3FFOA

F17b-g lectin domain with bound glcnac(beta1-2)man
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Adhesin
total genus 44
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3ffoA00
1ZK5A 2BS71 2BSCA 1ZPLA 2BSBA 3F6JA 3FFOA 1OIOA 4K0OA 1O9ZA 1O9VA 1O9WA 2BS8A 3F64A
chains in the Genus database with same CATH superfamily
1IGCH 4JQIA 4XP5L 2CO7B 4JG5A 5DHVH 2FR4A 5L2KE 4FQJL 1S7SB 3TO4A 4PJ8A 4DPBX 4JHZA 4TULH 2WGXA 1Q0XL 1WS7A 1WC7A 1FBIH 1JYNA 2VXVL 1YQVL 5EOCL 2RCSL 2Z7UA 3JXAA 3GHPA 3PL6C 4RGOL 5AAMC 1KCUH 4TQHA 4OFYD 5DRWB 3MJ9L 4WWPA 1MHHA 4GMTL 1P9MC 4GQ9L 4QO1B 5DUPL 3S7GA 3OX8B 5GHWH 5C2UB 1T1ZA 3DTUB 3N40F 3SBPA 3W0WE 3GGWA 1AC0A 2CE6A 5LGHH 3N2JA 3OG6B 3EHBD 3UBXI 4K3EH 1DJIA 2ATKB 2J3SA 5GRYA 4R2GD 1HHGB 3E6HB 2FLRT 1MVFA 1IARB 2RAMA 3EJZC 2Q8AH 3FB7A 1KG0B 4E41A 1KDIA 3KPLA 4Y4FB 1EHAA 4N3UA 2PABA 3QRLA 3SGDH 2EIEA 4L2YA 1TZOA 4OD1H 4H8WC 5F1IB 5HGAA 1QI5A 5T33H 5E5MB 4X83A 3IN2A 1E6JL 4R4BB 4Z0BL 2A99A 4WUUA 1I8AA 3DHPA 1P4BH 4S1DC 4NZDA 3DUHA 2IQAB 3STBA 3M45A 2WP3T 3ATDA 1YO4A 4OCXL 4E9YA 3BPOB 2OJEB 1T22A 2AXFB 2J8UB 3ZTJH 4GMSH 1ZLUK 1IGMH 2NUTA 4OUUB 3E6FB 1A7QH 4WI0B 1O0VA 3US9A 3B9KB 3LD8B 4Z7UB 1I1AD 5HBBA 4FHBD 5I76B 3O0RH 2G4GA 4EPSA 1YN7B 4DOHB 1IGYA 5IW1A 1WWAX 4PJ5A 5EWIL 3SGJA 3K91A 4HP5A 1ORSB 4GRWH 4DEWA 3J7HA 1AO7B 3O2DA 4XB3A 1OARL 1W6WA 4N5UA 3EBGA 3OG4B 4U1LB 1G7PB 4OZFH 4EI0A 1OAKH 5BQ7B 3X11B 2ZOKB 3QNZA 3QNYA 4KKNA 2FECL 3C8KA 5D6CA 4L23A 3E3QE 5HYSB 4JQIL 1NWOA 3P0GB 3IMBA 3CXDH 3T3PB 5J13B 4MVBD 3US0A 4WHCA 5B38G 1FNLA 4FQIL 1JZGA 4MBOA 4QHKJ 3KPMA 2KBGA 3HUJA 4PJ7A 2HVKA 5ERWA 4AE1A 2KL6A 2VDKH 1K8DB 4DGIH 1EV2E 4Y5YB 1UKQA 1XH3A 3KPRE 1KGIA 4OGAC 3GXTA 2ESVB 3HG4A 2XWJB 3MO1B 4YUEL 1HSBA 2Z4TA 4TV3A 3WD5L 3DUSA 3WFEL 3D3VB 1S7WA 1YSOA 1CTNA 3BAIA 3K6NA 3O6MH 5KJRL 1GS6X 4E5XA 1CMOA 4PJBA 4MASA 1JERA 2TAAA 5EPMA 1YEIH 3FT4B 3CSTA 4H25B 3LEYH 3H42H 4AE0A 2W1NA 3QEUA 4HZLB 1Z9SA 3P9LA 4B9KC 1IM9B 3TBVA 1BZ8A 2MOVA 2N3JA 3OAUL 4E68A 1CL7H 2LAAA 1TTAA 3EJYC 3GJEA 2F8VA 3GUTA 3DDFA 3D4ZA 3LDBB 3SPCA 4A7VA 4XPGL 3PWPE 1Q0XH 4Q0XL 4FLRA 3G6DH 4P2RE 2RJMA 5I8EA 1LEKA 2Y1AA 3VU2A 5E8PA 1J0KA 4FG4A 3SGDI 2AGJH 3UTTE 5DF0A 3I9PA 4AGOA 1WICA 4K23H 4LCIL 5GGVL 2YUXA 3QDME 2RQEA 4A2DA 4DHLA 3IMSA 4G9FE 5DJZB 4AK1A 2HLEB 2OSYA 5I6XC 2E6PA 1C8PA 3O2VL 4O2FA 4F7CA 3MNMA 4YPGB 1NEZG 2YAOA 1H5BC 5C9JA 1K8DA 3ARFC 4L4VB 4LSDA 4QGTA 2DM3A 2HAZA 2OI9B 4XNZC 5C0FA 4DEUA 2AV1A 2JB6B 5EU5B 1I3VA 4CGUB 1N0LA 3IETB 1ITBB 3REWA 2BNUB 2P80D 2XKSA 2JH2A 4ABVA 4Z5RA 4U1NA 3DMMA 4NN5C 1EEZB 4ONGH 4ZXBC 4V11A 5FYJU 3VJ6A 4JKWA 4D8PB 4QRRD 2B1HL 25C8L 3CDGA 2NY3D 2Y25A 3ECBB 1KB5H 5A6MA 4QRSA 1KFGA 4ELMA 2BFVH 5J1AB 1A4BA 3CZUB 3HLAA 2B7DT 4I0PC 4U6VH 2F61A 1MCJA 5I8CB 4OZIF 3BP7A 5CR8A 4Z7VA 2YARA 3L2NA 5FXCH 3TPUA 3QDMD 4JE4B 4WFHD 2X1OA 4P07A 3V7MA 2G4EA 1QW8A 2J88L 3IBEA 2R1WA 1OP3H 2J8OA 4I9XA 2ZUUA 2HTLD 1KPUB 3V5DB 3RKDC 1U3JA 1YY9C 3LPPA 4L3EA 4O2FB 5IIEB 2H3XC 4BK5C 5IVXB 3O9WC 4E0RA 3ULVF 3VFVB 3SDCB 2AQRA 2VZ3A 3BSZL 3POHA 2YBRB 4ICXA 2XZZA 1L5GB 1N6UA 1LK3H 5F6IC 5IR1B 3U4KA 1HX0A 1XSOA 4MWFA 2J8UF 4LXFA 1C08A 3PQYD 2QDWA 4OF6A 4Z95H 2Z93B 3VD7A 1TJHL 2JQZA 1QEXA 3R8BB 1BEYH 4IDLA 3CHRA 3ABKB 3E7JA 5BCAA 3LKNB 1X4YA 3W57A 4NUJB 4I18A 4IRSC 1ACZA 5ES4B 4PBVC 5E9DE 3EKCA 4F20A 2A83A 2EVFA 4JKMA 4FG6C 1WQVT 4W9KC 4X5XB 4YAQB 4JUSA 5E6IB 2GABA 4YIQA 3F7LA 1SBSH 4JE0A 4W9EC 3ZZLA 1KIQB 2WXIA 4OBRA 1J8HE 5E6IA 3LEYL 2DWTA 1T20A 1CDIA 2GG1A 4N1EA 3ZR6A 2Z8VC 2JQMA 2XZCH 1GY2A 1VFBB 3O9WA 4MTMA 1G7MA 2XWRA 3BDYH 4NHCH 2NLJB 4JPWL 3MRJA 3MNVB 1HE7A 1G7MB 1M2VA 4HK0A 3MFGB 4K5PA 4B5ZA 3Q43A 4W1TA 2PYEE 5IB2A 4JFEA 1FFTB 2EEXA 4ODXA 3WBDA 4J3OF 4DFHA 4J3XA 1MFAL 3IDYB 1AIFB 3CFDB 3MV9E 2YGVA 4LEOB 5HHOD 3QI9A 3WSQH 3S9DB 3P3SA 2VR9A 3ARXA 5CCKL 3AW5A 4O58H 3MPCA 3ZDYF 5D1ZD 2EIMB 2VISB 3IJ7A 2X6BA 4GAFB 3ZTNH 4JGMA 1Q38A 4I2XB 3WXVL 5HGDB 4F37F 1D7CA 4Z23A 4IIQA 3VI3E 4RFEA 5D6DA 2EJ1A 5JUEL 5C07D 4EDXB 5CU9A 5C2BH 3MJ7B 1PNDA 4UQ2B 3DX6A 3RFRA 2NXZC 4N9GB 3ASNB 3QUXC 4PRBA 3PWUB 3QUZD 5FHBL 3LKPB 2FYYB 2IPTH 2BHUA 2PR9A 4QRPE 3L4CA 4FAAB 3DROA 4I87A 1KFAL 4XAWL 3DXAD 4PGEA 3V6OA 3KBHE 2ZUYA 4NQVA 2N1KA 2AJSH 4NNXA 2BMKB 4PAZA 4CUCA 3VJ6B 2CBMA 1OTTD 3CZFA 3QQDB 5AYUL 3KDMA 1EDYA 2K9FB 4LPVA 4WU5A 2ITCA 4KX7A 4IK6A 2W60B 1TQWA 2FH8A 1P1ZA 1L9PA 5D2NC 1BFSA 1CLYH 4NS0A 4Y9FA 5GS2H 1BBJB 4JVUA 4OM1L 4UTBL 5DO2C 4NKDA 2MTAA 3QPXL 4YLQT 5F9WB 3ZDZB 1T21A 3T0AA 2HFFA 4JLRB 4PJHB 1BBDL 1BQHB 2ZXBA 3FSWA 1QYGL 2AJXH 3IDXL 2DLHA 3VTAA 2H0JA 3AROA 1R3IH 2Z1KA 4Z78A 1V7NH 5DD5H 4B9GA 4Q52A 2VDOB 2NY3B 2FJHB 1XEUA 4QHMA 3GKWL 3LS4L 1U8CB 1QSEB 2WLHA 1BFOB 1FN4B 2WQWA 5CIPH 5HGDA 1QSEA 4HJUA 1G6RA 1FNFA 3P2TA 1JF5A 4Y5VB 5J0BA 1U93B 1R3JB 3C6LC 2WTOA 3UO1L 4YHOH 1UVQA 2C1PB 4UV7H 4X9HA 3A4DA 2P8MB 5CCHE 3BQUC 2WK2A 2DAVA 3VWKC 4Z3IA 3ARBB 3KPOB 3PGFH 1NCIA 3MUJA 3DVIA 3NIGB 2GHWB 1HHHA 1S4IA 3AC0A 1YY9D 3CFCL 4LOVA 4S0SD 3AQDA 4XWOC 4CN6A 3CVCA 2E9WA 4OM0L 2MCMA 3CH1B 4JO1H 3C6SB 