3FFOA

F17b-g lectin domain with bound glcnac(beta1-2)man
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
176
Chain Sequence
b'VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adhesin
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 44
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3ffoA00
1O9VA 1ZPLA 2BSCA 1O9ZA 1O9WA 2BS8A 1OIOA 3FFOA 2BS71 2BSBA 3F64A 4K0OA 1ZK5A 3F6JA
chains in the Genus database with same CATH superfamily
1BFVH 1JGUL 1BREA 5JW5B 5F21B 4QRUA 3RVTD 1TZIA 1KN4L 5D7LD 1F00I 2C9XA 3A67L 4CVZA 3OR7B 3RIFK 3NK4A 3DRTA 4NHCL 3S34H 3WKPA 5EZPA 3BPCA 2RACA 3TXAA 2EC8A 3FU9A 3QJSB 1UT2A 1URLA 2IAMC 3PUUA 4N8PA 4RGMB 4XVOA 3TIEA 4AYDC 4F20A 1OIOA 2ICWI 1BYOA 3UTQA 3QQNA 1YEIL 3FH7A 4E68A 2UZXB 3F7LA 3H42H 3MACL 4AGMA 4R7DB 4GFTB 4HJ1A 5AW1B 3Q06A 4TLUA 1ZHLA 1QABA 5DK0B 2YPKB 4GQPH 1F3DJ 2VR6A 4HOWA 5IQ7H 4OGQC 3DROB 5FOBA 2FK9A 4LOUD 5AD0B 1GS6X 3LX9A 4MDRA 1FRGH 4Q89A 1JPGA 3VNZA 2B20A 3UERA 3BEVA 1VKXA 1EJOL 1QFWM 1J0ZA 4RFOL 5E9NA 2YEZA 2V3FA 3DBXA 1RULL 1JZ7A 3GINA 3L3DB 3CHRA 1FC1A 1T0PB 3IF1B 3NCEB 2Z4QB 3WG7B 4I9XA 2GIMA 5KVFE 4K2UH 1G4RA 2XKNA 2YEQA 4P8QA 5FUCC 3NUKA 2AW2A 4WV1B 5CJXA 1GSMA 2K4AA 2VXSL 3QUXD 3QDMB 3U6XA 4H40A 5L2JB 4PRBA 2XA3A 4CADA 4Z7OB 1AXTH 2QPUA 3FQUB 1NGPH 2UZPA 4XN4A 3TS8A 5BJTB 5A1AA 2BNQD 3UZQA 5A6IA 4CBZA 4F5CE 4MDIB 4XMTA 3IJEB 4Y19D 1YEJH 1IGCL 3IDIB 2X2IA 1XSKA 3PHOB 3T2NH 1U3ZA 1FIGL 1BVKA 1GGCH 4X0KA 5EWIH 1V7NH 3RZCD 3QNYB 4NZTL 5F3HB 1M6OA 4O02A 2Z65C 1AQKL 2OL3B 3DSNB 4N5UA 4OSUH 3HJ0A 1CE6B 3WFBH 3QRGH 3QIBC 2YBGA 4R9HA 3NZ8B 1YPZF 1HHJB 2WQVA 5IVOA 1CICC 3CDGA 3O6KL 2Q0ZX 1KACB 1PAMA 1YQVL 5AW7B 4QOKB 5HGDB 1AKJB 4I3GA 4NIYE 4OLVH 4P2OD 1X5FA 3KYOB 1CR9H 4CNIA 1J8KA 2BC4B 3HB3B 3NEXA 1X7QA 1OP5K 1S5IL 3FCSA 3D25B 5D7LE 1CL7I 1GW0A 3ARBD 2O61B 1GGIH 3SPGA 1ZANH 3BZ4B 1F4HA 1KBBA 1V5JA 2QGDA 1KFGA 4MASA 4PRIA 2F7OA 5B7EA 43CAA 2YMTA 3AWFA 1KGXA 4TVPE 2GPZA 3MFFB 2GY7B 1IAKB 2CBTA 2BP3A 3QFJB 2A74C 3B3IA 3X3GH 3P11H 4UV7H 5DVOA 4BH7A 3A4DA 4DGUA 5FECA 4AEIL 2YD4A 3ZW3A 5C0RL 4KRLB 1HINH 3FT3B 3NRQA 4P23D 2OI9C 5BO0D 3SZKC 4PCTA 1KENH 1NAML 1E9QB 4NQCB 5I8EB 1FYHB 1XXFC 5C3LD 1JVLA 3FO0L 5DU7A 4DKAA 1A1OA 1IO4C 3BHBA 3C6LA 4I48B 4RMSA 1C16B 1U6AL 4N1CA 4FX5A 4Q9RH 1G7HB 3PGDA 4XP1L 4K7PH 5AUMB 3G5XA 4ZFZB 1JZ8A 3CHQA 2CDFB 4UQIM 1IAII 4TUJA 2WZ0A 4UNVA 1XCXA 1SRDA 3L6FA 2QEJA 5TDNA 5C9JA 5J7CC 4R96A 3LV3A 5GJTL 4K3GA 3QDJB 1XGRA 4PW4A 2XQYG 1ANUA 1ZRUA 5AVSB 4KK5D 5C2BH 5ANMB 5I19H 4MJID 1BAWA 1KDIA 1Z3GH 2NY0B 2AI0L 4X5XA 1DQLH 5FO9A 3BH4A 3FTWA 4GXUN 3A6BH 1LXMA 2VLRB 2VN6A 3MGTA 2X9WA 4QXUL 3SCMC 1IQDA 1DE4B 3U6XS 4J2XA 1TZ8A 2ZUYA 4N0YH 4K4KA 3UGUA 1KGWA 4XP5L 4YHPB 4D0DA 4NUGH 4D0BB 5BQDA 2EDHA 1BIHA 2Z7WA 5FGBA 4GQZA 1F45A 5AZ2H 1U8MB 1U91A 3GS0A 4RX4A 2LTQB 4ZOBA 4M4RB 4XAWH 5DFVD 1NM9A 1ADQL 3L9EA 4GKNA 1E3ZA 4LOFA 3RBGA 2Y69B 1TNNA 1JMXA 4PRHB 4LDCA 1H6FA 4JCWA 3RWFA 5JW4Q 2XXCB 1KLFA 2Z4TA 5SX5H 2R0LL 1FORL 4KXAA 3PRZA 5FCSH 5E1GA 5HDBF 4LRIC 3QQ9D 3QR0A 3D2UA 3MC0A 4U1JA 5FK9B 1I3GH 5EIIA 5IG7A 3CFIC 2P5WE 4NNXA 2CG9X 2PF6A 4PJ9B 1TNMA 3U30C 1DJYA 1IAOA 4QT5B 1HEHC 2X09A 5JHLL 3IXAB 1IGYA 3BGAA 3WUZA 3D0LB 5IQ9A 3H8NA 3FRPG 1GA2A 1F6AB 5TTRA 1AGBB 1DQVA 2HVKA 1WFIA 3CFDB 1HNGA 4GO8A 3F7YB 5A43C 1AXIB 3A6OA 3SE3C 1NLBH 3M86A 4Z0XA 4OF6A 1MXGA 4M7KH 1MCNA 1PG7X 2CO3A 2Y06L 1OAZH 4CMHC 2Q9OA 5I16A 3KWVA 3S88H 4AYBA 1OARL 3VE0A 4IGBA 3ULUL 2EH7L 1IU1A 1RU9L 4RMRA 2V2TB 2GT9A 4RRPG 1HCFX 2JJWA 3ZE0F 2AFNA 4PV9B 4WW2A 1GMEA 2J4WH 3GSWB 3FU7A 4OIAA 1CGUA 2ZJSH 5I1AA 2APSA 4YMPA 5JR1H 4WCYH 1U42A 1XSIA 1Z5LA 2JI1A 2VAAB 4P48A 3TO4C 4DK3A 1LGVA 3EXLA 3QB7C 1ZS2A 3REWA 5T33L 3EH2A 4HALA 1V7MH 5FO8A 2CGZA 2XV3A 1M05A 5L88L 1ZV2A 5F88B 4U1GC 2K6WA 3A6CL 5AB1A 4S2SA 5D4JA 4JX0A 3DK2A 1AGFB 3PWPB 3NOIA 2FZ3A 4Q6IC 4YR6B 4DZ8A 3NN8B 1IVLA 1L9PA 2WBJD 4D7BA 1P7QA 1NFKA 1R3KB 2HT4D 1Q0XL 2KI6A 1TZOA 4H44C 2A1WH 5DEJA 4F3FA 4I0PB 3ULVH 3DVGB 4NCC1 5KSBB 5FR3A 2JKWA 2ESVE 4NKMA 4GAYB 1EFXB 1PZBA 1X5HA 5H37G 5MI0B 4BA8A 3U2JA 5JW4M 2N56A 3DUHA 5IROC 1LNUA 3MYJB 1UM4H 4AE0A 1F3JA 1F0LA 3K5RA 2Y07H 3FT4A 3KEHA 3A5VA 3TVMC 4TOYL 4K3JL 1U95A 4GRLC 4WNQA 2DDQL 4CVXB 4NERA 4IMKC 5GGSA 1NFDE 2XRAH 2XWDA 3DGDA 3EH5B 3K2UH 4QCIB 1ZSHA 4UT9H 3RDJA 3VXUE 4OUUB 1RIUL 2BVQB 1O6SB 1BBDH 3TV3H 2GJZA 5E4OA 1HSAB 1MXDA 3DECA 1KPUB 3HPLB 4NDMA 1SDDB 1GS8A 5TQ2H 2K6ZA 5C0IA 5DZOA 1G0XA 4XNUL 3QNZA 2FWOA 1ILSA 5J11C 4N90E 5AKRA 4XNYH 3ZYOA 4CKVX 2E6PA 1Q9OB 3QIWA 5JDSB 1CFNB 4YQXL 2R9HD 1T0MA 5MP6L 1LO2H 4AEFA 1ORSA 1R3IH 2OL3H 3CBJB 1QUPA 2H8PA 1KTRL 1E43A 4JMXA 3WO4B 1TJIL 2Z92B 3I9IA 1S7TB 2WINB 1F86A 1HDMB 1XIWB 5F44A 5AG8A 2VDML 4W70A 3ABGA 1VFBA 1H3VA 5IT2H 2HKHH 1O6VA 4MQ7A 3H9HA 2AXGB 3GBNL 3WLWC 5GS2D 2HG5B 2Q6WB 3UJTH 5IESL 1N6UA 5FGCE 3RVTC 2LFEA 2OMYB 3RL1B 2E7CA 4TQIA 1WD9A 1EUTA 1OAUH 2QHRH 3NABH 4ODUA 2D0GA 3O6FA 4JM4L 1O7SA 1ZT1B 4IDLA 1L7TL 1P84K 3KR3L 3QORA 3SGEH 1H6TA 1LTXA 4CMMB 3ARXA 1JF1A 2L4OA 1CK0L 4RX4D 3ULAB 4H25B 1PY0A 1G9NH 4N9OB 