3FFOA

F17b-g lectin domain with bound glcnac(beta1-2)man
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
176
structure length
176
Chain Sequence
VVSFIGSTENDVGPSQGSYSSTHAMDNLPFVYNTGYNIGYQNANVWRIGGGFCVGLDGKVDLPVVGSLDGQSIYGLTEEVGLLIWMGDTNYSRGTAMSGNSWENVFSGWCVGNYLSTQGLSVHVRPVILKRNSSAQYSVQKTSIGSIRMRPYNGSSAGSVQTTVNFSLNPFTLNDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Adhesin
total genus 44
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09222 Fim-adh_lectin Fimbrial adhesin F17-AG, lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1410 Mainly Beta Sandwich Immunoglobulin-like Bacterial adhesins - F17c-type 3ffoA00
1OIOA 2BSBA 2BSCA 1O9WA 2BS8A 3FFOA 4K0OA 3F6JA 2BS71 3F64A 1ZK5A 1O9ZA 1ZPLA 1O9VA
chains in the Genus database with same CATH superfamily
3QO0A 3UTSB 4YQXL 1K72A 4BZ1H 4ADJA 3L5JA 2YBGA 2NX5B 2BFGA 2A6JB 2NY2C 3BPNB 1IEAA 1I53A 3EXJA 3JWDC 2VDKL 3MCG1 1IBYA 1NBZA 3DURA 2QKIA 3EO0A 5CGTA 1NPJA 2VXTH 2BPBA 4YOKA 1E90A 2OAAA 5EIIB 4QRUA 4AMXA 1A3LH 1VACB 2EXTA 2Y1AA 4HMCA 1TZHA 1YUKB 4I89A 4MD0A 2AHIA 4XO5A 5BVPH 4H13C 1CK0L 1Z2KA 3CHOA 4Y9EA 3N1GC 2ODIA 3WEMA 5BZXA 3SKMA 1CMOA 4GI9A 1CGUA 4OLXH 5EEUA 3NGBB 3JWOL 2HSIA 5F71A 4KMTL 1TO5A 1E8XA 3RWEA 1ZSDB 3NPSC 4U7MA 5BUPA 3JZ7A 3Q1SH 2FO4B 1ZLWH 5I1LB 3V9FA 2BRQA 4UIMA 4X6DA 3VGHA 1ZT7A 1JV5A 2C9QA 2CE6A 3MPCA 1DBJH 2EDEA 2IPUK 2QTEA 4NEHB 3QXDA 2MHAB 2ZQKA 2BSBA 1UYWL 1IGYA 1UB6A 2W1NA 2PPFA 2OFQA 1HX0A 1HOCB 1V7NH 4TXVB 3O6ML 5IB4B 1I7TA 3K5SA 1KGUA 4HCRL 3SE8H 4CADA 3FT4A 1T20B 1P7KA 2R69L 2K7PA 1KMGA 4ANUA 2W92A 2CLZA 1QQDA 3T0DA 2GYSA 3Q8EA 2LVCA 4DEWA 3DDGA 4ZRGA 4AYID 1YQ2A 2VLRA 3CV5A 2YARA 2ZX8A 3OM3B 4C4KT 1IVLA 3QXUA 3S35L 1ZS8A 3TV3H 4S0TD 1S5IH 3SD5A 4XNBA 3EFOA 2Y1YA 4KOBA 2VCOA 2YXWA 4L5FE 2B4CC 5J6GA 1PD0A 2HMIC 4GP8B 2FBJH 3P02A 1F13A 3GK8H 1H3PH 3NOIA 3TEXA 1L9SA 3KYOA 3TN0C 4E36A 5IHZA 5JQHC 1CS6A 5HI5D 2NLJA 1GGBL 1LK3L 2CR0A 3LTVA 4WV1C 4GO8A 4IRSD 3U0TA 1RMFL 4YZFF 5F6HI 4DFIA 5B1BB 3IXTB 3MOAL 2UWEB 5IF0B 3MUZ1 1WHOA 4FFWD 5JIKA 1KN4L 4M1GH 1BLNA 2XWDA 1ZXKA 4JZOA 2IAMB 3B2PA 2E7HA 5IESH 5B38B 2AABH 4FI8A 3DUSB 2KH2B 4OLYL 3NZUA 3QUYD 1IGJB 1KULA 2YBRB 2D3VA 1PCSA 3GRBA 5H8DA 3AXIA 3UAFA 2B15A 5GS1B 4GRLA 3BFWA 5EBLB 5I1CH 3BZEB 1W80A 1ZGLA 3HS0B 3H53A 3CZEA 1G7HA 2P8MB 3CHRA 2V3FA 4OCRL 4Y5XB 5D4HA 4MRBA 3C5JA 5SV4A 1UA6L 1GC1L 2AERT 3OMZA 3MVSA 4GRWH 5FKAB 4DKEL 1LP9F 2Y5TB 1E9OB 4PUBH 4RRPG 5IB5B 43C9A 1P7QD 1OAKH 2FH6A 2NY1B 2LE9A 2QPDB 2VL5B 4NQSB 5IEHA 5IW6A 4XO9A 3MZTA 4WWNA 1RUPH 2JKIS 4OLVH 3LPFA 3TBSA 1ZJBA 2HMID 2CLVA 3GBEA 2Q8AL 5I6MA 2DWXA 1L9QA 5D1ZA 1QSED 1UQSA 4LEXH 1I7TB 2A4EA 1PLGH 5L6YL 1DFXA 1RHHB 3TJEL 5A43C 2K45A 4ZD3L 1UWXK 3EIFA 3A22A 3GSUA 4X5XB 4NCC2 1UC6A 1E28B 4R26L 1QABA 5BO1H 4WI0B 3ZHKA 2R0KH 3ETTA 4XMPL 3VFUA 4G2AA 4I77L 3NRQA 3ZMRA 5B4MC 3UADA 3VXUE 2ZUXA 4W9GC 1UT2A 3EYVB 1ZJAA 3RWFB 3VAEA 5KG9B 1HEJC 2NRDA 3L2NA 1NC4A 5SX5H 5KJ7E 4YL4A 5E2UH 1MCJA 4AQOA 1C9SA 1OHQA 3UZEA 4QNPE 4HAFA 1TENA 2BMKA 1RZKC 2ODHA 2QL1A 5HYFA 3S5ZA 3P30L 1J7VR 3ILEA 5CD5C 4Y4KD 1R24A 3QULA 5AZEH 4LVOC 2R23A 1QFOA 1XL6A 1WG3A 1ZHNB 3SO3B 2XKUA 2A73A 1XGYL 4JHVA 1IRAY 1T0MA 3T77B 4IMKC 4X7TA 2C3XA 2Z31C 4G3YH 4HK0A 5GGSA 3W39A 1T7VA 1ZKAA 2G0KA 5HYSB 2GCYB 1FAKT 3ULVL 2BHFA 1IO4C 4BXVA 4FKEA 3QDMB 2V37A 3CXDL 4N1CA 5HGBB 3EDDA 1U4FA 2XN9D 4HOZA 4JFPA 4K94C 3WEXB 3SJVB 1SXBA 4W6YB 4YN3A 1BSIA 2VL4A 1Q0XH 2F53D 1TUPA 5I15L 2E3VA 4LGSB 5DTFA 2JKNA 4WK2B 1DQDL 1VFMA 3BP4B 4G6JL 4ICWA 4HUCA 4NC1C 3P4MA 1QEXA 4GAGH 4JFYB 5ADPL 2NXZD 5J3HC 3MCKB 1T1YA 3H7BB 3OHXA 5KTEH 3P73A 1S6NA 3QNXB 3QC5X 3ZTNL 3ARGC 2WNGA 5MHSD 3JWNH 1ZHNA 3WTVA 1K4CB 3BEWA 4LSVL 1PY0A 5J5EA 1R34A 4HKBB 2WW8A 3ARUA 4U05A 1IGCH 5IBLD 2N56A 5IFAH 5JR1L 2V7NB 4ODUB 2VYRE 4M5ZL 1DCLA 4NWUH 5CD5D 4NNXB 2I5YH 3PCYA 2BP3A 4H4NA 1ACCA 1Y0LB 1XEUA 1QLFB 2WJ5A 4YFLI 2W81C 3NACH 4R2GB 5KANI 3QSKB 3EHBD 5EZPA 4OZGB 1ID5I 5AB2A 5ID0B 3C08H 3QWNA 1K4CA 2XWZA 1SJHA 1OSZB 3B7TA 3ZRFC 3FUMA 2NTFA 4DP7X 5E1HB 2F8XC 3CSGA 2N0KA 4V2CB 3GKWH 3T3PB 2OX5A 4LF3A 4AI7A 4NQEE 3F7QA 1JXKA 3RDTC 3V52L 1GZQA 3FQRB 3LRLA 2X4NB 3MYJA 5D72H 1UZ6F 4JHWH 5CN1A 2GQHA 3VFTA 3C60A 1WK0A 3TJPA 1RHHA 4LOVA 2OXGA 1OAZH 4OZIE 1SXSA 5I1AA 4WO0A 3WFCL 5LQBH 4FNPA 2D7TL 4FXKB 4OJFL 2WQVA 4B3EA 5HVHC 4QYAA 2VQTA 3KJ6H 3IDMB 4U3SB 1DFBL 5DCCA 2B7DT 1D3CA 5GJSH 1V55B 3LH2H 3ROLA 4MBOA 5IB5A 2V5MA 5IQMA 1NEZB 2DYPB 2CXKA 2W9DH 4LFHG 1WA1X 5DJCB 1UJ3C 2YEZA 3WFDL 4IBQA 3O8XD 2CHXA 2AQ3A 5KVGL 3U9PL 1D2PA 1VB9A 2AQNA 4R3SB 1G7HB 2L7JA 4M7KH 3ESNA 3M88A 2ZCKL 3DETD 3QCVH 1UB5B 1RP9A 3WDHA 3GPSA 1EDYA 4LSQH 4UQIM 1K8IA 3VWKB 4AYDC 4POZD 4JY4A 3G5VA 4DEPB 3AB0B 3IBEA 3PV6A 2X4TB 1F86A 1K4DB 5I16B 1X5MA 3V0WL 2SODB 4ORZC 5DC9B 3VXRB 3VFNB 3D7PA 1KCSL 4OCWL 3RY5A 3WIFA 4JR9L 4N6RA 2ZUSA 4L9LC 3TASA 5F21B 3QCTH 1SFDA 3CX5J 4I2XA 5F9OL 5HJBA 3MOBH 3QHFH 1A3QA 2MQCA 2M1KA 4FG4A 1OOAA 3VD9A 3FMGL 4QCIB 3V0AC 3CX5K 3NYKA 4BK8A 3L3JB 3QQ3B 2IBZX 3AQDA 1ZHBB 3GSNA 2F2HA 1OSPL 2MCG1 5DD1L 3P30H 3EFFA 4AQAA 4NQVA 5IHUL 4BA8A 2WBJD 