35C8H 2H9GA 3K71A 1I8UA 2A9NL 3O4OC 3UJIL 1UWYA 2WANA 4U1GC 2W07B 3B7TA 2JVUA 1DFBH 5KG9B 1BIIA 4M56A 1SVCP 4M93B 1GAFL 1IEBA 2GTWA 4XCCH 2G5UA 3AREB 1DQML 3Q48A 1RJYB 5D7HA 1MQ8A 3V7AE 5D7LB 3ARSA 1J0ZA 1YEHL 4JRXB 4U1HA 3G5VB 3O41B 4U6YA 2P24A 5FYJE 2WQUA 2Z0UA 3OZKA 2PTVA 4Y2NA 3GMNB 3MRBA 1EFQA 2SEBA 2F54E 2KQMA 3DWTA 3L9RA 2VLJE 3V0FA 1DQKA 1KJ3H 5IQNA 1W15A 1TZHB 4NQEB 4KKRA 4PRIB 4JZJA 1WBXA 3LXCA 2RALA 4U2ZA 5A2JH 3KPNA 3NMEA 4H40A 2QT6A 4MDJA 1GZHC 4K3DL 3HKZA 5BS0B 1UJTA 1HNYA 4GRWB 1SEBB 4QTIL 2E0PA 3TX4A 4JY5H 1T03H 5T1MA 1SEBA 5TE6L 3CK0L 2E27L 5GGSA 5F70A 1OLLA 2CIIB 3AB0C 4KOCA 3TIEA 2XC8A 3ZE1E 4AM0B 4M5SA 3Q6GH 1B2WH 2G2RB 3WKPA 1HOCB 1FZJB 1SLWA 1EMTL 1DDHA 1OTUC 2H32A 3BP6A 3HG2A 5JNYB 1NDGA 2WMPB 1Q9OA 1CPUA 5FYLL 1WA2X 1FZOA 4L1TA 4YC2C 5AOKA 1OCOB 4QJ4B 4DP5X 1SHMA 2C9QA 1KTDB 1GYUA 2M26A 4DP0X 2CG9X 3I02B 3B2DC 4NZ8A 3T65A 2G75B 3L5XL 4FN0A 5CLZA 4YH6A 5FYJD 3MODL 1QLRB 1RZGA 2CUMA 3QBTB 1MW1A 4PJHF 3FN3A 1AKJB 3ZMNA 4D0BA 2WNXA 1I1RA 4DJMA 1WZLA 3VGAB 4UV7L 3HZKB 3FAXA 1INQB 5F0JB 3SHSA 1A9VA 3LSOA 3MLYL 3QIBA 1TG8A 5F44A 3RX7A 5IF0B 1PY9A 3UBXA 1XXFC 3WE6B 4AKOA 3U1QA 1HK6A 1SN0A 2FT8A 3IJEB 2HX9A 3TO4C 3REVA 2OMYA 4RFNC 5E9NA 4GKSA 1S5IL 3CXFA 4BDVA 3ZIYA 5F7UA 4LCYB 4OT1H 2A6JA 4LSTH 2O5ZL 2ZCHH 3FCTB 3RI5K 1J87A 5CCGE 4F3FB 1Z9SB 1H3PH 5F7YC 1OWRM 2G3XA 3N1FC 3HMWH 3CN4A 2X5PA 5JDSB 2R2HB 4K8RH 4Y1TA 1DDHB 1BLIA 5IHBA 3NSCA 4OFKA 4GG8B 2ADFH 2YXWA 4ZUWA 1NCWL 1KBKA 2BY1A 3D5OF 3KGUA 5CP7B 2NSMA 3GS0A 2BSRA 1AD0B 1TTGA 5E94B 2XJKA 4JFXA 2GSMB 5DS8A 1TPXB 4J7RA 4F33B 5LKNA 3NJKA 3PAYA 4M48H 4PJ5B 4DP2X 4H88H 1G7HA 3QXTA 4L3CB 5IMKB 4ODWA 4EOWH 4AITA 1U95A 5EU7C 1ML0A 4D9QE 4OM1H 3TBYA 5GGTH 4L3CA 4D9RD 5LQBH 2GTZB 5GS1B 3PV6B 5TQ2H 4PTTA 4FMKA 3TBYB 5BJTB 2YPLA 5DK3A 2H6UA 4XCYB 1ZWIB 4XMWA 4QTIH 2L3BA 2CH8A 3BUYB 2FNBA 4GXVL 5MERB 4E42B 2YAQA 5JW4Q 5B39G 4BA8A 2Q76A 4E9TA 4NC0B 3DI2B 4QY8A 5E5RB 4F7TA 5EEVA 2BP8B 4P4KA 2JWYA 4GH7B 2A77L 2AK1H 2H2SD 2EVHA 3WLBB 4GUQA 3IETA 2GW5A 5HHNA 2N0MA 1KJMA 2V37A 2V0AA 2XPYA 5FDWA 3EXJA 3MJ6A 1CDHA 3QUYA 4F24A 3SPIA 3WIIL 3WTWA 3L48A 4QEGA 4MHHG 4QOKB 4JFFD 1QATA 4F3FA 2PR4L 4PW4A 5L88L 3VXTA 4RMRA 2J8UA 5MEND 3BDXA 2VXQH 1MHPL 4BGLA 5GRJH 2BNRB 4RFNB 4XP9H 2Y7QA 2B2XH 4W81A 4YGVB 1V55B 2IAAC 2QZQA 4I9WD 3S5LB 3OJDA 4IEFB 4UIMA 1GL4B 5FGBC 1BIHA 4YSEA 35C8L 2DS4A 1ZLDA 3C08H 4G8FB 3IGAA 4JQXA 3CFJA 3RIKA 4U1MA 3IGAB 4N2BA 4ALAL 4NM8L 3VA6A 4FI6A 1D6VL 1DQTA 3K7UA 1KGCD 4KQ3H 1EAPA 3L3KB 4MD5B 4PRHD 2Y1YA 1QLRA 1RZGB 2QPFA 4BSWA 5K5YA 4MB4A 5JOEA 1G0XA 2FJUB 1THCA 5C0EB 3FUJA 2GQHA 1D5ZB 2XWEA 3ZKMC 1G7LB 4OZFB 4J3WA 1CQKA 3GJFA 4IW4C 3VNYA 3FQRB 3HE7D 4B6ZA 4HHAA 4UZSA 3MJ8B 4AKPA 4PLKD 3PWVB 3ISRA 3UGUA 1NKOA 1DEDA 1QBML 4QXUL 1S7UA 2YS4A 1TNMA 4LSVL 1T1YB 4ONOA 4U6XA 3UAFA 2X0WA 1BGXL 4ZOAA 1KPRA 4BRVA 1U42A 1XL6A 5I1JH 5AOLA 5C3TA 3G7TA 4MNGB 5KUKA 3SKUD 3QDJA 3H3KA 1HKFA 2I25N 4QT5A 4BHUI 4ENEC 3QZWG 2FEDD 3LIZA 4PB0H 1ZV9A 3C60D 1BA9A 3CPLA 1BQRA 1EANA 1UCBL 5I66B 3V79C 2P43B 5AVTB 2OQJA 2XTJB 2W88A 4CU7A 4PJCB 1O6TA 1MCWM 3QUYC 3RHWF 3OGOE 3BFWA 3GBNH 4PJCA 1U8NB 5DWUH 4OQTH 2XX0A 5J6HB 5KSBA 4XNAA 1AJ7H 4LLMA 4BUQA 1SBSL 5GZNC 3ETBJ 3C5JA 1ZLWK 2WJ7A 2OYLA 3IRCA 1N4XH 1R3HA 3UZEA 4ZZFA 4UOW1 5C0EA 3FCUB 1A4JA 4LSPL 4JVPA 3WFBH 5GZOA 4NZTH 2LVEA 2FO1A 3OPZL 4LSUH 3HNVL 4X6BA 5HJBA 2WPGA 4RGMB 4JFYB 4A6YB 3ZVVA 1RV6X 3ZKND 3NG5A 2X4SB 4GFTB 3MYZA 1DN0B 3QEQE 3S2AA 1AC6A 5IOPB 5LHDA 4NZRH 4MQ7B 4FLHA 2CA3A 1GGIH 1T0MB 3FU7B 4JMXA 3TO2B 4FQJH 3SGKA 3FB8B 4TUJB 3VMOA 1DVFB 3IDNA 4WEUD 1MW2A 5E5MA 2X6AA 3WTYA 1FBIL 3TYGL 1EHLL 4N20A 4X8JA 3WO4B 4ZO9A 2BS8A 4HZLA 2YEQA 2WZ5A 1YEGH 4UQAA 1G4RA 4HU2A 3U9PH 3KH4A 2R1YA 1E5BA 1OAXH 1TLMA 5BUPA 5F7NC 2AEOA 2D3LA 2ADGA 3CBRA 4YGVA 1YNLH 1BBJA 4EIUA 1CTOA 3MYJB 3UZQB 1VFBA 4ZX5A 5DCCA 5PCYA 1A6ZB 2JIXA 2JTYA 5E2JA 4DGVH 1PW3A 1D2OA 1MAJA 2J6WA 4MJ6A 4R7LA 1PPIA 4KH9A 2C4FU 4PP1D 3WTTA 1J8KA 2YMXL 3SDXB 1E30A 4N5EC 2NTFB 3AXIA 1DVXA 1J8RA 1QLFB 2E59A 2UUDK 3QIWD 4NKOA 2UY6A 1JTPA 5D7JA 4ZAKA 3UGXA 2OMBA 1VACB 2DBJA 3KVPA 3PWJA 5IVXE 3GZOA 1Y18B 3PWNA 5BO0D 2UWEE 3K6DA 3QJRB 5D6CB 3SDCA 4QCIA 2MNWA 2GITA 3M1BB 4M8UA 5I9QB 1P7KA 3RGVB 3ULUC 1DBBL 1X9UA 4OF3A 1TU2B 3A5VA 1JPTL 4XNQA 2B3RA 1C08B 4TNWK 1UCBH 3IM1A 4L9LA 1YZZA 2LLNA 3N50A 4HHGA 2FHCA 4LDCA 5KJ7E 1IMHC 2E76C 2NY2B 4JDTH 1MRDL 1U3HB 2EE2A 1PCXA 3QQXA 4YDVA 3MLRL 3MBEA 2JELH 3DO3A 2JV6A 3FRPB 3KVDD 3KWUA 2WBWB 2JCWA 1BVNP 1T1YA 2C7UB 5BZXA 3OD3A 5C0IA 1KV7A 3D50A 3EGXB 5E9DD 3B3IB 1RK1B 4UYPA 2G3MA 4HJGB 2GJZA 3OKNA 3CJJA 4P3DB 3X1BA 4PS4H 2H9GB 1IUZA 4L1SA 1JZFA 4NNPL 4CAGA 1M71A 4Y8DC 3HS9A 3HI1A 5AALA 4G6JH 3NAAH 3UJTL 2B1OA 4WHYH 1J5HA 4AQAB 1GZHA 1PCSA 5TK4A 1SDDB 3FF8A 4UTBH 3GPEA 5A6IA 3MUGB 1AKJD 2ZD0A 1IE4A 2APBA 3BZFB 4GG6E 1YCSA 2YQ2A 3BGAA 4FF9A 2E6QA 1ACYL 3B56A 1UA6H 5F9OL 3KR3H 3I3EA 2EDQA 4P59L 1N9PA 2AQ1A 4NJ9H 5IFJB 1KLGB 3FXIC 4GUPA 3QI9B 2MCG1 1OCZB 5EEUA 4BE6A 1GC1H 3WN5B 1E42A 4PP2A 3P3YA 4FYRA 1JMZA 