3FFQA

Hcn2i 443-640 apo-state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
184
Chain Sequence
SRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 51
structure length 184
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ffqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ffqA02
4B29A 1DZRA 1XE8A 2D5FA 1O3RA 5I93A 1LR5A 3M70A 2D5HA 1HW5A 4IEUA 1ZZBA 3NSTA 2GU9A 2E9QA 4J1WA 3H1WA 4WBBA 1CAVA 2HKXA 1J3QA 2BGCA 4PIXA 2DCTA 5LEJA 2D40A 3FFQA 4XFBA 2FQPA 5C8WA 1CX4A 1YFWA 3IIAA 4KU7A 5KHGA 4FAHA 1LKNA 3LA7A 3H8UA 2GC0A 4ZU7A 3HT1A 4Q0QA 4HN0A 2Z69A 3FJSA 4QGMA 4BIFA 4MGKE 1CAXA 5AVPA 5BPXA 2QCSB 3DN7A 3UKTA 3PVBB 4XFIA 4QM8A 4JVAA 3N4MA 1QWRA 1RC6A 1EY2A 1UD1A 2XKPA 1J59A 3IDBB 2Q4SA 3ELNA 4FT8A 1ZZ6A 2IC1A 1YFYA 2IXIA 1EP0A 1Q3EA 4MUVA 4HSJA 4BHPA 2BNOA 3I59A 2OYZA 3B02A 3DL3A 4MV2A 4L2NA 5KHJA 4F7ZA 3KGZA 4I01A 1OD5A 1X7NA 3MPBA 1JUHA 4R8HA 3QACA 4R52A 1ZREA 4Q0SA 4E2QA 1CAUA 2Q0AA 4XF3A 5FLJA 3FHIB 1SFNA 4ORFA 3QOPA 4AQ6A 3G7DA 1ZX5A 3RPQA 3HQXA 1IPKA 4AVAA 4HVOA 4D7TA 4XF4A 3E5QA 1FXZA 5CU1A 2IXJA 4QM9A 4NVPA 1TQ5A 3IDCB 1LB2A 1PMIA 3ES4A 4QMAA 5I0RA 2QJVA 5BXXA 3KCCA 1H1IA 4HBNA 3FX3A 4Q29A 4IESA 4LUKA 5BUVA 1J3PA 2CV6A 2ATFA 2EA7A 3EQEA 1O3SA 2VECA 3I59B 4XF9A 1GQHA 1DGRA 2XGXA 2VQAA 4K8FA 1VJ2A 4META 2OZ6A 2ZCWA 2V09A 2O8QA 2UY8A 4YARA 3WW1A 2XLFA 5LRRA 3M3IA 4HLTA 4QGNA 2XLGA 4EROA 4OLLA 5I91A 2I45A 4L11A 2WFPA 1UPIA 1G6NA 3D82A 3OTFA 4KWJA 5BY5A 3LOIA 4UXAA 3VHRA 1FT9A 3USSA 4I02A 2WC2A 2Q30A 1ZRCA 5I0TA 3NKTA 3EO6A 4YSFA 5JSOA 3KMHA 1OI6A 1EYBA 4PIYA 1VR3A 3U0ZA 2PHDA 1QXRA 3NW4A 1WLTA 4AVBA 3HT2A 1L3JA 1DGWA 4RD7A 3SCFA 4QX5A 1DZTA 3E6BA 2ET1A 4EV0A 2PAEA 1RUNA 3NL1A 1SEFA 4XETA 1J3RA 2P17A 3LA3A 2IXKA 2H0VA 1X8MA 3LA2A 1OFNA 2UY9A 1ZVFA 2GC3A 2IXLA 3U11A 1GQGA 2QDRA 4IEZA 3GYDA 4LLOA 1NE6A 