4H0LC 4ZAKB 4EQ3A 4WWID 1WD8A 2AJ3B 2B0SL 3EGDB 3U36B 3PNWB 1CFQA 2HLFD 3HTLX 4YIQA 4Q6IA 2PTTB 3KAAA 2VDNB 2X4UB 4BDVA 3DGDA 4I18A 4WI5A 2KC0A 4F20A 3N06B 4ZMWA 3C5SB 1X9QA 2JQMA 3OAZK 1K5WA 4M4PA 1Z6JT 3OB0K 1VGKB 2CMRH 1BWMA 4I0PC 3ZTJH 1PLBA 3GI9L 1NCAL 5TDNA 4UAOC 2PNDA 2KYIA 2ZPKH 4ERSH 3TEZA 3KZ8A 2FVNA 3UP1A 4U3CA 1LE5B 3V7AG 2EZ0D 4ZZFA 1LGVA 3TWCH 3UTTA 3QQNA 4RWYL 1PLGL 4MWFB 4PV1C 3O6KL 4YAQB 1NJ9B 3VFRA 1C5DA 3VDBA 4P23B 3HVDA 4BHUI 3FQUB 3AMLA 3JUZA 3OPZH 4P9MH 2VZSA 1RZIB 4NN6C 4OV5B 1WBXA 4DZBA 2A77H 3QFJD 3QI9B 3CFQA 3FFCA 2YPVL 3GSNL 3SQBA 1IKNC 4XAKD 4C83B 1LO3H 3IJYB 1G6RL 3UIZA 1EMTL 3ZTJG 3V9EA 1FYHB 4LBEA 1K5NB 1TVBA 1AMYA 1X9LA 2EVHA 3OKKB 2E7DA 5J6SA 3ZZLA 3QUZC 3QEGH 3QJHB 3IGLA 1UD2A 3V0VA 1UXSB 2DL9A 2D4FA 4PJHA 2NY6C 4B9YA 1RUKL 2V5RA 5E9DE 2G60L 2CA3A 2A1WH 1AH1A 1A5FH 1KJ3L 3OKNB 1KB5A 3VUAA 4AVKA 5EIVA 1F6AA 4KU1A 3W1ZA 2X12A 3D2UB 3NJKA 4KRNA 5GJTL 1CICC 4DW2H 2YA1A 5GGVH 2NNFA 3GMNB 4JFDE 1MCCA 4WVRA 4WWKA 1LVEA 3BVNA 2AEPL 4Y4HB 4PVLA 5FOBB 4BKSC 3VFVB 1JPGA 1YMMD 1D7BA 3QEHB 3UPRA 4DESA 5F96H 4DNLA 4UV7L 1J9SA 2B08A 5C0RH 2I85A 5GZNC 3TZVA 5F7MC 3RLSA 2PO6D 1JL8A 1QLRA 3FCTB 5EUOA 4TV3A 2YA0A 4F33A 2ZWSA 4QHNA 1U4EA 2NXZB 1AOHA 3NCJH 4JFFE 4PRHE 1LQSR 4OGXL 4HFWA 4BELD 5ID0A 5FS5A 3CVHL 3TA4D 4XCNB 4FLSA 3K81A 5ENWA 3TEYA 4KI5E 4Z77B 2OZ4L 4NUPA 1N8ZA 3E8VA 5T3ZL 3PDGA 1YECH 3ZL2A 3RG1C 4NBYB 1CD1B 3ZXAC 5EO9B 4R7DA 4JO3H 4QRRE 3IFLH 4K3EL 4MXWH 1JBJA 1E67A 1NGQH 4W93A 1HHJB 4NAMA 3NCYP 3NIDE 2D2CC 4KRMB 4OFDA 3K2KA 5ICUA 5KVGH 1E4XH 2VUOA 4W9JC 3AS1A 4AIZB 4FQ2L 5DJYA 4E41D 2KZKA 4JPSA 3WGUB 4P5TA 4U3HA 1U8HB 5E94B 2X1PA 4N5EC 2HVKA 2OR7A 4ZUWA 4AYMC 2ZWKA 5MEPB 3U79A 3GS0A 2B1HH 4QJ5B 5E9NA 3B9KC 4OFYD 1FVDB 1E40A 3S88H 1TVBB 1JDCA 5IVNA 1JI2A 4TNFA 5GGSB 3Q1SL 4LHUA 3MREB 4PG2A 2FX9H 1IFRA 4HGMA 1YYLH 2G3XA 4RIRB 2NY6B 4X8XA 4YFEA 3DOIA 5DEJA 3QDMA 1I8MA 4OV5A 3QUZB 4A6YH 1FFOB 3AQXA 4JUTA 3ZKMC 4FQQA 2DY2A 3ZUCA 2B3RA 2D3NA 2J7LA 1E0OB 2IO5A 3ATFA 3CXHJ 3P4NA 4MCMA 2X4RB 4R7DB 2F53A 2V5SA 3WJLA 4GYBA 4MNQB 3TT1L 4BSWB 1XZWA 1KPUB 3L2MA 1XHHA 5I5RA 3NJIA 1ZT1B 2YR3A 4PBDA 4DK6A 1GS8A 4M1CC 2HTKC 3E6FB 4MZ2A 1AQKL 5DLLA 4ZFQA 3W82A 1DLFH 4EZMA 2JKWA 5FUOH 5JPMA 1I1YB 2QVKA 4HISA 1XXDC 3VTMA 4HUUA 4LAQL 4QR7A 4XI5D 4AYFA 4PJ8A 5EUOB 5C9KA 1S5HA 4KKPA 5CWSA 3N40F 1CDCA 5KYYB 4ODHL 1E3FA 3BKYL 1T4KA 3IFNH 1E4KC 3GEWB 3O2VH 3QWQB 4Y4FB 4U6YB 2BNQE 3QQXA 4FQCL 4Y9GA 3HG5A 4E41B 4PJ7E 3HFMH 1FBIH 3MLUH 1EXUA 1TT6A 3ZHDA 4QYOA 4GAGL 5DMGD 1LO2H 1WQVT 1JZFA 4KRPC 4C8XA 2X4UA 4BDVB 3HB3C 1HXYB 4UM9D 1A4CA 3S6CA 1IFHH 2XWTB 4LNRA 4FQ1H 4APQB 3LS4L 3OGCA 1GOGA 2OCJA 2JQZA 4OU3A 3UGXA 3V5DA 1C8QA 1IU1A 3QDGD 2E8ZA 1S7UA 3QORB 3S3BB 2PWFA 2X6MA 2ZCZA 2NYYC 1M7DB 3FU5A 3MLXH 2VXVL 1TCRA 2F1AA 3WJMA 5MHSE 2KLTA 1JV2B 1AXSB 4MJIB 4AC2A 4PGJA 1MCOL 4ZO6A 4Z7NE 1M6OA 5I17A 2VR8A 4N90E 3GSXB 5I6OA 4FQ2H 2XVBA 1FFRA 3X2QB 2QHRH 3BPCB 5LXGL 4NFBA 3G9VA 1BVNT 1D6EA 1MRCL 3EOBB 3LRKA 4N0YL 3EO9L 4CDHA 4MMZA 5FO8A 2CDEA 1ZSHA 1T21A 3C09C 1CTMA 4MQXC 5ANME 3T0EB 1J1OL 4XI5C 2E7LC 2WQ8A 5I0YA 4AGMA 3QJOA 1BXVA 2EE6A 4G7YL 4R2GD 1NCCL 3O8XA 3WIHA 4NN5B 1S78D 4RQQA 1DVFC 3NJHA 3WD5L 3SSGA 3MQIA 4M61A 3VFSA 3GBMH 2FT8A 5E6YA 3WMQA 1EXGA 2KBGA 3RKDD 1S7TB 1HHGB 3OZ9L 4J3OF 3IYLW 3K8KA 3KPSD 4J3SA 3HB3D 4LPUA 2HG5A 2ZE0A 3MLTB 3II2A 2ZUYA 3HB3B 3TL5A 3BQUD 3NIGE 2R0KL 2CCVA 4WHDA 1BBDH 2MSPA 1I8LC 4UT6H 2NY2D 1YEGH 5AUMA 5AAWA 1F90H 1NIFA 4NI3A 5D2NA 3U25A 2PR4H 2OX5B 4LF3B 4NNPL 4YX2L 1OF2B 1F02I 4K55A 4UM8B 1EJOL 2IF7A 2P44B 4E41A 1ZHBA 2CUHA 4XOEA 5IT2L 4JFHD 2E7BA 1MFAH 1Y6MR 4OCXH 1AS8A 2N4IA 1SZNA 2FQEA 4LDEB 2DIBA 3PQYD 3QJUB 4LRNL 3FCSB 1KIQB 3GKZA 3W0WD 3VXMB 3QIUA 4JRXA 5J11B 1NC2A 1IB5A 5ESAB 1I1YA 4XOAA 3ATAA 4XNUH 4PJ7A 4BSVB 2A74A 4ZUTA 4DIXA 4PUBL 3FO0H 3V4PB 4BK5C 1BQRA 3I2CH 1XZ0A 4ZW8A 5T3ZH 3V5HA 5J12B 3T6WA 4KKAD 2AXJA 4R2GC 4TSCH 4RGNE 1QACA 2DD8H 1S78C 1IJNA 5AZUA 4Z7WE 5H4YA 1S7SB 1U3HD 4HJGB 1X4XA 2EIKB 4MD4B 5ETUA 4LRNH 5TK4A 3ZR6A 1IL1B 1QBLH 2NW2B 4NFDA 3CWGA 2APVA 3U7AA 2FEJA 4HPOL 2BIPA 4DWHA 1MRFH 4HKBA 5EZJB 2GUOA 1RH8A 3QZWA 4Y5YC 3P3RA 3EO1A 1V3KA 2D03L 5DURD 3CZUB 4P5TC 5BV7L 1S9VA 1NLBL 3U7YL 1F90L 1CDHA 5EDXA 1BZ8A 4V1DA 3X14B 9PCYA 2Y4SA 4GUCA 2J8HA 2FAUA 3KGSA 1HAUA 3OKDB 5DJXB 3S8GB 3KCWA 3OF6A 2Q7AA 1ZTXH 1NL0L 1RU9H 3N50A 4ERSL 2C9UA 1MWAH 4DVBB 1KJ2B 3CDFA 3KE0A 2P4AB 2ZF9A 2VQUA 3TIEB 2RCSH 4XVSL 1CXEA 1J8HA 2WZ0A 4BE6A 4FX5A 4JY5H 1SF3A 3MTXA 3OKMB 4HS8H 4PI0A 1MFEH 2NCMA 3UTZA 5J4MA 4GFXA 5F1NB 1BIIB 4JUSA 3HOGA 1VEOA 4OGAC 3ZU8A 3OR7B 2E74C 3I2CL 4HJGA 1E8WA 1N26A 5ETUB 5FC9A 3F04A 5GGRY 3VGGA 1JFHA 4IW4C 2CBQA 2GBAA 4J4PA 1Z5HA 4OD1L 2OMTA 2HJLB 5C0BD 3SDXB 4XTRD 3AWFA 1JJUA 3DPDA 5LN8A 1G7QB 2AVGA 4FADA 2EYRA 1RZIA 2WVTA 1URLA 2NXZC 5KYNA 3OKOA 5J13C 1R17A 2XBZA 2Z7YA 1OM9A 3AREB 3K2MC 4XNQA 4XAKE 4OUOA 3GPEA 1ZLUH 1HILB 5IMLB 3FZUD 2VDPB 4UTBL 4MAZA 3HMXA 2QZQA 3VG9C 1ZV5A 4NNPH 5F6IC 2X4SA 3U48A 4DH2A 3V4PA 3FCBA 1B2WL 3EYVA 5C7ZA 2BP8B 4YHIA 1OP5H 5IBUB 2GIMA 4BSVA 4DK3A 2WBKA 4Q58C 2ZXBA 