1TTRA 4BKLA 4PRHB 3MX0A 4WZ9A 3QUGA 1NKGA 3D85B 4BKLB 4MNQD 1K6QH 1OGTB 2CGRH 3APCA 1A65A 3MMEB 2G60L 3N1QC 3N85L 4Q4IA 4XB8A 3V10A 2G0LA 1NA8A 5EZJA 5DUJA 3DETD 4YL9A 5ILTL 3UG3A 4CDHA 1MIMH 4W6XB 3SQBA 2BOBA 1KB5L 1MCWW 4B97A 1CL7L 4G6ML 3SOBH 2CBPA 1UVQB 2C1PA 2YAPA 3D52A 4TN9A 5KZCD 4LHUB 2PF6A 5B1JC 1JN6A 3TIEB 4XMUA 1DLHA 3H3PH 7PCYA 5D2NA 4KI5D 1NMCB 3RKPA 1GJWA 1S7XB 3IAGC 3GM0A 3VXPB 3MRPA 3S88L 5EUOA 2H3NA 2DLEA 3IDGA 5F3HB 3UYRH 3KWWA 5BRZD 1KTKE 3SODB 4G7SB 5KJRH 5IT2H 3BAYA 4CNIA 3ILQD 4ZUTB 1R47A 4LNRB 4TNEA 5JZ7C 1I1YA 2VSMB 2FTAA 2WXMA 1ZHLB 3C6LB 3KPPA 3IU4L 5TDOB 2LLGA 4XGZB 4OIFA 3T9WA 4DKEH 1ETZA 4JPVH 2XXGA 2JIXD 3WUWB 3MTXA 1GA2A 3GLEA 4QOKE 4K71B 3VGHA 3S8WA 4D0BB 1A0QL 1XGTA 3AM8C 1CE6A 3OZLA 5C6TH 2HJKA 3ARQA 3VXNA 3VSTA 4ALAC 1M56B 2ZICA 2NT1A 4LT7A 4ZAKD 4YHZL 3LIZH 1ZT4B 2CJ3A 4U4BA 3EUDA 4XXDA 4KTYA 4EZJA 4KAQH 4N87A 3U1SH 4OVVA 3ZPDA 4PMEA 4QHKI 3T3PE 5EEYA 1SOQA 2EEBA 1NFDE 4HIEA 5DQ9B 3H9SE 3PHQB 1Y18A 4MSWB 4W93A 4HIEB 5DQ9A 1FO0H 1N19A 4PRIA 1Q1JL 3TESA 2ORBL 3HE6C 1HS6A 2XKNA 2W9EL 2VMDA 1SYVA 2ED9A 2XHNA 3FONA 3AS0A 4L1LA 1UFGA 3FTGA 4MA3A 4YXKL 4PJXB 1N10A 5LDUA 2FBRA 4YEFA 3KHOA 5E1HB 1EJ8A 5F88B 2RBLA 3VFWB 3Q9PA 5D2NB 1UWFA 4YX2L 3IS0X 1LM8V 3EGSB 1AHKA 3N91A 4NO2A 5KBNC 1XD0A 1CXLA 2ZSVA 4Y5VC 5K1NA 3TC9A 5D1QB 5B8CB 4XCNA 2J88H 3GDCA 1ETZB 3NZ8B 2Z6FA 1ANUA 1Y0LB 3QZOA 4FQQA 1SXAA 3AGVA 4PSPA 1ZT1A 1F3JB 1F6AB 1XVSA 3ZL4H 4ORGA 2NY2D 1MCCA 4EQ3A 2O72A 5E6RB 4A1RA 2J2ZA 1TJXA 4HKJA 1Z1WA 4U1HB 1DBJL 1DJGA 5KYUB 2X4UB 3RVXC 1ZGLP 3QUZA 3OF6A 3KPSA 4QLRA 2V3EA 3ZHDA 5FB8B 6FABH 4G9FB 2XNAB 4O51A 1J1XH 1LP9B 3QDMB 4PS7A 4L4TE 1AIZA 5D70L 1VZGA 1UURA 2DQEL 2XQYA 3MGOB 4IBYA 3MLSH 5D7SL 1BF2A 2D3NA 3QQ3B 4IJTA 2AEQL 2HRPH 1GY1A 4PGZA 3NOIA 3VVWA 2FQEA 4P2RB 2BP5M 1HHKA 4PRHA 4C55A 3BWUF 4HCRH 3TWCH 3CXHK 4X7CC 3WFDH 1HHKB 1WPCA 2R0LL 2GJ6D 5T1KD 5EMYA 3VXTB 3KLLA 4JZNA 3MV8E 5EBLA 1JPSH 1JTTA 3FU3A 5KVDE 1MHPH 1BOGA 2OCCB 1E5YA 1NMBH 3HPJA 1GSMA 4ZI8A 4MJJA 2WXFA 2AK1L 2NNCA 4IRJC 2Y69B 1HOCA 4BFJA 4I18C 5D1ZB 3IRPX 2X89D 4GW4B 3R7QA 4N8VB 4ODHH 2E86A 2VXVH 2GJPA 4G71B 1UXWA 3QDJD 4PTUB 1EAJA 3U1SL 2BMKA 5DGRA 1CF8L 2V7NB 3BRGC 1K4DB 2ZOLB 1PNCA 4XP4H 4B60A 5ADOH 2GK0A 4Z7WE 4L8CB 3TBBA 5BVPH 5KSVB 1L0XA 3F5WA 4ISVB 3C8KB 1KJVA 2IH8A 1KXVA 3AXLB 2NY0C 1UT9A 1A7OH 1OT4A 3R06A 4M6NL 3LIUA 5FF6B 2VERN 1XF4A 3DVGB 3L9RB 2A6IA 2J1XA 3V9FA 3M8OL 3H55A 3MJ8A 5C09D 3ILQC 3BWAA 4EI5C 1D5IL 3BGMB 4B9ZA 1JXDA 5BRPA 4BSVB 5IBUG 4HUWA 4Y5XB 3CPUA 5EV7A 3L2MA 2XA3A 4OGYL 4I0PA 3WFEH 1KNOB 3AG2B 3EH4B 2AC0A 5EBLB 2B8OT 4JHUA 3ME0B 4Y16C 2W9EH 3OAWA 4JGJA 3FC8A 1OAZH 1ZJAA 5HDQL 2YA0A 1E8YA 4MKMA 4RRPA 3W81A 1BVKA 4BWUA 2IQAA 2IDCA 1PY0A 1QQDB 2A9BA 5AL8A 4ZXBA 1ACCA 3EOBA 4G8GA 4I7ZC 4UINH 2D4FA 2PETA 3HI5L 5FGSA 4WWOA 4QKXB 3IFPA 5FHAH 5E4EB 2DMGA 2X4OB 3KJ4B 3BVWA 2HPOA 3Q13A 3EJRA 2BSED 1I31A 1NIEA 4HJ1A 2A73A 1A5FL 1SFHA 2NY7L 5DD6B 4DKTA 2DQDH 3HC4L 1VEPA 3ZL4L 3BAJA 3WJJC 1NOLA 3ZHKA 1S7QB 3EYUH 3S36X 3TJEL 6TAAA 3QPXH 1QMUA 1OF0A 4MAYC 4JKLA 3S34L 1KN2H 4R8WL 1NGQH 4N28A 1CDBA 4M4RA 4JM2A 5K9JL 1WWBX 1E50A 3JTTA 2WIMA 4LSVH 1KJMB 2WYIA 4CKVX 1X5MA 5D5ME 1JZEA 4PREA 1WBXB 3MA9H 2YWZA 2WUCH 1FZKA 1L9NA 1T3FB 2GUOA 2QQNL 5ALBH 2WGNB 1HSBB 2WLLB 5AWNL 5HI5C 4LLQB 4QRTB 4YC2B 4XPAH 2X7LA 5CJOL 1FV1A 4QRRE 5DVKA 2ICEB 3U9PL 1SZNA 2CLRA 4BKTC 5F9JB 2QELA 1PF3A 2OMWA 2QKIB 3MVSA 3FQXA 5AZ2H 3P77B 2BVYA 1U91B 2ZOOA 2Y07L 2V5TA 5D2LB 2OTUA 3TN0B 1YPZF 1KMGA 1YEHH 3P30L 2NDGA 1YEJL 2OQJB 3V2AR 1ROCA 3LKQA 3TT3H 3V6FB 1KCWA 1P1VA 3ZL2A 5EU6A 4PTUA 2D0FA 5DURB 1REIA 2WLKA 3G6JE 3P40A 1BZQK 2B0SH 4NO0A 3IVKA 2V7NA 5DC0A 4H26A 2JJSC 3UG5A 3RWCA 3L3IA 1CGWA 4YHLH 4PRAA 4TLKA 1I9RH 4M4PA 4PTTB 3OPZH 5M7QA 4L0ZA 1FCCA 3NCJL 1UEMA 1SHWA 1C1EL 1UXLA 4F93B 2WXNA 4NOBA 3CDCA 4C57C 3D39A 5C9KA 2C3HA 1LJMA 4JM2B 4OKDA 1UHVA 4L9LC 5I6KA 1JZDC 3F7VB 3KPQA 1BJ1H 3GXFA 3GYRA 3IWUA 5DRNA 1AANA 3FOMA 4PIRF 4KQ4L 4LO9A 3QWRA 3LV3B 5J1SC 2JLLA 1UH4A 1N0LB 2ZWYA 3UDWC 4HJEA 4F5CE 1AKPA 3ZHFA 3UTTB 1VCBC 5IB4B 3CV5A 3QQ9C 1KZQA 5EULV 2BZ7A 2ZCHL 4Z77B 4X8JB 5A2FA 5SX4H 4F7KA 4N0YH 4HAGA 2F53A 4ZMXA 3MV01 5GS1C 1OHZA 3LZRA 3GUTB 4D0DA 1LEIB 4MNQB 2I26N 2FR4B 3DX2A 4JY4A 5LCVA 5BVJB 4L37A 3V0HA 5T3XH 1QSFD 2AEWA 1AGDB 2R2BB 1ZT7A 3PJSA 4LLMB 2JKRM 4X5RA 3HBQA 3HZMB 1T7YA 4AEEA 5HHOE 5IVZA 3TZVC 4P2OB 2MPVA 3TN0C 4M6AA 3D4GA 5EZOH 5I0VA 4PJGA 4JJOA 3I50L 1SVBA 3Q1SL 1H19A 1F4XL 3HNSH 2CKBA 3FMGL 1WF5A 4RAVB 3VMNA 3G6AA 3QJHB 4MCZA 1YEFH 3TA3A 1HC1A 1NMCC 1DJHA 4OB5L 1NAMH 4B7IA 4MCMA 2FUTA 3OB0K 3RDJA 3QIUA 5FM8A 2OL3L 1BJMA 2FGWL 4ZD3L 4AT6A 5EIIA 3SDDA 1TU2A 2Q76B 1NGQL 1JFHA 3NN8A 1NMAL 5C0AD 1XH0A 1KIPB 1N3NA 1Z3RA 4UNIA 3VI4B 1BZDA 3DK2A 3UC2A 2P1YA 4JFDD 3H3PL 4WCYH 3QO1A 4NCC1 4NJAL 3UO8B 5L8LB 4MMXB 1PZAA 2VZOA 1NCTA 4N26A 1OCRB 4X5QA 3UFIA 4FX5A 1YQVH 4ZSOE 3LZOA 3UZEC 5IWLA 2B0SL 2PTTA 1FV1B 2GHZA 4ZUTA 4PJXE 2ZUTA 3CDGB 1A22B 3CZFB 3QQDA 3LN4A 4AH2A 5KJ4A 3HRZC 4PY7A 4U1SA 5F1OB 2VUYA 