GRWA 3U1SH 3V6FB 4HS6A 3SE3C 1FSKB 5D7JA 5HDOA 1FNFA 3MUY1 3MYZA 4M3KB 5C71A 3HFMH 3B6SB 5MHSD 3Q6GH 4MD4B 5TDPA 4ZUSA 1DN0B 3BE1L 4HWNA 4NQEB 5JW3L 3S5LG 1NAMA 1LHZA 4GBXB 3Q1SH 5HY9B 1ZAGA 4MSWA 2AK4B 4XH2B 1TLKA 3K2UL 1DQDL 3MRNB 5D2LB 5EC1B 4YNYA 4HBCH 2F8VA 3C2SA 3HCVA 4P3DA 3RU8L 4AIZA 4LEXL 5C0IA 4O5LL 4RMRA 5DDHA 4J12A 3IKKA 2I9LA 5E8NB 1Y0LA 3GSRB 3GK8L 1FH5L 1HIML 3FQXB 4NCDA 4UTAL 3WNMA 3SDXA 4PY8J 3VWKB 5A40E 1KENH 2DM3A 3QDMD 5JOFA 3K8LA 1JNHA 1MFBH 1JGUH 3S88H 1DVFC 3DMMC 3SDDB 3BP5B 1GSMA 2R0LH 3V6ZA 4NO0B 3O3UN 4P3WA 1MCPL 2CIKA 2CLZA 4MA3B 1GH7A 1OL0A 1WCBA 4FQQA 1CK0H 4GS7C 5I2IB 2XTJE 4OD3H 4I3SH 4XVTL 3DRQB 5IVXF 3SO3B 2BFVH 1UJ3B 5CP7A 1K8IA 1U8PA 4OF7A 2D7NA 4K55A 4RBPK 2CRZA 1X5AA 3GBMH 1NGWB 2YZ8A 3FFCA 4K3EL 1G7JB 2UYLB 4JFZL 2FJFA 3KPSA 3V4VH 2CDFB 3QEGL 3MRLB 2R8SH 4HBCL 2ZJSH 3C60B 3CX5J 2ESVA 4PP1C 2AV7B 1KJ3H 2H26B 2ZPKH 3B9KA 1BZ7B 1WFNA 1C5BL 3QG6B 3TO4A 3ARBD 1CLCA 2J6EA 3MXVL 5GGTH 5DD6B 2XN9B 2VXQH 4GRWH 2EC8A 5EUOF 4Z78A 3WHE0 4U1KB 1QVOB 3HC0A 4W81A 1BIIB 2CXGA 3I3EA 4RFOL 1EO8L 5SWZD 1MLBA 3HCVB 1J7VR 3IFLH 1JZ7A 3BPCB 5EU3A 2ITDB 4JDZB 4GKOA 4BFIB 5DQJB 4YBLC 5K9JH 1QFUL 2OL3B 4PGBB 1T1XB 4AEHL 2YBRB 3OKMA 1BX2A 1KIRA 4OD2B 1CICD 1MLCA 1RIUH 4I8DA 1LEKA 1FO0A 1RU9H 1EVUA 5KVEL 5KJRH 4GKSA 4XI5C 4GMTL 1R3LB 4M7ZC 5I1AA 4G8FA 4EBQH 1E4XL 3P73B 2XNAB 3GSQB 4OZIB 2W0PA 2C4XA 3CSPA 1UM4L 2X9XA 3KS0J 1P7QA 1IC7H 2DQHH 2NY4C 4NQVA 1OD7A 4GRWE 3KWWA 5DSCA 5E7FA 4LIQE 1XGUA 1UACL 4BH7A 1A4JB 1S9XB 4HGMA 1MI5D 5BCAA 1RK1B 4UV7L 4YFEA 5BO1H 4P46A 4KMQA 4J8RB 3OR6B 3G9VA 4WW2C 3Q2CA 5IOPA 4M1DL 4H25B 3MRFA 4DVRH 2DLHA 1DFBL 3C60A 2I07B 4K23H 3S37H 3QCTL 4XB8A 4I4WB 2AK1L 3NBNA 3QJFB 3LPWA 5I19L 2CDEA 1FGNH 3LDBC 2AXGB 5EU5B 5ISZE 3GSWB 2PTVA 3BVNA 4NO2B 3GMOA 1FORH 2F15A 4Y1AA 1NAMB 3RZCD 3PL6C 3WO3B 4Y2DD 3MRNA 5EC1A 4U1NA 1MH5A 4PJHF 2NY2C 2X1WL 4F9LA 3TO2B 1QA9B 4LIQL 5DDHB 4J6RL 2UY6A 2VLJE 2WUCL 4U6XA 4LP4A 1RQ5A 2AEWA 3DTXB 3IF1A 4K3JL 3IDIB 3WL9B 2VYRE 4QXGL 2YBRA 3OKMB 3RAJL 4PG2A 4GMTH 4PGZA 1EFXA 4PJEA 2MMXA 5BS0D 2DQTH 1L0XA 2OSLB 4Q0XL 1FDLL 1Z2KA 2VNCA 3ARBC 4DJMA 3NIFF 5DC0A 4CKVX 4K94C 3PHOA 3OMZA 2ICWB 2DIBA 1T2QH 5IW6B 4NRYA 2XY2A 4DEPB 4WEBH 3IB4A 4P23C 5JA8B 2XTLA 1BQHG 1F58H 4GSDL 4HC1H 3QWOA 1ZVYA 2PO6C 3BKYL 4PRPB 1IILE 5T1MA 3UTTA 2AS5M 4XMKL 3SDYH 4XMKH 3DBXB 4JG1L 3MRRA 5DUBB 2IG2L 4FFVD 3NZHL 1NMCC 1GGBH 4EN3B 2V2XB 2Q86B 4MNGB 2CUMA 1I8MB 1D5IH 3HC0B 1TJHH 5T3ZE 4K9EH 1J0JA 4RAUB 1QNZL 2PKDA 3Q6FA 2JCCB 