4I4WB 3TVMC 4YSUA 1E4HA 2A83B 4P57B 4ZTEA 5AW6B 4FQ1L 3WTUA 1O9VA 3VXSD 4O02B 3F65A 3GSQB 3IVKB 1EBPA 2YD7A 3MLWL 1JRHI 1ECZA 2EIZB 2HX9A 3EADA 2AQ2A 1CFQB 3MROB 4AEFA 3HA0A 5TDOA 5D1ZB 3Q9PA 3T08A 4CW1B 4WAFA 3L1OL 1HH9A 4NWTH 3C6LA 1CURA 1ONQA 32C2A 4POUB 2HTLD 3L3DB 2Y7NA 1NCCH 5I23A 3QJHA 1N12A 2J1KA 5DJDB 2JCCF 2FEEI 1BZOA 5BNXD 3SYCA 1A6TB 4J1UB 3MV7B 3T0WA 2Z35A 2R2BA 5LXGH 4KDTC 2GY7B 3L6FB 1NH6A 4QMEA 1H8OA 4F9LC 4UTBA 4JDEB 3SGEI 5E00B 3EOBA 3S8WA 3SQRA 4OFYA 4AENB 1MF2L 2EXWD 3TH4T 1NPUA 1PCXA 1AR2A 1EA9C 3VG0L 4ZNEA 3GBLA 4IBLT 3FZUC 4PJIE 1HXMB 3ARFD 2AV7B 1A8JH 2BMKB 4J3OG 4N2LA 3OVUB 3ZT7A 2V7HB 1IIIA 1XQ4A 3ALPA 1A6AB 3G6AB 4JM2A 4KKLD 1DQVA 4PY7A 4JPIA 1A9BA 5IW3A 2IALB 1JNJA 2Z65C 3Q6FA 2R1XB 5JHDE 5FLVA 5KVFL 5F8QC 5T8IA 4DZ8B 5B7FA 1WZ1L 4UOZA 3IDNA 4YXLL 4RFNB 4ZUSA 3AG1B 5CN3A 5K9KA 5DR5L 4K5NA 2XIIA 4YSDA 3MV9D 4XN7A 3F58H 3P3TA 1FORL 3F84A 1OP3K 4LGPB 4JL1A 4LLQB 4X4ME 5AVWB 3ZSSA 2NY3C 4FJYA 4CUCA 1WAEA 2J2ZB 5T3XH 4ZUVB 1HC1A 1BQHA 3QG6B 2LV4A 1J0KA 5LN4A 3S34L 1KJ2L 4L4TA 1HIMH 3PJLA 4LAJH 5FW6A 3SKJH 4AH2A 1KIPB 4XNMA 5IKCA 2R4RH 4HXBH 5FUOL 3QUMH 3LIZL 4V1DD 5GRVL 2OV0A 3LKQA 5F0JB 2YGPA 1BD2D 4ZAKD 4MDJA 3L81A 1S8DB 4L0ZA 2OYMA 5EPMB 3VYOA 2D9QB 2K1MA 5C9JB 2BSSA 1PY9A 2FSEB 4QXUL 2IXQB 3LQAC 1MJJA 3S37X 1CF8H 5IQ9B 5DUPH 3QZBA 5E5MA 3NCJL 4S0HA 1LO2L 5SWSB 3WY3A 3DO7A 3VFWB 2Q87A 4ZX3A 4I2XE 4EO5A 4WW1A 3VFPA 2WUBL 4Z7WB 3PGCA 4DN4L 4UINH 1XGYH 4PRBB 5C92A 3VFGH 1UWEL 1W0VA 3TO4A 5JHAA 3LN9A 1RJLB 4G82A 4CU6A 1RY7B 1YYCA 4UB0H 4MD5B 1B4JH 3I6LE 3S3DB 2OTUA 5DRNA 3BGMA 4N8CH 3BH9A 1KTDB 4OZFA 1LYQA 1AYOA 1BFVL 1BOGA 3Q44A 4I88A 5SWSD 4M43H 3FQTA 1T7YA 4N8UA 4XP5L 2FX8L 2IBZY 2CO3A 5C0CA 1Q72H 1MCPH 1JG9A 4P3WA 4U1NB 5AVYB 2NY0B 1FYTD 1GHFL 4QRTA 4Y1AD 2XQBL 4GPVA 4MAUL 3N1QC 1A1MA 1KIRB 1DUZA 2XTJD 5AL8A 2CHNA 3EJCA 2HFGH 5F8RC 5IOKA 1PKQA 4GUPA 2NY6D 4JGJA 5DZOA 4X4YB 3VI4F 5HPOA 1YYLL 4V1DB 5I71C 2WYTA 3D0LA 5HYSA 4C57C 1CG9A 5GRJL 3UCQA 2X9YA 5JXAH 4TVPL 4RAUB 2VR7A 3U4KA 5B38G 4GLRI 3VGAB 1AIZA 1IGTB 3LZPA 1T22A 2J88H 4YWGL 2OTWB 5I24A 5EA0L 3I6LD 1AGFA 2VXQA 4TLSA 2B2XH 3PHSA 3G6JF 4PSPA 4K7PH 3VU1A 4NQEA 4PCTA 3CVIH 3D33A 3QUXB 3VWJD 5HJDA 1QHPA 5DHEA 4JO5A 4GXVH 5C09D 4TQEL 5K1VA 4NERA 3NJMA 5DJ8B 3LYRA 4PJ9B 1W6WA 5AOLA 3IPFA 4WTZG 3ZPDA 2X5PA 3ZKND 1NFAA 4MJ5B 5I1CL 4R9HA 5GGVL 4K5PA 4XXWC 1NC2B 5I6XB 1X9UA 2EEXA 5J57B 4YSEA 1TOXA 4NQEB 4HWEH 2ARJB 2Y22A 3ZY7A 4JRYA 2RCSL 2D7PA 4TLKA 4XMPH 4QHUB 1S9WB 3OKLB 4GT0A 4B9CA 1YMMA 1QI4A 4R7XA 5D6DC 1HKLL 1IAKA 4GSRA 5HYSG 2DEWX 5IHWA 3CAFA 3K2UH 1SF5A 1W2KT 5KYWB 3V9CA 2R59A 1A7RH 4PP2B 5EU4A 1DDTA 2LFGA 4X6EA 1BOGB 2OKMA 4XWGL 2YD1A 1IC5L 5T1LA 3FQYA 4PRIE 3L1FA 2K4WA 2VH5L 3G7TA 5I1DB 2ADFH 2X4OA 1CPUA 4KXZI 4NM4L 5J9PA 4XX1E 3HC4H 2NDGA 1CGXA 3QARA 1VFBB 3U0PB 2FBOJ 3CN2A 1H9VA 3RB7A 5DO2D 1DVSA 1VHPA 4P2QE 1YY9D 3T2NH 4O02H 4JFQA 1N6VA 3APMA 3FTYA 4CRPA 4BH7B 1YNKL 4EVNB 2C1PA 1TTAA 3EJQA 5JHDD 1S2EA 1C5DB 1ECYA 1JDAA 1NGXA 4YHMH 1E9QA 4JREB 4TNVK 3LDBB 2WQUA 1QUNB 4XNZC 3TYFB 1U91B 4M6AA 5CINH 1X6LA 3GXPA 2RGSA 2YD0A 4BGLA 1J5CA 5D1QD 2HN7A 4Q6IC 1NIEA 5C0JA 1AY1L 4Y16C 3FRPB 1MJJB 4HIXL 4Q74A 1CE6B 1H3GA 3IU3B 3PREA 3ULUE 4UNUA 5EZIL 1CFNB 5G4NA 3P0YH 3RVTC 3PIQB 2P42B 2PCFA 4L1HA 3L9RA 1OZTG 1LNUA 1EEYA 1M1XA 3IMVA 5DA4A 1SUJA 3VXUA 3GTNA 1YEJH 4NT6B 2CLRB 3ABZA 4NQVB 4XPTL 1AC0A 1A7QL 1JPFA 1ZS8B 3NZSA 2NY4B 4KKQA 1L6XA 2YZ1A 2DBJA 1NWPA 2PTTA 1HEZA 1TU2B 3P2BA 2D8KA 4QXUH 3HG3A 1A3LL 4F3FA 1U8IA 4AGPA 3L48A 3UFIA 1VADA 3BIKB 4YUEH 1F3DH 1OARH 3J7HA 4HV8B 4NT6A 5AOJA 2YAQA 5IB3A 1J5DA 1YY9C 4Z23A 2XQYK 2DWEB 4F7PB 4YPGB 3IXAB 5HYJA 4XO4A 2R69H 3O4LE 3QHTC 3DUUA 2FLBT 4G6FD 1WCBB 1OLLA 4KVNH 4PSRA 1EFXD 4OZHA 1X5FA 4QRQB 3UDWA 4M6NL 3DJ9A 1SEQH 2OMXB 3EDFA 2EVGA 1MFCL 4FQLL 1RZJH 5TE7H 5AW7B 4EI5C 3P9MB 4AQZA 4JGUA 3GHBL 2NW3A 2I07A 3SPJA 3Q7JA 1T04B 4HHGA 1T1XA 2ZONA 2BNUA 3PDDA 3BAIA 3BDYH 2RAMA 1FORH 5ABAA 5D6CA 3MV8B 1R3HB 2D73A 4G8EB 2C1PB 2IPKA 4UM9A 1BVNP 3ROLB 1D5IH 2GAZB 2GT9A 3C2AL 3CSYA 3FFDA 5A2FA 2IAMD 3BZ5A 1YYMH 2B14A 1MUJA 2PABA 3DVIA 2ZKHL 3ECWA 2J6WA 3FRUB 5GRUH 2B1AL 2ICES 2AEQH 4ZXBA 2I9TA 2WB1A 2PYEA 4LLVB 1U33A 4D3CL 3A24A 3SDAD 4HV8A 5GS0D 2OMYA 3BPLB 1UJ3A 4HXBL 2DM4A 3T8VA 4N68A 3NJFA 3QA3A 4IHOA 2WLKA 2H32H 2ZCKH 3BPOC 3QCVL 3V0EA 3OGCB 4K0OA 1OQOA 3RKDC 1UM6H 1BD2E 2DMGA 1KBVA 2FECL 4RSVA 2EDYA 3D4CA 5E2WH 2APWA 1G9NC 3QO0B 3UTSA 1NKOA 1CVSC 1U92A 2P7TA 2QADC 3C08L 4Q2ZA 5EN2B 3VD3A 2DYPD 1INEL 1X4YA 1VEPA 3BQUC 2RA1A 1M1XB 3WIHL 1NCJA 2AK4E 4DCQB 2Z8VC 1MIML 2F7RA 4CC4A 3LKSB 5CEXB 3JVFC 3HG1A 5DT1L 1AQMA 2HVJA 4LCCB 5FGBC 5EO0B 3U1PA 4W9DC 4PJDA 4EIZC 5JW3H 1AQ8A 4QRFA 4KJQD 2GC7C 1RERA 1UHVA 3L5XH 3LD8B 4GRWB 4HJJL 4MMXC 4KTGA 2V8LA 4ZO9A 5IR1A 3RBSA 3NTCH 2NY7L 4N0CD 25C8H 3GINA 1Q94A 5EOQH 3HJ0A 2Y0SA 4NN7B 1U58A 2DWDA 4Y7MA 2IH1B 5D7LB 3RUGB 5IREA 4K8RH 1R33A 2XNAB 3AY4A 3DTDA 5EO0A 2CR3A 2F0CA 3HC0B 2E4TA 1UCTA 4C56E 4LCWA 2FCBA 1U6AH 1CC3A 4CJ0A 3BP4A 4FXGA 1MLBA 2E5EA 2L04A 3RX5A 5CCHE 4E0RB 4FHKA 3BVDB 4JN1H 1NIAA 