3L4ZA 4L8SB 5EBMB 3UX9B 1NH6A 4ZFQA 4PEEA 3S5LG 3FUKA 4N0CD 3WUZA 3PXJA 3QWNA 5B4MD 4NHCL 3VGBA 3HS8A 1PLCA 1IJ9A 3B9KA 4MCYB 4Z7UA 5HHVH 1RZ8B 4YGAB 5I74B 5BZDB 5C0CA 4WO4B 3TT3L 3PGCB 4N0UA 4N86A 4R97B 4HUVB 1CBVH 3GSXA 2F54D 3OM3B 4PJGB 2ADYA 1LO5A 1AFVL 3EH2A 3MV7B 1MJJB 5C0JB 2FZ3B 4KKBC 3ZHNA 5T5FH 3RG1C 1WWWX 2G9HA 3OKLA 2X6VA 3W0WA 5BUGA 4YHKL 1D6VH 2Y23A 4PIBA 3DHJA 3TF7C 5CILL 4LPXA 4FOMA 2VMJA 2YOAA 3GMLB 3W39B 5JIMA 1CZ8L 3PAZA 5B39A 4PB0L 4HW6A 2BHZA 2ZP0T 1VPOH 1CF1A 1CD8A 1C9SA 3LIZL 8FABA 1KTRL 5I6OA 5KTEL 4KDTC 4A2LA 3NP4A 4X9YA 4QRAA 3EOTH 3FOMB 4HCIA 4N2MA 2VLME 4FHJA 2NUPB 5EEWA 3GBNL 4KRLB 4JY6A 4LLUA 4UANA 4NNYB 4NERA 3FT2B 3UTSE 4FI8A 1HH6B 4HFWA 4FLOA 4X99B 1I3RA 1PDKB 3DX0A 3G08B 2Y6SC 3SJVE 5A7BA 3DX9A 3DYMA 5EU3A 1GPOL 3SKMA 3GHEH 2WLNA 3VM7A 1KGWA 1AH1A 3L3JB 3V4VH 3MQIA 4JHWH 1RZ8A 1J5OH 4ODTL 3B2PA 2A6DB 4P3WA 3D3VE 2EDEA 4MFHA 3N40P 3QS2A 2DWEB 4NP4L 4ZT1A 5IBLC 4KKAC 2YPKA 4QRQB 3PY9A 4WWNA 4CVUA 4FI7A 2XVGA 1H3XA 1EGJL 2EXWD 2PP8A 1QBMH 4HUXA 4QXUH 4RMTA 1U8IA 4GAGH 3E80A 1KJ3L 1CFMA 1RK0B 1FNGA 2GB2A 4FJ6A 4UDTB 3C60B 1ORQA 3CHQA 3L5HA 2NR6A 1OK0A 1QVOA 4YHYB 4ZMZA 3T0ED 3WFBL 5CINH 1RIHH 5D1XB 5D1XC 2NPLX 1WWCA 2ZP9A 1XWVA 3HPLB 5I16B 2VDNL 2QFRA 3GXIA 4OV6F 3HEIB 4PLJC 5C0GB 1CWVA 1T4KA 1N64L 2EDBA 4APQC 3L17A 4HJTA 1I7RB 2ZWZA 2HZHA 1E4KC 3EGXA 2IADB 4KJPD 5AVWB 4PGEB 4F80A 5EN2A 1V3JA 1ZANL 3QO1B 4R7VA 1KTLA 1JF6A 3ARBA 5IW6A 2BNUA 3O81A 4WHTB 3NABH 4A2GA 3TFKD 1JK8A 1WYJA 4PJBE 1XTLA 2ZWKA 2FQGA 3QZBA 4Q89A 2HMID 1RVFL 3UTPD 3QNXB 4GPVA 4J3OD 4MDIB 4YDZA 3ZE2E 3DMMD 5JHAA 4A2MA 3TL5A 2PP9A 3CH1A 1GR7A 2JK5B 3H6AA 5DC4B 3S4SB 2VW6A 4JFFE 4PWGA 4WTZG 1I75A 2YUVA 4J3OG 4NKIL 2ZOUA 2ADGB 4K15A 3RZCC 3MGTB 2G5BA 1DUZB 3MYJA 4V1DB 2Z9TA 3CDYA 3G5XA 5I1DB 3O8XB 5EO1B 1OV8A 3VRIB 3N1GC 2IFFL 4YDJB 4Y16D 3D0AA 3EO0A 3GSXB 3VD4A 2B16A 4K5NA 3TZVA 4EO5A 3A6CL 4P4KD 3QDMA 2GSGA 5KBPA 3BZEB 2Q3XA 3T3PF 5I15L 1W2KT 3H9SD 2WZ6A 1DO6A 3L1EA 5AOMA 4JFFB 4JDVA 4DKFL 1CS6A 1F6LL 3W9DA 2XZAH 2M2DA 4YSUA 3BPNC 2PWFA 2L04A 2N7AA 1ZV5A 4HKBB 1O6SA 1YEGL 1LO0L 3GSOB 4MDRA 4KJQD 2P42B 1BFVL 3GNMH 4TQEL 4QHLA 3MUZ1 3BEWA 2B4CC 3FT0A 1RZQA 2VYRE 3H2WA 4UBDC 5LAXA 2C9XA 3UPRB 3JWDL 4X9GA 4N2IA 1ZA3A 2AQTA 2V5YA 4FQ2H 4NO2B 1QACA 4L3AA 4ONHA 2Y36L 4I9WE 5IQOA 3C09B 3EBHA 3LKNA 5GRUL 2ADFL 4PJ8B 3FO2B 4JO2H 3TBCA 4APQB 1I3UA 4HIJB 1ZT1B 4H5SA 1OAYH 4RAUA 3D2UB 5E8EB 1JZ2A 4L1DA 4C83B 1UEYA 1HDMA 4G7VH 4DH2A 1RJYA 1MFBL 3B1UA 1XCTB 1JPEA 3CLEL 4R90L 3FBKA 3NTCH 3ZTNL 1CB4A 1MELA 1HNGA 1IB5A 3BIBX 4XXDB 4DO4A 1ZE3H 2F1BA 1SEQL 2GPZA 3HJEA 3MRBB 5K9QI 2FLMA 3BAKA 3GSWB 4PGJA 2CUAA 4L4TD 1KYOJ 2EKSB 5JMRA 3F83A 4Z95L 3ABLB 1I85A 2EYSA 2J73A 1L6PA 4BZYA 4G42A 4JG0H 4LK4A 1HCVA 3ZYIA 3MNDA 4L3EE 3V9EA 3P9WB 1CFSA 3Q3GA 1RMFH 5CILH 5E24E 2X53A 1KY6A 3B9KD 5DJYA 5C7XL 4RNRB 2KLTA 3MC0A 4KUZH 1MFUA 4Y7OC 3RVUD 1LK3L 5IJBC 3D39D 2EEFA 4Z7QF 4E2OA 1IFRA 1X4ZA 4O2EA 3PUUA 4AK2A 2X4NB 5DUMH 1KJ2B 1N70A 1U8HB 2BNQD 1LMIA 4L05A 4XWGL 5B7EA 4V2CB 3A21A 4F2EA 4UUJA 3FO2A 3MRQB 5D1ZA 3V55A 2AEPL 2H6PA 2R0KL 4ORZC 4PBWD 3ZDXB 1W0VA 2NYZA 1OGAA 3B2MA 4QWWC 1J12A 1I4FB 1QFUL 1GYAA 1J8HA 4FNRA 3UZVA 5I15H 4RGNC 1WBZB 1KGCE 1LE5A 1SJEB 3RL2A 2IDSA 4RMUA 2PPFA 1MF2L 3O3EB 4LAQL 1AGEB 5GHWL 3VD0A 5FFGA 3UTQA 3GIVA 5GGTL 2R0WH 3A22A 3RWIB 5MHSE 2I27N 1S7QA 3P30H 3RZWA 3N55A 3MFFB 3UEQA 4HJ0D 2AITA 5DFWH 2Y5EA 4JMNA 3CLFL 4ZG1A 5SWQB 3GSNA 3VFOA 2CQVA 4YR6B 1IL1B 3RAJH 1WRFA 1NUDA 1JGEA 1SUHA 1DBAH 1LVEA 3GXMA 3NACH 3QH3B 2BSTB 4RWYL 4HIHB 3N41B 1YY8A 1S7TB 2LV4A 3RJOA 3G5YB 3PIQA 2AABL 2XWJA 4BELD 5IGXH 4DESA 3LV3A 3QG6B 3BISA 3RUGA 1DQQA 4L1BA 3OZ9H 2WKOA 4WFGE 3N85H 1IGJA 2XN9E 2ZYSA 3FTWA 4ADJA 3ZO0A 1QFWI 2ZG3A 3CX2A 3HN5A 1QEWA 3KEDA 4U6TA 3LH2L 2F9BT 4XPFH 5LBVA 1PYWB 5GISH 3TA3C 3NEEA 5CD3B 5ICZA 2V9UA 2P9RA 4AXWA 2A7BA 5I5RA 2OFQA 3V6OE 5LJYH 4M1GL 2FRGP 2J1KA 3PFUA 1MFNA 4W4NA 3TN0A 3LCYA 1ADWA 2BO0A 1WUNT 3GMQA 1NCNA 4HGMA 8PAZA 2YZ1A 3MZGB 5A2KH 4Z7OE 2XN9B 3VXMB 3KWVA 4FQCL 3L5IA 4FYTA 4P2AA 1KGXA 4UU9A 3DUUA 2DY2A 3I50H 4ALAH 3MLUL 4YHLL 2AJ3A 1RMFL 1Y6NR 5FO9B 1N59A 1UXMA 2RQ8A 1P7QA 4DVRH 2CBOA 2DI7A 5GS1A 3D0LB 3R0MA 1FAIH 5ABDE 4PJBF 4R26L 4JPSA 3GI8L 3A6OA 4X80L 1QFPA 3QNYB 1RCYA 4K3DH 2ISDA 4XR8C 3VXRD 5DVPA 4I3SH 4Y16B 4NIKB 2B1AL 5DMJB 1WSST 4UM9B 3JV4A 2ZXQA 2SEBB 2VR3A 4H13C 1ZSHA 5F3BB 3PGFL 1RI8A 2R29L 4HHAB 4O2CB 1T1XB 5I1EL 3KNBA 2ZQKA 2X28A 2Z34A 4Y2DA 4CBPA 3K3QA 3QZPA 4BFNA 4TSAH 4URTB 3REWB 2XZAL 1SQMA 5C3LD 4DP1X 4POZC 4MLSA 4FQLL 2BIIA 4XO8A 5J6GA 5HYEA 4NN6B 1RY7B 1FSKC 4PVLA 5KVEL 4PSRA 3VWKB 2C1OA 3Q44A 1ZTXE 1M7UA 5IB4A 3L5WA 1WLHA 2FJGB 5I8OL 1JNHA 1IAOA 1YDPA 3EYVB 3GXNA 4GG6B 3J2PA 4UUJB 3IFPB 1VF5C 1YNLL 3S5LA 2XTLA 3P3UA 2BOCB 2CK0H 4P9HC 5ICXB 3ZO9A 2VN5A 1RUPL 4OM0H 4ACTA 2JCCA 2VJ8A 1J11A 2A73B 3DV6A 3JVGC 3OSVA 4U1GB 1MJJA 4X6EB 4F1SA 2PPCA 2J6EA 3H0TB 1CF8H 3HVDA 4ZMWA 1NC2A 3WIFB 3FTVA 3MRLA 1W72B 3EGDB 4GRLD 2VR8A 1M9SA 1ZEAL 4YHIA 2DQCH 4MHHI 4L3EB 4UQEA 