4G6AC 4UT6H 2JF1A 1AHWB 5IVOA 2E3VA 2CLRB 2FEDD 3OQ3B 4JQVC 5MEND 2N7BA 3QXWA 3CU1A 5CLWA 1FFQA 3IDIA 3WL9A 4AIOA 4ELMF 2CPCA 2BNQE 4Q0XH 3EDJA 4KVNH 2WBKA 5EIQA 2VDRH 2P44B 2DM2A 5DUML 3G5ZA 4P5MB 3SDDD 4AM0A 4MWFA 5ESVA 4NQDA 5JHDE 3DARA 3V5HA 2I60H 2OR9H 2VLLB 4RBPH 2XPGA 5ALCH 4XPGH 3T0EA 2RGSA 4P3CL 2FGZA 2UZYB 5C3TA 3V95A 1HK6A 3VXSA 4JFFA 1ZGLM 2JCCE 1NDMA 2R69H 4P4RA 3AU1A 32C2B 3BHBA 2YPKA 4LSVH 2EZ0D 4NKMB 4OCWH 1LDPH 2AQ3A 4LLVB 3W9EA 4K07A 3UJTH 3TNMA 1RZKL 4YBQD 2X4NA 4Z95H 1MHEB 2JB5L 3U4BL 4HWEL 4TVSa 3DBXA 1JZ8A 2ED8A 4MDIA 5AAWA 1VFAA 5DTFB 1GXEA 2FB4H 5GRVK 2GIYA 1G6RL 1KN4L 4JDVB 4R2GC 2A6KA 1U58B 4K7PL 4NO2A 2X4TA 3U6RA 2YD1A 4PRAB 2Q8AH 3B2UD 2GTZB 5HXMA 5JW4M 4FQ1H 1A7BA 3TT1L 1ADQL 1KT2B 4WEUD 3P0VL 1OAKH 2J5LB 2DQHL 3PP4L 5CHNA 4ZD3H 3VMPA 3WIHH 4IBLT 4QRPE 1OGAB 3LZFH 2R56L 2VABA 4R4BA 3VD7A 3QI9C 5IBUB 3SDAD 4QXTA 3GSUB 3BMVA 2ICEA 4YDIH 4K9EC 4OCRH 5IIEB 5C0BD 3KPSE 4NM4H 2FZ3B 5MP6L 2ICWA 4JFPA 2ZCKH 5BMFL 4U1MB 3ZKXB 4RGMC 5I17B 4H0HB 3IRPX 3IDYB 2O93L 2VSDA 1UXSA 3VXSE 4I0PB 3S35L 5EH1A 3T0ED 2VXQL 4YGVB 3VCLB 4NN5B 3O6LL 5F21B 1MRFH 2P46B 2BY3A 5GRUH 1GZQB 2B4CC 2QJDA 5BW7A 3HPJB 4MXWL 4Q6YA 3MOAH 5KOMC 2X4QA 4CGTA 4PJAA 2D4DA 2WNGA 5IVNA 3QFDA 5IJVB 1MRCH 4OF8A 3D39D 3MLUH 5EBGA 4W70A 5BQ7A 1UWGH 1E6OL 3QP3A 3P4OB 4XNXL 3VFSA 3WFHB 2I5YL 3WKML 1D9KB 3VFPB 1HSBB 3GO1H 3PWJA 1BVZA 1KACB 2G9HB 1J9CT 4JG0L 5HPMB 2RAMA 5CHNB 5E00A 1B0WA 2FJGA 4H0GA 4WUUD 3QEQB 1N64L 4YLQT 3ZKNC 1ACYL 2BMKB 2FJHA 1OWWA 3HE7A 3TYGH 4XRCA 2A0LC 3FO9B 3UPAA 1A6AB 1XT5A 3BKJH 1T0MB 4NPYA 4KK6C 4LCCB 3V7MA 1RZKC 3UX9B 3T09A 4U3XA 5DD3H 4MA1B 2XPGB 4G7YL 5A2KH 4HC1A 3HMXH 4X7EC 4R96A 5TE7H 1RHHA 4OM0H 5E1HB 3WNKA 2NY1D 1D5MA 4OFIA 4MCYB 3AM8C 3VXPA 5GGTA 2C4FT 1DQMH 1LO5A 4MXWH 4NDMB 4ODBD 2YK1L 1HINL 3P77B 2V5TA 1QSFE 2NQCA 4KK5D 4YJZL 2IJ0C 3OKLA 1W8NA 4HWBL 1JI2A 2NZIA 5D5MB 4LARL 3PQYB 3LS5H 4XNXH 1R0AH 1KCSH 3NFNA 4XMLL 5FM8A 4HH9A 5D8JL 4Q9RH 3TZVD 1A6TA 4IRSD 2OX5A 1H3PL 5SWZE 5C08E 2DOCA 2R0WH 1P7KA 2V5RA 4K3HA 4DOHB 4HXAH 1XGPB 1HOCA 1J8HE 5AAMA 4N1EA 2P5WA 4JHBA 1YEFL 5I15L 2GY7B 3VXOB 4XP5H 2YPVL 5F3HB 2AQ1A 4NOFA 3RWGA 2D9QB 2F53A 3GSNB 1U42A 1KLUB 1HHKB 5CZVH 4GAFB 1MCIA 4AMKL 3RI5K 5ADOH 3V8OA 3W5MA 3PIQB 4L3EB 3E6HB 1RUMH 1CL7L 5C0EB 4Q6IB 2FRGP 4XHJC 4U1MA 5SX4H 4YX2L 2H2PC 3VXUB 4MAYD 5ANMA 5DURD 4ZYKB 2Z91B 1YDPA 4BQBA 4L5FL 3H3KA 5JNYA 3MLVL 1Q9OA 4KFZC 5L0QC 1MIEL 3ARWA 5FO9A 5FO7B 1S9WA 4XNUH 1HWGB 4KTDL 5HHME 1KTDA 2BNQD 2OL3H 1QFOA 