1HHHA 2FUTA 5D2LA 2DEYX 4PJAB 5HGHA 1OALA 2P24B 1FL6B 4B9GA 4D0BB 1AY1H 1DSWA 2Y06H 4ZI8A 3HC2A 4X6EB 3BFOA 5IBUG 3KWVA 4HVBA 3IMBA 2GTWA 4R83A 3W37A 5BJTA 1KIUA 2AAVA 4YHYC 4Y2DD 2PF6A 2WXHA 3BYYA 5EOCL 1UXMA 1BXUA 2VUYA 4JANB 2VM4A 3I9AA 4KUCD 3V4UH 1X5YA 5E2TH 2XA3A 1FH5L 5HJGA 1MCIA 4OGXH 2L0DA 4QI3A 1U8LA 3MR9A 2W9EH 1OPGH 1LHZA 3APFA 3GXUB 4NZUL 4GS7B 4IBZA 2DH3A 3BWUC 3QRGH 4JFED 4P23D 4L3CA 1WUNT 1KCRH 4WUUD 5F7HA 2VDPH 4G70B 3L4UA 2W9LA 4PWIA 1NC4B 5DJZB 5EORH 4CMHC 2VLME 2YD8A 1WFTA 1X5LA 1V7MH 3IJ9A 5DD5H 1HQ4A 5I19L 4GP4B 4C55A 3KBEA 3K6FA 2K9UA 4L3ED 3W9EA 5GISH 4XVJH 1AGBA 2ZG3A 2LHAA 3NK3A 3CC5B 3TFKD 1EJ6A 5PCYA 3OF6D 5C7XL 4KJYA 1XR8B 3ES6B 1AGFB 4C4BA 4HS3B 3EGSA 3MRPB 2Z8SA 5E2VH 2ZAGA 4EZJA 2WZ5A 5CF3A 5HSFA 2F54E 3ARYA 2EXSA 4PJXE 1C16B 1DQKA 4XN1A 5GS1C 4JRXB 2FATL 4WI0A 3UYRH 2VDQL 4X7SL 3TV3L 1NBQA 4FJZA 4HH8A 1LILA 1EAQA 1XH2A 1VEMA 4LQFH 4NZTL 3VI3E 1U9KA 1M7UA 2ZWYA 1I1AD 1VFAA 4AH2B 1BV8A 3U36A 4YHOH 2WINA 1H8LA 5F7YC 3LEVH 4WUUE 4FNLL 4OKDA 4LKCA 2VISA 2CO1A 5BMFH 1T5XA 4NKOB 1A14L 1XBDA 3BUPA 5L2JA 3WKMH 4MNGA 4YXHL 3FQNA 4JRYD 1P84K 1F1DA 2MTAA 4WGWB 1Z0NA 4N2AA 2L4OA 4X0KA 1B0RA 3QR1A 3WKNA 2NOYA 4HAGA 4PJFB 1BPLB 2VDLB 3GMMA 5FYLE 5IMKA 1P4IH 2FZ3A 4EIUA 4DN3L 3HUJA 1KT2B 5IMOB 3IN0A 3MI6A 1WWAX 2V7HA 2K78A 4KMTH 2OJEA 4HMEA 3QUHA 4O2CA 1PZ5A 1T2QH 3O6FB 4B6ZA 2EAEA 1FQ9C 4S1RH 4F8LA 1XB6A 5F6IB 3QXTA 4EXPX 4N8CL 1ZEAH 3PWNA 4F7TB 4Z3EA 1T5XB 2C7UB 2YZ8A 5GRYA 4Y5VB 2HYMA 1NCNA 2XG4B 2B16A 4E5XA 5IT2H 5F3BA 1UUNA 1BLIA 5T1LB 2A0LC 2GBUA 3MJ9H 2D4DA 2XQ0A 3PGFL 1D6VH 4N20A 4A68A 3MYZA 4PJFF 1BYPA 1M05B 2J8OA 5AWNL 1UD4A 3PNWA 2JKSA 1ONQB 5C7XH 1IQWH 2DJSA 2WD0A 4JG1L 4MJJA 5A7EA 2CBPA 4JO1H 5GRZA 3L3HA 3OQ3B 2WMPB 4D0DA 1DJWA 2CNYA 4LSTH 3LEXB 3O41B 4XH2A 1XF4B 4H1LA 1A6ZA 4JR9H 3RRQA 3D87B 1LWHA 1P5VA 3HRZB 4OBSA 3HNVL 4EI5B 1JZ2A 4NZJA 3U0WL 1CBVL 4K2UL 1PZDA 4OFPA 1EGJL 1IFGA 4HJ0C 4I4WA 5B7MA 5JHMA 5K9QI 5L88H 1SOKA 2Q3ZA 1HSAA 4KMQA 4OD3H 1P84J 2RFXA 4IOIB 1UWGH 2MKLC 2EILB 4TNEA 2ZG2A 5CEZL 3G5VB 3BP5B 2EQDA 4M7LT 1E2VA 5EU6A 5I8KH 1I9JH 5HDWA 1RJYA 1JGDB 2CWRA 3X1BA 3C5ZC 1ZGLP 1FFPA 4PGDB 2FO4A 5I1LA 2KI6A 4NQUA 4PV9A 2YGNA 1UEMA 3CBJB 4OKVB 4FFTA 4BZ2L 5LVEA 2JV6A 3MREA 3QWRD 5IJVB 1PL3A 1A1OB 2D7OA 2A0LD 4GS7C 4IMKA 5CSZB 3TPKA 1KIUB 1WSST 3ZO9A 2ICCA 5KS9B 5GSRA 4IRJC 4G7VL 1MG3C 1OGAB 4NOBA 4M93C 4OSUL 2R8SL 2YK1H 4XPGL 1GGCL 4WENB 3E3QE 4JHWL 2SEBB 3NCBB 1ETB1 2H0PA 3BWAA 3N42F 2IV9A 3A67H 4XPFL 4HX1A 3UZQA 4Y19A 1F4WH 4XMTA 4BCYA 1JF5A 4ES9A 2PPEA 4XE5B 3CDZA 3X1EA 4Z7OB 1OGAA 2BP5M 3BH9B 4ZDHA 1E7VA 3KPNA 5DHXB 1FL6A 1QP1A 1UD6A 2EKSA 4H20H 4P4KD 2BY2A 1GGCH 2AXHA 3BSZH 4ELME 4JM2F 1J5OL 3EO1B 4RDBA 2A73B 1FZKA 2O5XH 3QDJD 3HR6A 3DOSA 5GIRA 4UMGA 3D0VA 2QR0B 4LCWE 4K8RD 4Z7VE 5DK0B 1NFDB 4OB5L 1AQDA 2WKOA 4GW1A 5C0FA 4Y88A 4WEBH 4F15B 1WAAF 5EBWA 3K1KC 2CU9A 3LEYL 4UOJA 2EJ1A 3S5YA 3HG1B 1JZHA 3C6LC 1TTFA 5D1XC 4ZFFB 2FHBA 3N42B 1YAZA 5B39A 4M8UA 4NN7C 1HL8A 1JDDA 3VXOB 5C07E 2FB4H 4PY8I 3BGFB 1PG7H 4G11A 2EYSB 4M48H 4QTIH 5EPMA 4LU5L 1G7PB 1YJDL 5FOBA 1MY5A 3HFFA 3GD1C 5B22A 3QHZL 5K9JL 1M53A 3DHMA 4FNUA 2EIEA 1C12A 1OW0C 1KPRA 5AW0B 2XVLA 3CXFA 3FRPG 4XVUD 3MLYL 1RXLA 5F7EL 4MB1A 2WWMD 3MNWA 4GKZB 4H2AA 4OZHF 5T5FA 5D71H 5KSAB 1F6FB 4K9EL 4NENB 4N1EA 3HC4L 4NZRL 5C97A 3FDWA 3DGCR 3SJVA 4MA7L 2A74C 2P8LA 1AD9A 1ESOA 3CDCA 2VL5A 1NAKL 1RUQL 3JYCA 1YRKA 5FO9B 3MRKB 1FGNH 2PKDA 1DR9A 4XMLL 3UJJH 2QSQA 4MXQC 1O6SB 2CDGA 5IB2A 2NXYB 4D0CB 1HL5A 4XMXA 2DLEA 3IJYA 3MX0A 1MJUH 2VITA 3BWUF 3D4GA 4H5SA 5I18L 3ZDYF 5F7DB 1OHZA 1D9KC 4ZPTB 3V4PH 1NMCB 3CHPA 1OGTB 5JDSB 3KDMB 4Y2DA 2GJ6E 3NIDF 3M1OA 2GEQA 3U46A 2EIBA 4S1RL 1RUKH 2LU5A 1N7ML 4U4IA 4G7QB 1Q0EA 5CLZA 1PJWA 4AZUA 3U30C 5JOFB 3DETC 4Q6YA 3T5WA 4PREB 3JQOB 1IT9H 1XEDA 3OMIB 5GQBA 3LZFL 5IHBA 1M57B 2PP9A 4BCXA 3QEGL 5DEGA 2EE2A 2NT1A 3TJHC 1FG2B 2OSYA 4XBMA 3N0AA 5C0BE 3RQ3A 1A6TA 1BF2A 1AZCA 3UG4A 4BV1A 1RUPL 1JPSH 3PP3K 4LLWB 4OLVL 4XVOA 5D1QC 5HYJE 1SJVA 1EPFA 2B4CL 1K9TA 2BS9A 2VZUA 1QTSA 3PWVB 4MHHI 3ZDXF 1LE5A 2FWUA 4BM7A 3BUIA 1MHCB 2O5ZL 4KRLB 3H3PL 2KL6A 5DQ9B 1HNGA 2VW6A 3F5WA 3VNZA 3JUYA 3LZFH 4LLYA 2UUDH 1XR9A 1U8MB 4X2UA 3UG3A 4FABL 4G9DA 3BVUA 3S3CB 5DVPA 1FRGL 2XTJC 3MDJA 1QAWA 1FAIH 1K6QL 2WBJC 3PHOB 3IETB 2F8IA 2CMRL 3NCYS 5F7KC 4L37B 5KVEE 4JLRA 1EANA 1XL4A 4JN2B 1TZOA 4OFQA 5F0MB 5LCVH 4MJ6B 4OLYH 3FN9A 1ZS2A 4MGXA 5A2LH 1MLCB 3O0RL 3R8QA 1LMKA 3D18A 4QOKD 4PREA 3LPOA 4U6YA 1RI8A 4P5MB 1BMWA 2NR6D 2XX0A 4LBAA 4X80L 1G6RH 5BW7A 1JGEA 4E9WA 4Q9RH 4WDIB 5LNDA 2KKQA 3T3PE 4X7CC 5DS8A 43CAB 4OLUL 1P5UB 1HXMA 3BVWA 4U6TA 2P43B 1NAML 1JHKH 2H2SC 3HG4A 3VXUD 4JNXA 4YSSA 1GRWA 2WXGA 3VXRA 4KI1A 1KTLB 4JFOB 2C5DC 2JI3A 3QFJE 4XNZB 3CZKA 2KQNA 4QEGA 6FABH 3IT8D 3MJ7B 4FFYH 2ZCHL 3VI3F 2X4OB 4W4NA 4H8PA 3BIBX 5JHLL 1R0AH 4UI2A 5E4OA 4JZJC 3BAEH 5CHNB 3ESMA 2NZ9D 3GIZH 4MA1C 3EH4B 2BWQA 4NZUH 3QCTL 5F9OH 3WNPA 3L3GA 4CNIA 5EEYA 3IM1A 4HETA 3N41B 4QJ3B 3MN8A 2BC4A 2D7NA 3NCCB 1FDLL 2W9EL 4M3JA 5DC0A 1HHKA 1TYEB 4WU7A 3UO8B 3A47A 4HC1L 2Y7MA 