3PDOB 5IMMB 1XIWC 2W65A 2OMUA 1GTFA 4NWUH 4KC3B 3PQYE 3HR5A 1UENA 4P46B 4ZFFB 4HS6A 4XPTH 4XO4A 5FA3B 5AW8B 2XQYG 3WY3A 1CVSC 4MWFB 4QF1B 5K39B 1BDYA 1D5IH 3FQUB 4G43B 2DDQL 3CX5J 2AMUA 3H8NA 3BLBA 3ZJAA 3WNLA 3G5YA 5E4EC 2E7HA 3RDTA 2NNAA 3OC8A 5AVSB 3EJUA 3W2DH 2AS5M 4HV8A 2AV1B 3O4LD 3Q2LA 1J10A 2CLRB 5F9JA 3ETTA 1B3JA 1SUJA 1OE2A 2QKIA 5HP5A 1FQ9C 1U92A 2YAEA 4JO4H 4ZFGH 1TVHB 2DV6A 4GI8A 1EH9A 2RACA 3BD5A 3LH2H 4XPFL 3TXAA 1BXVA 5DT1L 4U0RC 3SY0A 1IO4C 3ISWA 4MD4B 2DWXA 5GZOD 3O9WB 4KTEH 4YOKA 4BV1A 3T3MF 3JZYA 1MW3A 4J4PC 1G6RL 4V1DD 4ZX3A 1Y7VA 3L1FA 3VFTA 1CGSL 5ID1A 5F3FA 3FHQA 4OH2A 4NPKA 4EI6A 1L9OA 3QWOA 3HI6H 4R96A 5J56B 2EH8L 4OZIA 2EXTA 2F5BL 4O02A 1HNFA 5JQIB 4UIKH 1BQUA 5IJCC 2LQRA 3STZB 3OX8A 5ENWB 4JN1H 4K2UH 3DOSA 3ROLB 2CZNA 4XOCA 4OJFL 4XXWC 4F2MB 1PKQE 2ZYHA 3HMXH 4BK8A 5FOBB 4WJ5B 2VM9A 3SCMD 3QS3A 3FTZA 3P02A 4LKXA 4NP4H 4Y16A 5LXGH 3VXSD 1JGIA 4FL4B 4ZFZA 1FPTL 3ULUF 3X13B 5B38A 5DHMC 2K6WA 3NH7H 1J48A 5IFAH 4JO8A 1TJHH 2G5RA 5AAPA 1U8OA 1DVFA 1SJHA 3SE3C 1E4WL 5I19H 5JTWA 2AABH 1CFTA 3FNKA 2C9VA 3BE1L 1DLHB 1KF9B 1XF1A 1W8NA 3IRZA 1T0OA 1IEAA 5I75C 3Q2WA 5I75B 1WIOA 4B9PA 1IRAY 5H4ZA 1KPVB 4DP7X 4WKZA 3BKML 2R39A 4OCMC 3F7QA 5IEKA 1GIGL 2R29A 4EI5D 3IK2A 1BYPA 3VAEA 4NM8H 2Y1VA 2C5DC 4NQXA 5T1KA 3STLA 2OYPA 4TMPA 5DD1L 5DD3L 5D2LA 3T3ME 5FUZL 4NP9A 1SFDA 1NFKA 4X0NA 2GYSA 1PFOA 3BPNB 3GJEB 4ZOBA 2RMNA 1JRHL 4FXGA 1ACYH 1R5IA 3GRGA 5G4MA 1FGNL 4JDEA 3RVVC 4AENA 4HOWA 1G84A 4MNHB 4UAOB 2L4OA 3QWOB 3MRRB 5C0JA 1ZT4A 1OE3A 2ZXGA 4QD2E 2APFA 2DWEA 4FQCH 3RIFK 3BXNB 4NHUB 2YRLA 3BPOC 1EX0A 2TSBA 4JFSA 5F0PB 2ZOKA 2PCXA 3QNZB 2LU5A 5I1AA 1AGBA 1QNZL 2Q86A 1Q1JH 4X6CF 4BEIA 1NANI 4KXBA 3EYQD 1KXHA 3EJPA 3MREB 4XT1C 4XNQB 1WFNA 4OCXH 1PY4A 1JF1B 4PG2A 4RH4A 3WTSA 4M7LL 4OZHE 4XI5D 2QR0B 2D9CA 2YGPA 5F1KC 2IF7A 3UMNA 1DJWA 3I6LD 3IGLA 1U3NA 1JUFA 4Y4FD 4TULL 5SX5H 1RZKL 3RDTB 4F7PA 3FB6A 5DJ8A 1JHTB 2FYYA 5HYIA 1O7VA 1RVFH 3N42F 4HK3J 5ITBH 3DX4A 4JFPA 1JZJA 2ATPA 4ZDHA 3FU9A 3SKOB 4XP6H 2O30A 4IU3B 4UQ9A 4WTZA 2JTDA 3IU4H 4QNPF 1BXAA 5EUOB 5F3HA 5MENB 1L0QA 4CNIB 4GKOA 4KZEH 1D5MB 2UY7A 1HYSD 2Z4QB 3VX0A 4ETQA 4KMTH 1OB1B 4OZGA 1GS8A 1KB3A 1PZ3A 4B9YA 1C1EH 3P1VA 4MNQA 2ZKWA 4KNTA 2NMSA 3TV3H 3L9EA 2BVQA 3BMWA 2EYTA 2OL3H 1T5WB 1MZZA 3MV7A 4S1DD 2BVQB 4KROB 5E8PB 1OSEA 3VRIA 2GAZA 1ZGLM 3UP6A 4NQCA 5HYSG 4G8IA 1E4WH 3OLDA 1HCYA 1TVDA 4MMXC 3V4PA 4ZK8A 2GVYA 2OM5A 5IUCA 4NJAH 1Q8MA 1A4JB 2BSDA 2JXMB 3GS4A 3A4AA 3CSGA 4ODVH 3L6FB 3QIWA 5DTFA 5KYYB 4HWNA 3SE9L 3SQOL 1USZA 5G4NA 5IKCA 3HMXL 4RISL 3VGGA 1FLRL 3I9GH 8FABB 3F58L 5MI0C 1FNEB 2EDLA 1MJ7H 2IMMA 3B6SA 4ELDA 4ADIA 2FK9A 2Q7NA 2WOBA 2X4SA 5LO7A 2PCPB 3ATFA 5FHBH 1HVXA 5ANME 2NQCA 3DBSA 3WNOA 5GRXG 2HKFL 2P8LA 3CFUA 3WNNA 5EFIA 2BIHA 2WVVA 1E9PA 3RZCA 5F88A 4Q74A 2Q6WB 1GGUA 5GGRA 1UOLA 3DIVA 4LLDB 2IQ9L 3QDJE 4X0KB 1N26A 4B9IA 4F58H 3LQMA 3ABGA 1UXWB 3DJRA 3RURA 1EO5A 1IKNC 2IGFL 1YEIL 4LCWA 4PJDF 2YMXH 1W6LA 3HG1E 2ZAIA 4KFZC 5BV7B 43CAA 1JPGB 4MQXD 4AG4H 1PLGH 2ZJSH 3LAFA 1MHCA 4UV4H 2YBGA 3DJTA 3GPSA 5DT1H 2ZUSA 5EUKA 4AJVA 1AGCA 5AVYB 3RWHA 5BW7A 1KJVB 5JIQA 4BH8B 1G5AA 5BRQA 1BIIB 4YHPA 4MA1B 4M6NH 6PCYA 1J1XL 2WQRA 2J5WA 4UDTA 3BFQG 3R1GH 1PLBA 5C70A 5HY9B 4HF5L 5TE4L 4PJEB 3W5MA 5CBAB 2CJSA 4JB9L 2H2SC 2HX8A 2XBTA 5D1XA 5J12C 5IM7A 2VQ4A 3DARA 4GI9A 3ZDXF 1P4IL 2QQLL 4Y4KD 5DMGC 3PAUA 2L7JA 3SN6N 4AIZB 4ZFOL 4Y0GA 1FZMA 5HDRA 2NR6C 4HWZA 1OOWA 2F7PA 2WLYA 4LAJH 1YJDL 3CQQA 2P7TA 2A6JB 1LDSA 5HHXL 2MH4A 2WVUA 1ZLWH 5L9DH 1U4FA 1NUNB 4ABQA 4AMWA 3VDBA 2K70A 3PWPB 4X6CA 4J23A 4JFVA 1IJNA 5A40E 2BWIA 4A68A 5IFHL 3MLTA 3KD4A 2YGQA 2W80C 4C47A 1ZS8B 4QRUA 2G2NA 3DHMA 3QPQC 2EDRA 5CM1A 5K33A 4LIQE 5F89A 1EGJH 4WVRA 3M88A 5HJGA 4B3VA 2YGNA 3NCEB 1MLBA 1KIQA 4E41E 5I6MA 2X44D 4GT7A 1NCJA 2WB7A 4KRPD 1NPJA 4MS8D 4L3FA 5E2TL 1SLUA 3G5XB 3QT2A 5J3HC 8CGTA 1E90A 4UCFA 3FRPG 4JW3A 3ZKMD 1JHKH 4X4ZA 1SY6A 4QOKD 1IFHL 5ELIA 2Y7LA 4Q14A 4LDLB 3V6BR 2X12A 4KQ0A 2D8KA 4PJHA 3IJ9A 4OLXL 4QUOA 4IMKC 1UQSA 2FT6A 5KVGL 4HXAH 1ZLVH 1JGLH 2V2TB 3O3AA 1CT8A 5I8KL 3SBRA 2Y72A 3KYOB 3WLBA 1YN6B 4HKZB 3MX0B 3QJZA 4ZS6C 5TDNB 1FN4A 2HJFA 3HG1B 4RZKA 4OD2B 2OYMA 3NQIA 2ZCZA 4RVBA 2ZF9A 4Q6YA 1IGTA 2N56A 4KKAD 2R2CA 4PCSA 4O2EB 1OSYA 2WCGA 3F58H 4CJ1A 4J1UA 2OA9A 2ZUWA 3ME0A 5E51A 4P9HL 1JZHA 4JDTL 2JJUA 4N9OB 3UP1A 1QR1B 1VERA 1WJ3A 5DZNA 4NOFA 3LKPA 3E6FA 1PYWA 4JRYA 4PJ9C 1MCSA 1N0XL 3QORA 4RZCB 4NAMA 4FYQA 3OQ3B 3PP4H 4N6RA 2JQAA 4RFOH 2H2PD 2Z65C 1T0PB 4XNYL 5CZXC 5E6ID 4LCWB 3EXLA 5CP7A 2PO6B 1KEML 1IC4H 2DIAA 3F6LA 3OJMB 4A6YL 3CFBB 4LVHC 3EJSA 2C9SA 5F7BA 1PZ2A 4BQ8A 7PAZA 3UACA 4UT7H 3HE7A 3EBIA 3LKSA 3MODH 1IGFH 2QQLH 4UV4L 3V4VL 3WHXB 3AXLA 4MD5A 5E7FA 5IMMA 1QHQA 3RX5A 4LEEA 2WWNA 3WXVH 3H7LA 5CHNB 2KPNA 3BIKA 1UA3A 4HIIB 2HFEA 3O2DL 4G11A 1IBGL 4JFUA 4YR6A 5CSZB 3SCMC 1MFEL 1RUPH 3LSOB 4P8QA 5T5NG 1GYVA 2X2YA 2N7BA 3DIFA 3UPAA 3B34A 2OMNA 1U58B 4XBGA 4XPHH 1VB9A 1F3RB 5TJWK 1E4XL 1K5NB 3CN1A 2DBLL 4PRPD 5TDNA 4HIQA 1WG3A 5LCVH 4M8QA 