5FCCA 5EZWA 4MZUA 1NE4A 1RGSA 5JSPA 4J1XA 3IWZA 2MPFA 3DKWA 4LTAA 1IPJA 4HVRA 3LAGA 5FPZA 3BU7A 2CGPA 1Q43A 4HVQA 2PAMA 3O14A 4IEWA 5KHIA 4LA2A 2UYAA 3CLPA 4QGLA 2H6CA 3PLQA 3EHKA 5FLHA 3ETQA 2ZKLA 2GZWA 4ONUA 4Z82A 4E2GA 2D93A 4HMZA 4JTNA 4UBGA 4AVCA 5JCTA 4EWAA 4JV4A 5EFUA 2XHKA 4IETA 1O5LA 3H3UA 4FBFA 1ZZCA 3BPZA 2Z2SB 4UBHA 5E1RA 3D0JA 4BH9A 4LULA 1ZRFA 4A2UA 1YLLA 2PHLA 3R6SA 1J1LA 4XFFA 3TNQA 2UYBA 3PNAA 3H9AA 1YHFA 4HN1A 4QXKA 1Y9QA 4BYYA 1YFUA 3EJKA 3FWEA 1XE7A 1CAXB 3NVCA 3FE5A 2Q1ZB 3BB6A 3EBRA 2XLAA 3H3ZA 3MYXA 3H1MA 4KU8A 1O3TA 1O7FA 3RYPA 3BALA 1CGPA 2VPVA 1XRUA 4KWLA 4P9GA 1ZZ8A 2ET7A 2OA2A 4XFCA 2GC2A 2B5HA 3L2HA 4F8AA 4E2SA 4I0AA 4MGIE 1UW8A 2PTMA 3S7IA 2BEOA 2QVSB 3I7DA 3ACLA 3UKVA 1OMIA 1X82A 3LZZA 1LRHA 5J48A 4AQ2A 4PIZA 5D1IA 3SHRA 1ZNPA 1YUDA 2PA7A 1CAUB 4YRDA 5BV6A 5CADA 4X6RB 3FZ3A 2O1QA 1O3QA 4I0BA 1RUOA 4KWKA 1Q5OA 4PJYA 2MNGA 4LUMA 2GH2A 5I0SA 1ZRRA 1O5UA 2CAVA 3E5XA 4Q0VA 5JR7B 5LEKA 3MDPA 4TLFA 4O9GA 4ZU4A 4EWEA 4XFGA 2XKOA 5LRSA 5E16A 3KGLA 1CAWB 3TNPB 3ZDSA 2OPKA 2GC1A 5I8YA 5I8TA 3UKNA 5K8SA 2EVXA 2BYVE 2PQQA 1H1MA 1VP6A 3WW4A 3C3VA 4IEOA 2IXCA 4IEPA 1QY4A 1I6XA 1UIKA 1UCXA 3OD0A 4XFAA 1EPZA 3E5UA 4MGYE 3CF6E 3DV8A 4LA3A 3OCPA 1YFXA 2ETEA 4IEXA 5C6CA 4YNIA 2K9ZA 2OZJA 5J3UA 4KL1A 1Y3TA 3OF1A 1ZRDA 2FMYA 3H1YA 4MH0E 3ES1A 4XFHA 1UIJA 2CAUA 4Q0PA 3CO2A 4WVZA 1O4TA 2KXLA 3ROUA 3RYKA 3CEWA 1WGPA 5I8SA 4DINB 3D0SA 3S0MA 3E97A 4I2OA 2K0GA 5I0UA 1NYWA 3SXWA 2BNNA 4LEJA 5FLIA 3RYRA 3WW2A 2B9UA 4MX3A 4D7SA 3S7EA 4N9IA 1X8EA 3WW3A 2BNMA 2N7GA 4Q0UA 1WA4A 3H7YA 2PAKA 2PYTA 3SMHA 3H7JA 3OGJA 4CYDA 4YYOA 3NJZA 5FQ0B 2PFWA 3RNSA 5JSRA 2B8MA 3H50A 1NZCA 1SQ4A 1I5ZA 4MGZE 4N9HA 1RTVA 4I3PA 4AXOA 1CAVB 2MHFA 4IEYA 4Z07A 3JZVA 1ZZ9A 1PM7A 4EWDA 1FI2A 3LWCA 1V70A 3RZZA 1RL3A 5JAXA 5F1RA 3CL1A 4FAGA 5FPXA 