1EFXA 3C60B 4LNRB 3F6JA 3CX2A 4G1MB 5EU4B 3ARQA 3IKCA 4NQDB 3TIDA 2QHRL 2R2EA 3KCPA 2A7BA 1BAWA 2OMVA 5ADOH 2CLZB 3LRHA 1HH6A 3H0TA 4K07A 5DRZA 4JG0H 3DOHA 1M2OA 4FYRA 3G04B 2ZXWB 3MRDB 5DC2A 1BZ7B 2O6DA 3ZK0A 5FPIA 1XCTA 2NY0D 5EHFA 4B41A 2GUOB 1XIWD 2P5WE 2K3TA 5GZOD 1CICB 1HYRC 1WTLA 4GSXA 5F7EH 5EBWB 3BDBA 5AVVB 1OWRM 3GSRB 4KO9A 3BX7C 2DQJL 1I1RA 1A0QL 3EAKA 5AG9A 4QTIL 1UM4H 1BX2B 3BUTA 1WFOA 3QIUD 1PZ3A 2FDBP 4GAAA 4TQ8A 3SY6A 4LCCA 4KZCA 3ARBA 1OCZB 3N3EA 5BS0B 2X70A 3ZSTA 5DK2A 1SEBA 2CKBA 3QEQE 1GA2A 5F1NA 3S36L 4F2MB 2HLAA 1I9IH 1BZDA 1KB5H 4MD0B 4HULB 5HHQB 4UIKH 4GAYB 1MOEA 4O58L 3ZGHA 1Q9OB 2OMZB 1N8OE 2VZ3A 3P73B 1QLEH 2VDOL 4L8BA 1SLUA 4O2FA 3RNQA 3TVMA 4JK0D 2XG5A 5CSBA 2YXFA 3M8OH 3TH3T 1XXFC 1JFQL 3HZKB 1FO0B 4AV0A 1ROCA 4OIIH 2NUPB 4LLAA 1IC4L 4GKLA 3FPXA 4Y16A 3UO1H 1J48A 4FFVD 1AI1H 5KYXB 1RK1A 3V95A 2XXFA 3SE9H 1NCBL 1I9JL 1DVQA 4LVOB 4P2OB 2BY0A 1ZV2A 2G75B 3M86A 2OLDA 2YN5A 2RHEA 5D9SA 5I15H 1QWUA 4FQXD 1QBMH 2CM6A 4PJ5B 1USZA 1FP5A 1PDKA 1U8NA 1X5KA 2IANB 1DQDH 2JIXD 3W39B 3DVGA 2IOMA 2B5IB 2FEDC 4LT7A 4NHCH 4ATTA 1GY2A 5LGHH 3H1ZA 3RIKA 2A9BA 2DWDB 5B3JF 4YHPA 1XZ0B 2OL3B 3KPSE 1P7BA 1BJ1H 3OSKA 5CJXC 4ZQKA 1BDYA 5L2KD 1KYOK 1CR9H 4F33B 3PWJA 4LNVA 4UBDC 4XC1H 3RFZA 1WBYB 3WTWA 5A16A 1JCKA 3HG2A 2JXMA 3L45A 1JZ6A 4L9DA 4JRWA 5AD0A 1ZT4B 4Z78B 2WYIA 3EGXA 3ZO0A 5E5LA 4S1QL 4ZFGL 1O7DC 1EDQA 4X8JA 3RUGE 2J44A 2X87A 4G80B 5CP3H 2VQ1A 3SCMC 3ZIYA 5EU3A 1GGTA 1A4JB 3QCUH 2AF2A 1XB3A 3CBKB 3NFPB 5E8OA 1DQML 4FKKA 4I0CC 2NDFA 2BNQB 5G2NA 2Y36L 3O9WB 1PZ2A 4H1LB 2V0AA 1MI5A 3TO2B 4TTDD 4KNSA 3EOTL 1R0AL 3NFNB 1MFNA 1R5WB 2EE3A 5FO7B 2EECA 1RV6X 5K33A 1I1AC 2CO2A 4HUMB 3LZQA 2HP4A 1M9WA 1WAAE 2Z91B 4LPWA 4UV7H 8FABA 2XUWA 3K46A 3UAJD 2J25A 2GK0B 4GG8A 4PCYA 5L2KE 4RFNC 1JHKL 2D03H 5TPWH 3QUKA 3VO0A 3MRFB 3WNOA 5CILH 3ZW3A 4L4VE 1WP6A 3CZFA 3OB0H 4Y8DC 3KL0A 1DO6A 3LN4B 1A1NB 4NKDB 3FOMB 3O0RH 4IRSA 3K6OA 1G5AA 4I3SH 1FVCB 4CSZA 2C1OA 4F2EA 1YEFL 4BFIB 1NBYA 3QNFA 3H6AA 3VXQA 1KBBA 5DK3A 2GUYA 1A14H 3TN0B 1JPTL 1HOEA 4DKEH 1DSYA 7PCYA 5T3XD 5IMKB 1R19A 1V5JA 5JW5A 2YKKA 1D5RA 4BEIA 5DJ0A 3RA7H 3V2AR 1WT5A 1JF1A 2ZXEB 5E7BA 4I3SL 3FSVA 4FQHB 4BFJA 1MAJA 4AQEA 4APXB 4DK5A 2O6FA 2FQGA 1F42A 2Q8AH 1MCSA 2TRHA 3TA3C 3IPBA 2UX7A 3DX9A 4N2DA 4RNRB 4PJAF 5KYWA 1WIUA 1EJOH 3N0PB 3B5TA 5B21A 1IKFL 3FF7A 4B5ZA 2XBDA 1HH9B 5JXED 5ISZA 1BECA 3MTRA 4A6YA 1EHLL 3WBDA 1UT9A 3OPUA 1IT9L 5L7XL 3MUY1 3SPIA 4HS6A 4O51B 2AP2A 3BIAX 5JA8B 4AKPA 3E8UL 1ZVNA 2KPWA 2WNKA 2HFTA 3O2DH 4JFEB 5FHAH 4XN5A 4KROC 4FQPA 1ZWIB 3MFFA 4NQXA 4AJYV 2Y36H 1L9MA 1A47A 4N6RB 1ZVSB 2IVFC 2IQAB 2MQGA 5DURB 2I26N 4FA8A 2YPKB 1T7WA 4ZFFA 4N9OB 4LQFL 4ZK8A 1UM5L 1U8KA 2MQ3A 1XTMA 3FUKA 4NQCA 2X4RA 4RGMB 4XP4L 1ORQA 1JD9A 2VERN 4ZTPH 4XNAA 3C12A 3DIVA 4JM0A 5D9SB 3OKOB 1YNTF 2F58H 1L5GA 2JFCA 5JO5A 5MEQA 2P46B 2XZQL 1JPST 4FLRA 3GS4A 3FMGH 4QRPE 4XXWA 5DHDA 1OTTD 5JTWA 2P3YA 1IKFH 3EJYC 1JWSB 2DTSA 3VD4A 2DLFL 3B2UC 4U1KA 1L9PA 2GHZA 5GRJH 1E8YA 4P2OA 1J1XH 3IE9A 4B95C 5CLWA 1F5WA 4HUXA 4WO4C 1CDYA 2V2XA 3V4UL 1RIHH 2XKSA 1EDHA 3X11A 1PNCA 2QSTA 5HHQA 4BQ9A 1JNLH 4JG5A 1DE4A 1DQJA 3T3PF 3U4BH 4OF3A 4AGNA 4K7FA 2NY7H 3ZTEA 3KPOA 3FONA 2OXHB 2OCFD 4LCWB 5LDSA 1IL1A 1IUZA 1S7XA 2XG5B 3V4LA 1CUOA 2P24A 3MRBB 3PP3H 1FZJB 3H9ZA 1CD1A 1GOHA 2UXGA 1KPVB 3SPVA 3CJJA 4ZPVB 4DPBX 1Z9SB 2RQ8A 3OC5A 3TOPA 2R23B 5FWRA 1CR9L 1BZ9B 2IAND 4PMFA 3QJFB 2WXQA 3VRLE 3FU7A 3LAFA 4Z7WA 2FJSA 3NN8B 4K94H 3WXVL 1AO7B 2OJ1A 5AOMA 4TSAL 3VFGL 3NZ8B 1DLFL 4KKCD 1OCWH 1X7TA 5C0DB 5D5MB 3QQ9C 1S7WB 1Y7VA 2BFVL 1ZVSA 4NO2A 2E0PA 4G6KH 2XRAH 2CQVA 2I9LA 4DAGL 1AJ7H 2WXMA 3HUJF 3QUXD 5FM8A 3VWJB 4BFRA 1A02N 3IJSA 4YR6A 3FS9A 3FFCD 2HH0L 3B2UD 4HK3N 5GRUL 3S3JA 2X1QA 4K7FB 4P4KA 1J0JA 3BQVA 1TLKA 2FR4B 2BIOA 1G94A 2WJ7A 1G1YA 2UXFA 3HVNA 3TNMA 3H6JA 3RX9A 2X41A 1GL4B 1L4IA 3CZLA 1J86A 4QRTB 5HDOA 5DUBA 1W8OA 3I9GH 3WTTA 3UTOA 4W9EC 5KBPA 2ZYRA 1ZK5A 1Q4NX 4NLAA 2AJSH 5I76A 3GSWA 4A63A 3KS0H 5IVZA 3U1SL 3MLZH 5LWYH 2H47C 1MQKH 3GGWA 3AY4C 3HCVA 4M6OH 2K8MA 5KSBE 3P0VL 4KVNL 2FJGB 3WFHA 1WFMA 1MFUA 4RETB 4F9LA 1DDHB 1SEQL 4LAQH 1CTOA 4Q8BA 4HWUA 2Q9OA 1XF1A 1A3RH 1A65A 3P9MA 2MOGA 2VLLB 3RU8L 5TJWK 3L3OB 4QRPB 3X13A 3BYTA 4IBSA 4GUQA 4O2CB 4GLRH 5EU6B 1G1OA 2DQGH 1EERB 2ITEA 4FL4B 5ANMA 1T1XB 4ZW3A 1XVSA 2GTZA 1KY7A 2EXWC 4BJLA 3T2QA 4XNXH 4JZOB 5C70A 1DDHA 4KJPD 4TL4A 2V9TA 3BZDA 4K7PY 1N6QL 1ZWIA 2UVEA 3MFFB 1KN2L 1S7UB 3TBCA 4EPSA 1TO4A 4MB4A 5KAQF 3MV7A 3EYFB 5ICYA 4WFED 1MWAA 2IADB 1BFTA 4NQCD 4KI5C 1JYWA 4KK5D 4FRWA 2FL5B 5EF3A 1TCRB 2J4WL 3KLLA 4HS6B 3NEEA 3QH3A 4O51A 1T89C 2BSEA 3TNNB 4O9HH 3W56A 3W9DB 4QRSB 5TDPA 3FQXB 2BOCB 4Y9FA 4LKCB 2Q6WB 2B5IC 2FRGP 3D3VA 5LNEA 2X2IA 1OP3H 4Q9RL 4KBPA 1MSPA 5HDQH 3BP7A 3VJ6A 3QQDA 4KTDH 5AFAA 4OZGE 2YLHA 5HHPA 3NH7L 4WV1A 4IRZH 1QQDB 4FQHA 1M71B 1XF3A 4HJTA 5F3BB 1MWOA 3B1UA 3BZ4A 4V11A 2Q7YA 5B3JE 4LLMA 3P54A 5C0BA 3LXUX 1R3KB 3P3YA 3LNGA 1CE6A 1JUFA 4N0UE 4LSRH 2BP8A 2N3JA 4R4BA 5DMKB 4Y4FA 4PS7A 4EUPH 4PW4A 2X7LB 3MRGB 1WS8A 3GDCA 3VW3L 2VDRL 1P4LB 1ZGLB 5HI3D 