3SYCA 2DBLL 4OFPA 1AE6L 5E2WH 1PZ2A 2BM3A 1PX4A 3DOIA 4QPEA 1G7PB 4IBZA 4NQXB 3KW8A 4JANB 1E2VA 3O4LA 4YXHL 4AQAA 3UBXB 3WS6C 3QH3B 2ERJC 3FOLB 4RGNC 5GS0C 1K2DA 1HNYA 1VFOA 2Z7UA 1A14L 1JYXA 3D2UD 2AJVH 3CXHK 1C5DA 1HI6A 4I1PA 2WNKA 1QR1A 5FFGA 3CGTA 1WJ3A 4MXVE 5DQDH 1TQSA 2EXWD 2DIEA 1WBXA 1YC7A 1KWKA 2C1OB 4AQ1A 3U7WH 1KJMB 1INDL 3SPIA 3MGAA 2X7LA 3H0TA 1Z9LA 4W4OC 5FYJH 4PRAB 4Z0BL 1G1YA 3EYFB 4DUWA 5IFJA 5I71C 2KQMA 2MHAA 4DSYA 3FO9B 3CC5A 3GUTA 1PFOA 3O3DB 2H6PB 1X3DA 2B4CC 2FHFA 4GRWF 4HZLA 1G5GA 1TXKA 4PREB 4KGLA 5DJAB 2OCFD 4UM8A 4DKEL 4JO3H 4P57A 3SY6A 1A1MB 4IGBD 3RWJA 2VUYA 3OAZH 3PWUA 4DPCX 3O3AB 4NAQA 5E1AA 1A65A 2UWEA 3BC9A 5C9KA 2AQ3A 4WY7H 1EDYA 1BSIA 2CO2A 2XDHA 4G5ZH 4R5VA 3UTSE 1WAAE 3K4DA 1UWEH 1AC6A 3C6SA 4ZRGA 5IEHA 1RZPA 1FCGA 3D4CA 2Y24A 3LXUX 4P4RB 4PG9A 1A6AB 1QSFB 2WM0A 1RUAH 3T04D 2ZZUT 1PW3A 3FN0H 3NIFB 3BFOA 2UXGA 4G7RB 3BQVA 2IOIA 3V95A 3R06A 5GRJH 5IHUH 2NY5H 4XC1H 1CDGA 4ZS6C 3BRDA 1J8HD 4IBLT 4X4KA 4UBDC 3TC9A 1OTTD 4L8BB 4ZW6A 1RPUA 3AQYA 5KS9B 3IXTB 3UPRB 2VWEE 3DX8A 1R47A 4AW4A 5E5UB 4AIZB 2VH5L 1KULA 2RCSL 5DRWA 2I25N 4BGDA 5BW7C 4V2CB 4HGWB 3I3EA 4FYSA 1P7QD 3HZMB 1OK8A 3HHSA 5MENB 3E7JA 4LSRL 5JIMA 3MUJA 2YMOA 4JFZH 5ALBL 1CTNA 2JJTA 5D72L 4LF3B 1XB3A 1J48A 5DD0H 4ATTA 5JW5A 1KZQA 3B9VA 2IANE 4XPAH 3MLZH 3GNMH 2OZNA 2YXMA 4X4XB 4XCFH 3IMRA 3ZDYF 4Y5YB 1QKZH 4Q0XL 4QHMB 3O8XA 4WQOA 4JQIH 1KN2H 1G6RB 5TD4A 3T3PE 1AQDA 5CN2A 4DPBX 1AMYA 5A2LH 4UAOC 3RUGB 4GMSH 3HE7A 4FQXA 1CF1A 2ZOLB 5HGAA 1CXKA 1GGYA 2MQGA 1QNZL 2XN9E 2YPKA 4XB7A 4AEHL 2WLMA 2WANA 1JZ2A 1OANA 3NEEA 3DROA 2P49B 5AD0A 1OP9A 5EBMB 4WWKB 3TBBA 1B0GB 5I1HH 3CE1A 3GF8A 1KIPA 1GL4B 3N43F 1NEZG 4QRSA 2FIRT 3ARZA 4U6HB 4XXWC 3WLBB 1E5AA 3QIWD 1ZT7A 2OMXA 1YEGH 5E23A 2YLHA 1TVBB 2C3WA 4ZFQA 4HKJA 4IBYA 1D7FA 2HLEB 5IQMA 2Z4QA 1IFGA 3P3UA 4JFEE 5KBMA 4RDQG 5INDA 2WKOA 4LO9A 1QRKA 4A7GA 1WC7A 2VKWA 5AVVB 1SQ2N 2KDYA 4MJJA 4WV1A 1RJYA 1T2QH 4KK5C 3IVKA 4OLXL 3QDMA 1AKPA 3HJEA 2M1KA 4ZYKB 3VI3E 4JJ5B 3REVA 3MQIA 4JRFA 4OF5A 1J0IA 2NDGA 3BYTA 5F9JB 1GPOL 3RWEA 4YDZA 3PFUA 5CUSH 3FNKA 5DZVA 5KZCB 4KROC 2YJQA 2UY6B 3ZT7A 2GJJA 2PW1A 3OF6D 3MA7B 2VYRE 3CXDL 3GKWL 3BMVA 2E9GA 2JJVA 3KYNA 3QQ3A 1H9DA 4HXBL 1W9XA 4M6NH 3V5KA 2FD6L 3B2PA 1ZA3B 5F3HA 4CC4C 4Z7VB 2D4FA 3DSNA 5DK2A 2AK4A 3CFCL 3QORD 3UEZA 2XBZA 2BS71 3LAFA 4Z7WA 3ZKXC 1OGAD 4UMGA 1JGVL 4XPFH 5I1IH 2ZCLH 3PWJB 3EOAB 4A7QA 4FFYH 2NY3C 1O9VA 3I9GL 5B39B 1KJ2B 3HNVH 1JFQL 2AJXL 1ACCA 5ISZE 2BH0A 2FEDD 6TAAA 1WWCA 3BVVA 3GIZL 2V17L 2VR5A 1AD0B 3FW6A 3VFPA 2WWMD 1U8IA 3VFMB 4C56E 4J8QA 3D08A 3VRIA 4ZW7A 4BDVB 1LEIB 1HZHH 2F58L 4JFFB 1AI1H 4Y9GA 5A16B 1ZSDB 1SYVB 2X88A 3NCFB 3O2WH 2W07B 1OV8A 2H3NA 2PYEB 2WTRA 3QFJA 4MZIA 5CJXC 2CLRB 1BZ9A 3JVGA 1JWSB 3O2DL 3KLAA 4XWOD 1IGTA 3P69A 4RLDA 2J5LB 4NJAL 5CO1A 5F7EL 2G5UA 4R83A 3VXMA 1XGTA 5I6PA 2L7UA 5D96B 1U8OA 2DJMA 5E2TH 2JJUA 2VZOA 1OPOA 4NQCA 4PS4L 4F2MA 4LQFH 3STBA 3ZJAA 2P43B 1I82A 2VDLB 1Z0NA 4FNTA 5DHMC 3S7GA 3GSNB 1UM6H 5C92A 2CHNA 3IU3B 4LRNH 3RB5A 4NJ9L 4OTXL 4XP9H 3SGEI 1N5AB 3R4DA 1M42A 1UOWA 3DVFA 1M7DA 5E8NB 1ZVSB 4ZPVA 2BIOA 4K94H 1KCUH 2X40A 1KIUB 4J28A 3SGJA 3CK0L 2UYLA 4AL8H 3CSTA 3SJVB 3O3BA 4KZ0A 3CXFA 1PKQA 4LBEA 4JKWA 3G08A 4KHTH 1R0AH 3G6JF 5K9JH 2HT4C 3B1TA 4U1SB 5HPMB 2PPCA 3KPQB 3GGWB 5DMIH 4RGOL 4KFMA 1VADA 4LIQL 4AJVA 5IK3B 1KFAH 5CXPA 4F7MB 2F7PA 4RZKA 5BXFB 1NCHA 4UQ2B 1CBJA 1S3KL 2EUVA 1QP1A 3OQRA 4Y16B 2X44D 1L0YA 2XICA 3LZFL 4BA0A 4TSBL 2DZEA 4NKIL 1OGAE 2YAQA 3D69B 2EP6A 5D93B 2I26N 5T3XH 1B9KA 4GBXC 5DJ0A 3QJTB 4M4RA 5T1KB 2DTSA 1I1AA 1I53A 3OPZL 1SMDA 4L8CB 5EEXA 3B9DA 3OB0K 5K9QI 1D5BB 2R0KH 2EE9A 3FMGH 4KJWC 2ATKB 3G5WA 4N2LA 2QDWA 4N26A 2A77H 5DGQA 4J3SA 4OJFH 3HE7D 3ZTJG 4FQXD 4OZHA 3I75B 3ULVD 3C6LC 3VDCA 1CFTB 4QNPF 3IGFA 4XZUB 4WKZB 4BFIB 2ZSWA 3BGMB 3SY0B 3QO1B 1GR7A 1GS7A 3AG1B 3DJTA 3GBLA 4LHUA 2PR4H 32C2B 3NK3A 4ODSH 4ADIA 1EO5A 3VX0A 4N1HB 2AJ3A 1NWOA 1QPPA 2I85A 4QT5A 4GLRH 3BAEH 3GMLB 1H8SA 2HMID 1MCBA 3CSPA 5HHMD 4LVEA 2OAAA 2Q2EB 3OXRB 4IRJB 4MJ5A 2CK2A 2ADFH 4JQIA 1N59B 5AKSA 1A1NA 4XP6H 2AEPH 3AMKA 3FONB 3M7OA 1QSZA 3F7YA 4NZDA 5HYIA 2CHDA 3KPSE 3QDMD 2DQJL 1AH1A 4M6AA 2P5EE 5JQ6L 3MV7A 1YEEL 4L4TE 2D7MA 1NCIA 4PH8A 2WMPB 3HG1B 4U1IB 1MCQA 2J7LA 3VXRB 5HVFB 2V2TA 1Z9SB 4JREB 4R97B 4WGVB 3FU8A 4WUUB 3WNJA 2VW6A 3KH4A 1DEDA 1RV6X 1P7BA 2C9VA 2HYMA 1IE5A 3S9DB 2WOYA 3QXDB 4GUPA 4F91B 1CD1A 2NW2A 2XTJB 5FGBC 1T0OA 2C7FA 4L0ZA 2XY1A 3WSQH 4FP8L 4N0UE 2PNDA 4TVUA 4EDXB 3V0VA 2ED8A 3SBPA 1AHWB 3QUMH 1T7YA 1ZEAH 4KVPA 4P2QA 5A6MA 2HWZH 1G6RH 3L9YA 1QA9A 1OE1A 4OZ4A 3BP5A 1ACYL 1CVRA 4QOKD 1AKJD 5DI8B 4GAFB 4MCZA 5C09B 4QRTA 4HAFA 2LOEA 1VRSA 1XV8A 2XKSA 4BEIA 1JK8B 3NP3A 3GI9H 4LVNB 1W72L 4HJTA 4JW3A 2BSDA 2O72A 4GO9A 1IKOP 5CP7B 4CRPA 3LIZL 3LNEA 4G80A 2J88H 1JGUH 3VXPA 1OCWL 3BESR 4NN6B 2PP7A 3F7VB 4B97A 3RNKB 4LLYA 3RWDB 3EO1A 1G94A 3QFJD 1MCHA 3LN9A 4LLAA 2DL2A 4NQEB 4WSGA 5ABDE 4FFYA 4IGBC 2H1LM 2VGLM 4HSAC 1X5ZA 2NNCA 4UQAA 4NQCD 3EHBB 4JFDE 4WW2C 3R7RA 3HFML 3UTPD 