3IVKA 1IGMH 2P5EE 3AREA 4P59L 1AC0A 1TTFA 1IC7L 3KPMB 1UM4H 1ZWIB 5E1AA 1R3IH 3OPZH 3TNNB 2MKLC 1D9KD 2VB5A 4E0RA 2VXVL 4XVJH 4MZ2A 1BBJB 3N0PB 4WCYH 1P7KB 3ULVL 5C0RH 4J3TA 3WMSA 1XGPA 4KVCL 4U2ZA 1HI6B 4KK9C 3CJJA 1OCWL 1T20B 1F4XL 3ARGD 3VRJA 1ZLUH 3EJZC 3DHMA 2JIXA 5MENB 2HFEA 5KS9E 3MUJA 4YFLF 1SJHA 3KNBA 1HHKA 2R2EB 3MRBA 1NGZB 4YNYB 5AG9A 1XFPA 4Z5RB 4L3EA 5J11C 4YHIB 3TWCL 1B0GA 1QSED 2DKSA 1K4DB 1F45A 5T1KD 5AYUL 2ITCB 3CIQA 4O2CB 2NW2A 5C0AD 5TQ0H 3VI3F 3GHBH 2E8YA 4GXUM 4YXKH 4P2QB 4XAKD 4DUXA 3F7VB 2ORBH 3PQYE 3BPOC 4HAFA 4P2RD 5LKNA 3CPLA 3QDJA 1T7VA 2FX8L 3U0TA 3FN3A 5DRWB 4JY6A 1P4BL 1UZ6F 2DJUA 3IGAA 3BDXA 4IDJL 1G7HB 2DBJA 1SHMA 3C2AH 3K2MC 3QFJB 1G9NC 3AVEA 4GUPA 1KIPB 1KB5H 4NJAH 1NQBA 3O2DH 2QSCL 3H0TB 4Z0BL 3QDME 3KPSB 3P30H 1E4KC 4WV1C 1JGEA 1U8IB 3UZVB 1KYOJ 3IJYA 4P57A 5C2UB 4HT1L 4AG4L 1EAJA 1ZSDB 5D1ZD 4LGPB 5I18H 4Z7WF 1EX0A 1EH9A 1NFDA 1C5DA 4L3ED 5E9DA 4ZFGH 4F7TB 3RWJB 3T3MF 1SY6H 3FONA 1WWWX 2RBLA 1KIQB 2VQ1A 3KDMA 4IJ3C 1A6UL 1DQJB 3GMQA 3O3EB 4BSVA 4RWHA 3O8XD 4QTIL 4TSCH 4HJGA 4KUCD 3F62A 5DEFA 5C0RL 1A3RH 3Q3GA 2EO1A 2LVCA 3CSYB 2JJTC 1J05B 3PGDB 4WV1B 2A6DB 1N0XH 3UTSD 3OKDA 4OUUA 3KJ6H 5TE6H 3GM8A 1G0XA 1WFTA 1NL0L 4XCEB 3LKSA 1I7ZA 3TFKD 3ARGB 2BVOB 1U92B 2A9NL 4NYLB 4E0RB 1BFSA 1K8IB 1U8PB 4MNQD 4LDEB 4Z7VE 5EBMB 4TNWF 5K9KB 5HHPA 3QZWG 2DF3A 4Z18A 2J12B 2XQBL 4JHAH 4Y2OA 5JZ7D 1HI6A 4HK3J 2GSIA 2F5AL 3DV4A 1A1MA 5EZLB 3QJFA 2H26A 1MJ8L 2HH0H 4F37F 2EDFA 3J8F7 3ROOA 1ZLSH 4D9RD 3OJ2C 1K9TA 3SBWA 1BZ9B 3D2UB 1BVLB 3C6LB 1BFVL 2DI9A 3UO1H 7CGTA 1KTLA 1U3HB 2B5IC 3QA3A 3IDGB 4PJGB 4NZTL 2B7DT 2HTLC 4NQCA 1DQJA 4ZAKD 4LSPL 1EA9C 1YEFH 3MLTA 3X11B 1MEXL 3TPKA 5B39G 1OAUL 4WO4D 3BQUD 5F96L 3TBWA 2J8HA 1T1XA 3L7FB 2C26A 5CJOH 4KI5D 4OV5A 4X9BA 5D7LB 4TUKL 1FIGL 3HLAB 2D0GA 3K4DA 3FFDB 5DJ0A 1QP1A 1ZXQA 2A6DA 3VXTA 1XIWC 3KLSA 2ADFH 5A1AA 3AB0B 4PG9B 1JNJA 5ACZA 4KGLA 5C0DA 1OM3H 5D93B 5J89A 3ZKXC 3PWLA 5EC2A 1YPZB 4M48H 4ORGA 5CSGA 4ODXA 2DQIH 5FEBA 3PWPD 3HS0A 2QR0A 1INDL 2F5BH 2FCBA 1LK2A 2HRLA 1KIPA 3QQ4B 2IQ9L 1QTYT 2RFXB 4J8RA 4N0FA 4XBPA 1JGUL 1PKQE 1ZS8B 4AYFA 4JEGB 3S4SG 5CCKH 3D3VD 5EZLA 1RIHL 1M7DA 5GRUL 3UTPD 4MLIA 4V1DB 5DMKA 4YO0B 3RRQA 4HGWB 4OFPA 2VDQH 5GGUA 3ZE2E 4HPYL 4F57L 1NGQH 1A47A 3R8BB 2PETA 1T3FA 1VGEL 1KTLB 1YJDC 3RWJA 2V2TB 2DQFA 1A9BB 4X6BB 1NH6A 3W0WA 4XC1H 1MUJA 4ELMA 2C1PA 3MV8E 1S7UB 3QXUA 1EFXD 1F5WA 1FE8L 2GITB 3NZ8A 4JZJB 4ZS7H 5F93C 1PG7H 2EDBA 2YC1B 4MAYA 2CUHA 1BOGB 4TNWK 2FO4A 2F74A 