1WBYA 2H26B 1A7QH 1S5HB 1GTFA 4K8RC 2DZEA 4PGEA 4Z5RB 5GS1A 3UXFA 3QZWG 3U7WL 4HKZB 4PVBA 3RZCB 3W9EB 2I7SA 4QOKB 2NNXA 3LZOA 1A6UH 5L9DL 1XFPA 2HN7B 5FAAA 3BEWB 1N4XL 1ODAA 3OXRB 2FT7A 4RAVB 4X9BA 4H5SB 2J5LB 4PJHF 4UTBH 1ZSDA 4AXWB 2CHWA 4P2RB 5EZIH 1QA9A 1OD9A 1U93A 1LO0H 3I85A 2WK2A 5IB2B 4U1SA 2G3NA 5I1DA 2HRPL 2H2SD 4Y2DB 2COQA 1UH3A 2UYLB 1DVUA 3CFBA 3EJUA 2AKRB 1NDMB 2F15A 2DQUL 3FUDA 1G7IA 1YJDC 3PFUA 4P46A 1GS7A 5E6RB 5EUOF 2ATKA 4F7KA 4GW4A 5KBDA 3FT9A 4FGMA 1JZDC 4BH8B 1TKWA 3FO2A 5EIIA 3T2NL 2HKFL 2V2XB 4G8GA 1E7UA 2J8UF 1IJ9A 4YE4H 3SOBH 2NNAA 4JDVA 4LVHB 1YNKH 2X53A 2C3GA 1HDMB 5IP4A 5KVFE 3MJ9A 3RWCB 1SJEA 1Y07A 5E6ZA 4NM4H 2VQ4A 3SDYH 5ES4B 3DRQB 1KFAL 2WN3A 4P2AA 4BIKA 3L4ZA 4WK4B 3VGAC 3CXHK 2B59B 3T0ED 4JFFD 4PRHD 5JNYA 1BAFL 2CIKB 1T20A 1IILE 3PFQA 2OM5A 2XICA 5ANHA 4KV5E 1JZ4A 3AS3A 1I7UA 1O75A 2AC0A 3CLFL 5E8NA 3Q2NA 4XVJL 3DV4B 3KYMB 5EC2B 4HGWB 4QRRA 3R4DA 4N0RA 2IDCA 3HPJA 4YDKH 1V7ML 1KCUL 4G1EA 2X6AA 3DWTA 4NO0B 2VERA 4QAMB 1H5BA 2NY0C 3C9NB 3FB8B 4DGUA 4UTCA 1RK7A 1XIWC 1RD6A 2A4ZA 5KW9L 3BSHA 4ZMVA 1F41A 3QS3A 5B39B 1F2QA 3MJ8B 5JA9A 3SDXA 1QO3A 3UBXA 1HHIB 3QDGB 3QHZH 4HEPA 5DXWA 3U4EB 2VB5A 3BD3A 4GKSB 4ELMA 4Z1PA 1IM9B 3G5YA 5CZKA 4PJAE 3ULVF 3TJHD 2V2WB 3P0GB 4KOCA 3UABA 2G9HA 2VT0A 4OM1H 1GHFH 4L4VB 3UTZB 3U4AA 4DCQA 1IGTA 3AM8C 1MXDA 3D06A 4TPRL 1TJGH 4NIKB 4LCYA 1QNIA 1B4TA 2QSCL 4A7SA 3ROOB 4KUZH 3O2DA 4L4TD 4LHQB 2WZAA 3OG4B 1I4FB 4KH2A 4KK8D 2EKJA 2WQXA 2A9NL 1XBRA 1Z9OA 4YX2H 3CDZB 2AKRA 2KLSA 4ONHB 1ZLVH 2BCKA 1A6PA 43C9B 2GKIA 1OGPA 4XP1L 1PY4A 5HI4D 1KB5B 4BRVA 2E75C 3GXDA 5E9DA 2JK5B 3FU0A 2HT4D 3D4ZA 4G59C 5ELIA 4DP9X 3NZHL 1E4WH 5EV7A 1PNDA 4Q4EA 2AZAA 4TULH 1SDAB 1YN6B 1MUJB 2CK2A 3GNMH 4GAJH 3TLRA 3C8HA 1H9DA 4G43A 2F19H 3MRCA 5LG6A 2W0LA 4TRPL 3T1WA 4G9FB 1MW1A 4HKJB 5DHYB 3BP5A 3UC0H 4FTDA 1GYAA 2GVYA 5DO2C 3ZDWA 2FX8H 3CIAA 2BERA 1KTLA 3NH7H 3QIBA 4JFOA 4WRLA 1AS7A 5TF1H 4G7YH 5I6NA 5IOPB 4R5VA 5AYTA 5KSUB 4XMWA 2YJLA 1JGDA 2ZXCA 2YPVA 2OW6A 3QCUL 5AB0A 3GSXA 4EN3D 2J57A 5LGJA 4K9JA 4U1HA 2BVPA 3Q8FA 1DYZA 2YUZA 2VRAA 4GRWE 1NANI 3K71A 1ES0B 3LKQB 2BXYA 1P4LA 4JEGB 2XCMC 4AM0B 1S3RA 4Y16D 1FL3B 2MQ0A 1AG0A 3F7YB 3EGDA 1KGIA 5K59F 1HE7A 2Z31B 4J2XA 1ZLDA 3UX9B 4NPYB 3QYNA 3ULUC 3RVTD 3BZ4B 3ABKB 2W5PA 3K7UA 4D3CH 3NJJA 3BEVB 1C5BH 2JB6B 2R2EB 3ECBA 2DQTL 1IM9D 1JZEA 3L3JA 3LZRA 1D9KB 3KPRE 2HPTA 3ULUL 4A7VA 2R7EA 5K39A 2WKOF 3LEXA 4XH2B 5JPNC 3CG8A 3QUML 1JF1B 1TZAA 1LEKB 3RKPA 2OK0H 5CGYD 2Z31A 3KVPA 4TVSa 4DP8X 2C7FA 4I5BB 3MMEB 1BZQK 3PWLA 5C6TH 1LJMA 1P1ZB 3VRLF 4YFLF 1A9BB 1P9MC 2HT2C 2PCFB 5HHVL 4KROB 3HNSL 3LB6C 2ICEA 4HEME 4R6UA 5GZOC 3K6SB 2BFVH 4YO0B 4KHXH 4OZIB 5F93C 1G4RA 2XYCA 4P2CG 4WKXA 3EYOA 3RI5K 5E6UB 1T0NB 1XF2B 5JOPD 3SGJC 1A1NA 4NKDA 3DKHA 4OGYH 3K91A 3RYMA 1BPVA 2FD6L 2YKLH 5E0FA 4F8PA 2JI1A 4H8HA 1U91A 4GI8A 3SKUD 4EN3C 5IVXA 2J6EA 4PGCA 5DR5H 5F9WB 3O0LA 1DBBH 3IF1A 1NGXB 3N44B 2PCPA 2G5BA 4OJEH 4YO0A 2WVVA 5DMIH 1F58L 4G43B 1JGEB 2B1OA 4MHHG 2G2RB 4TRPH 2DWEA 4F7PA 3T8XA 1H6TA 2HAZA 1ZE3C 3U0PA 5IB3B 1J8KA 1NINA 3O11B 2R2BB 3T1FA 2JI2A 1HN1A 1ULVA 4P5SA 1UURA 1WYJA 2ZOTA 4XB3A 2ZZUT 5BCAA 1ADQL 3RX7A 2R1YB 3WXVH 3WNJA 1QD0A 5FYLD 2W91A 1OAXH 3IDGB 1N2RA 3WFZA 3PPEA 4U6VL 2B1HL 1EXUB 2YS4A 2KPNA 1FC2D 3MBEC 4GW5B 1HE8A 2IOIA 5KOVC 2VSKB 3BXNB 5I75B 1UGNA 3W5MA 4BKTC 3TA3D 1IBGH 4F2FA 2FR4A 3EYSH 1EGJA 2XN9B 4HIHA 2AITA 4HS3A 3EJZD 1CD8A 4OD1H 1PZSA 4FI7A 4A39A 1DJZA 3S8FB 3GMQB 4TUOA 3WN5A 1L0XA 1H3VA 2F58L 4AJ0A 3U4EA 5F9AC 4LP8A 2AANA 1ASPA 2VGLM 4XP4H 2VSMB 5F70A 2Z93B 4R0LB 2ZOKB 1PX3A 2V33A 2WB7A 3IFLL 4L3CB 2QQLH 5AVSB 2GSGA 1SYVB 3HLKA 5KYUA 5L8JB 3U2IA 2ITDB 2C9XA 2Y7OA 1PW3A 3CDGB 3O9WC 4HGWA 5DZVA 1J1XL 2YHGA 3MJ6A 4BYHA 4AMKH 4BFEA 1T4WA 4TNGA 4FXGC 4K5LA 1VLXA 3KXFD 3VD5A 1AD0A 1EAPA 4JQVC 2DI9A 3G9AB 3O3BB 3FPYA 1BQSA 4C4KO 4D9QE 4JHBA 1CBJA 3ABGA 2J55A 4JFPB 4WSJA 3N5AA 2F74B 1NBZB 3EO0B 3QXAA 2K6ZA 5ACLA 4NJ9H 2DM3A 2C9VA 1KCBA 1EEZB 2QTVA 3CUPB 5CIPH 3T3ME 1EFXB 5DWPA 5BV7H 2J1XA 2LTQB 1KJMA 1AIFA 5HDBB 4DHLA 1INQB 5ECJE 4FDWA 4NJAL 3QRGL 4L9LA 3U2JA 3OG6B 4YDLC 3ISRA 4TTDC 4NRXB 1S5IL 4PJHB 4YDVB 2XA8H 4KX8A 4ODVH 3WY1A 3QJSB 1G1KA 2X3AA 4FLHA 2OMNA 2MKWA 3GF8A 1UA7A 1SPDA 3UMNA 1CFVH 2X70B 4TQEH 1ILSA 3WNLA 2YD4A 1IQDA 2O61B 1T5KA 1K85A 2VABA 2DQUH 1U2YA 2NY1D 4GRMB 5BQ7B 2UZPA 4O4YH 3MRRB 4YHZH 4FOMA 4P2QD 1YSOA 4HGKC 2XWCA 4UNTA 2DJMA 3VXSE 3ZZQA 4IJTA 4F27A 5I1JL 1A4AA 4PJGB 2NR6A 1WHPA 4EIBA 3VXMA 4JQIH 2A77L 3U1QA 4N4YB 4P04A 3UPAA 3Q8CA 2YPVH 3GRWH 4X9IA 1JTPA 1GAFH 2J8UE 3BQUB 3O45A 1E2ZA 1OAKL 1RUAL 5TD4A 1QBLL 1X5AA 1U3HB 4JN2A 5I1GL 2WVUA 1QSFA 2X4PA 2EDFA 3TBVB 4J6RL 2CUAA 3BMWA 3E7JA 4QGTA 4I18B 4YVUA 3CSTA 4Q6KA 4PTTA 4LSSL 4DFHA 5IM7A 4M8RA 1Q72L 1DBKL 2F5BH 1UWXH 4QLRA 4JFUA 1XR9B 4ODVL 5TGBA 1HAWA 3QDHA 5D1XE 3I02A 4WF7A 2R0ZH 1Y18A 2YRBA 4TN9A 2Y2YA 3PQYB 2EDNA 5DEFB 2V3EA 5H35A 3I6GA 2P9RA 3IJEA 3FQTB 1YDPB 4P9HC 3LHPH 4HLEA 1DN0A 3BMVA 4BZ1L 1FA4A 1LQBC 4FQIH 2BK8A 4N2IA 4OT1H 1R3IH 1UOKA 1YN7B 3ATBA 4KY1L 4AG4L 4D8OA 4N0YH 3SODB 