1QSEE 4ANXA 3W37A 4YAQA 3U36A 1IJ9A 2F8OA 2YRBA 1FQ9C 2DTML 5BRQA 1AO7E 2D2OA 2APVA 4OAWB 2DH2A 2A9CA 3BIBX 1BQRA 1EJOH 1S9YA 2FL5B 1HVXA 2HG0A 2NXZC 5FYJD 3O9WA 4I85A 4OJAA 2W65A 1RULH 2BP0A 1T4KB 3W56A 2YD8A 3TA3C 5HI3C 5I6XC 5JLZA 4YHOL 2Z92A 4P59L 1S7TA 4JKMA 2WXQA 1T4WA 5FPIA 1MCCA 4BM7A 5C0AB 4AM0Q 3T8XA 3K8LA 3L54A 1EO8L 2XVLA 3Q3GB 1EQWA 3PGCB 5E1IA 4LP4A 5KANI 1Q9WA 3BSGA 3PV6A 2NY0D 2X4TB 3MRQA 3N40F 1J18A 1PTZA 2Q6WA 2H32H 3GB7B 2H26B 1MJJA 3EZ8A 3FB5A 3EFOA 3A23A 3RL1A 4MA3A 2AQTA 4LVOB 3VFSB 2VLRD 1IGCH 3T4AB 1FZJA 3R8QA 2VABB 5G55A 1FIGH 1CN4A 2BDNH 3QPXL 5HHPB 1JNLL 1QI3A 3EUDA 3CDZA 2ZIDA 1T03L 4NZTH 1HN1A 4EQ3A 1IB5A 2OXGA 4LEOB 4P5KB 4H25A 5D1QA 4PTUB 4PJHB 4QOKE 3DUUA 2GHZA 3FB8A 3RVXD 5GXBB 3LNIA 4OV5B 5CF3A 1W6LA 1ML0A 2X9YA 3HN3A 5CSZA 1G7PA 1WP6A 5IM7A 3UBXA 1KTDB 2VXQL 3O6KH 3V6OA 1YQVH 4A67A 2LQRA 4IOFD 4KKAC 1NICA 2VDLH 4YO0A 3UO1H 1FGVL 3VJ6A 3WAKA 4F8OA 3EYOB 3ARGB 3GSNH 3K8MA 5ICZB 3HUJB 4I4WA 1N10A 2DM3A 5BRPA 3GHBL 1B88A 4EOWL 4W93A 1C12B 1K8IB 3IGAB 1S7WA 2F54A 3MRDB 2VDQB 4M1GL 1FV1B 4PBVC 3SOTA 1Y7VA 3U1QA 2K1MA 2NUTA 4R4BB 3GMRB 1F02I 1HEJC 2O6CA 4PWJA 3DO3A 3L3JB 2YEVB 4G6AD 1BFTA 3UBXI 3CU1A 3IJ7A 5C0RH 3MV7D 4QHPA 1A1MA 4L2YA 2YFOA 3VVWA 3GDCA 4HX1B 1EZVX 2H9GB 5D2LB 4YLCA 3ZE2B 3FO0H 2RH0A 3L2NA 3PDOB 2YC1B 3O6FC 1COBA 1MG3C 3W57A 4NC1E 1U6AH 4X7SH 3RURA 3RTQC 5FM8A 3P0GB 4XP1H 2HH0L 3ZE1E 3QDJE 4D7PA 5DR5L 4JB9L 4MFHA 1R3HA 2VMJA 2ICEA 4P46B 4OI9A 1I3VA 5ABAA 4P2QD 4GP5B 5ANME 3KBHE 2O6FA 2K3HA 4X6CF 4EMZA 2SODB 2ENYA 2YBRB 5M7QA 3HLAA 4OCNC 5I76A 4HWBL 5F0PB 1DVFA 2WWOA 1I4FB 2VLRE 1C1EL 2A9BA 2YD9A 5I6LA 3OAYH 4I0PD 4YIQB 1JHKH 2AI0H 1NIDA 1ZXQA 3BD4A 5BMFL 2EE3A 4AQ1C 4JRYB 3TJEL 4MD0A 1FVEB 4KPHL 3US9A 3MGOA 1SHMA 3RX5A 5FFOA 3HRPA 4EIZC 1CCZA 3QUMA 4KK8C 4XP5H 4FE9A 4PRHE 4Z7QB 1CLOH 1CLVA 5EOCJ 3L9RA 3EBAA 4FQQA 2K7QA 3QZWG 1IGIL 4K5NA 5AYUL 4CSSA 5JIIA 3QZLA 3HZKA 5FDWA 3AXIA 2PMZA 1ADQH 1UENA 2A6JA 4ZNEE 1PEZA 4TNWF 1DFBL 1NEPA 1A7PH 3AQZA 5DQJA 4UNTA 1OLZA 4WWPA 2ZOLA 3OZLA 4L9LA 25C8L 2EEXA 4N3TA 3V6BR 3VGBA 2EDLA 2DJ4A 5DQ9B 5L8JB 2R2EB 1XF3A 3G5YA 1WH0A 1H15B 5J6SA 1LWJA 3AQXA 2BY3A 4U6HA 4HV8A 4ZUVB 4X80H 3BPNC 4KX7A 3W5MA 3L3IB 2WN2A 1FSKC 2X0UA 3WO3B 1NOLA 1PNDA 4QRRB 5JHLH 1GY2A 1TVBA 3B2MA 2ZWZA 1FZKA 3QYMA 2XN2A 3T71A 5INCB 3ARRA 1SBBA 4PJCA 4WI0B 4G8EB 4EXPX 4LASL 5HDRA 2ZP0T 4IS6B 2VDNL 4JJ5A 1XIWD 1BPVA 2IJ0C 3EJPA 2XBDA 1YSOA 3NPZB 5DUBB 3HIZA 1KCSL 2Y06H 2BCMA 4V1DB 1OARH 2JJTC 4TQHA 5FV2A 1GH7A 1BZ8A 2CZNA 2EH7H 1OO2A 2XQBH 2ZXAA 4N25A 2Q76A 5J06A 4JRLA 4XVJL 3T77A 2XWTB 1T1XA 4LLUB 5T5FH 2R2BA 1A6TB 4QD2E 5T3ZL 1B6UA 1UH3A 4JN2A 5L9DL 3FQYA 3O8XC 3JZ7A 3FZUD 1ZTMA 2X1XR 1KELH 5DD1L 2QHLA 3PWPE 4PJDF 3ZRCC 2BZCA 4PJEA 5AZEH 3WDHA 2GC4C 3B5TA 4U33A 4UIKH 1HESA 2WGXA 3BAWA 1X5MA 2X6AA 1U92A 5DC0A 4DFIA 5IFHL 1DQQB 5L88H 4L48A 5KSBE 3R0NA 2X4RA 3A6CH 3KMDA 3RVWC 1X5GA 4RQQB 1ZV9A 5DZJA 2VDRL 2E7BA 1GYAA 3DETD 5BRZB 2H32A 4GAGH 3OKMA 5EU6A 1Q0XH 2ICES 3C6EA 3MRCB 4P4KA 1RUQH 3GMPB 1BDYA 3VFMA 4K9EL 2EUZA 5J1AB 5DEZA 3VFRB 2WVUA 2ZXDA 2F54D 5ERWA 1TVHB 5T3XD 4UF7C 5KSUA 4A6YL 2J71A 3VDAA 4JDEB 3PWVB 4K15A 2WXJA 4MNGA 1MI5A 2Q86B 2YD7A 3ZLQC 3CN3A 4PJ7B 4K3JH 4TOYH 2V5MA 3E8UH 3ZQWA 3U25A 4QLWA 3WEOA 4BINA 4U1LB 5I8KL 4M93B 1JTPA 1GZPA 3GSQB 4NO3B 2AEOA 1NIFA 4NO2B 5TF1L 4KI5C 3C60B 3FCUB 3LB6D 4PCYA 1A8JH 1RIUH 3N85H 1HXKA 4GINA 4JAMA 5CJ5A 2GJ6E 1MFBL 3S5LB 5HHOB 3MLVH 4S1DD 2X2YA 4JPQA 2H0JA 3IU3A 5JTWA 3H3PL 1N5AA 1DQDL 4KVNH 1NDMA 5E8NA 2PTTB 4G8IA 3ZY7A 4YQXH 1QSFD 2F2HA 2FJHB 3HMXL 1MUJA 5MP6H 3U4KA 3KYMA 2XXGA 3BKJL 5LG1A 1OK0A 3GI8L 3CMGA 4Y9CA 1Q90A 5D6DA 5ADOL 4WK2B 1MFMA 4XCEA 1SJEB 1A6UL 2FJGA 2K9UA 2C1PB 1JN6A 3S6CA 3SODB 3T3MB 4RFNC 5F6HI 3TTSA 3H2PA 1U8HB 1INEH 1P5UB 2GG1A 4AUYA 2TRYA 1NAMA 2VDMH 3BKYL 4CDHA 5JIQA 4OW6A 5LAXB 2CO6B 5LLIC 4D9RD 1TFPA 3GBNH 5I26A 2KHAA 3FUFA 4OCRL 3FQNB 5IESH 2I07A 3KPNA 5E4AA 1QQDA 5ESQA 2DLTA 2J8UF 4YEFA 3RNQB 5IVZB 3CHPA 2VISB 3P1VA 3D69A 1FN4B 3BPLB 4BFEA 1N18A 3MMEA 1S5HA 5DHVA 1WUZA 3KPRA 1L7TH 4X6FB 1CD0A 1OW0A 3JVGC 3KR3H 5FGSA 4UQEA 1K72A 4ZOCA 4LPVA 4Q2ZB 5HVGB 4OBSA 1HKLL 1D5BA 1YN6B 2R0ZL 1DQKA 1JV2A 5TFSL 2QT6A 5ITBL 5IKCA 4W9CC 1HHGA 2DBLH 1AE6H 1AG6A 2EAEA 5K33A 1PCXA 4YXHH 1LK2B 4XX1G 1NGXA 2PCPB 4Y2LA 5EORL 3K71B 2O4EA 1SXBA 1UOLA 3OWEA 3OSVA 3BGMA 4I2XE 3OTTA 2VZTA 2FLMA 1SJHB 3FUDA 4ZMXA 3RJQB 1Q1JH 2VNCA 2HPTA 1A14H 4NQUA 4F8QA 4MNQA 3D0VB 2A7BA 5EFIA 4ONOA 5T5NF 3SGJC 1RK1A 2FH8A 5AAWA 3MLUL 1KPRA 4FULA 3EOTH 4D9LL 3O4OB 3OXRA 4IRJA 3JWNG 3MV01 2QBWA 3ASWA 2FWSA 4NRZA 4N2AA 4Y4HA 3L7EB 3MA9L 4NN5C 3VRLE 1X4ZA 1D2PA 5CZRA 1ADQA 1EHKB 4Z0BH 2IQ9H 2ZUSA 3GTNA 5EBLA 3NJGA 5BQ7A 2CLVB 2BK8A 1OD7A 1JGLH 2GSIA 5EBGA 5TE6L 4DKEH 3TBSB 3IDXL 3MI6A 4L1TA 1W8NA 5CLYA 3DURA 5KZCD 1NCTA 3UJIH 1X44A 3II3A 2A4CA 2C9AA 2GAZA 3P4NA 3WGVB 4A2HA 3NIFE 4Z6AT 1T5XA 1CXFA 4BFNA 3WYRA 1FZOA 4R0LB 2OMUA 5JHLA 4JFSA 1U33A 2NY5C 3QZNA 1NFAA 1I1AC 3SD2A 4N2HA 5L0QC 4R5XA 4NENA 1MWOA 4TSCL 1I7TA 2PPEA 