2H6BA 4IERA 3I54A 3E6DA 1ZZ7A 2C0ZA 2XL7A 2HJIA 4O9EA 1J58A 3E6CC 4OFGA 3BCWA 4H7LA 4GULA 3MZHA 4IEVA 1QXJA 2Y0OA 2GAUA 2IXHA 3SCGA 4XF0A 4WZCA 1NXMA 3U10A 2XL9A 4IEQA 4JTOA 5KHKA 4XF1A 2QNKA 1YWKA 5T3NA 4I09A 2F4PA 3KSCA 5HI0A 3CJXA 4ZU5A 1U12A 5KBFA 4XEZA 5CVRA 3HIFA 5FQ0A 1CAWA 2EAAA 5KHHA 3SCHA 5FDBA 3GBFA 3IBMA 3RDIA 4HZFA 4HSLA 3ST7A 4X6QB 5J7MA
chains in the Genus database with same CATH superfamily
1FX5A 4URAA 2CE4A 3VBRA 3IN9A 3M70A 1JX9A 3JCZA 4IEUA 1JZ6A 1IHMA 3NAPA 4RUFA 4C1WA 3MI8A 2BGCA 1XUQA 4PIXA 2JDYA 2GDFA 2D40A 3KKYA 1SPPB 4JAVA 2G38A 2CNAA 5ITZA 4PLNA 1REDA 2ZM6O 4YW6A 1OCOC 1R6TA 4AGRA 1MS0A 4QPIA 3L75H 2DV9A 2DTWA 3CCLV 3CSXA 5FY8A 5EK0A 4NKGB 1R081 2EXKA 4F7ZA 3O1TA 2JDMA 3X2QB 5B4NA 4PA9A 1M57B 5DAWA 1CAUA 4WM7A 4JTDB 1HR0B 3FHIB 4O4JA 4X8AA 4ITCA 5LHHA 3RPQA 2DTYA 2WLLB 2Y8KA 4LBJA 4CVUA 4X65O 3AG4B 4NAMA 4LP8A 1HKDA 4YLZA 4X66O 1OA2A 1OOPB 1QR9A 4QIWF 4IV3C 5EJ1B 3ZMNA 1O9GA 2VJXA 5FREA 5LP6A 2ZCEA 4UFJA 4I9WA 4Y24A 1XREA 2ZCWA 2V09A 2Y64A 3GCWA 5CBFA 3K04A 3WW1A 4CZZA 3AG1B 2R071 2HEPA 3FYEB 1RUG3 4CZSA 2E32A 3DPRC 3HR9A 3IDEA 4B3TO 2A6ZA 3OTFA 1RUF1 4UXAA 3MHZA 1G9BA 1I9RA 1RPOA 3ZN6B 1M90W 4AFCA 1KITA 1W6MB 3A8TA 4QGPA 1F2NA 4AEDC 5LK5A 1C5IA 1IOAA 1HJGA 2ET1A 1LJ7A 4QE9A 4NTYA 1QJZA 1AYM2 1W6MA 2WN3A 5TSWA 2OPWA 1PNMA 1T5EA 1BHBA 5A3NA 1ODNA 5GM0A 2DCYA 1N36B 3GM8A 4JDMA 4J1XA 2QQIA 4DR2O 3JD72 1AP6A 1JU3A 2W52A 3KLSA 1NY71 1EAH3 3POEA 1VARA 4I9QA 1K5MB 4J41A 4DV0O 5FR3A 4JI5B 3AP7A 2YG0A 2VD7A 1TVKB 2HJDA 5CA6A 2J1RA 1R3IC 3ZMZA 2Z2SB 4BH9A 4KHPB 1PIV2 3CEIA 2GP5A 2PHLA 1IS3A 5FY1A 2ZS6B 4YVSA 2UYBA 5A7QA 5E6HA 4QQ2A 4NXMB 4TSFG 3JALB 1YDXA 1ND3B 4BR6A 1DQ6A 5FPAA 1UO9A 3N3HA 3RBZA 5BNPB 4HNAB 5LW9A 4KU8A 3RFRA 2WT2A 1W8FA 3BTAA 4PLOA 5FP9A 1MS1A 3BALA 3EB7A 4INDA 1LEDA 5C7GA 3JU9A 5EJ3A 