1L9TA 5D7IB 1O7DC 4O58L 4Z7OF 3NRQA 4O2CA 1KG0A 3TPKA 2FCBA 2O6DA 2FO8A 3DO4A 1SYSB 1RLWA 2FJFA 4FFYL 1A64A 1SMDA 2PW1B 4R7DB 5DK0B 1P4BL 1N18A 2WKGA 3UTTA 2P7TB 5AYUH 3L95A 1R3JA 1ESOA 3QJFB 5EIIG 4WW1A 1TTBA 4WTQA 3WDHA 1YVLA 1E4HA 4JRFA 4XPBH 2GT9A 5FO7A 3QR2A 2B2XL 2IAMB 3IB4A 2I9TA 1F2QA 3QUYD 4EQ2A 2BNRA 5EA0L 5KAQG 2VXUH 1VGKB 2F8IA 4EZLA 5BV7L 4PJEF 5J89A 5E8OB 4W9LC 1F02I 1G7IA 2Q2LA 3N43F 4JAMA 3EF7A 2F2HA 4TOYH 3AS3A 2J1ZA 3II3A 4EI6B 2ZXWB 4M48L 3N04A 5AW6B 1CFQA 5CP3A 1G0YR 3RX8A 1C7SA 3EFDL 1Y07A 2HRPL 3EFOA 4PJ9B 2JKIS 3BIKB 4FMFA 5GJSH 5TH2B 3STZA 1MEXL 1OAQL 2J2ZB 2MRYA 1MLCB 1UD2A 4G7YH 3TNMB 3GNML 2K45A 2GC7C 4CKQA 3DSFH 3VXRE 5KS9B 1MWAL 3SD5A 2FWLB 2P28B 5CLTA 4MA7L 2QMKA 1DQDH 3FQYA 4FDWA 3QHFH 2EKSA 1R34A 4I77H 1R0AL 2BP0B 4IHBA 3O4OB 3GC3A 3CFCH 3TGXA 1MNNA 3N9GL 4DP8X 5FDWB 5AG9A 2CCVA 5I5IA 5J3HD 1JXKA 4KHTL 3HAEB 3TH2T 2WZ0A 3K8KA 3SPGA 5D9SA 2HPTA 3VD2A 1EXUB 4S1QH 1YJDH 4F27A 1UADC 2UZIH 2AERT 1QEWB 1UGNA 2A9NH 1TO4A 2FATL 2FAUA 4Q58C 3L4YA 3GMOA 1WGOA 5HDBB 2XDHA 5A2LH 1MFBH 2DD8H 4QT5B 4L8BB 1KWGA 2CPCA 4ZMLA 3BZDA 3STLB 1R9FA 3V4PH 4KVNH 1MY5A 4YHML 3MLPA 3CBKB 2VLKD 4ZUUB 5FM5O 4K9JA 4XPGH 3BP5A 4O9HL 1N0XH 2WM0A 4Y9BA 5EC2B 5FX3A 4JZJC 2VL4A 4AYBA 1CFQB 2HH0H 2IBBA 2N0KA 1I4FA 3AWEA 3QUMA 2XWBB 5J57B 4TSBL 2IAMC 5GRWA 5E08L 4M9PA 2NY3C 4KVCL 4Y4HC 1J0HA 1AMYA 3VYOA 1Q90A 4RA3A 3PREA 2M1KA 3G3LA 2DKMA 3AVEA 5FUCC 5JPNB 2OMUB 4FTVA 2G75A 3QHZH 1CGUA 4R0LA 4FFZA 1MHHB 1YNKL 3P0VL 2WXLA 4LGRB 4QRBA 1RIUL 4TUUA 2Q3ZA 3BD3A 1JPST 3LY6A 4I85A 3DRQA 4ES9A 2PMZA 2K7PA 4G9DB 2EACA 4N2FA 5HDQH 2IO5A 3EO1A 4AEIH 3DRQB 4DGIL 1T03L 3QIBB 1WT5C 3ESUF 5JW3L 3ULUL 4RGND 3B9EA 1AXTH 4D3CL 2VTFA 1CURA 3KM1A 4QJ3B 2Y3NA 4MQ7A 1KC5L 3SYCA 3AG1B 1U8OB 4FXKA 1D5BB 1HE8A 1T83A 1QNZH 3QZMA 1AQDA 3VWKA 3R8QA 3O3DA 1UXSB 1CCZA 4MJ5B 4P3DA 2HG5A 5J8OA 1XF2B 4LVEA 4JQVC 4ANKA 4FGMA 2J21A 4X6DA 5GJSL 5JQHC 1D6EB 3EDKA 4OD3L 4OJCA 3UJJH 3OV6A 5HHQB 3BP5B 4UM8B 3F7YA 4JK0D 4C4BA 4UQ3B 1E2ZA 3KLSA 1X5IA 1AZZC 4M1GH 3CHOA 4GKLA 2VXTL 5KSBB 1DQDL 3T09A 5L6YH 3GMQB 5L4JA 3BN9D 4W9IC 3D4YA 3NACL 1P0SE 2YQ3A 3G6JF 2VN7A 4JDEB 3VVVA 2F8XC 4KTGA 1JGVL 3OAZH 4TRPH 3OB0H 4UT7L 2J4WH 1CE1H 3BPCB 4QRPA 1N5YH 2FGZA 3H9SB 1Y1UA 1VSCA 3MA9L 2P4AB 3K81A 5BQ7A 5IHZA 4I48B 4H1LH 2ZXCA 4DAGL 3U4EA 4N4YB 2LGNA 4WWKB 3CSBA 2CO2A 1OAZL 4L4VA 1WISA 2J6EL 1QTYT 3VXSE 2ZKYA 1OIOA 5JPNC 4OCSL 1HAWA 4Y2OA 3I2CH 5M94B 4F8OA 1WD8A 4YDKL 1CFTB 2MCPL 1EPFA 5FGCB 2XX1A 4MMXA 4B3EA 1XGQA 4FULA 4XHJD 4UB0L 1X9LA 5DJ0B 4FFZL 1JG9A 3C12A 4CVXB 4A04A 5K93A 3WO3B 2X1PA 2NOYA 2WQ8A 3QIBC 4CVZB 4PCTA 3WLWC 4ONFH 1HH6A 2CK2A 2ICEA 4HFWB 5T1DH 4LARH 2A83B 3FRUB 1B4JH 1XCXA 3CDZA 4AG4L 2IEPA 1QSZA 4ZX4A 2XKUA 1PEZA 2CIKA 1MCKA 1AHMA 1YA5A 4X5PA 2XXFA 1T20B 2E7LA 4WI0A 3AQZA 2WLIB 3MBXL 1F2XK 4FKHA 4HSQA 4L48A 2XYBA 4YDJA 5JZ7D 1E2WA 5BZZA 3VRLE 1C5DA 1A4KA 4Z3TA 1NEUA 2P44B 4UTBA 2OK0H 5CJQL 1BAGA 3AZUA 5SV4A 5IVXF 2BS9A 4NX0A 4JANB 2P47B 3WN5A 1FAIL 4OZGF 1FIGL 1M6UA 3ZYZA 1BAFH 5L7XL 1DVTA 2A4ZA 3M07A 1X9RA 3PWLB 2M83A 4XNMB 4AQ8A 2QL1A 3AJ7A 1HQRB 3W3BA 1SYVB 1HZHL 4WW2F 3P4LA 3QHFL 3BQUD 4DKAA 3B9AA 2D0HA 3LYRA 5EZJB 1XGQB 5F7LB 3VFNA 1U9KA 5D5MA 5DJ0A 5KEZA 3UOAB 5A16B 1AQ8A 2CPUA 2ENSA 1Q72H 4NUJA 4X9BA 4DTGL 5JDJA 3K5SA 4L9DA 5AB0A 3FB8A 4TUJA 4CGTA 3C8HA 1XSKA 4S1QL 5CLWA 4XMTA 1RURL 3P0YH 3C5ZB 3ARWA 1RUQH 3QDJB 2E46A 1EEZA 2IC2A 3FT4A 3P4MA 4GMTH 4P4RA 2ODIA 1X44A 4I88A 1V7ML 4LHQB 4NNXB 1CTMA 5JXED 1WFOA 5HHQA 2XPGA 4CC4A 3BD4A 4WI5A 2D7QA 4UOW0 4ZMOA 1A0QH 1RAMA 1RLBA 3U0WH 3IPEA 4M03A 2DQFB 2VDOL 2DLFH 2OMVA 4K7PX 1M3JA 5DD0L 4NO3B 4ODXB 4BFKA 2WLJA 1U8IB 1ETB1 3MLWL 2JIXB 1Z0MA 5B3JE 2BY2A 1QI3A 4L5FE 3KL3A 1F56A 4N0FB 4TRPL 4JFED 3AMLA 2AMGA 4OZFG 3QUHA 4PGCA 2VISA 4K07A 2GSGB 3GXUB 1IIKA 3BZEA 2YGOA 2BIQA 2M8XA 2BVOA 1BZ7A 2CXKA 2D7OA 3I75A 3PWNB 4FCAA 4NUGL 2KLSA 1NDTA 4BH7B 2PCYA 2ERJB 3D39E 2Y2WA 4G6FD 4ODSL 1XGZA 2J8HA 3GSQA 2G30A 5AYQA 3H7BA 1UACL 3HRPA 4XXWA 4R4NC 1AG0A 2WBJB 2WBJC 4OZHF 2VDRH 4M5ZL 4NAJA 1JZ6A 2F18A 2AZUA 2NW2A 1G6RH 3DYPA 4KUCD 3GO1H 2HT4D 5EORL 4P2YA 1FGNH 3AXHA 5EU4B 3UYRL 5IT2L 2OX5A 1URLA 5J9PA 3OHXC 5JHDD 3OKOB 4XVTH 4GO6B 3TBTB 5TF0A 5HGHB 3RBGA 2CMRL 4U6HA 3C2SA 2DB8A 5D4QA 1H5BA 1B4TA 3S97C 3CSYA 2WSKA 3RTQB 1ZHKB 2VDLH 5TDPB 3TV8A 1C12A 2Q9OA 3AG3B 1S46A 1U21A 2G5BB 4JN1L 1QW9A 3GIVB 4K2UL 1A3QA 2WINA 4P3CL 5CEYA 5F9AC 2NQ3A 2NXYC 2V7HB 4P2CG 4UM9D 4NZUH 3ZXAC 1BVLA 3K6IA 5JOPE 1TT6A 5FCUL 3WI9A 3TZVB 1X3DA 3HR6A 3VU1A 3WO4C 2L8AA 1WA0X 3ARDD 5JOFB 1KLFA 2LU3A 5AVQB 4R5VA 3LQAC 2P3YA 4HC1H 4BFGA 4KK5C 1AQHA 5LCVL 4YSRA 2XICA 3TO4D 3ARUA 5CNHA 3L1GA 3QUXA 4HLJA 3LXUX 4FFYH 1D7DA 3SBQA 1YYMH 5GGUB 1TVBB 3BUIA 3IAQA 5HVGB 3T8XA 2Q1EA 2WBJA 4YXHL 4HS8H 2ZNWA 4HPOL 4J3OH 3GHEL 3VXSB 3GLDA 4IIQC 3X14B 2CLZA 1FDLH 3DTXA 4I5BB 4NQSB 5C07E 3VG9C 4F9LC 2JJWA 2WVVB 1VRSA 4M02A 3DPBB 1DR9A 3L4UA 4DN3L 3ETSA 3NFNB 3U0WL 4UT9L 4R83A 3PFQA 5L2KD 2NY6B 3VXRB 2CUHA 4JAMB 4ANWA 1UH2A 1TKWA 2PN5A 