3D87B 3R06A 1Q0YH 4EVNA 2ZKHH 2MPAH 3NN8A 3MYJB 2D7PA 5L7XH 2EDHA 4Y4HD 1MCCA 4QGYA 4Y4FD 4LNVA 3E2HC 4PJEF 1NAML 1B3JA 1HQRB 3FHAA 4NRYB 5K93A 4EUPG 1E0OB 1IGTA 4H8WC 1NCWH 1QFUH 3S5LA 4QRQA 3SQBA 4ONFL 4Y2DB 1V3KA 3WNPA 3PE9A 5FM4A 1W0WB 3C8HA 5F6HI 5CZVL 1MCQA 2G2RB 4BFEA 1Q8MA 4IIQC 1JF5A 4S0TD 5T1MB 3UTTB 1QFWM 4Z7UF 1MFAL 3ARVA 5I71C 3FAXA 1QG3A 3L6FB 2APBA 5CMAB 4R97B 4XZUA 2HG5B 1UH3A 3EZJB 1DBML 3MGTB 4FFYH 4H5SA 4XBEL 4XCFL 3K1KC 2CR3A 3QDJE 3ULSB 5I1IH 2V2XA 1CDGA 3NA9L 4LPVA 4ISVB 1MCHA 2BNRE 4HIHA 1B90A 4OCSH 3MV7D 2ICWI 1HHHA 1KYOK 2IANB 4G9DA 1RUPL 5C6PB 3GIVA 2XYCA 1YEGL 4XCCH 1HNFA 3LPFA 5JA9A 3BGMA 3MODH 1QBLH 3KR3H 1AXTL 4PBXA 4JRYE 3I6GA 3G5ZB 4OAWB 2C3WA 2DLFH 4GW4B 1PEZA 5FDYA 3HG1D 3MACH 3RIAK 3VXSD 1J5OH 1JGLH 4LSUH 3MRDB 3SN6N 4S1DD 1EHLL 1NMAL 2VR9A 3QDJD 4S1RL 1TITA 1ZVSB 5IF0B 5HYJB 1VKXB 4OM0L 1KPUB 1ZLWK 1AD9B 3QDGB 3ZDXE 4QRQB 5CIPH 4OGZA 1LK2B 2R23B 3DX7B 1MQKH 1JPTH 4N0RA 5GRVL 1X4XA 5C0FA 3UTOA 3OB8A 4DK3A 3HKFA 3VW3H 5LBSL 3RVXC 5GRJL 2IBGA 3GSOA 4DGVL 2ZOKB 4OLVL 4FZ8L 5D6DA 4DKDC 3G6AB 4XZUB 3WSQH 1TJGL 4Q9CA 4JM2F 4Z7QF 5MEQB 4P59H 4H5SB 4JDVA 5DK3A 3ULSA 5GGUB 4DFHA 3VFVA 5H2BA 5IHUH 2X4RB 1L6ZA 4LGSB 4XXDA 3H9ZA 4ISVA 1MJ7L 1MPAH 5KSVB 3MJ9L 1F4AA 4PD4J 5LQBL 4ZO8A 2G9HA 3LN4A 2VDKH 5ERWB 3QULA 2VDKL 3FFCD 3A6BL 1ZEAL 4HWBA 4EI6A 1DDHB 4ORZC 3VMOA 4IDJH 5DJ2A 1INQA 2C3VB 4ZDHA 3RHWK 5IVXA 1I9EA 2EDQA 4N0YL 3MLSL 4WDIB 1AGEA 3D9AL 2VXTH 5GGTL 3WHXB 5EUOA 1D5IL 2EE3A 4AMKH 1C08A 1FZOA 2NY3C 3PDOB 3ZE0F 4KHXH 4XPBH 1FCCA 3HAEG 3U4AA 3B6SA 4P48A 5L2KA 2YUWA 4QTIH 5I1JL 2GAZA 3T2OA 2DIAA 1DN0A 4X5WA 1GGIH 4UMGA 4Y2DC 3BOVA 3O6KH 1PQZB 3VI4E 4FTVD 5SWQB 2P47B 3EAKA 1IFHH 5I1KH 1NUGA 3UTTD 3RPKA 4XH2A 3QI9D 1II4E 3BH8A 2FYYA 4QRUA 3O45A 2DD8H 1LE9A 1GOFA 4JJ5A 4XNMA 3RGVD 5HHVL 2I9LB 3CXDH 4Z77A 3IFPA 1V8HA 4NWUL 3NCYP 4XVSH 2YEZA 5J56B 2XG4A 3T0DA 4RIRB 4F7PB 3VFSB 1OW0A 4RGNE 3LKPB 3KPOB 2ERJC 3CAFA 2AJUH 4NO0A 4U1IA 2I27N 3M07A 1FZKA 5D2LE 4IDLA 1OP9A 2AJXL 4PPTA 5C0CE 1NLDH 2APFA 5DJ8B 4Y0GA 3MUZ1 2P4AB 5EIIB 5CP7B 2ZWLT 2WQRA 4JN1H 5DD3L 4GBXA 5HY9A 4GW4A 3MBEA 1FIEA 4LCCA 5T33H 4WGVB 5F6IB 1KPRB 3WJJA 5I1DB 1UYWH 1NPUA 1LO2H 4Y5XB 3VXNB 2IEPA 5DJ6B 3FB8A 5EN2B 4BH8B 3MO1B 5CZKA 3NFPA 3QEUB 4U05A 4KJPD 5JIHA 5ESAA 4D3CH 2AEIT 2SEBA 1UWEH 3VXPB 4UIKH 3DX8A 2C1OB 2Y25A 4S2SA 4HMEA 5DK2B 1XGTB 2B2XL 5DK0B 1SYSA 1WWCA 3LRSA 4IRSB 2FX8H 5HGAB 1BBDL 4MNQB 2Z92A 3MOBL 5IROA 1PKQA 1RUPH 2BHUA 4ZXBB 1TCRA 5IK3B 3RVWD 2J88H 3MRIB 