2C7UA 4TQIA 1G9MH 3QORC 3RWDA 5IJVA 3VI4B 1QR1A 3Q2WA 3MJGX 1A8ZA 2I9TB 4UQCA 4OCSH 5IEKB 1MHHA 2A9ML 2IQ9H 2VE6A 2ZP0T 1UVQA 2FBJL 3IB4A 1GTNA 5EBLA 4H44C 4MA7H 4XO3A 1B6UA 5EU7E 4HH9A 3BKJH 4KZ0A 4K7PX 3GBML 4K71C 5KVDL 1NBVL 4NZRH 4QRQA 5ALBL 2DQ6A 2EYTB 4OZHE 5KBNC 2GJRA 3DNKA 1D6EB 2XZCL 4LL9A 4K9EC 1GC1C 3LH8A 3S34H 1XF2A 4JPVL 3ARFA 3FB6A 1IFHL 3VGDA 2EUWA 1VADB 1U3JA 2R4RL 2JB5L 1O6SA 2CDGB 1YNTA 1IBFA 1R47A 4OQTL 4XBEL 4QY8B 4JM2D 2WLIA 4ADGA 5E8DL 3MKGA 1EBAA 1I85C 4HU8A 2NY4C 1LTXA 2XPGA 2Z3FA 3V4VL 5CU5A 2W38A 3L4CA 4ZS7L 4X9HA 1LEIA 4Q52A 2Y7QA 4UU9B 1BYNA 1QSFE 3FTUA 2XTLA 1A9EA 1U2HA 3W0WE 1P2CB 7FABL 1AG6A 12E8L 3MROA 4LLQA 1FL3A 3F7YA 4IJ3B 2BOLA 2JF1A 1ZLUK 5FUZL 1EVUA 2O5XL 5E4AA 1WS7A 1A3ZA 3S96B 1I9IL 4BWUA 1CYWA 1I1FB 3MLRL 3IU3A 3L4WA 5ERWB 4YR6B 3F7KA 3DYPA 2ZX6A 3ILPB 3S98A 3ARED 1UWFA 1IKOP 5I9QC 2WM0A 2J1ZA 3KLSA 4PY7B 4MXVF 5JQ6L 2OL3H 3Q43A 2D0HA 5E08L 5F9JB 2UY7A 4W1TA 5E9AA 3K71B 4PD4J 3NZ8A 1K3ZA 1CFNA 4RMVA 3CFIC 3H3BC 4IK7A 1QKZL 1WV7T 1F4YL 1FNEB 2Q76A 4PWKA 1KCLA 4IS6A 4QTHA 4A2HA 5FYLH 2VDRB 4APQC 5T3ZD 5DK0A 4YHNB 4X7FC 4YZWA 4OT1L 5I5JA 4AG4H 4W9LC 2BVQA 4HUWA 5IBTH 1KPUA 2XTSA 4E9SA 1RFDL 3LHPL 3KPMA 3OHXB 3VH8A 5KVMC 1CE1L 2DM7A 5K5YA 4K4KA 3U6RA 1TQSA 2A6JA 2E9GA 4GQ9H 1YDPA 1LMIA 3QAQA 1ZMYA 4JO3L 4QDGA 1NANH 1E27A 3GNML 2FQDA 1R3JB 3FUNA 5DUBB 4UQ2B 3M1BB 3WHE0 1HL4A 4LCCC 3VRIB 1WD9A 3V6ZA 2CO6A 4XPHH 1I75A 3O2WL 5DJXA 4QF1B 4ZW6A 3MKKA 4C4UA 5KW9H 4YBQC 1XH1A 4R84A 1XGQB 1J1PH 4Z95H 1LDPL 2AAAA 2EYSA 3HMXL 3MUHL 4ZZKA 3B2DC 3E9UA 4XBPB 4A7GF 4KK9D 5IJKC 4OJYA 2ZUTA 2QQNH 4PV8A 4U6HB 35C8H 1XO8A 1FPTL 2WUCH 5JHDB 5KOMC 2IG2H 3CFCH 4DP6X 2H8PA 1RZJL 2UXVA 2HCZX 3QWOB 4QHLA 5BQDA 2WLMA 2EABA 2D7MA 2NNCA 4JFFB 4PRHB 3BD4A 4HIQA 4ZMOA 3F64A 4YHKL 4HLJA 1JHTB 4Z7UF 3G5ZB 4X7EC 5IIEA 4P2YA 2EDXA 1G7QA 4YGVB 1I7UB 2A74B 3BCFA 4HWEL 3ILPA 5D55A 4ZUTB 4Z7QB 3SPVB 3G04A 3CVHH 1HH6B 5DRZB 3GIZL 4KVPA 3RWHA 4PJCE 1J11A 3HPJB 5L0QC 2HX7A 1QLRB 1DBKH 2F5BL 4XVSH 3B3IB 1CICA 3O2DL 4PG9B 2YEQA 3VE0B 1OW0A 2MPVA 1PKQE 4LPYA 4WFHD 4Z7QE 3NZHH 3D85B 3VFVA 2UZXA 4OBRA 3CFMA 1WIOA 5I1IL 5INCA 1MFBH 3L9BA 3TZVC 4ADIA 1S7QA 3PAZA 4R4FH 4D8PA 3DV6A 3EKCA 5AEAA 3U6RB 5I6LA 1NC2D 1NAMH 4A2LA 5J7CC 4CSSA 3H9HA 4IIQA 3HR5A 3ZRSA 3T1FB 4X80H 1QFUH 1IAOB 3UZVA 1E27B 3WLBB 4NYLA 5E5RB 4OKVA 3BRDA 4Z3GA 1IGIL 3UP6A 5IVXE 2DQEL 3GHEH 1G7IB 3BE1L 5I6PA 3RVUC 3GI9H 5DHVH 3ZE1E 2ZYIA 4X9YA 2YSTA 1ACYL 4U2ZA 4MQ7A 4AUUA 3TPUA 3QK0A 3VH8B 3QYCA 3EBAA 3KH4A 5KANG 1F97A 2DH2A 2RIKA 1GIGL 4MJID 1FNSH 4XCEA 2HT3C 3WI9A 2R1WB 4KQ4L 2ZSWB 2AXGB 5IQ7H 1PZCA 5E23A 4LVHC 3PF2A 2V9RA 3VI4A 1QR1B 1DEEB 4JFTA 2WP3T 1I8UA 1XGRB 5KUKA 3E1ZA 4KK6D 3D39B 4JFZL 1P5UC 1ORSA 5CCJA 3T4YA 5D7JC 5ILTL 4HSCX 5F9JA 5CFHA 3SGKA 1WF5A 5ITBL 3DGGB 4OW6A 4UILH 2PR4L 2VLJB 3NDZE 5JPNA 1HQRB 5GGVY 2AJ3A 1U8QB 4MLIA 2KZ1B 2R4SH 3SPHA 3B6SA 3OPZL 2WZPA 2OZNA 3OKEA 5E03A 5TDPB 3MNVB 1GKEA 1ZHKB 3VWKC 4ZMPA 2J5LC 2Q8BL 2ZWZA 1JRHH 4GKNB 1W9XA 2WXNA 4N9GB 3EG9A 3ZDZF 2LLGA 3IDUA 3MOBL 3QHFL 3N44F 3BH8A 5BS0D 3CDYA 2PXYD 3LCYA 3G6JA 2BVOB 5FM5O 4ZX6A 5I1EH 3S4SG 5D7LE 2WBJA 2W94A 3V4PL 1E6OH 5F7LB 4WI6A 2J2ZA 2PYFA 3MLVH 3AFLA 2Y6TE 2QQLL 3K1DA 2EIMB 5D7IA 5IB4A 1FH5H 3RVUD 2EEFA 2R1WA 3EGSB 3M7FB 3V6OA 2R29L 3VQ1C 5F1KC 4MJIE 3II3A 4LCIL 4FLOA 3WFDH 1MJUL 1T2XA 3MRLB 5C0EB 2AJYL 4QIRA 3MV8A 5JOPE 4PJGA 4S1QH 3DXAA 5MENE 2B2XL 4DZ8A 3RVXD 4X6CF 2W0KA 1ANUA 3TONA 5F3HB 3JYBA 2IMNA 5C2BH 4S11A 5DI8A 1U36A 4M6MH 4NYLB 1NUFA 4XC1L 1FYTE 1ZHLB 2Y6SC 3EF7A 3LQAH 4L1LA 4Y1AE 3RDTD 1E30A 4XMZA 2E46A 1ACXA 4MQ7B 4RA3A 2MPAH 4AW7A 5ID1A 2C4XA 3NIFF 1H19A 4R3SA 5DS2A 3VACA 3JWOH 1QFPA 2EH8H 4IMLA 4NHUA 5AW9B 2CGZA 2H3XC 5H35B 1OTSC 3T09A 3FBQA 3PXLA 5K9QG 1EV2E 2H3NB 2WO4A 2KMWA 3E0GA 1DUYA 5EDSA 5DD0L 1B88A 4ONHA 2R7EB 1MAMH 1FO0A 2ENSA 5D8JH 3J8F7 3A4AA 2JMRA 2DLTA 2AZUA 4AZ8A 2C8NA 5GRXG 1SJXA 2N0MA 1P69B 1IARB 4JHZA 2YMTA 3FB7B 1JGVH 4PJAA 1JPFB 5HGHB 3WCYA 4HSQA 5HYQA 3US9A 1QZ1A 3O8XC 1NDGA 2ED7A 4U1MA 2NY5C 4LSPH 5DT1H 2PW1A 4OB5H 4JCWA 3MRMA 1AGEA 3DJTA 4IU2B 5HD8D 5IM7B 3ARZA 4GIPD 2CKBB 4F2MA 4O02A 3IVKA 4B5EA 5DZAA 2O93L 1T03H 1VZGA 5I8EA 2MCAA 5KVEH 1Z9PA 2B3IA 2ESVE 2M8XA 1KWGA 1OT2A 2NNRA 5D7KD 5HHOA 4NO0D 1CIDA 4JO8A 5CJOL 3FL7A 4JMNA 5CLYA 2Y25A 1S4IA 4KKNA 4JFDD 3UJIL 4IQHA 3DJZA 3OL2A 2YEVB 2FX9L 4GRMA 1RZQA 3UZEC 2P8PB 3CLEL 1UXWB 2YAPA 4JFYA 1AHWB 3BT2H 3ARBC 3WJLC 1B0GB 2LLLA 5FUZH 4EI6B 4HFUH 4NWUL 1JGIA 3B7UX 4E9RA 1YY8B 1VDGA 1Q9WA 2WCSA 2OMWA 3DIDA 3QNYB 1IAIH 3IS1X 2J71A 4GO9A 5GS3A 1NOFA 2FWLB 4IOFC 1JGVL 2BZCA 3ASNB 1T66C 4WHTA 4OCLC 3QISA 1XTLA 5ACZB 2NX5A 2CJUH 1E4KA 3AG2B 3OKMA 2D3LA 3HKZA 4IIQC 4JO2H 5IGXH 3QA3B 4FA7B 2YRLA 4EDWL 4AIXA 3I75B 4ZBJA 2FGWL 4TKWA 4Y5YB 4JGMA 4R97C 1EQWA 4FFZA 3K6DA 4WNQB 2DDQL 2PWGA 3UBXI 4J4PD 5KVDH 2X42A 1RPQA 2HLEB 1MHPL 3QFJB 4GAFB 4ZOBA 5BS0A 1M9SA 5E8PB 4ZYKB 4H88L 3REVB 5CSZA 5F88A 1MFDL 4XR8C 3HW7A 2DLFH 3LNHA 4PGBA 3MGOB 1T04A 4ZUUB 3VG0H 1GGYA 4A7GA 5ENWB 4R0LA 2WLJA 3FN0H 5E4EC 2DJ4A 3M07A 1JRHL 5GGQH 1LWRA 