3URFA 4K8ZA 4LBQD 2KB1A 4FP2A 3UKVA 4DZGA 2AR6A 1ZA7A 3ACGA 1ZNPA 4CU9A 4UV9A 2ADPA 3VZLA 4WF9V 4FLUA 1WBFA 3GJAA 3K51A 4DV5O 4EWEA 4W4ZA 1MZ6A 4A5UB 5I8YA 4WM8B 2JS3A 5EPAA 3WOGA 3K5OA 2Q5ZA 1MOFA 1NX9A 2RMKB 2F17A 2JG9B 4NWWA 1POV3 1LGBA 3ASNB 2OS2A 1U0AA 3ZXKA 4KL1A 2D44A 3W7UA 3QD6A 4CCNA 3ES1A 2R9RB 1ROPA 4JF3A 5E88A 3MIFA 5LZ6A 5EYPB 2ZEWA 1UPSA 5EZYA 3F2ZA 3VDDA 2ZGUA 1QIQA 4N9IA 2YPDA 4Q0UA 1URFA 2VQEB 4CXXA 3OGJA 4M4RA 2WKKA 2BBVA 2BOIA 3CMEV 5ABJB 2W0XA 5CFCC 4FK5C 3ATGA 1KKCA 3VBHA 3HKCB 2FMLA 5BNOB 1MVEA 4WFHA 3CL1A 3G6BA 3ZHTA 1WMXA 3DYMA 3A22A 1JJOA 1H2NA 1JMUB 4UFZA 1KD7A 5B1NA 1OXCA 4FP3A 1D4M3 4WZCA 1H2SB 1WW4A 3LFIA 5KHKA 3N2KA 3AYEA 5KBFA 3W7SA 4AOCA 1PD3A 4O61A 5A1LA 4QQOA 2VVDA 1ORQC 2L35A 5JZGA 3CJIB 3ZYBA 1US6A 1HW5A 4K7JA 2DFCA 2R7EB 4UT5A 3O65A 1ULCA 1WMDA 4WBBA 4XUTA 1K8AW 3A0RA 1GZWA 2HKXA 4JRLA 2R1DA 1QJX3 3LDCA 2VMEA 5T5LA 1TME1 1XYOA 4KXRA 5C8WA 3ETDA 4FCAA 3T4ZA 2FDGA 3HN3A 3VQVA 3C8XA 1K34A 4AFBA 5JOYA 2P22C 2IH3C 4GWIA 3HNYM 4UVCA 4UFHA 1EY2A 4YHHB 1L0NH 4QXBA 4QB1A 5IJ9A 4K20A 4OHWA 4RFT0 1FATA 2F1MA 3IM0A 5LP6B 4X62B 3MV11 1N4CA 3DXRA 4GKJO 1N1VA 5IY5B 5GALA 1BQ0A 1QVGU 5IFPA 1Y74A 4E2QA 4CEWB 2UUAB 3WF0A 4X20A 4XZUG 3QOPA 1XSQA 3S5AA 5EBWC 3ITQA 1CX1A 3M8AA 5CU1A 3VN4A 1VQNV 1HNXO 4LKSA 5IYYA 3WU2Z 1GOHA 3L71H 1ND3C 2W91A 1S1AA 4Q6GA 3PIGA 1GNZA 4IXLA 2QJ1A 5FZ0A 5EBLC 4R4XA 2OZ6A 5L7OB 2VZQA 3IAPA 1ONAA 4XQWA 1K33A 3WF1A 1AX2A 1G6NA 5F5CA 3ZKYA 2EXJA 4CCOA 1LNQA 2ZHLA 2PLV1 5F2VO 1BZWA 2XWJB 3RWKX 4AK3A 1VBB1 1V55B 1ZYBA 1AHSA 1VR3A 3O1PA 5F3EA 4AVBA 5FBZA 2X6AA 2GHYA 5L36A 2QEXV 5B1OA 2R70A 2YPJA 3INAA 3HQRA 2VOTA 2GC3A 1PNFA 1S5LZ 1RUD1 4RHV1 2QDRA 1AX1A 1ZBA3 1KQRA 1SFYA 3EMRA 4RGKA 5C9AB 1DCSA 3NWKA 3CIHA 2KM2A 1HLCA 2Y0PA 3LSDA 4RUEA 2F4LA 4TYSA 4ZKTB 1GNHA 3ZFEB 1AILA 3H3UA 