1OTTD 4JRXD 3QIUD 1JV5B 4R0LC 4IOFC 3L1OH 1Q0XL 2X4RA 5HYFA 3K0WA 3NIDF 4NO3B 1MAML 4H26A 3MV9D 5I8EB 3RIFF 1MRFL 4MJ4A 5I1AB 4U1IB 2FJFB 3V6FA 2ADGA 3OXRA 2F53D 5JHDA 2JELL 3QHZL 4QRRA 3WFBL 3CDCA 1NGQL 3DMMD 4NRZB 2JTDA 5EU7E 3MR9A 5T33L 5C07A 4JKLA 3MUGB 4XP9L 1JF1B 1XGRA 1U0QA 4U1GB 3CZFA 3V6BR 4Y16B 2F54E 4Y4FC 2D3VA 4JGMA 3NFSH 4U33A 4WRLA 4I48A 1T04B 4P2OC 2AJ3A 5C6TL 1G9NH 5J9PB 2B1AH 2G5RA 3UBXB 4JKPL 4KTEL 1H5BA 3JSSA 3GI8H 4WHDA 3QRFM 4RZCB 3L7EB 4W4OC 1XAUA 1FAKT 1DVFB 2HTKC 8FABB 4MNQA 5DD1L 2IPTL 2XNAA 3GSQA 3HHRB 4HEPG 3SDDA 4OZIA 2BFVL 5D5MF 1TETL 1P9MA 1IM9D 1OHQA 3VFMA 1TZGL 2R29H 4PLKC 3T2PA 5IFAH 1UWGL 3EYVA 4S1SH 4JZOB 2FD6L 3FT4A 3JWOC 1FYTA 1RK1A 5CLTA 4LKXB 3P4NA 25C8H 3JBG7 4G8EB 3QO0A 3MRFB 4XAKE 3ZL4L 4ETQA 2UYLA 5K9OB 4XMPL 3DJ9A 5I19H 4NNPH 4ZS6D 2QKIA 5KG9A 3AXLA 3N1MC 2X4PA 1P4IH 4L4TA 3V0VA 4A2MA 1ZLSL 5FO8A 2J2ZA 3C60D 1JF1A 1SJHB 2LAGB 1M71A 4LLQA 3JV6A 5E9DB 1WIPA 2XG5A 4CMMB 3BQUA 3DMMA 4U1NB 2IADA 1VPOH 2ZNXA 5KBNC 1KF9B 2WINB 3MCKA 4XNZC 1VFBB 4PGDA 5LXGL 2HT2D 2EO9A 3BN3B 5EU3B 4UT7L 3EOAA 1RJYB 3QQ9C 3VFGL 1AQDB 4CDGC 5GS0C 5A3ID 2E9IA 2YSSB 4ZSOA 5GGRB 1DVFA 4EXPX 1MLCB 1RK0B 5F89A 3QIBA 3RDTC 4GAJL 4HWBH 4P5TC 3ABZA 2QHRH 3DROB 4LCCC 5DRWA 3ARYA 3VFMB 2EH8L 4R26H 2NXZC 1NLDL 1AP2B 1JGVH 2NYYD 2D7OA 2O5ZH 1J0YA 5DSCB 1HCVA 1J0ZA 4HQQH 1D5XA 4PLKD 2CQVA 3P9WB 5T1KB 1F3JB 4KZDL 1BEYL 1FZMB 3BKYH 5IJKC 4QKXB 2VLRB 4WI3A 3MRGA 4K71B 3V4UL 3PWNA 1OGTB 4PJIE 5I1GL 3NABL 1GC1H 1FL6B 2BSTB 2GSIB 3CFCH 3IXAA 3LEXB 4K7PY 4OI7A 3E6FB 1VPOL 3WSQL 1H0DA 1M7IB 1MF2L 5D1ZA 4JPWL 1FG9C 4BFGA 2B1AL 3A6CH 5C0AB 5D9SB 4JFFB 1LO3L 3Q1SL 3EO1A 4NNYA 1MNUH 5IB5A 4PUBH 2HLAA 5DMIH 3ZYJA 4Y4FB 3DIFA 5E2WL 4CRPA 5IHLB 4MB4A 4PD4K 2XY1A 5DUPL 1AKJA 4PJCE 5E8DH 1B4JL 4DGIL 4MXQD 1U3HC 2B5IB 4B0MM 2AI0H 3BZ4A 4OCNC 4ETYA 3HG1B 2FEEL 5CD5C 1I8IB 1UM5L 4GQ9H 1H5BB 1YMMD 1DVFD 5EFIA 1U93B 4AENA 4PRDA 2YD2A 1N59B 4H1LG 4PJEB 1I3RB 2IWGA 2OR9L 1N26A 2LV4A 3ZDYF 1MFDL 3QPXL 3MODL 3WXWH 3QPXH 4H1LA 2V17L 2GJZA 3LS4L 3PV7A 4IJ3B 5ALBH 2A83A 2HKFH 1CICA 4HGKC 4ODSL 4QHNA 1DBJL 4RRPG 1XF2B 1JHKH 2BVOA 4X6EA 4OF6A 1U8OA 1FYTB 4BQ8A 1WTLA 3L3JA 1YMHB 2RFXA 2EIZB 1BF2A 2ZSWA 4PV8A 3U7YL 1MFCH 4OZHA 1F90L 4JQVA 1FCGA 3VA6A 3WIFB 3CLEL 1R5IB 2YZ1A 1A1MB 3VJ6A 3W0WE 4ELME 1DBAL 1QUNA 2B1HH 3IU3B 4KMTL 5M7QA 5T5NF 1P1ZA 4NNYB 5IB5B 3C5JB 2AAVA 1UXSB 1CD1B 4H20L 5EU4B 5T5FL 3HN3A 3MLPA 5GJTH 5HVGB 4HS8H 2PYFA 5DD5L 2A73A 3W0WB 4ELMB 1JK8B 5DYOB 2P1YA 5JW4Q 3IAQA 