2CUIA 1SGKA 2G75B 3GHPA 3IFNL 3MLPA 1M71A 5EU7C 3VFGL 3L4TA 3QIUC 3U9PL 1U9KA 2PETA 5MENE 2XIBA 4KVCL 1NFDA 3N91A 2BY0A 5K9KB 4FLSA 4Y2OB 1SN2A 1L6ZA 2K3TA 4KRPB 2ZOKB 5KN5B 2WO4A 3AUWB 2RCSH 4JFQB 4I9WD 1RIVL 3O45A 1KY6A 2AKRA 1K4DA 4AIOA 1CDCA 5L2KA 2YA0A 4LSRH 1CBVH 1U8KA 4P4KD 5CP7A 3AXHA 3VAEA 5D72H 5LGJA 3AREA 1OTUD 3FO1B 4H26B 1WDAA 4B9IA 1VCAA 3FN9A 1ZLDA 1TCRB 5B1AB 1R3LB 2CJ3A 3WUWA 5FC9A 2TAAA 1OSEA 3RUGE 2BHUA 4J2QA 2VT0A 2PYED 3K6OA 4Q0XH 1UVQA 3QWOB 2FUQA 4M00A 1IAIM 3RDTB 2DMHA 3S96A 3GXPA 2X05A 5KG9A 1AANA 3MJ6A 4YDLC 2ZT9C 5HI5D 1BX2B 1RZ8A 1QBML 4W9ZA 3ZN6A 1IM9A 1N8OE 3EYSH 4L4VA 4AI7A 3GJFB 5CCKL 4TRPL 3MBEA 3FSVA 1QNZH 1FNLA 1S8DA 2E9IA 2IWFA 4MRBA 4AEHH 3C5JA 2EECA 5J6HA 1MRDH 2EDJA 1W72B 4J8RA 4WHTB 3SDCC 1MZZA 3C5ZA 3GMOA 3VW3H 3LRGA 4PJ5E 3DPBB 3L4UA 2O5XH 4TUUA 3NIGB 1SPDA 4K5OA 4AVHA 4FA8A 2X4NB 2LV4A 1S4IA 1J05B 1I9RH 3IRCA 2YXVA 5CZKA 4YHNA 4J3OG 3SJVD 5AOKA 2VUKA 2EE2A 1UB6A 4FYRA 2GEQA 5BCAA 2IPKA 1U41A 4M5YL 3L1OH 4RISL 4ZPTA 1Q8MA 1XTMA 4U1HB 1EVUA 3QEQA 3KGTA 3S36X 1I7UB 5D1XB 3LRSA 5FB8B 4O00A 2MH4A 2BVYA 3Q3GA 1GPOH 1L0XA 1NCBL 4NRYB 2YPLA 1YEKL 2APWA 2C34A 2VXUL 5D7IE 4Z7VE 4OI8A 3NCJL 4U7SA 1ZLVH 4HDIB 4Y16D 3TEXA 5B3JF 2DKUA 2P8PB 3CXDH 4RSVA 1FA4A 1F4WL 4WI6A 2APTA 4HXBH 3ZMEA 4K71B 5IIEB 2FD6H 4RWYL 2M83A 3KPPB 1M3JA 2J8OA 4EUPH 5ID1A 3Q2NA 1A4BA 2CJTA 1R4XA 1CB4A 2GW5A 3VMPA 3CFCH 4P5KA 5T1KD 2ADGA 3ZK0A 1LJMA 3N1MC 2OTUA 4QY8A 1JGVH 2R23B 3QDHA 1QFPA 1TSHA 4C4BA 1KTDA 1QTPA 2OX5B 2XPYA 2V37A 4XMLH 4KO6A 5DTFA 4HD5A 3NIDF 5K9OB 3I9GH 2QADC 3QQDB 4HUVB 3V2AR 2JE8A 2FATL 1QHOA 3MOAL 3NSXA 4R5TA 3ZTNL 1HFUA 3U1SL 3UGXA 4JFFE 4LLVB 4YDKL 1I9IL 3DXAA 4KO5A 1HCVA 2CM6A 2B1AL 4JS7A 2GIYA 1EH9A 3O9WC 2IEPA 4IRJD 3S97C 4PFEA 4B7LA 2F58H 3KL0A 1JPTH 3EFDL 3MBWA 3MUZ1 4QRPB 4YHKL 3ZKSD 2GHWB 1RH8A 5K39B 4RESB 4R7XA 4PUBL 1KCRL 3ZHDA 3O2DH 5E8EB 1H0DA 4N22A 2HRPL 5F7EH 2JVUA 2CO7A 3T0BA 4QGYA 4YX2L 4JO4L 5I0DA 3L9BA 3RX9A 4PS4H 4DK6A 3KDMA 1JNNL 1HKFA 3VXRD 4M3KB 4JRXB 3U46B 2R69L 4FI8A 4L29B 1KLGB 3THML 2WQUA 1IAMA 1T21B 4X4ZA 4WUUD 1JD7A 3QEUA 4KKQA 2LLLA 3ARWA 1V05A 2A83B 4FHJA 3SJVE 4PJGB 5C0CA 2HT3D 5IEKB 3DV4A 1BF2A 4OTXH 2Z34A 2XTJD 3RKPA 4LMQE 1NMAH 1I85A 1CQKA 5D1QC 1DEEA 4YGVA 3RTLA 3CK0H 5D7EA 2WCPA 1NBVH 2GK0A 4WW2F 2WJ7A 5AW5B 4U3XA 4RNRB 5F70A 2YBRA 2R0WL 3TYFA 2BW4A 1F97A 3PXLA 4XBMA 3V6OC 3EYQD 5I6NA 3GO1H 2VSKB 3P9LA 4WFEE 2BFVH 2GJPA 5C09D 1S2EA 1YNTB 4ODBD 4LIQH 2IADA 3ATEA 1CT8A 1T83A 4TVSa 4G6JH 1JTOA 3ROOB 2O5YL 5L2KD 4S0SD 2OLDA 5DT1L 4JFOB 2OYMA 3MNVB 5E95B 2WZAA 1S3KH 2AQRA 2DI7A 3VYPA 4G9FB 1F3DH 1LMIA 4CC1A 2G60L 1NBQA 5EEZA 2Q8BH 2F15A 3BAIA 4ZTPL 4ZUWB 1FWXA 5GSRA 2FYYA 3VXOB 1B2WL 3LB6C 3UCRA 1NBYB 3OPZH 1T66D 2A6DA 1FO0B 2B14A 1Y18B 4P9MH 2R2CA 4KBPA 1CMOA 4HUKB 1PY9A 4JM2C 3QJZA 2CNYA 5DQ9A 3VI3A 4FG6C 2WXPA 4GXVH 3EHBD 1IM9D 5E5LA 1KJVB 1FP5A 1H15A 2DAVA 4XBPB 4GAAA 2NY7H 4FABH 1L9MA 5HYEA 2J43A 4HHWA 3BLBA 3WAJA 4L5FL 3KWUA 4ODTL 5E08L 3TO2A 3DX2A 3T4YA 3Q1EA 4ZMPA 3ES6B 1BVLB 1M7UA 1U8JB 3WFCH 4WO0A 3FU0A 4QRRA 2ARWA 3ZKMD 1Q0EA 1ZD6A 3F2LA 1LE9B 5AB0A 4QYOA 4YBQD 3TYGL 4APQA 1PFCA 3RWGB 4HUCA 3MRHB 3C08H 5E4EB 3GJFK 3HG1E 4IS6A 4GIAA 4S1QH 3VXRE 1T1WA 1DVFC 3GSOA 3W81A 2HFFA 1IE4A 2DQJH 3FJTA 3QEQD 2EIKB 4L8DB 4WUUE 4YL9A 5IBTL 3RX7A 2B9BA 4V1DA 1D5MB 2VERN 5JQ6H 4Z3EA 5JHDA 1JF6A 2EO9A 2L7EA 3G5VA 3JWOL 5HSFA 2JMRA 1NC4B 3RGVB 2XTJE 2YPLD 3H4FA 1OT4A 5E00A 2VIRA 2NNAB 4HH9B 5HD8C 1YQ2A 1IMHC 1J9CT 2ZUWA 2BSEA 2V5SA 1XR9A 5GJSL 3HN8A 2A73A 1N0XL 2OJEA 4U05A 3SDXA 4ZX3A 4FP8H 2UV3A 1WSST 2YAMA 1U3JA 5EEUA 4G7VL 1FL5B 3MDJA 3MV9B 3QJXA 5AWNL 4MA7L 3NYKA 4N2EA 5DRZB 2RFXB 2NYYD 3FB7B 4N6RA 3CZSA 5EC2B 3GS4A 4OLWL 2XBTA 4RQQA 2FJUB 2ZYRA 1U3HB 5DVLA 5BZDB 1ACYH 1G9MH 2X4UB 3ARDB 3CPUA 4OF8A 1GOHA 3OVUB 4J27A 1YPZB 3MVSA 1T1YB 4IRSB 3X1GA 1GJUA 3ARGD 4U49A 5C08B 3U2SA 1W72H 2OCJA 3MR9B 4AQ8A 1W6WA 3N1FC 4HC1H 3DXAD 3QRLA 1FJ1B 3LIZH 1FVDB 4P3CL 1TMCB 4EUPA 4NQEE 2JTDA 5J3HC 1OCWH 3UC0L 4LDEB 3SDDA 3MLTB 1BAFL 3SE8L 1CFSB 3MLXL 3SN6N 4W68A 5CLZA 2WVTA 4X2UA 1OB0A 4G43B 4HJ0D 2BHFA 3LOWA 5E8OB 3TPKA 4AMKL 1CZ8L 1E9OB 3MNWB 4JEGB 4A38A 2RB8A 3FT1A 3QULB 3CZJA 4N8VA 4CU8A 3L13A 1H6EA 2W94A 3TPUA 3MSPA 3ETSA 4B9FA 3S5LA 4N4YB 5HHOA 3Q6FB 2W9EL 3HKZA 3HFMH 5GHWL 4DOHE 2WQXA 5BS0B 5I66A 1CFQB 1TR7A 1NBZA 2DQ6A 4UOZA 1YEDB 1ZDQA 4EKJA 4ELME 4RETB 3BUYA 4TNFA 2DTMH 3G9AB 2ZUQC 1YMHB 1NKGA 2AK1L 4PSPA 5C0AE 4ZSOB 5A2JH 3VXNB 1BHGA 3PP4L 1X6LA 3BKML 3LN5B 3TEYA 2F1BA 1YMMA 2DMCA 2QMKA 3FSOA 3O2DA 4M62L 4UILL 5E1HB 3OKLB 4W6XB 5DMGC 2BZ7A 2GTZA 4YHOH 2ZICA 4P59H 4G42B 3T8MA 3S5ZA 4YSTA 5EOCL 2JKLA 3ATAA 3WBDA 2V0AA 4U1KA 4CILA 2YD0A 2DMBA 4BD4A 1SMAA 3RG1C 4G9DB 4P4KC 1EO8H 3JBG7 3O6ML 5DC9B 2NW3B 4BWWA 1G7LA 4B50A 5CGYC 1F4XL 4ZUSB 1P1ZA 2AAAA 4FNLL 3RNQA 2NQDA 2D3LA 4PJHE 2VITB 5TE7L 4BHUA 1KIRB 1O7DE 4PJXA 1JNLH 3W0WB 2YA2A 5FUOL 3FU3A 1T03H 3RL2B 2X1WL 4J7RA 4YPGA 1E5ZA 1PF3A 2DKMA 3IDYB 1MFVA 4XOEA 4U1MA 2OSLB 3ALXA 1HYSD 3I6GB 3WEXB 1P9MA 3BWZA 1WHOA 