2VZ1A 3T3YA 3J9SA 5GONA 3IFXA 3CP1A 1H0BA 4L87A 2ATKC 4Q2FA 4FPLA 4QPIB 3PHMA 1TUEB 4FM0A 1H2MA 5A32B 3QH6A 4FTBA 1QOTA 1HRV1 4IV1A 4NPRA 4JYYA 5A80A 1VBD3 4I0AA 1SRYA 2PTMA 2BEOA 1VF5B 3BHPA 4DUYB 4GMP0 5C4WC 3ACLA 1K3EA 4MTOA 4X8NA 3GDBA 1N33B 3WDTA 1MEC1 2NMNA 4MHUA 2HR3A 1M1KW 1V9U2 4JI7O 5ABJC 3J8F1 1Y76B 1XNCA 4K1ZA 3WF3A 3D36C 2JS5A 3T2OA 5B1AC 4RL7A 4COVA 3WF4A 2ZMKA 4JGYA 3BA8A 3I56V 3AKPA 2YFUA 3UO3A 1W2TA 2WPDG 2X5IC 1BXHA 3OBRA 5F2SA 3FC0A 4ASLA 1E79G 2BYVE 2UXCB 2OIIA 3KV9A 2M6YA 4JI0O 2EULA 3G80A 2LW7A 5FIXA 1YFXA 1SETA 4FPJA 4JI6O 1HB1A 3SISA 4ATFA 4GH4A 4LCUC 1AL22 1IPSA 1VBB3 4PDRA 2FZ1A 3ZMUA 5FYMA 2CAUA 4K0KO 2ZEYA 2GMMA 5HV0A 2C6SA 4AI0A 2J1EA 2CTWA 3ZHQA 1LCLA 1E5HA 1JYIA 2JIZG 1YVWA 1UJWB 5FK8A 5FUNA 3UJOA 1NCQC 2UU9O 1FFTB 2B9UA 2JG9C 3C2UA 3S7EA 4P9IA 3JAWA 5KXDA 3CCUV 1PO12 4DY5A 5LBFA 1NU1H 1QH7A 4X1IA 1O59A 3V56A 4LF5B 1I5YA 4A3XA 2H94A 4OHXA 1JPXA 1GZWB 2DUPA 2YGMA 2PHWA 5ANQA 1BVP1 3RZZA 2DJVA 3GGLA 4IERA 3Q8EA 4PA4A 3BKZA 3W7XA 2LFRA 4CXWA 3ZMSA 3JD73 2ZTNA 4IEVA 1R6NA 4XF0A 5FZFA 4X66B 1N32O 2FDJA 3PJSK 3AL5A 3TOJA 1WMFA 3T4DA 4YGDA 1XNBA 4V2VA 4O2BA 3MIHA 1LR5A 1OT5A 2VUCA 3BOWA 1VF6C 1WJZA 1JR9A 1BQPA 2LGWA 5JXIA 5E89A 3FFQA 2VAUA 3WQBA 3VD4A 2P1BA 1AXKA 1JHNA 5CAZA 2QWQB 1ENXA 3JALA 2X05A 1UZ0A 1AZDA 1CWPA 5A6YA 1Z7S2 1OQEA 2XTAA 2YIBA 4P5HA 2WFF1 1MS8A 1L7QA 3N9PA 4L2NA 2GTAA 2HG5C 1OD5A 2WAAA 3ZMVA 2VCMA 4LBEC 1N47A 1MSWD 4R52A 3I2KA 5LY2A 4XIKA 4D7TA 2XWBB 2AZ0A 4I30A 2EIJC 2DE0X 4LBOA 5B5EZ 4LORA 2DWEC 3CC7V 1BKZA 1OQ1A 2O8OA 1XYNA 4JI7B 2VQAA 1OZ0A 1H4HA 2OYQA 4YGCA 4ZHQB 3ZSJA 4PDWC 3UO2A 2D3OW 2BJSA 4D6QA 1LU2A 5I91A 4P08A 2YEVB 4CUBA 2WNUC 4LF9B 1OFSA 3AJYA 2ZZQA 4AI1A 1FXHA 3LOIA 1MEC2 3K3OA 2YY1A 5A32A 3SPCA 4ZBMA 4WFFA 2RM21 2A3XA 2Q1MA 3ZVXA 1WP8A 4MOAA 2J1AA 5A6ZA 1OI6A 