3L3KB 3P11H 4IHOB 1P4LB 4ZTOL 4HXAL 2JCCF 1T1ZB 4X6CB 3O41B 4XAWH 1RPQA 1IGIH 5F72S 1YPZF 4G6FB 3H2WA 4JO4L 4M7JH 4RGOL 1S7TA 4L29A 1TVHA 3VFGH 4RWYL 5K59F 3EBAA 3RDTA 3ZTNL 1CFTB 4ZFFA 1PKOA 5ALBL 4D2NA 1FDLH 1YMME 5DJXA 1CVRA 4LBEB 3NOIA 2FZ3A 5FCUL 4HF5L 3PJSB 4WHYG 3U0WL 3UP1A 5JOPD 1RVFL 1HYSD 4PJGE 4YXLH 1HN1A 5I17A 2DQDH 1GHFH 1MCNA 2DTSA 3AAZA 5E70A 3OR7A 4LSQL 4ODXB 1ONQA 3B9KC 3BO8B 3HZYA 4XWOC 5FXCH 1YMHA 3UZQA 5HYIA 3VXRA 3UDWA 1IAII 1BD2D 4QHUA 4DVRL 4F7MB 3MRHB 4D9QE 3ALPA 1RUKL 1IFHL 2GCYB 4OZHB 1RZIA 2DKMA 4PJFB 1NJ9A 5KTEH 1NBVL 1H3VA 3E6FA 4TSAH 2UV3A 1M7DB 2Z8RA 2E7LC 4PJ7A 5C0CB 5IQ9A 1T7YA 2AKRB 3QUXC 3AM8A 2IH3B 1JMXA 1V7NH 4LSTL 1O0VA 4YHNA 2N1KA 1TVBB 2X4TB 4MS8D 4IMKA 5HBBA 1D9KA 2ARWA 1E4XH 2A38A 3VFUB 2GFBA 4MB5A 2Q6WB 1QNZH 4UT6L 4W4NA 1ZT1A 2AJUL 3VGHA 4DGYH 4NKQB 2M2DA 1I9JH 4LPXA 4PJHB 1RUQH 3QI9B 4N8VB 2EKSB 3VRLE 2UZIH 2Y6SD 5D1XB 4GRMB 2E9WA 1EGJA 1EBAA 1QHPA 4CVZB 3E1F1 3G5YA 1YY9D 5ITBH 5LWYL 1A6VL 3JWDC 3Q5TA 3CVIL 2R9HC 2ZG2A 2BY0A 3RNKA 4PRBB 2VAAB 1EO5A 2BHZA 4Y5VC 4I3RH 3CSGA 1S5HB 4MD4A 3BIKA 4EDWH 1QSEA 4NO5B 4KUZH 4P23B 5T5FH 3I2CL 4P2RE 4QOKD 4YPGB 4LSTH 2X9YA 1S8DB 3O11B 2HVKB 1YQ2A 4LLWB 3D3VB 3SKJL 2YD8A 2BC4A 3IDUA 1G7LB 1MJ8H 3WIFA 2QQNL 3WLWC 2O5YL 3FQNA 4RMWA 1MFCL 3PQYA 4QGTA 2W59A 3T0AA 4I13B 3HNVL 1W72A 1OD9A 5MEQA 3IU3A 5CMAA 5CUSL 5D1XC 2Q8BH 1YDPB 2KKQA 2EZ0C 3QZWA 1P7HL 4LF3A 3WUWA 1I8LA 2BVYA 5CILL 3VXMB 3UTQB 3RA7H 4O4YH 1BFOA 4QT5B 3BWUC 2GFBB 2HMID 1U8JB 4GKZB 1T6WA 4Y88A 4XNZB 4Z7NF 4IIQB 4WI8A 1BLNB 3BJ91 4PIRF 4PGCA 5CEXB 3OAZK 4OFYA 4ZO9A 4PJIB 4ZUSB 4NN6C 3LDBB 3LEVL 4X80L 3W82A 5DGQA 5HGHA 3RTQA 1OT1A 1JPGB 1IGYB 4PUBL 1O7SA 4X6FA 3BGAA 3RDTB 3C5SB 5D2LA 1D7FA 3BP4A 3G6JE 4U49A 4BELD 5HYSG 4ENEC 2V9TA 3C6LC 1JTOA 4G6AD 1IGFL 4P9MH 5L2KB 5IKCB 4MGXA 4F7EB 3GK8H 4S0SD 5KAQF 2KZWA 1TQCC 2NY6B 1JTPA 4JKPH 2ZUSA 1DTUA 4NHCH 4OM1L 5JOFB 4U1KA 1FV1A 3MRBB 3REVA 2Z35B 5L6YH 2J1KA 3GJFK 5GSRA 4UINL 3OJMB 4RAVA 1CXHA 1JYWA 2ZZUT 2ARJQ 3NGBC 5EIVA 1M4KA 1MIMH 2CIKB 2CLZB 4XNYL 1Y6MR 2ICCA 4ZMAT 2PO6D 3T4YB 5D5MA 2Y06H 1J88A 2X1XR 3LH2L 1EGJH 4HIEB 4R2GB 1FLTX 4YHNB 4ALAH 2O5XH 4YHLL 1P6FA 4YHZH 1J0HA 3O6FA 3FFCB 3PP4H 2PR4L 4QYOB 1N5YL 5C07D 3CD4A 2HKHH 2DMBA 4KPHL 4NKIL 4L1HA 1DQQB 3EYQD 5E6ZA 3VFNB 5I1EL 3N1PC 2OMNA 2V17H 4C4KO 1KEGH 4HWUA 4PJHA 2F53E 5J3HC 3UJJH 4NN7C 1I1AD 1S7XB 2IGFL 1DUYB 3MLZL 4FN0A 3T0EC 3TM6A 5IR1B 2ZCLH 2DICA 2CLVA 2I24N 4DKEH 1JYNA 3MRPB 4C56A 1KLUA 3EDDA 4NHCL 1W72H 1CYGA 