2AXFB 4NWTL 3UO8B 2BP8B 5HYJA 4KV5E 2OJZL 3IB4A 5F7MC 3HUJE 4TULL 2JJSA 4AC4A 1SXCA 2QSCL 5CWSA 2B77A 3AS2A 1NC2A 2ZWLT 1MAML 5KVDL 1T1ZB 3V0WL 1FGVH 3WY3A 3ZHFA 3V9FA 4BHUI 2FLBT 5C07A 3FF8A 2H2PC 2XWBB 3MRLB 3VGAB 2VXTL 2DLFL 4EOWH 1JZDC 4QRRD 2NYKA 4XPBL 5F0LB 2FNWA 2R4RL 4H13C 2X1OA 5D6DC 1RIHL 5CN1A 2FE0A 4APQD 2ITCB 2NQ3A 3AXLB 4PJIA 3B6SA 3NRFA 5CU9A 1EO7A 3T0EB 2B5IC 4UB0H 2EEAA 4C55A 5D2LE 3HE6A 2XPGA 1SDAB 4QAWA 2D9QB 3DOSA 1UH2A 2H6OA 2Y1YA 4NKOB 1L6XA 2VM4A 3MJ9H 1OE3A 4XI5D 5KYWB 1KCBA 2BNUB 4LCWB 4A04A 4V1DD 4Y5XC 4JQVA 3D05A 4GG8B 3NSDA 4JFWA 3P30L 1EJ8A 4A7GF 1FNEA 1CDJA 3NGBB 3VSTA 4XGZA 4UQBA 4BE5A 2WIIB 4HCIA 2FTAA 4BQ8A 3WKQA 1IEHA 1N2RB 1F6LL 5D2NB 3FL7A 1T0NB 1CGSH 4POZD 3WE6A 1OW0C 1YY9C 4KI5F 1PZ3A 2ZXQA 4NO0B 5FWRA 3V5HA 3C5SB 3SIKA 3P3RA 1TKWB 3M1BB 1QO3B 1MFAL 1HH6A 4DUXA 4ETQA 3UTOA 4KDTA 4BV1A 2ETWA 1XGPB 4YK4C 5DR5H 2G75A 3BQUB 4JB9H 3BZEA 2OYPA 3W38A 4XNQB 2H0PA 2FAUA 2QGBA 3A4EA 3CZLA 3MRBB 4NZRH 3UDWA 1AYRA 4O2FB 1IQWL 1HXYB 4HWBH 1IL1A 2Y5TB 2OR8A 2K4WA 4JRYE 1FFRA 4OZGF 1F56A 3SOBL 5BRZD 2GEEA 4Z7WF 2Y22A 3CDCA 3X12A 4QTHA 4RMVA 1DBBL 4RWHA 4IBVA 5BZWA 5KJ7E 3W82A 5AAWC 1KNOB 3EOBB 3K81A 4LVHC 4WU7B 4H26A 1G7MA 3OC8A 3QG6A 4WIQA 5C0BA 4KPHH 3VXSB 4Y4HC 1R3LA 1U8PA 3TZVB 4AZ8B 4XMPL 2VL5B 2F7RA 1CI3M 1CWVA 1JWUB 1AO7A 3ZDZF 3U6RB 1SJVA 1TETH 3UROR 3T0AA 5AYUH 4XN5A 1IGIH 3QCVL 4WK0B 1T3FA 4KO9A 5GS1C 4YBLB 4GI6A 1JGIA 3F3HA 1DFBH 3C60D 3UGEA 4RAUA 3VD3A 1XH3B 5MEPB 4IU3B 3VH8B 1JZIA 4JDZA 4ESKA 2WW8A 3Q5TA 5HHOD 1W72A 1WIPA 4XN7A 1BIIA 2XC8A 3LKSB 3OMIB 2IGFL 1RHHB 2XQYA 3LIZA 2ZCHH 3FRUA 5F9WB 1A9BA 2J55A 5CCGE 5C0FA 2Z0UA 5IB4B 1MREH 3PXHA 4NBXB 1OSPL 1W0VB 3HC3H 1BBJB 1NDGA 1AR1D 1V8HA 3C12A 4KKNA 3KLHC 1OP4A 2HFEA 1U36A 5DVNA 4X98B 1JHTA 2B3IA 1ZLWK 1J7VR 5C0JA 4LASH 3DARA 1XSJA 3LSOB 3ULUC 4IIZA 2VDNH 5FB8A 3OLEA 1P0SE 4OCSL 1O5DT 3V9EA 2ZX8A 5F0JB 3C09C 3UTTA 5FF6B 2IV9A 3EOYG 4HVBA 4UAHA 2I69A 2P7TA 3NFNA 3INOA 4LKXB 5ESAB 3O11A 3AREC 4NO5A 5FCUL 3SO3B 2DMGA 1HL9A 2P8PA 1NLDL 4XVJH 5DXWA 2XVBA 5ICUA 4FXKC 2QR0A 1PZCA 3KPMA 2ISDA 1IKNA 3VWJB 4G8GA 4ODXB 5C0ND 5T3ZH 5L9DH 3CZUB 4M5ZL 4YN3A 2ADJA 4XOAA 5DD1H 5J9PA 1HWGB 3FB6B 2IBZY 4EN2A 4EJ1C 4D8PB 3WN5A 3KNBA 4ZFOL 1BQ5A 1U2CA 1UXSA 4FTDA 4Q8BA 2ENJA 3M17A 3RWHB 5AB9A 5IFHH 5E6IA 5FX3A 2LHAA 2X3AA 3FRPA 3MBEC 5MEQA 2EDEA 4AXWB 4PJ8B 5T1MA 3OMZA 5E5MB 3LPFA 5DJCB 1HQ4A 3AG4B 3C5ZC 3KPLA 5IMLB 4L23A 4J6IA 5BV7C 3OBAA 1TDQA 2Y2WA 3Q44A 3WNLA 4PJFF 2X2JA 1UD6A 4K9EH 2F53B 5IHBA 4PWHA 1EAQA 4PJ7E 1B6DA 1RUPL 3WTSA 3BEWA 1OWWA 4WTZG 5B7FA 1LDSA 3MODL 1OP3K 3SPHA 3TT3L 3RY6A 4FCAA 3EJQA 4RRPA 4A6YH 4H8VA 2F8XC 3ASOB 1CD9B 2GSGA 3JWNE 3V0EA 1QTSA 5D7KD 5KYXB 2NZ9D 1CDHA 3V6ZA 5BUGA 4X9YA 1MW2A 3OX8B 1ZA6B 2HX9A 5I8KH 2VXVL 2BIPA 3MXWL 5IVXA 3IJ9A 3OLIA 2OSXA 2VXQA 5EUOF 5TF1H 3RA7L 4ZXBB 1YCSA 4L29A 4PJAE 1WBZA 2VN5A 1GJWA 4GRWB 3VX1A 5CD5D 4FFVD 1AQ8A 1E5UI 3DGGA 4TUOB 4S1SL 4YJZL 4KKRA 4DF9A 1N19A 3ORJA 3P77B 3DJZA 2CD0A 3QUYB 1DQDH 4GW5A 4P5TC 4ZOEA 4HSQA 1IT9L 5FKAB 5KW9L 4UIMB 3VI4E 1PG7L 2MCAA 1ZLSH 4JZOA 3V8CA 3PWNB 3T3ME 5J89A 3MROB 1ILUA 5IQOA 3BKJH 5EO9B 4RNRA 1FYTB 5ADOH 3BIAX 1XB8A 3NFPA 2HJLA 1A6UH 3QNXA 1O0VA 1EXUA 1LDPL 1F58L 5SWSE 2Y6TE 3GIVB 4ZNEA 1M1SA 3INUH 1YNTA 2CJSA 2FO4A 4PB0H 5GGUA 1PYWB 4TNGA 1PD0A 3D85A 4PIBA 1E7VA 4V2BA 1GXEA 1SN0A 1F41A 2G3ZA 4QXVA 4IDJL 4PR5A 4UT7L 3VTAA 5C0BD 3VSVA 1TPXB 4Y4FB 2EIEA 4QTIL 4ZAKB 1BOGB 3ZXAC 3K6NA 2BNRB 4Q97A 3V4VB 1JGEB 2DF3A 2R1YB 3HBQA 2JXMB 1ZMYA 5I76B 3A21A 3UAJA 1NBYA 4PGBB 2XYBA 3BWSA 4U2YA 1HKLH 1JDDA 1JPFA 4JQXA 1JZ4A 1G7JA 4LARL 3HR5A 5ITBH 2DY2A 2VWEC 4HWBA 4M6MH 4NKDB 4NQVB 5JXEA 5DO8A 1N68A 2MEJB 2D2CC 2UZYA 3O3EB 5ICXA 1OM3L 2NY1C 4MX7A 2EZ0D 1TLMA 4LPCA 1Z5HA 4POYA 3B8SA 2R1XA 4WRLA 2OMVA 5EORH 2PW2A 4WFFE 1MWAB 1JYVA 3U9UB 3ZZQA 5FW7A 4S11A 1PZSA 4A66A 4MXWL 5KYUB 2HKFL 4KJYA 5LWYL 2DQHL 4Z5RB 4P2RB 5F7HA 1KEGL 1RERA 2ZKYA 2YRZA 5CJ8A 2VLJB 3M45A 4R90L 2FCBA 3HZ3A 4Y4KA 1F90L 5I5RA 3MRHA 3MA9H 3L4CA 1XTLA 4ZOAA 2FEEI 4FLRA 3BIKA 1FIEA 4PY8J 5ITFB 3LKPB 4AVIA 4ZQTA 3LVTA 1JYNA 1SLVA 5JZ7D 2PP8A 4L8DA 4Z7UF 5CZVL 3EG9A 3HVDA 2VC2L 1KGJA 3UG3A 4WTWA 5I1KL 5TE6H 1NSNL 3KPTA 3SDAA 3IDXH 3KWXA 4DVBA 1NC4A 2OMZA 4EEEA 4M1DL 3UG4A 2C9QA 4HPOL 3CHXA 1T5KA 4LSPL 1KLUA 3DOHA 4QRAA 2V3DA 2CGYA 3V10A 1CLYH 3WU1A 4JFYB 2EUWA 2IF7A 4NP4L 1MCWM 4KMTL 1CO1A 1EV2E 1LD9B 3K72B 3LEYL 3PNWA 4G8GD 5IR1A 5AZUA 2RGSA 5B22A 3BPOC 3E6HB 1AC0A 4TSCH 4BXSV 5DS8B 4YHYC 1JZEA 1LP9F 3IFNH 1I3RB 3VFGH 3U9PH 1VFAB 4L2LA 3ARFA 5E6ID 4WEBL 1QASA 3OKEA 4O2CA 2X4UA 3IDNA 4OKVB 1MVFA 3EBGA 2J1WA 4E41B 1YPZA 5LGHH 2FGZA 1J1XL 1RIVH 4KH9A 4K7FB 4YXLL 4X7TA 1WG3A 4J1UA 5FYLL 2GJ6A 1CTMA 1EEQA 1NMCC 2ZNXA 3BO8B 2OKMA 3L8QA 2ZX7A 3V7AG 4AQZA 2ROYA 3N50A 2C9UA 1BD2A 5A2AA 3P4MA 4EPSA 4XNDA 5CAYB 4LLQA 4L8SB 1ITBB 3A24A 1AYOA 3BSHA 4NCDA 4Z7NB 3HHRB 4URTB 5E8PA 4QRPD 3ELQA 4KQ3L 5E8OA 4XI5C 1B90A 2IH3B 4HUUB 5AKTA 3JTSA 2DL9A 4XXCA 4PLKC 3QULA 2CRYA 4ZO6A 5E2UL 3WFHA 1KYOK 3ESOA 5C71A 