1GIGH 4L8SC 5EBMA 2CR0A 3HNTH 3RILA 2EE3A 4FNSA 3ARRA 1EO8H 4MMYA 2UXTA 3FCBA 2XPGB 4CC4C 5D7LA 3HAEH 1IC7L 4N25A 1RZPA 4HUCA 3HE6B 4PMFA 4IYKA 5KSVA 2O5NA 4A67A 5LDSA 2R9HD 4WGWB 2Y24A 3K8MA 4M7LH 3BP4B 4M3HA 2LTQB 3LNDA 4V1DE 2XTSA 3SGJC 4BJLA 1XL4A 2WOYA 3FH8A 2NY5L 1ZTXH 2HUEA 2PPEA 4P2QE 5IREA 3V4PB 1YN6A 4HKZA 4QR7A 3RP1A 5HYJE 1U8MA 1A3ZA 4YVUA 1MAKA 3KE0A 4PREB 4H4NA 1I1AA 3QFJB 3OSKA 4PJDB 5C0AA 4B50A 5KAQF 1KEGL 2JI2A 1CZ8H 5DJ6A 4XN9A 1TQCC 4XBPB 2IGTA 3GXPA 2F58H 1CO1A 1B88A 4Y9GA 4Q9RH 1SYSA 2EAEA 3W9EA 4Y5VA 2J7LA 4JY5L 3S8FB 4G6JL 5DK0A 1NMBL 1NCOA 4U1KA 4L8DA 1NICA 3LEVL 2B3IA 3APFA 3MLTB 4WNQA 5DI8B 5LBSH 4QLWA 1KCLA 2WCPA 3HMWL 4FS0A 3WN5C 2QDVA 2WQXA 3FO1A 4XVJL 1LMKA 1OPGL 2NQDA 1D9KB 4KI5E 2IDQA 3MU3A 1KCSL 1HHHB 1UM4H 1DL7L 4LKCB 5D1XD 4W70A 3SJVA 1A3LH 3FCGA 3P0YL 4KO7A 1LQBC 2ZSVB 2XWBA 3PP3K 1WC7B 4KDVA 4RMBA 5F7DA 5GZND 1DUYB 5INCA 4OAWB 3NJIA 3PRZA 4PJAB 2Y1ZA 3NAAL 3UMTA 3EG9A 5F7FA 5JIDA 3APDA 5ICUA 1AKJA 1TCRA 2QQQA 3DUUB 2ROYA 2R27A 3BH9A 4K94L 3ROOB 2ZOWA 4NZUL 4WENB 5IJVA 2MFNA 4WHYG 5HHXH 2B1AH 2ICEC 4Y19E 5C6PB 2C7FA 3KH3A 4KKPA 2KQNA 3TNMA 1TEFA 3FO9B 4YFLF 5EZLB 2R29H 4M93C 5K9JH 4EUPB 3VUAA 4YSQA 2FEJA 2MHAB 3MI6A 4YO0A 2BRRH 5DZJA 2XQ0A 1AXIB 1JDCA 4GNKB 5SWZE 5LBSA 4NQEA 4KY2A 4WI3A 1ONQB 4PJCE 4CC0A 2VDQL 3D06A 4KX9A 5C08A 1QTPA 3OTTA 1QWHA 4OTXL 1P7HL 3T8XB 2WB1A 2D2OA 3FSZA 2HWZL 4DEPC 3ARFA 1MFMA 1JV5B 1AE6L 4FXKC 1MJUH 2A3TA 3ARDB 4KO6A 3AUVA 4QPEA 3FW6A 1L9SA 2KDYA 1W0YT 2C26A 4MNGE 4KVNL 2I5YH 1P7QD 4GLRH 2CDFA 4PJFA 5JIIA 3UXFA 2AP2A 1NAMA 2VE6A 3KW8A 3FTXA 5K1VA 1TXKA 3DO7B 1DQJA 2QQKH 2NUTB 1MVYA 5D7EA 2ITEA 3K4AA 1R46A 1FL6B 3IXAB 5DA4A 2DN7A 3SCMB 2RGSA 4RIRB 2CKBH 4M3JA 1IC0A 1NIBA 3HZMA 4UNTA 3HB3C 5DA0B 2JCCB 2K3TA 2OZ4H 1YN7A 5CSGA 5D7JD 5IW1B 2J4WL 1ASPA 1WHPA 2CHXA 2WP3O 3J27A 1FVCB 2WCSA 1EXGA 1CR9H 4GG6F 5H94A 3U4BH 2EDKA 3O45A 4MCZB 5C7XH 3NCJH 4XHJC 3H4HA 4U1MB 2DIBA 2ID5A 2G3ZA 1NINA 4PW3A 4GXUM 4QAMB 1WDAA 5D8JH 3ULUD 3RNQA 2AJUL 2J6EH 1H3WM 2R69H 4AEHL 1V54B 2WSPA 2A9CA 1EUTA 4KMQA 4AC2A 1C5BH 1YQ2A 1T83C 4GSUA 4M8QB 1WCBA 4Y1AE 4KRPC 3S35L 1U8MB 2A9ML 5F1IA 1BJ8A 1B0WA 2R0KH 4IRZA 5E6UB 3RB5A 4GP4B 2R83A 4A7QA 3VGAC 1JVLA 1XH3B 5IBTH 1VEOA 2HRGA 4IBZA 1XCQB 3EYFB 4JO1L 4CVZA 1LO0H 4WW1B 4XVUC 2F7IA 4LASL 5BS0A 4DUXA 3V7AG 1GVIA 2H6OA 2AK4A 1LP9E 2IWGA 4N0YL 4PJFB 3OR7A 4BUGA 3TURA 4J2XA 2FNWA 3E1F1 1QR1A 4R0LC 3SO3B 2OZ4A 1TVHA 5AUMA 3EHBC 2YD6A 3SDAD 1OLZA 1NOFA 3ET9F 4OBSA 3SY0B 2CO7A 4P23A 4YWGL 1NCGA 3S4SG 1I9EA 5EU6B 4N6RB 3RAJL 3C08L 3TPUB 2IXQB 5D96B 1FZOB 2VLLB 4GOSA 4AGNA 5ID1B 4CJ0A 3LRHA 3WIHA 1KEMH 2XQBL 4A6YH 2CNZA 1MJ8L 3ZW3A 3ZKQD 1GOHA 2ENJA 4AZUA 4JM4L 1BQHG 2IDFA 1XSJA 3W11C 4D8OA 3G9VA 5I1AB 5SX4I 4CMHB 4R90H 5KOMC 4JO3L 3FFDB 4KUZL 1ZK9A 2ENYA 4P5MB 1KCVL 5KYWB 2XY1A 3DI3B 1AO7E 2ALWA 3B7SA 1TPXC 2MQCA 5IROA 4CMMA 2NW3A 1BJ1J 3N1PC 4YE0A 1R3KA 3MROB 1MFEH 2A9AA 3KXFD 1DANU 2HVKB 5TK2A 2NW3B 4NAQA 1J5CA 1MNUL 1BSIA 3D18A 2BJML 5CWSA 4TVPH 5E2WH 2G9KA 4UQIM 5AW2B 3UTSD 4AQEB 5A2CA 3IJ8A 4MS8C 2AEPH 4AQ1B 4BYHA 4EN3D 5JXAL 5I28A 3MCLL 3ZKXC 1ET7A 1CI3M 2WBKA 1R3LB 2VUOA 5CJQH 1IKFH 3VI4A 4ADGA 2ZWSA 3NQKA 4X42A 1CLZH 2I07A 1QKZH 3G08A 4R7DA 2NYYC 4YSDA 2RFXB 3SDDD 3M46A 4NKMB 3V52H 2UX6A 3QEGL 4XNXL 1VGEH 3K2UL 3FO0L 4PS8A 3AABA 4GKNB 4X4XB 4WTWA 1ZLEA 4IOIA 3ULVE 1OB1A 1YG9A 2EC9U 3LKOB 1BX2B 4OZGB 4X4XA 5MEQA 4IGBD 4JY4B 4MQSB 2I9TB 1KDJA 4FJZA 2CO6B 2KC0A 4OUUA 3IJHB 4RMVA 1JE6A 3U79A 3V4UL 4NGHH 4G6KH 4ODHL 3SCMA 4F8LA 3S8GB 4KV5E 1NCUA 5IVZB 1IE5A 1XBDA 4F9PC 3H6JA 5D7KE 2EZ0C 4N2LA 5GGVH 2DF3A 1FHNA 4IIZA 4PJ8C 5HHPA 1BAWA 2R4RH 3N9GH 4TTDC 4LRNH 1F90L 4MQTB 5ENWA 5FO9A 3NJMA 5EUOE 5DWPA 1YMHB 1ETA1 5IK3A 4EZMA 3O2DH 1MFDH 3EO1B 5JW4M 3RWEA 2X6UA 4ZFZB 5IZ7A 3CWGA 4M6MH 2BY0A 1P6WA 4TM9A 2VDMH 4MJ4A 4JHVA 4J3SA 1X7SA 2DOCA 4EIZC 2DM7A 1RUAH 5TQ0L 4ZW5A 3EJYD 3JVFC 4IRJB 3MOAH 3HI5H 4WCYL 2K3HA 1BREA 4U3XA 1CD0A 1NGYA 1Z5LA 2QR0A 4P9ML 3DTDA 3D2TA 5DFTA 4LGPB 5AENA 2NX5B 3MO1A 1EHLH 3BI9X 1JHLL 2MSPA 2C3GA 4XHQA 2HTKD 3KPRB 4BXVA 3PXLA 1UT1A 4QRTA 5DLML 3QNXA 3ZZ1A 1GPOH 5HGGS 3NCXA 5T33L 2OSXA 4UQ3A 2MNJB 3AS2A 4Y2DD 4M5ZH 2AZAA 3EYUL 2EXYC 3MUHL 3WUWA 1YNKH 2X2JA 5I6PA 3RWHB 3I74A 3QXWA 5HGBA 4HKXB 1HXYA 3RY4A 3MRRA 1ND0B 5EBWB 2IOMA 3ARFD 1F97A 3ARGB 2FLBT 1IILE 3K2MC 2X9XA 2ZUXA 4IQHA 4OI8A 1AGDA 2R2BA 3DNKA 3ARGA 4HLEA 3CMGA 1DJXA 1B90A 3D69B 1JGDB 5IROC 4HK0B 4MXVF 5HDOA 2D31A 4Z7QE 1MFCL 3IGKA 3J07A 1EEQA 4A7TA 1W72A 3EGDA 1AZNA 1KC5H 3L3GA 1RIVH 3PHQA 1F5WA 1XBRA 3QFJD 3MBWA 1JPFB 2ZCKL 2CGRL 2VM4A 2XVLA 3IKCB 4XPAL 2VW4A 3MCKA 1JI1A 4KKLC 5C0ND 1TNNA 2H4EA 4TNVF 1VGEL 1WIPA 4C54A 1N6QH 2X89A 1RL1A 1H3PL 5FA3A 5GS0H 3HG5A 4H8UA 2EDTA 2QSTA 2X3AA 3LKRA 1U4EA 4JFHE 4JKPH 3PNRB 1NDMA 1JP5A 3ML8A 2N4IA 5FHAL 2CK0L 4PI2A 3QEQD 3MCLH 1QA9B 2LE9A 4YNYB 1MDAA 1E4XI 4PH8A 4OJEH 3IXTA 4YIQB 3DX9B 3GBDA 2VQUA 4LOUC 5D1QA 3O3DB 5EU4A 5FFOA 3QDHA 4ZS7L 2A4EA 3WMPA 4BFFA 3X1NA 5KVEH 4NRYA 4HH8A 3UCQA 3K2UH 