4K8RC 4Q7DA 4WI5A 3ULUH 4OIIL 2DMKA 4UT9L 3PIQA 2I07A 1FSKC 1FNEA 4EN3D 4OFDA 1JBJA 1EEQA 3RDTD 3IJYB 4Y8DC 1MAKA 1LEKB 1E28A 3P3YA 1K3ZA 4P5TB 3WXVH 1JZ2A 3K4ZA 4X9FA 2FYYB 1E27B 4LVEA 3QXAB 4XNMB 2BCKB 3U9PH 1OM3L 1ZMYA 2ADIA 2YPLB 1BQHB 2XWTB 4PRIB 1T0NB 1EFXB 4JAMB 1ZGLB 1HYRC 4XWGL 5DF0A 4RGOH 3CVHH 4FFZL 4O5LH 15C8H 3HAEA 4IOIB 4JDTL 2IMNA 2PCPB 4AH2A 1DQQA 3RY4A 2GY5A 5TPWL 3DYOA 4JY5L 4FQ2H 5JXAL 5ENWB 1QFWL 2J8UA 4D0CB 5CGYC 4XI5D 1MF2H 1MSPA 2XRAH 2CSPA 2CGRH 4C83B 4BUHA 5KSAC 5MENA 4WUUA 4B53A 1DLHA 5CKAA 3TVMD 3HZMA 5HHPB 2CK2A 4KK8D 4MB3A 3CMOH 4PLOB 2VLJA 4X99A 3BP4B 4HLZH 1BQLH 2GJ6A 2WP3T 2J5LC 5DJAB 1FG2B 3BPCA 3TBTA 1S78D 1OLLA 4F7EA 1MCKA 2P8MA 4KAQH 2HTKD 4E41B 3MLYH 3KPQB 3QXVA 2CD0A 3JUZA 3MBXL 3O2VH 4LASL 2DI7A 3L7EA 1YEKL 4HWZA 3F5WA 1SBSH 2IAMB 5DEFB 3WKMH 1UQSA 4PJ5B 4ONGL 2EH7L 5DK2A 1G7IA 2EE6A 2VDPL 5DHYA 3STLB 3RIFK 4NKIH 1RY7B 4UQ3B 1JN6A 1Y6NR 4M02A 2CIIB 3H8NA 3STZA 5JMRA 1MI5A 4XMPH 4JZOA 3OGCB 5CJ8A 1BQHA 1KJVA 4DEPC 3RPIA 3ARFB 5GGVY 3O6FB 4WCYL 4G3YL 3CDGB 2ATPB 2J7LA 4ODHL 2IG2H 2ADGB 4X4ZA 4LHUA 5HGBA 3T0EB 4HD9A 3V0VB 4ORGB 1CBVH 5IR1A 5EOCJ 5DVLA 1IZKA 4P4RB 2OMBA 5EULV 5DMIL 1WICA 2LU7A 2VMFA 3VRIA 3RVWC 4TPRL 4N0FB 7FABL 4RNRB 3O4LB 5INCB 4X98A 4NZDA 1T04A 2APXA 1U8LA 2DDQL 3PABB 4JQXC 1YEDA 2PXYB 5J9PA 3KLAA 3DX6A 1K3IA 1A4KB 2J4WL 4O58L 4DKFH 4AQOA 5L9DL 4YXHL 3QCUH 5FUCC 5F8RC 3P30L 3DNKA 4YHKL 3X14B 4RX4D 2Z9TA 4X0KA 5HVHC 3O4LE 3FJTA 4P3CH 3V7AE 3C60C 4XPHL 3MACL 3RKPA 5DMGC 3LIZL 3EYVB 5D1QA 4JZJA 2Q76A 3AS2A 2ADIB 4NP4L 1EMTH 3D69A 3U9PL 4I18C 2DQCL 4W68A 1CBVL 3E3QC 3OXSA 3CFDA 3K3QA 3TP4A 3W9EB 1FNAA 1YNKL 4K94L 2P5EA 4RMSA 1MHEA 1MCRA 1KBGH 4NQXB 1RIHH 1EEZA 2VDNL 2ZSVB 3ARBB 1KB9K 2YRZA 3B9KD 4XWOD 1WFOA 2VUYA 1CR9H 3DSFL 3G6JB 1KCLA 5D2NB 4HGWA 4Q9QL 3LOWA 4MD0B 4TSAL 4UOJA 1P53A 3TZVA 1JHTB 2A6KB 4RRPA 3GMNB 4OJFH 3WLBB 1IL1B 1K8DA 4FQXD 2F54D 1S5IH 4CU7A 3H9SA 4MQ7A 2NZ9D 1U8LB 2A77L 3LZFL 3PABA 1HEZA 1DUZB 3MRQB 1PBYA 2E7HA 4OZGE 3SHSA 5EFIB 3QXDB 1U8QA 5F88B 4I18B 1N59A 1UFUA 5CAYB 1QOKA 3F5WB 5CWSB 2WK2A 5KOVC 3MJ8A 2CMRH 1KEMH 3C9NA 2VLKE 3O3BB 1CXKA 5DHYB 3PWJB 4QO1A 1N5YH 1J8KA 3NGBB 4LSSH 4CU8A 4J3WA 4PJAF 4WHYH 1U8HB 4RX4A 1TQBB 2X6MA 4NZJA 4RCAA 1IGTB 4PJ9B 3GIVB 3D48R 1CGTA 2HLFD 3T08A 4CN4A 2ADJB 4K8RH 1FL3B 3I9GL 1S7WB 2HRPH 3IDXL 2EEDA 4NZTH 5DO2D 1W0WA 4I77H 4N8CH 4HUXA 5HYJD 2ZG3A 2G2RA 1UENA 4A6YA 4U7MA 1WBXB 3BEWB 3BWAB 1FRGL 5IW1B 3MPCA 4C4KT 4ODHH 4R96B 1AD9A 1P84J 5C08A 1JHTA 1P1ZB 