4LU5L 1CDUA 3LKOB 2CWRA 2X6UA 3OZ9L 4AT6A 1ED3A 1QBMH 3ZTDC 4JRXD 5CCKH 2VR3A 3Q6GH 1NCDL 1RL1A 4LLMB 5EA0L 4QJ4B 4LSVH 4N2KA 1B2YA 2DLIA 5I5JA 3RGHA 1R6VA 3WNPA 3QC5X 3FH5A 4MQXD 3V9CA 3TWCL 4JM2F 5IP4A 4A6YA 1CJYA 4EIGB 4L3CA 2IAMB 3WJMA 1KTCA 1THCA 2JIXB 4OM1L 1GZQA 5D1XE 3MX0B 3W9EB 3DYMA 1MNNA 1TQWA 3MRIA 3QR1A 4LCIL 2DQIL 3GSXA 3N04A 3VTMA 4M5YH 4OFYD 3STLB 4RISH 1AXSA 1ET5A 4LZKA 4JGJA 4G9DA 4YDVB 3F65A 3D0AA 1IM3A 2DWDB 3OMAB 4NQDA 5I8CB 1U8LA 1NCBH 4AQ8C 3N0AA 1HIML 3FQTA 3QNFA 3GC3A 1YEKH 2ED7A 1OGPA 2VXUH 3D85D 3TA4D 3VFWB 2XG5A 4G5AA 4R3SB 2GBUA 4M61B 4I2XA 3NCJH 1T5WB 1RJZA 5ADPL 1A2YB 3QA3A 1G0YR 3SDDC 3VACA 1BG1A 1F4WH 3EDKA 3MV8E 3PAYA 3HMXA 4FYTA 4L9DA 1FVCB 4Y8AA 1WYJA 1GGBL 3FAXA 3K6DA 3ARVA 4IW4C 4JPVL 4TTDD 3ECQA 2ADYA 1NEZA 4FLHA 2VKXA 3DHMA 3NH7H 2OYKA 1UUSA 3TBTB 2X41A 1KB9J 3OR6A 4QF1B 1FLRH 3CFBA 3N55A 2P1YA 1VZGA 3SKOB 5JXED 5JIDA 4Y1TA 3B7SA 3JV6A 2BSRB 2FNBA 4XN9A 4DEPB 3BCFA 4KKCD 3EGXB 4NQSB 2VDOB 1YZZA 4OZFB 4GRWH 2FATH 3MOAH 5LBSH 3VCLB 2W38A 3ZTNH 3U1SH 4LSQL 4NLHA 1AR1C 1MLBA 4OFDA 2P4AB 4QRPE 5KBPA 1UD2A 3SE4A 1TU2A 2B1AH 1ESOA 1UWGL 3WN6A 1DQML 2JK5A 3IFLL 4FMFA 3QIBB 1USQA 4XP4L 3DVNB 3MUGA 1CICB 3EFDH 3KE0A 4YZFE 1VGKB 3TOPA 4A55A 2EYSA 3RFRA 4DESA 1L5GB 4PUBH 1KCRH 2XWRA 3E3QE 1SMOA 1BZDA 5EZOL 4LCWA 2HRPH 2X53A 1PAZA 3WIHL 4TPRL 1SLXA 5TH2B 4YX2H 4JO4H 4PJCF 1JNNH 4MYWB 1NC4D 2R69H 3IT8D 3THMH 1R5WB 3WL9B 2ZCZA 1KTBA 5SX4I 4NYLA 3DK0A 1T0NA 3N06B 1FBIL 3JUZA 4P99A 1UEYA 2IH1B 5SWQA 2IDSA 3HCVB 1FFPB 3C5SA 1K3ZA 1UEMA 1KXTB 4MS8C 3FOMA 2D3VA 5KSVB 4AYGA 3TH3T 2CKNA 3L48A 3BQUA 3MV9D 1P9MC 1HXMB 4LEBA 2OI9B 5AAMA 3TCTA 3MRMB 3QPQC 4MVBC 2W1NA 2GUYA 2R0WH 4BYHA 2JJSC 3PWLB 4JFXA 1U3HD 3LMJH 1ND0B 1AJ7L 2WK2A 1UWYA 1JZFA 2GQHA 3JV5A 4Y5VA 5F97E 4OBRA 4PJEF 2ZUTA 3W2DL 1DLFL 4Z3HA 5I1LB 1XZ0A 4WO4A 1OALA 1PD1A 4IRSD 2HN7A 3HBZA 4G9FE 4PP2A 5C08D 2O5YH 1QRNE 4UOW1 4XMVA 4L37A 5DT1H 4DGYL 1BZOA 2OA9A 2ZAIA 4MQSB 3ZDXB 5DUPL 3X14A 3D18A 3TZVA 3N0PB 1H3XA 5T3ZD 3VQLA 2VL5A 1M2OA 1EIBA 1JWUA 1TTAA 1BD2D 2F18A 2JB5L 3D39A 4WWNA 4WFGD 3WJLA 5J1SC 2WNXA 5KYYA 3HZYB 2G60H 1JZ6A 4OZFG 3HE6C 4YH6A 4X99B 4ZTPH 1KJ3H 2A3TA 1CS6A 2LAAA 4FKEA 3FT2A 4QXTA 3T0WA 1B2WH 3NVQA 4HETA 1D7BA 3UBFA 4JQVC 5AYTA 4NUJA 2ATPA 1HT6A 2BOLA 1QLFB 3IDUA 1MW0A 1EEYB 3QUKA 2DMKA 4F2EA 5JOFB 1M9WA 4LNVA 5C7ZA 1CQYA 1CVSC 2I9LB 4NGHL 5FA3B 3TCLA 2DPKA 5D5ME 1RHHA 4DIXA 3DJRA 3CZKA 2YLKA 4L5FH 5E08H 4XOCA 1DYZA 3P3YA 1VIWA 4HKZB 1XGQA 1JNHA 4RGMC 5EZJA 2BW5A 3ILPB 2BLFA 1S7SB 3UBHA 4GKSA 5AFAA 3UDWC 5FO7A 5EU5A 3V6FA 4AOFA 3U0PB 2OP4L 2R7EA 1Y1UA 4KO7A 3TBYB 3TONA 1KB9K 1A5FL 4Z3FA 4FQIH 4KXZH 5PAZA 1QFUL 3B8YA 3DV6B 5B38G 5IBTH 3O41B 1F11B 3FFCE 4ONFL 1MCLA 1NUNB 2LU5A 3SKJL 5DJXA 3IAGC 2CA3A 3JWOH 4NQDD 1WGVA 5F7DA 3KWTA 1R3JB 2PO6A 4OZIE 1S7RB 1SOKA 2K45A 5F1IB 2N7AA 3ZMRA 4X9IA 4ECNA 5HY9B 4LCYB 5CEXB 5GJSH 3WI9A 4U6XA 1UQSA 2DEYX 1E50A 1E6OH 2EVGA 3W0WD 5JA8B 4URKA 1N0XH 3DRQB 2A6KB 1A3LL 5ACZA 1X5IA 4G7VH 2JFCA 4CMHB 3RIAK 5AWNH 4BFFA 3KLKA 4MA7H 2EDMA 4BQ9A 5CEZE 1K9TA 5D7JB 3ZO9A 1YN7B 4KFZC 3H55A 3GK8L 5L8KB 3LD8C 4U3SB 4ZJ9A 4AXWA 5CSBA 5E5MA 3SPCA 5IB2B 2XT1B 3WHXA 1AGDB 2ITDB 2VLME 3HRZA 1EZUA 2I5YL 3EFFB 3TO4B 2AQ1A 2QLVB 1EHNA 3J7HA 5BZXA 4JFHD 1TSRA 5JPNA 4XNZC 5E2JA 4P3CH 1NGZB 4FXTA 4GSQA 4X4ME 1D5RA 1F5WA 3N44F 4U1GB 4XVUC 5D7HA 3TJHD 4B9GA 4E0RB 4PRNA 5LXVA 4RIRB 3CBKB 1BAFH 2EXYD 3SE8H 3MLXH 4ZMWA 2OYLA 1LLAA 4Q6IB 3S3PA 3FUNA 1BLNA 1VEMA 2G9KA 1C9SA 3TFBA 4YSOA 3D06A 1CZ8H 2IDUA 1R5VB 4GY4A 2C4XA 2BP5M 5BS0E 4LCWD 1QAWA 4ACTA 1INQA 1ETB1 5CIPB 4LPWA 2CXGA 2W9EH 1Y6MR 3KJ6L 3P4LA 4QHUA 2QSVA 3HAEH 4F33B 4ZSOE 4FADA 4NZJA 5FKAA 3LEXB 4UIMA 3TVMB 1EA9C 2V3EA 4GRLB 1SYSB 4LQ1A 1USZA 4PGCA 2DQTL 2BJML 2NY6C 3WN5C 4TUKL 1N8ZB 2AK1H 3M46A 5EO9A 4BWUA 3BQUD 3PP4H 2N4IA 4OGZA 2FJFB 3BKMH 4WFHD 2GBAA 4UDUA 1SEBA 4A2GA 5EZLB 5EOCH 3F85A 4A1RA 4Z8FL 4S1RL 3A47A 4K3HA 5J11B 1OTSD 2R69A 4Y1AE 4AM0B 3O6MH 2V2XB 4NPJA 3OPUA 2VDOH 3JTTB 1UXMA 3ESNA 4OQTL 4NC1C 1NFDF 1F4XH 4IRZL 3RY6C 1U8NA 3WEMA 3ULUF 4FNLH 3CFNA 4FXGA 4LSUL 3TZVD 2J5WA 3EJRA 5F89B 3BN9C 1YNKL 4YSPA 5TE7H 3ZHNA 4PS8A 4TN9A 5FUOH 4XAKD 3O0RL 3OJ2C 5CR8A 5EF3A 1QX1A 2CA4A 4HF5L 4E5XB 1RZGA 3X2QB 4F7TB 2YA1A 4NKDA 4F7EA 1CU4L 5AW3B 3FCTA 4J23A 4NWTH 4WI7A 4XMKL 3TN0A 3MPCA 2OJZH 4ANKA 1I7RB 4TULH 3NG5A 2AXHA 4JFHE 4HK3N 5FGRA 5TDOB 1LE5B 3LJ3A 3WFEL 3BE1L 3SE9L 1I8KA 43C9B 5HHXH 2K8MA 1XF5B 5AL0A 3OKNB 5F1NB 5KVDH 4HLZG 4HKXA 4R6UA 4Z5RA 1CFVL 2ZYSA 2VLJA 3T0EE 2VXTH 2R4SL 3N1GC 1VGEL 1J0KA 2AXWA 3LS4L 1I8IA 2R4RH 2V2WB 2VLKE 4ZQKB 1YO4A 4F57H 4UANA 1MEXL 1RIHH 2GUOB 5ITFA 5J0BA 2AITA 3DX9A 4HCFA 4O9HL 2P24B 1MQKL 4RGNB 1NCAL 4F1ZA 2RR3A 3PHQB 4GS7B 4MGXA 3GPSA 5GRVK 3T0VA 4IMLB 1BJ1J 3CH8A 1XBRA 1WE5A 4JKLA 5LGKA 1FZMA 3EF4A 5CJOL 1W0WB 2FSDA 2N0MA 3P30H 1RZKC 4NEHB 4AMXA 4KTEL 3S4SB 2PO6D 3EDDA 3KBFA 5H94A 3T65A 1ZHBB 5IB5B 4MJ4A 5E0QA 3VWJD 3X13B 3EGSA 1XGUB 1MHCB 2AV1A 5I71B 3UAJC 5L4MA 1BMGA 3QDGA 4JQXC 1MFAH 5EO1A 2DQFB 3Q8CA 3WMPA 