2F54B 3NA9H 5D7SH 4LEXL 4Y4FD 3NAAL 4UQAA 4N0FA 5ERWA 1P5UA 2ZP9A 5J1SC 2YMXH 1KGCE 2H32B 3EF4A 3HRZC 5SWSA 5EU6D 4LCIH 2BWIA 2R51A 3KBHE 4NS0A 3ZKSD 2H1XA 4P99A 4E42B 2EIJB 1NWOA 4NDMB 5IQ9A 5LJYH 3KD4A 2FEEL 1U8JB 4ZO7A 1OWWA 1BZ7A 4PLJC 1ZIAA 2DMKA 5SWSE 4CBPA 1JUFB 4MAYB 4LSSH 2UXTA 4R96A 4K71B 5HHNB 1IEHA 4I3RH 2VJ8A 1EHXA 4FFZL 1PTZA 4KMLB 3IDGA 1WZMA 3DX9B 5ITFB 3MBXH 3BH8B 1MW2A 5EEZA 5A6IA 3NCMA 1H15B 3MRIA 2BLFA 3QQ4B 1LO4H 2Y3AA 1HDMA 4LIQH 5AVTB 1JIBA 3BXNA 4RMWA 4IBUA 4GAJL 2CLRA 4IYKA 2CRIA 4PB9L 1HQRA 3RGVB 1J18A 4G8GD 4C56B 1V10A 2YAMA 1CI5A 5I73C 2Q2EB 4FZEL 1TJMA 2ZWLT 1G6RA 2E7CA 3WUWB 1ES0A 4AM0A 5TPWL 2H3KA 1T89A 1OAUL 3EYFA 5ICYB 4ZNCD 2FX7H 5H2BB 2Z8WC 2AK1L 3KWUA 3FRPA 4ODXB 4QRPD 1T21B 3D08A 3T0EA 3WU1A 1L9NA 1BMZA 5LB1A 2W80C 1XGUA 4JM2B 1P7QB 4FG6C 4DGIH 1TEGA 1YEWA 4JE4B 4JQXA 3ARVA 4GFTB 3VFMB 4ONGH 2PCPB 3RPKA 2WTRB 1QPXA 3OZ9H 4FN0A 5E1GA 2QQQA 1AKJD 3HUJB 5HHMB 5I73B 4X98B 1JXGA 4AE0A 2WQSA 4N8VG 2GITB 3JWNC 3LQMA 4AYSA 1IC7L 1XSJA 4BK5A 2A6KA 2WHVA 3MNDA 1I8KB 3NSXA 4DGVH 4KDTA 2JCWA 3QJZA 4HUVB 1UASA 5DHMC 3HBPA 2VW4A 3OTTA 3L95B 2WSDA 3D25A 1MW3A 4OFKA 3AROA 4K15A 1HEZB 1G6RB 4Y5XC 3WS6C 3CMOL 2VLJE 3ESUF 2R2CA 2E9JA 5B1CA 5IKCB 1KGJA 2YGOA 1FNGA 5C0AB 2PO6B 1QEWB 4HK3J 4H40A 1M7DA 4XCCL 2RTTA 5DEFA 5J6HA 3DVFA 5DDHA 1RZ8B 1IZKA 4ABVA 4RGND 2ZKMX 4AGLA 2OMBA 1P6WA 3DPBB 4DVRL 4U0RC 4L8DB 3SGDI 1MXGA 2H2PC 1W16A 4PJ7F 4NCC1 2BNQA 2VC2B 4F7MA 2ILLA 1KN2H 1A9VA 5C07B 4ICXA 3S37H 5KYYA 1N18A 5JXEC 3FT3A 1I7ZA 1W91A 1HCZA 3B2MA 3DX7B 4CAGA 2XY1A 1JVOA 2X4PB 4G8AC 2I7OA 3QZLA 1I8IA 3G6DH 3EYUL 4XZUB 4CMHB 4ZW7A 3LRSB 5I5MA 1Y1DA 3CFDA 1F3DJ 4EDWH 1II4E 5C0ND 3RWEB 1R46A 3IGKA 3IMWA 4WFFE 1UUSA 2DAVA 4OLWH 4A38A 1SQMA 4KROD 3DVGB 1F1AA 4NP9A 4Z3FA 1QRND 1PG7L 3KDMA 4QOKE 3HI1B 4BH7A 5CR1A 1HJBC 1MZYA 3QJFA 3LH2L 1FGVH 2QR0A 2VTFA 3Q3GB 2QVFB 1MCLA 2I25N 4P2RD 3QDME 3JV0A 4NXKA 3TH2T 1F3JA 3AS2A 1QNZH 1UADC 1OAXL 3OJMB 4APQD 3H4HA 5C0CD 1JNNL 1FZJA 1NCOA 3IDIA 5CUSH 1ZANL 1FYTA 4Y1AA 4QJ4B 5GHWL 2KT6A 3PXJA 1EEZA 3CUPA 3PE9A 5AW2B 1E65A 1TJHL 3MAWA 5GGRA 4AIOA 1J05B 3M1BA 1F2XK 2VMDA 3FK3A 4HCIA 4QHKI 5MENA 1SLWA 4LHUB 4R5TA 4ZOEA 1KYDA 4EF3A 5HYJD 5AVQB 1UD5A 2WZ6A 4GKZA 1NCDL 5DLMH 3MLPA 3DO3A 4PG9A 3VE0A 3ZQWA 4ZT1A 3IJ7A 2P47B 5C08B 3FYIB 1AXTH 5FGBA 5AAPA 3OLEA 5EWIL 1GZQB 3NGBC 4P57A 1BJ1J 3MBEB 3IFPA 2IH1A 2VXTL 1GJWA 4UQEA 3MODH 2RB8A 1B3IA 3VD2A 4AUJA 4PJ9A 4ZS7H 1FFPB 4L3EE 4PGDA 3VB8A 6PAZA 3OX8A 1IEBB 1CZ8H 1XIWB 2NQCA 5AKRA 4PGZA 3ZTNH 5GS2H 4JFFA 4PRHA 4F58L 5L4FA 4NQCB 3GMRA 5D8JL 5AOIA 5ESVB 5FYJD 4IKLA 2XYBA 4NB7A 2PYED 3MC0A 3M6DA 4L29A 4XZUA 1BVLA 3LHAA 3C60D 4ZW5A 2L3BA 3N9GL 4YBLC 4RAUA 5HYEA 3LXCA 4CVZB 1WUZA 3ATDA 4YH6A 3AW5A 5HDRA 3UDWC 2PW2A 3UL4A 4XCFH 4DUVA 3FCTA 4GQZA 1R5IA 4NUMA 2YGVA 3EDJA 3TIDB 3U2SA 3FSWA 2MH4A 2R1YA 1U8CB 4JM2C 3KYNB 4P5KB 3RPIA 3WSQL 3LOWA 4M9OA 4HZLB 3C8KA 5DVMA 1A9EB 4G6AD 1EK3A 1KOAA 2Q6WA 5DD3H 4UQ9A 2A2QT 1V05A 2CRZA 1I7RA 5HGBA 2OSXA 3L3GB 1WA0X 1F4HA 5CIPA 1ZTXE 1OAQH 1DANU 4M6OL 1YEJL 1UOWA 4F24A 4LSTL 3TN0D 4BKLB 5F96L 1YVLA 3BGMB 4M7ZB 4LBEB 5TE7L 2H3NA 4YK4C 2XOTA 3H56A 4HK0B 5TF1L 1BQUA 3RNKA 4UZSA 3MO1B 4FTVA 2EO9A 4D9QD 2HUHA 1IAMA 3SY0B 5FDWB 1UXSA 2I07B 4BGDA 3T65A 1SM3L 2JQAA 2IJ0C 4X98A 1NDMA 4JQVA 2Q86A 1VJSA 4X6CB 2ICEC 3AU1A 4HKZA 2IPKB 2WANA 1ZHLA 2WIIA 3S5LG 1JF6A 3RVWC 1BXXA 1UM4L 2OR8A 4HPHA 3UTTE 2P5EE 3WNKA 4O2EB 5I2IA 1FC1A 4N6QA 1OXYA 2BNRB 4P5TD 3RWDB 1VGKA 4TUKH 1TITA 1OK8A 2WY3B 3D34A 4HIIB 2WLLB 3LKOA 4HZAA 4PMEA 4UILL 5C9JA 3F3HA 1KZYA 4JG9A 3L3KB 1X5ZA 1DJHA 1QSVA 1NIDA 2WYHA 3FCSA 5IFHH 1ETZB 1CLZL 4GMSL 2OZ4A 4PJ5D 2WLZA 3D18B 4MNGB 3P0YL 32C2B 3T2OA 1T3FA 4NKOA 1H6UA 2JH2A 5LDUA 1FNHA 1Y18B 3VX0A 1LEIB 1A7RL 3N1PC 4KK5C 4Z3IA 5TDOB 3AGVA 3P9WB 3TBSB 5M94B 1GC1H 4APQA 3ZBMA 2CDFA 1WFIA 2CPUA 1RURH 1RZKL 5I5IA 4P06A 4K3EH 1Z9LA 4MXWL 3I3BA 1J87A 4RGNB 2BVPB 2H41A 1V3LA 4L5FH 1KLGA 3MCYA 2O5YH 2ARWA 4IM8A 3K0YA 4A04A 1I1CA 3VQLA 1RUAH 3GZOA 5IVOA 2AXFA 4KK9C 1H3UA 3TYFA 3DX3A 4U0QB 5I9QB 5DZNA 3DRTA 2B0SH 2O1AA 2XN2A 1KB3A 1UXLA 1SLVA 4OJDH 1TQBB 2FE0A 1MCQA 4M4RA 3WFBL 4R4FL 5DEGB 4DT2A 3X13B 2X2UA 2W0FA 3BAYA 1UB5A 4PCKA 5G4MA 1WZAA 4ZMZA 2VDLH 1CLYH 1IC5H 2CDEB 2CKNA 2Z7ZA 3OWEA 3F05A 5B38A 4CMMA 1CB4A 2FECI 3VD7A 1MREH 2VMFA 5I16A 3MO1A 1KC5L 4FTVB 2E7LA 1GH7A 2BSRB 2J12B 1H3PL 3ECUA 3WN5C 5GGSY 2JJSA 3SDDC 2YPLB 2OXHA 1U3ZA 4K5OA 4ZMAT 2MIZA 4P4RA 2Q86B 5D4JA 1MCWW 1YLBB 5D4QA 1MFDH 1OSEA 4OGZA 4PP2A 1YEHL 1HINL 2Y7SA 2K3HA 1MVFA 2YEZB 1BVZA 1ZTMA 2VMEA 2VZTA 3TIEA 3UTSD 3GUTA 4RMTA 3TGXA 4LMQE 1ETJA 5E4IA 3ZTCC 1OL0A 4IKJA 4Q9QH 2R2HA 4YXKH 4AK2A 4GI6A 4HUNB 1C12B 4ONGL 1S7QB 4ZUWB 5AYUH 5CCGE 3DBSA 5I6XC 3O3AA 3PL6D 5HHNA 4K73A 2Y06L 1VZIA 4GEIA 4ZMQA 4WTWA 2PUQT 4DUWA 5DWUH 4UAHA 3F00A 1NMBL 2E9IA 1PFOA 1OT4A 1SEBB 3ALWA 1KLFA 2WXKA 3KBFA 5IFHL 4NO3B 2XXCB 3BDXA 2NXYC 3MXWL 5DYFA 4GXFA 3QWOA 4QHLB 4XP9H 3NJLA 3RPBA 4NQTA 2V7NA 3DMMC 3HE6D 1MHEB 4N2FA 3V5HB 2UV3A 3KPPB 4ZOCA 4NSKB 2P5WA 4OLXL 4FTVD 4R7VA 3ZT6A 4B0MM 2Q3AA 4TL5A