4POYA 4RMQA 3GMNA 4NZRH 4WHCA 1A1NB 4PJ8C 2W0KA 3BRFA 5JQ6L 2FL5B 1HKLL 4NT6A 3MXWL 3W9DB 3S37L 1NGPL 3RX7A 3LQZA 3QAZC 1S7UA 3LKOB 1NCDL 1QLEH 2ZNWA 4Z0XB 1OGAA 5A16B 5GIRB 5C0BA 6FABL 1C8PA 3TJEL 4ELKB 1A6TB 5F1IB 3IJHB 5IHBA 4Q9BA 4DVBB 1F13A 5KAQG 5FUZL 2DLIA 1VACA 4Z7UE 5I1HL 3CXHK 1SJEB 4NNXA 2A0LD 3HPLA 1DDHA 4LEXH 2X1QA 1IKNC 1IGCH 1MQ8A 3T1FB 4YEFA 4RFNC 3RTQC 2VC2L 4LASH 4OJFL 2BNUA 2ZCLL 1LEIB 2Q7YA 5AZ2H 1QSVA 4NZRL 3I02B 3VCLA 2MOVA 1C08B 1FZOB 5K9JL 4MHHG 1Z0NA 1CFSB 3TIEA 5C3LD 5J7CC 1CG9B 4OLVH 5FYJE 4UINH 5DURB 5DEZA 2V2WA 4WEBL 3INUL 5E8NA 3VFRA 1WZ1L 4ZUWA 3JVGC 1Q0YL 4LRIC 2LFGA 1MJJA 4HC1L 2NXYC 1MPAL 1MRDH 4GSDH 2J8UF 1EGJL 3P4OA 4XXDB 4BSJA 4I0CC 5IVZA 4G6FD 5HD8D 2A9ML 3BDYL 1X5ZA 3BGFB 1NAMH 4V1DE 5A3IC 1A6VH 2W9DH 2LABA 4JJ5B 5IJKA 3N1GC 3L3KA 1PFCA 3QEGH 4KWUA 1WBYA 1ZANH 5EU6A 4PYGA 1T1YA 1YEHH 3PV6B 1N5AB 4NZUL 4GKNB 3ULVD 3T0BA 2LVEA 2W65A 4PB9L 3O6MH 3LPGA 4QRSA 2EKJA 4WTZG 3RBGA 3D25B 2PF6A 1E4WL 4ZUTB 5F1OB 2R0LL 2JJSC 4Z7QE 5J6GB 1FHGA 1NCCL 4Y16D 1U91B 3QG6A 3WIIH 1YA5A 4HZLB 2G5BB 1CT8A 5EU7C 5E94B 1Q9OB 3VXRB 5EO1A 1OY3B 5JHLL 3E0GA 2EECA 2BC4B 1IQWL 1KGCE 1S9YA 1WBXA 5DS8B 4D0DB 3O6FD 4K3DL 3ESUF 3BH9A 4G8IA 4Z77B 1NMCB 1DLFH 4AEIH 4C54A 3B43A 3VGAC 1VGKB 1DBJH 3NFNB 2P5ED 2OL3A 3QEUA 1CLYL 4M1CC 4APQD 2A2QT 4KMLB 5ANME 2GK0B 4UDUA 5DJZA 4CW1A 2W9DL 1T5WA 4RFNB 3IETA 1TNNA 3Q5OA 4ODTH 1OLZA 2VITB 3BYTA 1XH3A 2WUBL 3VXQA 4XPHH 5GGSA 3TT3L 3U1SL 2A74B 2E6QA 1NGPH 4JO2L 4ZTPL 1RMFH 4GG8B 1KPVB 2WBJA 3SDYL 4P4KC 3KNBB 2NNAB 3WFEH 4JE4B 4NN5C 4R4NC 3MV9E 4ZUUB 3LSOA 1ZLVH 3WHXA 1FL5B 4QOKB 5C0AE 1CFQB 3BE1H 4TRPH 3VWJC 3KYMB 5CGMA 3MV8B 5DQ9B 3DSNA 4Q74A 4JRXE 4WW1B 3O6KL 2VN4A 1JZ3A 2VJXA 3S37X 1DLFL 4NRZA 2NPLX 4ZSOE 4X5WB 3HMWL 1ZSDA 4LLDB 2Z35A 1HXMB 5KW9H 5EO1B 3BQUC 4NQEE 1KELH 1UC6A 3CZFB 5D1XD 1BM3H 4L9LC 5J06A 2UVEA 5DS8A 4UQ2B 2NXYD 5D2LF 1WIUA 4ODTL 3IDMB 1OAXH 5GRWA 2MQ0A 5GZOC 5F3BA 2IC2A 2V6HA 4X7SL 4QNPF 1BMGA 1X5HA 4F8TA 5I1EH 5DFVC 4L8CB 3JVGA 3SGJC 2WIIA 1EIBA 4CDHA 2A9NH 4U1GC 5IVZB 3V5DB 2BXYA 5J6HA 4DN3H 3OXRB 3UBXI 4TNVF 4KJPC 3ZDYE 5BW7C 2OR7A 3RTQD 2N56A 2YPLE 3GGWA 4PGCB 4O02H 3G6DH 2VRAA 3ARGA 2VLRD 4P4KD 1KNOB 2XQYG 1JPGA 2IQ9H 5LGJA 1LO3H 4WFED 3KPLA 3K1DA 4OD1L 3QJHB 1RVFH 1WTGT 2YK1H 5K9OA 5I1CL 4HLZG 2W38A 5D7JC 1GPOL 4IM8A 1G6RA 3GMQB 2V9RA 5C09E 5DJ6A 4YBLB 5IMOA 3CFBB 4BH8A 3BKJL 3D0LA 2DL9A 2ARJB 3VWJA 2XKUA 4JFOA 3LRHA 1FN4B 4NRXA 5JO5B 4LSSL 1PX4A 4X4YB 2PO6B 4YIQB 1WT5A 3TVMC 2COQA </