4P5MB 2KT6A 1BLIA 4G6ML 4Y19B 4AENB 1R5IA 3PQYA 4MXVF 4PJDB 1FFNB 3AABA 1X9RA 1L3WA 5BO1L 3SQBB 1TJHH 4HIXL 4MDJA 1IQWH 3ARPA 4PJ8D 3ZIYA 1KCVL 2WTOA 4IEFA 3SOBH 2P8MB 4K7FA 3VXSE 1QW8A 3TL5A 1X7TA 3RHWF 4DVRL 3CVDA 1Q94B 3BVXA 4E5XG 4FFZL 4HIEB 2F53D 5MERB 1V3LA 3HG0A 4Y4KC 3Q43A 3DTUB 3GKZA 1KCWA 1MFCH 2XV2A 3AROA 1J1PH 3PJNA 5KVGL 3FQWA 1N5YL 4KXZI 3WTWA 4HUUA 4N68A 3QCVH 3ARBB 1Q9KA 4UINL 2WXNA 3FFOA 5HJ3B 5DFTA 3SDAC 1WAAF 3QCTH 2XHNA 4M7JL 2CO1A 1MJ7L 4QMEA 5MI0C 2P8LA 2AF2A 5DDHB 4ATWA 1HHKA 1WEJL 1XF2A 1W8OA 3QS3A 1DCLA 2NY2C 4JFPB 5JNYA 3VFTA 2IGFH 1BWWA 1BXXA 1KXQA 4OM0H 3IDMA 4P23B 2EKSB 1ZE3C 1OSPH 1HILA 2FYVA 1Z1WA 4UAOB 4NSKB 3N41F 3D4ZA 3HS0A 4JG9A 4X5QA 3DSFL 1FYTD 3ARFC 1M2VA 3T2OA 2JCWA 1HEZB 4G8FB 1GTNA 5B8CA 1BQHB 3GM0A 2AGJH 1XCTB 3UEQA 4OCSH 3GPEA 3OSKA 1MCSA 1BZEA 3G6JA 2QTVA 1BV8A 2Z64C 4TSAL 4GRMB 3Q2LA 1RUKL 3HAEA 4J6RL 1URIA 4U6YB 3T3PF 4BH8B 3F8UB 3HZVA 1DN0B 5FCUH 3QW9A 3RVVC 1A2YA 3B56A 4XMWA 1NLDH 4JPIB 1AZNA 2ZAHA 5TDPB 3AWGA 5HDQL 2BNRD 5DEFB 5E70A 3V4PL 1FC2D 1FVCA 3HG3A 4MKTA 4LAJH 4ZW5A 1F4YH 2E27L 3ROLB 4AC2A 3IWUA 1MHEB 1PLGL 4M5ZH 4MJIB 4XXCC 1OT2A 4QYAA 2ATAA 2P48B 1C08B 2NNFA 3VWKA 2CJUL 3JYCA 2CK0L 1ES0A 4E9WA 5LG6A 3OKOA 5CBEB 5IWLA 1LHZA 1U8QB 4KROB 2CPUA 3PAVA 1FH5L 4NFBA 3WDIA 1E8WA 5FA4A 4HA1A 4QRUB 1TZIB 4U3CA 1KBGH 2F53E 3EGXA 3JV0A 5H4ZA 4XT1C 3DRTB 4Y2NA 2Z3FA 4PGEB 2OSYA 3BPCB 1MLCA 3U4AA 2Q2LA 1ZTXL 5IFAL 3VI3F 1SLWA 3TIEB 4P2RD 2MOQA 5DSCA 5LO7A 1VESA 4KY2A 4HW6A 4R2GC 1RUPH 3UTQB 2VLJD 4DP4X 3IE4A 3LQZA 3MODH 4HS6A 1GMIA 1WBYA 2ZPKL 1P4LA 1Q1PA 1ZHLB 1BYNA 1C5BL 2Z93A 1OAQL 2QQQA 1QFOA 2F7IA 1SUHA 3LKNA 2HFTA 4HFUL 3MXWH 4NM4L 1RURH 2CHWA 3LPPA 1IKFL 3BEVB 1VKXB 3SE6A 4H5SA 3RIFF 2ENPA 1R5WA 5GGRY 1V10A 2JQZA 4O5LL 2B59A 1LK3L 3CN0A 3FTGB 4S1SH 5IV2B 2IH1A 4HS3B 1WIUA 4WTQA 2XKNB 1BQHG 3NACL 1S78C 1KXTA 4H20H 2A74A 2V9RA 4XCCL 1IT9H 5I2IA 2AANA 1WVZA 1JERA 1PG7H 5E94A 3K6FA 1HH9A 2PUQT 3QDGD 4HUMB 3MRMA 1AZZC 4MHHI 3UZQB 4MWFA 2YZ8A 1IGJA 3LH2H 1D6EA 3SDXF 4N0RA 4X9BA 3MRPA 1ND0A 1LDPH 3CSYA 1F58H 5BVJB 5CKAA 1BVKB 1ZVNA 4OGYL 2VQ1B 4X0KB 3ZHKA 12E8L 4DP9X 1DZBA 2MCPL 4W9FC 5IGXL 1M6OB 4O02B 1ZTXE 2BNRE 4PGDA 4BRVA 4QDGA 3SE4C 2COQA 3DMMA 3MLSL 3WIAA 2X6BA 4UT7H 5CM1A 2FLRT 1I1RA 4QTIH 2YK1L 5E99L 3CDGB 1C7TA 3CZNA 4ZMTA 4GMTL 1FL6B 5DJYA 3V7AE 2QFPA 1O9WA 3EGDA 4GAJH 4ZFGL 4C57C 1X7QB 5DHYA 2AJSL 3FCSB 3SSGA 3IBOA 3E80A 4BSVA 4LARH 4NS0A 2QGEA 4QIRA 2RALA 2AEQL 4PRIB 4F37K 1EEYA 1W16A 1OM3H 2FX7L 3SCMA 2R59A 4P2RE 5E1QA 1BF5A 5T8IA 3CN2A 1GY1A 3IBEA 2MKWA 3EW3B 2LFGA 2XWCA 2NNRA 4Y5YC 3B3BA 1HX0A 3GSRA 4GBXB 4MXWH 2HKFH 2J1YA 3ME0A 4RBPH 2DQHH 1TYEB 4MMXA 5K93A 4BH7B 5FECB 2BFGA 1PQZB 2VR8A 3MRFA 2BS9A 3QXVA 2JIXD 5BVPL 1A9VA 2AJZA 3CIQA 3MRKA 2LLGA 3LH8A 3HLKA 1KG0B 1XH1A 2B4CH 3IKCA 4HSCX 4OQ1A 4Q6KA 4YSRA 3GUFA 4GUOA 3W9DB 1A1OB 3BHBB 3C6LB 4Y5VC 1RFDL 3VB8A 4YPJA 3GLEA 3MJWA 3MCKA 1P4UA 4WO4C 4X7CC 2WZPA 4HUXA 2XFXA 3OGCA 1NSNH 2Y1AA 3T8VA 3BCDA 1ZHNA 1XO8A 3G5XB 4M1DH 4OKDA 1J5IA 2DQDL 1EBAA 2YGOA 4HPOH 4TUJB 3I02B 3QRBA 5CCJA 3QDAA 4LSPH 3HI5L 1RK0A 1PIFA 5GIRA 3L6FB 5E56A 5TDNB 2CNZA 4NP4H 5C9JB 4KMTH 3LV3B 4R96B 3EH3B 3STZA 4C83A 1XGRB 1F4AA 3LEYH 4FQJL 3SE3A 4DZBA 2OTPA 4ZW8A 4N1EA 1LQBC 1YY8A 4XHJC 1MN4A 4R26L 5IB3A 1Z7JA 4GG6A 4LNRA 1WZLA 2VR4A 1YUHA 2FDBP 3F62A 1QATA 2WVSA 4X5XB 4D9QE 2VLLA 4QJ3B 1E3XA 4DT2A 4E41E 3VWKD 5FO9B 5AW2B 4LCUA 1MELA 2OTWA 3APNA 3CUPB 3MGTB 2H2SC 3N40P 4GQ9L 5E2VL 1NMBL 4BSWA 4LHJB 1IQDB 1BXUA 4RZCA 1E40A 1NCUA 1NINA 4Q9BA 5GGVH 1L3NA 1WK0A 4Q58C 4FD0A 4D0DB 5BUPA 2FEJA 1J1XH 1U0QA 2ZCKL 4IYKA 2DWTA 3RI5F 4YXLH 1U91B 3BVTA 1FG2A 1JI1A 3NIDB 4Z7NE 1UH4A 4GKNB 7FABL 4WDIB 1SHSA 4G7YL 1NGZA 4N5ED 3RIKA 3RWFB 4KK9D 3LH9A 4X6BA 5IMMA 2KKQA 1E7UA 1KLFB 3VI4A 5HGBA 1ODUA 2CCWA 3IJHA 1NBCA 1CICD 2A9NL 1FGNL 1DBKH 3ZOAA 4ZFOA 5A7BA 5KOVC 4KQ3H 3TNNB 4GSXA 2Y25A 1A4AA 1R5VA 1UCBL 2YUZA 3I6KA 4MCNA 4NUPA 4U1JB 4ZX5A 2X4PA 5A3IC 2O6PA 5FYKL 5IG7B 4NNXB 5E2UH 1D5XA 3ULSA 4LU5H 1IAOB 1Q0YL 4PJIF 5DHDA 4E9SA 2MPVA 1IGYB 4TLTA 4MS6A 5IQ9B 2QV4A 3MBXL 1Z6JT 1NCDH 2NXYC 1KTLA 4OCWL 3ELAT 5L6YH 3LHPH 1ZGLB 1BMWA 2HVKB 3ECBB 3H4HA 4XVTL 4OJEH 5DK3A 2IDCA 1PU0A 5F93C 3S8FB 4XH2A 1T7VA 5CLTA 3TWCH 2E76C 4M8VA 4Z95L 3QHZH 4WENB 4PB9L 3VE0B 1JUFA 4IGBB 4OM1H 2FJFA 2QQKL 4DKFL 2NYZA 5KVEL 2LVEA 2GT9B 2EDYA 4WW2B 1P4IL 5EZIH 3FU7B 4ES9A 5DFWH 2C7UA 5I1AB 3HRZC 3D33A 3QQ4A 4KDWA 4UQ3A 4H1LG 4X6CA 1Z5LB 4UCFA 1DDHA 1RZFL 2MKLC 2V2XA 2LE9A 5C3IA 1JZ3A 4HIHB 3REWB 4P2YA 3HNTH 3R1GL 5JPNC 1I8UA 2O26U 5DJDA 2Z35B 4LHQB 3DMMD 5FO8B 1U2HA 5F89A 5ADPH 4W9IC 1YECH 4S2SB 3FO2A 3CSBA 5J6GA 4FTVB 2FZ3B 1OF2A 5LN8A 4DZ8B 2H1PL 1GGBH 1W15A 4TQEL 1G1KA 1W91A 2UXTA 5FYKE 3LRHA 4F7TA 1NGYA 2UY7A 3AG2B 1TQUA 1PJWA 1QYGH 1U8CA 3TEZA 1MFDH 4N2DA 2IVFC 3ZDWA 1F3JB 1LYQA 3SCMD 4OFQA 1XCQA 4QGTA 3FT4B 3ILEA 4I3SL 5D93C 4DGIL 3AU1A 1U95B 2BVPA 5I73B 6CGTA 1ZS8B 5GGSB 4LSQH 5EIIG 5SWZA 3BH8A 1NCNA 5DD6A 3VQ1C 3FYEB 2V2WA 1UWGH 2JQMA 5JW4N 1DQMH 2GJZB 3ZKNC 