3KWWB 1IQWL 1F90H 5ESVA 4JRWA 4JJ5A 2WO2B 3CZSA 1HOEA 3M1OA 5MEQB 2GIMA 2ED6A 4CSPA 1CYXA 1HJBC 4D0DB 1LEIA 4HKJB 4HISA 4ERSL 4C4KO 2F6AA 5IHUL 1NSNH 3SDYH 1ZHBB 5L4MA 4HJ0C 4IHOA 4UAOC 4WW2A 4IKJA 3V0VB 4LLVB 1RJCA 4NGHL 3MV8A 4MB1A 4WO4A 3R0NA 2O5XL 5IY5B 2Z35B 3BP7B 1ROWA 2DKUA 1BQHA 3M6DA 2Z8WC 5JIKA 3T2NL 3OXSA 1A14H 3ZDZE 4AVJA 2AXGB 1R3HB 2VOTA 4UB0H 4PJEA 1U8QB 2QADC 4DKFH 4Q97A 3TEYA 3FQTB 4AQZA 5IIEA 4BE5A 2FJHA 3BAEL 2FECI 3C8DA 4QHMB 5HHMD 3HPLA 4BFBD 3ESMA 4R7XA 1MI5A 4X6FA 3O6LH 2HT3D 2K4AA 2Q10A 5I30L 1R5VA 2IAMD 4UOQA 1SXZA 1K4CB 1G6VK 4OI7A 4RGMC 1MHEB 2P8PA 5F97E 3KLHC 2ZCLH 3IFLH 4G8GD 1ZLSH 2IWKA 1N3NB 3KBFA 3GKZA 4JFDE 2H32H 4NFBA 5HPMB 4C56D 1BQ5A 3HHMA 1BF8A 2F68X 3V8OA 4AV4A 3DPBA 1IKFL 1D2PA 3FQWA 1Q9KA 2VXTH 3RPIA 3GF8A 3C5ZA 4PJIE 3VFWA 5L6YL 4XMPL 4KK8D 4JL2A 3SJVB 4DFIA 4RGOH 2IANA 4WWKD 2GBUA 3CQPA 2PTTB 1U3HC 4JPVL 2GSIB 4QHNA 5L8JB 1M7IB 4OJDH 2F1EA 4NKIH 4N85A 5KVMC 2VLRD 5F7EH 4MXQD 3O3EA 4OV5A 4ISVA 2DRUA 2MJWA 3B5HA 3E9TA 2W07A 5BQDA 4QWWD 1URZA 5CZVH 1UB5A 5H2BA 1IBGH 4U3SA 2EUVA 1UM4L 3JYCA 2IGLA 4AMKL 5KANI 4BCYA 4KROC 1IFGA 2DMHA 3HZKA 1HHJA 1H8NA 3EYOA 1IL1A 2OTWA 4QRQA 4MJ6B 4H20L 4K3JH 2EXSA 5ACZB 5EIVA 4CSTA 2L0DA 3II2A 1PLAA 1BFOA 2WXRA 3MTRA 4PB9H 3WE6A 3PIQB 4CU8A 3D12B 1S9XB 3HW7A 1TTFA 2PW2A 5GS0D 3H7BB 4PV9A 1RK7A 4M8VA 5DQJA 3QI9C 5MI0B 4ZO7A 1G9EA 3BEWB 5I0WA 4OLZL 3WENA 1HQRA 3L95B 1RFDL 2P8MA 1UWXH 5DQJB 1E5CA 1IQWH 2AW2A 2BHYA 5BO1L 5C0RH 1OAUH 1UJ3A 3VQ2C 2NW2B 3FHAA 4KMTL 1A7QL 1H6EA 2NZ9C 1ADQH 1QD0A 2VLKB 5EOTA 1LXMA 2ARWA 3EGSA 4ZXBB 2B39A 4YJZL 1KJ2A 3HTLX 3QZWB 1XMEB 3LZFH 1P69B 4FFZH 5LGJB 3H9HB 1JDAA 4J5VA 2BSCA 3WXWH 2WZPA 4RGNE 5T8IA 2ZAHA 4LVOC 3HC3L 2P5ED 3Q0HA 1A2YB 4FA7B 1JK8B 3IGUA 1Y0LA 4P5TD 1BEYL 2ATPB 4RZCA 4ZDHB 5BV7C 4F91B 1Z6JT 4WY7L 3HIZA 1NDGB 4LSPH 1WHOA 1ZK5A 1YEFL 5L88H 4IRZL 2ZXAA 1TR7A 4NCDA 1P84K 3O2VH 4J28A 5FUZH 4BKSC 1T1ZB 1SDDA 1FP5A 3BWUC 3HE7B 4GO8A 4PJAF 1SEQH 2NY1D 2SODB 4OFIA 4P23D 2OTWB 1F00I 3WEXA 3BP4A 4KK6C 3L16A 4QI3A 4DW2L 1UCTA 2W59A 4XO3A 3MJGX 4Q9BA 3WKYA 4IBLT 1A1MB 4TNWF 3W37A 4YHNB 3WNKA 1F8TH 4FFWD 1ORQB 3C09C 3QWRD 3X17A 2WQVA 3NJJA 2QPUA 3NIDF 4W9ZA 2BSTA 2CLVB 2HB0A 1TSHA 1XGPB 2ZX7A 3OZ9L 1UD3A 4JCLA 5EO9B 4YSCA 1NCDL 3LB6D 3QHTC 5HHOB 2FIRT 3OMZA 3OPUA 3OXRA 3WSQL 7TAAA 5LLIC 4GRWF 4LLQA 1VLXA 1LWHA 2WTRA 4ODSH 2I9LA 4Y2LA 5D8JL 1O6SB 4K4KA 1DQQB 3QJTB 5I16A 1FNHA 4HPYH 1RZJL 2E27H 1P53A 2UUDH 3BO8B 1A6WH 3FUFA 2GJ6A 1PSKL 2R56H 1DVFC 3SE3A 2D3VA 4XNUL 4LHUA 4NI6A 2P8LB 3Q6GL 3RVXD 2AQNA 5AL0A 3MDJA 3K71B 1CBVL 3ZY7A 4H1LA 4AWJC 4Z8FL 3UTPE 4NQDE 5FV1L 4HZ1A 3D48R 2EUZA 3JWNG 4DEPB 5DQDH 4PJCF 2H26A 3C6SA 1PVHA 1MCOH 2OXGB 1AGEA 4UT9A 3CSYB 1TCRB 5EH1A 4YHIB 1SGKA 2OPCA 5E70A 5C8JA 1O5DT 4TKWA 1DBBH 2GTWB 2VSKB 5E2UH 4ZTOL 4FMVA 4L29A 3L4TA 3MOBH 4U3SB 3FDWA 2EDHA 1CU4L 2HLFD 5A3IC 1E27A 1NGWB 5L9DL 4XZUB 3VFGL 2OBGA 4GRLC 3AT0A 4HXBH 4TVSa 3U46A 3KCPA 5GGRY 2DL2A 3ECWA 4PJDA 5C0AB 5DRNB 1JYVA 1IBBA 5EF3A 3NZUA 3REVB 2AK4D 4QXTB 1AYRA 2WC7A 4TVPD 3H1ZA 1XMWA 5DHYB 2I9LB 3KPLB 4Y4FA 1TZIB 4XAKE 4Z1PA 1CLOL 4NKMA 4E5XB 2I69A 4OIAA 4IOFD 4XXCC 2B9BA 4AMXA 3O2WH 4FZ8L 2VDLL 3D6GA 5ICZB 4X7TA 5E1AB 1BX2A 2XETA 2NY0D 1HXMB 4KZ0A 4YHOL 2XG4A 1S7SA 4NQDD 2AAAA 3BYTA 3TO4B 4C56B 2D3JA 2IOIA 3DSNA 4F8PA 4ZFOA 1VKXB 4ENED 5C0BB 3T0DA 1JDDA 2BSEA 1UUSA 5DS8B 3KJ4C 4BQBA 2RTTA 4FQXC 1F41A 2IGFH 4FNPA 3BJ91 2D7NA 4NQTA 5FO8B 1ZLUH 1QRNA 4AL8H 4LESA 3JBG7 3KYNB 1MCPH 4NZFA 3W0WD 1CLVA 3VSUA 5IMKA 1QRNB 1BVNT 3LQZA 3D0LA 1OXYA 2CKBB 4NPYB 4HIXH 4XNBA 3K2IA 1YYML 2OZNA 4MA1C 1KCVH 2ADIB 1P6AB 2FIKB 4GKZA 3CU1A 5KS9A 1S9YB 4KKLD 5C0NC 3KLAA 4NWTH 3WIHH 1C7TA 1NC4A 3L7EA 1D5ZA 4DZBA 4CW1B 5KW9H 2DQHL 3V5HA 4BCXA 5LWYH 4NYLA 2JKSA 4X4KA 2E7MA 1NBYA 5BOJA 1E8XA 4HIHA 2JB6A 3KYOA 3IFNH 4Z7UE 3VCLA 4BFOA 5I1GH 1QABA 5EF1A 3VFMA 5C0CE 2GY5A 4JM2D 2QV2A 4U3CA 1M7DA 4LMQI 1EJOL 2Z7ZA 2NNRA 2ICES 2J8UE 3ZKSD 3QEGH 4XNXH 1A7RH 1ZVNA 2F54B 3NZHH 4Q9RL 3NIFE 1PTZA 1AQDB 1P5UB 1Z9PA 3EADA 3EJCA 4LARL 3AS1A 4P5KB 4Q8BA 4QRFA 5E2TH 3T4AB 1JZ7A 1DN2A 1W72L 2XG4B 3RGVC 5KN5A 5DI8A 5G55A 2FEEI 1GGTA 1XDTT 1KOAA 2UX7A 1BD2B 4TUKL 4WNJA 4M29A 4F7EA 4FKEA 3TA4D 2EDXA 1FVDA 2N59A 1D7BA 4I0KA 2E9GA 1X7QA 3VX1A 4DSYA 4NENA 4BM7A 3LOWA 2A38A 3HFML 5CCKH 2X4OA 2C34A 1RJLB 4ODUA 1H6FA 5H94B 1WA1X 5E1QA 2YSSA 5I8EB 1B2WL 4P5SA 1WEJL 3FS9A 3PHOA 3OKLB 4KRPB 4R0LB 3SO3C 5TGBA 2AJ3B 4BSWB 1RIVL 4R96B 3O11B 4DAGH 1BLNB 3WN6A 1D9KD 2XFXA 4PRDA 4LCVA 1R3KB 3BLKA 3MROA 3H9ZA 1JHKL 4HCGA 4NN6C 4OZ4B 3Q7JA 1RQ5A 4G9DA 2V5RA 1LWJA 3GZQA 2VN3A 2VZTA 1HL9A 3CN3A 4S1SL 4XCYA 3SE4A 3ZUNC 4XWGH 4N3TA 4OGXH 3VD3A 4AQ1A 5K9KA 4QNPE 4XVJH 3D07A 1MVUB 3G5ZA 1NDMB 3U2SA 4HUWB 4Y5XA 3MBEB 2JB5L 3VSVA 3BE1H 1Q72L 2DYPA 3D3VA 5ECGA 1U8JA 3PUCA 1T0MA 2PKDA 1AXSA 4PBDA 4RRPG 1FFQA 5E9AA 4M9OA 3EFFA 3PHAA 2GJZB 4QKTA 1U92B 3ZSSA 2NX5A 4JFPB 2WLLA 2FX7L 3AM8A 2EIZB 3DMMC 5EOQL 1JCVA 3DMMB 3S5ZA 5ECJE 2FJSA 1W16A 2XY2A 2BFGA 3RRQA 4UM8A 2BNQB 2EADA