3IFLH 4XP4H 5J8OA 5A40E 5C0IB 1MIEL 1OF0A 4M7LL 3QNZB 2FWOB 2KPWA 3HBGA 4N8CL 3HPJA 3EUUA 3NZHL 4PVNA 1IC5L 2X28A 3Q8FA 5EZOH 2DICA 3QIWB 5DD5L 2WZPD 1RMFL 1DDTA 4TPRH 3WIHH 4DO6A 3UACA 2ARJQ 2XN1A 5E4IA 3VFUB 4AY0A 3OKDA 3QHFH 4F7CA 1E4WH 1WWBX 2D3JA 1ORSB 5GRVL 3ZUNC 3WOVA 4GYBA 4FXGC 1WV7T 2H8PB 2G3XA 4ODVL 5IB5A 2PWDA 1TIUA 5FM5M 3QUZA 5BOJA 4ODHL 3S36L 5FO2A 2X0VA 4TTGA 4FFWC 2V9UA 3D51A 1VFBB 2D31A 3QR2A 5IW1A 4P5MA 4AYID 2W92A 3QXUA 3H9HB 4MQ7B 4YBHA 1MNUH 5FWQA 3TN0C 2ZSVA 5CGTA 5CGBA 3BRFA 2BWIA 3L3KB 2EDXA 2HUHA 4ODUB 4YUEL 2OR7A 2VAJA 3O6FB 5KEZA 4J3XA 1AJ7H 4PRPE 2WWNA 3W2DH 3ZDXE 1W8EA 1DLFH 1DBJL 2DQUH 3QORB 4X8JA 1JK9A 3LS5L 1M6UA 2EICA 4OD2A 4MRCA 3TH2T 4EDWL 1JF1B 4HXAL 3BRGC 2OXHA 1TQCC 4DGYH 4XNAA 3NJFA 4R7NA 4I88A 3CZFA 3US0A 5DUPH 2JKXA 4RRPM 1HAWA 3RAJL 1PX3A 3B9EA 2JB5H 2GJRA 3O4LB 5DMKA 2BY1A 4AQAB 3X1FA 1KT2A 4KQ0A 1K2DB 1U93A 5BW7A 4Y9EA 2C3VB 5I74C 5LCVL 5H8DA 1R9FA 3EH4B 3OXSA 3H7BA 4KXBA 4JO2L 1C5DB 1L4IA 1HI6B 4LVNC 4EZKA 3NBNA 1QR1B 1WBXB 4G1MA 4AQ1B 3J8F7 4YNYB 4AK2A 2UZIH 3ZE1F 2X7LB 2ZX9A 2QVMA 2NCMA 5IROD 3K1KC 1MIMH 3VFVA 2UVEA 3HG4A 4NGHH 4FEMA 4WHCA 1VAHA 5IVXF 4EE2A 2OV0A 3FS9A 5IFJB 2BRRL 1LMKA 4GRLD 2J56A 3CC5B 4GKZB 3ILQC 1K85A 1F1DA 4HZLB 4HG4J 1OAKH 4UM8B 4P57B 1OAXL 3DYOA 3RWJB 5DJZA 2WCSA 3PWUB 4G8FA 2XX0A 5E1AB 5D1ZA 5FUZH 1AAJA 3CMOL 2WOBA 2OP4H 3JWOC 3B9KA 4OFKA 4XBEL 1A5FH 3DIFA 4LESA 5B7MA 1TT6A 3IJSA 5IEHB 1QFUH 5IBLC 4F8PA 2DQEH 5KWYC 2UXFA 3QP3A 4ONFH 4PG9B 4XXWA 3SKJH 3HI6H 1FSKB 4JZJA 5FW8A 4AYFA 1BF8A 3R06B 3T1FA 2AAVA 4ADJA 4MMZA 3F6LA 2WXHA 4DKTA 3FUHA 4XO3A 1ZJBA 1MCDA 5KVFL 4YHLH 2RAMA 2MNJB 3WV0A 3DX8B 4YE4L 3NA9L 4PPTA 1MHEA 1T80A 2GB2A 1N0LA 2J8UA 5DRWB 2VZSA 5CZXC 4HEMA 5D1ZI 5LBVA 1A3LH 1C08A 3HHSB 1E30A 2DM7A 2G5RA 3N42B 1RD6A 2J73A 4NZUL 2YR3A 5AYQA 2WLZA 4IIQA 2WXFA 3WLWD 3GK8H 4FQHA 1BFOA 3OQ3B 4L3EA 5G2NA 3ZL2A 1UB5A 2BY2A 1X9QA 5IOPA 4Y0GA 2FIKA 2GK2A 1AD9A 4CC4A 2I5YH 2I24N 3O8XB 2FH6A 3LDBC 5IQLA 1TEFA 1AQDB 4KOBA 2NX5B 4AW7A 5SWZD 1P7HL 1O7DC 2Z91A 1P7KA 3HS0C 4DPAX 4K0OA 1MCOL 3HE7B 1AS8A 4I3RH 4FQXB 4NUQA 2QQLL 3F12A 4O51A 4YSDA 5JW4R 3D87B 2MNUA 5HGAB 5GZNA 5B8CC 4BGLA 2DLEA 2K7PA 2KUTA 5B3NA 4JY4A 4RGND 3S3BB 3KXFE 5GS0D 5I15L 1J5OL 1WZMA 5DD3L 4Y9FA 1JZ5A 7TAAA 1QBBA 1KIPB 3QHTC 4QRSB 3KYKH 2F68X 2CKBL 1I1YA 1ZT7B 2OMXB 5HHMB 2A9AA 2Y7OA 4W9EC 5HYSG 5I24A 2DWYA 4ZX6A 4HKJB 5E51A 5HHQA 5KSAC 5INDB 3O81A 3FTGA 3KJ6H 3L5IA 4TVPL 5IV2A 4HS3A 4UOQA 5F72S 1WC7B 4G6FB 1L6PA 3IVKB 1RJYB 2EIZA 3QUZD 2QVIA 2JCCA 5DS1A 3REVB 2EVIA 3RWEB 7PAZA 3JZYA 2DQTH 1YNLH 15C8L 2BJMH 5EOTA 3VWKC 1H9VA 4TUKH 1KBVA 2B2XL 5HVWA 3TBVA 5IWLC 4WEUD 4GSUA 4WHYH 3CFUA 1L9TA 1PZAA 2AZAA 2PW1B 3AWEA 4O58L 1IFRA 1M53A 3QJHA 1FFTB 4Y2DC 5BVJA 1G9HA 3WIHA 4JVWA 3KYNB 4IBWA 3BT0A 3QQ3B 5AW4B 4Q9QL 2VQ1A 3V5KB 4Z8FH 4S1RH 1IGML 2QJDA 1DJIA 5LJYH 2MFNA 2AK4B 5DK2B 3GRBA 1DVYA 4OQTH 4N5EC 1LEGA 4Z7WB 2KS0A 4KK9C 3HKFA 3WFZA 1KMGA 5D5MA 1URZA 4KOCA 4ZS6D 3SPJA 1L9QA 3VXTA 4LSUH 4UBDD 3WKMH 1FL6A 1YNKH 2R83A 4RDBA 3PL6A 4HG4K 3L4YA 4QO1B 4RFNB 4ENEC 1HC1A 1TZAA 2QQNH 1TTCA 1F8TL 3O0RH 1RSYA 2DLGA 2ZONA 3ZDZB 1HOEA 3N5AA 2QKIA 3VFPB 4JK0D 1U8IB 2DWEB 3QEGL 1NAKH 2GBTA 5C7XL 5C0EB 5KJRL 3VRIB 4P3DB 4ZK8A 2WSPA 2YGPA 3PPSA 2HA1A 3L16A 4I1NB 3WFEH 2IBZX 3BE1H 4IHOB 3SE9H 2H3NB 2WTRB 2JB6A 1T20A 4GBXA 1OL0A 1BZ9B 1SFHA 3ZQ9A 4OZIA 3I2CL 4IKKA 3KLAB 1IGTB 1PQZA 4KXDA 1GGUA 1UZ8B 1XGTB 3FSWA 3VXMB 1U8OB 3K6IA 2Y0SA 2R4SH 4F2MB 3LS4H 1KG0A 1TO5A 1DJWA 3L3GB 2DYPA 4GEJA 2OMNA 2L8AA 4C47A 1MEXH 2WC7A 4PWGA 3W9DA 3C2AL 3RKDC 3E6FA 2GBVA 4O9HH 1MQKH 1NCAH 3B9KD 5AVTB 2VZUA 4FQ2H 1M7DB 1IC4L 1VACA 4ZPVB 3ARYA 1J1OL 4DQAA 3DMMC 2UYLB 1O6TA 4UZSA 1G7QA 5SX5K 2GABA 3O3BB 4KTEH 3I02A 1X5JA 3CWGA 4JHAL 4AQEA 2CQVA 1PKQB 4LBEB 4NN5B 3LPOA 4TLKA 1UYWL 2BNQE 3G08B 1A4JA 2ZD0A 4OVUA 4Y19E 4B41A 4PLOB 4W9DC 2F7QA 4PJDE 1VADB 1WO2A 3BAKA 1ZOXA 1F18A 1TJGL 2CIKA 2N0KA 4D3CL 1J8RA 3AT9A 8PAZA 4LK4A 3CUPA 5B4MC 3L7FB 2XA8L 4KROD 2P45B 2G9HA 4C8XA 4HIXH 3AB0C 2X1PA 5HJBA 4HHGA 3VRLF 3GBDA 3GDBA 4QXGL 4N2GA 2XX1A 4X6DA 3COOA 5DJ0B 2APXA 2G30A 2VSCA 4MMXC 1EEZA 4DVRH 4CVUA 2MIZA 4PG2C 1I1AB 1BVZA 4WDIA 5L0QB 3SYOA 4FFZH 4RDQF 1M4KA 4DW2L 4FN0A 2N7SA 1JG9A 1A6WL 4DN3H 2HRLA 1H6UA 1J5DA 1QHPA 3QIUB 4GH7B 4OZHB 5IB1A 3CCHA 4MA1C 3L81A 5KVGH 4PTTA 1VF5C 4ORGA 1ET8A 2JKNA 2NY3D 1N5YH 3TNNA 3H85A 1KB5L 1D6VL 2ZSWB 1UKSA 1SJMA 2XV0A 2IH9A 3IN0A 4LHUB 4UINH 2DM4A 2O6DA 3TEWA 4RAVA 2AJ3B 1IZKA 2XTLA 4M7JH 1P84J 3CDFA 2X4QA 1JWMB 1DUYA 4ALAC 1NCWH 1MJ8H 1OEZW 4MJ5B 2HJKA 1K6QL 4EO5A 3WJJC 1ZGLA 5EUOB 3MRNA 4K07A 4Y1AA 1J5HA 1A1NB 3ECBA 4CU7A 1MF2L 3D12B 2DIJA 1JJUA 2CRMA 2BVEA 4ENZA 1PCSA 1OCOB 1HE7A 2BIMA 3VRJA 3ZSSA 5KYNA 3AU0A 3MV7B 1E2WA 5HBBA 5EC1B 5JIHA 3JWNC 4YDLB 1EJFA 1UD8A 4XCYA 3CXHJ 4Q52A 2CDGA 1VZIA 3IFPA 1JVKA 2KQNA 2XNAA 4N86A 4PP1C 5D6CA 3F58L 1GAFL 4M8UA 1NUFA 3MXVL 4GUPB 5K9QG 1CD1B 2NW2B 3P0VL 2PKDA 3NFSH 4IU2A 4PW3A 1IVTA 4HIHA 5FM5O 5CR1A 3JVFC 4TSAH 1RUKH 3V0VB 3I3BA 2KZBA 5TQ0L 2Z35A