1S4CA 3M1HA 2VTXJ 3WNNA 5A1AA 1PIV1 2CSGA 1TMF1 2RS31 5K7PA 5FZ4A 5LK7B 2P6HA 1K92A 3JCIA 1J3RA 3MBWA 4UW3A 2XQRA 3E2EA 4UV8A 1VALA 1WLEA 1ZVFA 3QTCA 5JQGA 3GYDA 4GJYA 2OQ6A 4EE2A 1VQMV 3UGFA 4LF4B 2AZ2A 3APBA 4AVTA 2OCCC 3F5WC 4GIQA 3ZM8A 2R041 2VZPA 4YW7A 1ACCA 2CWMA 4Z82A 1Y9MA 1QEXA 4RO2A 2BWAA 4AVCA 1HB2A 3JD0A 1UMIA 4D3WA 1IBMO 5E79Z 1YQ5A 4LULA 2ZXWB 1OURA 2R0FA 4JI0B 1W8OA 2AHZA 4IHJB 3TNQA 4BJ0A 4IL7A 2WRAA 1CPNA 4W8JA 4BYYA 3MD0A 5T50A 1JS9A 3FWEA 5LASA 4XBQA 2BFUS 3FN9A 3WP4A 4H44B 3LDRA 5HCAA 3H1MA 3QO5A 4PDLA 3RJ2X 2B5HA 3T1YB 1DF4A 4N43A 4LO8A 4CU7A 2GNBA 3T1CA 5J48A 2XVGA 1Y74B 5CADA 4X6RB 3NR7A 3CBNA 4FQZA 2QSAA 2VZTA 2DVBA 2J1SA 4PJYA 4GAZA 4Q5OA 1GKBA 4GB31 5I0SA 2C9KA 2WT1A 1XQNA 3MDPA 1SA0A 3GWOA 2CTVA 4K6BA 1XU1A 4OULA 4KUMA 1XBLA 1IBKO 5FYUA 3WW4A 1ZM1A 4TT3G 4OUMA 5F5AA 3ILFA 1UIKA 1B06A 4XFAA 1GN4A 4AHWA 2W1WA 4KH9A 1DQ5A 3OF1A 3IC7A 1A8DA 2PLV2 2FMYA 3HKDB 3OGCC 3NRUA 4Q0PA 1O4TA 1UX7A 4H2AA 3K79A 2A73B 2DUOA 2ZHKA 1A34A 5BMVA 4BCUA 2PHUA 1RVF2 3E97A 2Q9LA 3VLBB 2BPA2 3D3IA 2VUJA 4CDXA 5LXTA 3JCUZ 3JD4A 4J10A 5E8AA 4FFKA 2BNMA 2GALA 1KJRA 4Q1PA 5ITZB 5LXTB 1NZ6A 2H8PC 4HT1T 3H50A 2ZEZA 3RS6A 4OCTA 2VGDA 4YVSB 4E27A 1ZZ9A 1FI2A 3N7LA 3LWCA 4GQ7A 4YGEA 3POBA 5JAXA 1UOGA 1LOGA 4TTGA 1W9TA 2PELA 4J80A 2OTJV 3OFNG 3LSEA 1G1XB 1Y76A 4DYLA 1KDKA 1QXJA 2ZMLA 4FXKB 2ZGTA 4XVHA 4Y20B 1I1EA 2RQ6A 1RM1B 3CZJA 1BEV3 4C0BA 1HR0O 3SYAA 1S0EA 1P84F 3GJBA 4XUOA 3CJIC 4MO3M 1F5FA 1SLAA 3J7HA 4JI1B 3TBDA 2QM8A 4J6GA 4RGGA 5I93A 3NXSA 3CRCA 1FJGB 3GXUA 3NSTA 1JFFB 3H42B 4AHZA 5C93A 2E9QA 3SGIA 3O1UA 2ITDC 1OH3A 2IU3A 1HN0A 1VBB2 1C8M1 4I55A 1ZBA1 3BTYA 1QJU1 4DEQA 3Q8CA 3VQYA 4BQ1A 2EXIA 3L74H 3AG4C 3N27A 4BIFA 1CAXA 2XH6A 1UU5A 5AFBA 4Y1VA 1UD1A 1PNLA 4NAOA 4AQYO 4CEYC 5FPBA 1MQTB 2JDNA 1KU9A 4DV3B 3K3WA 3PMSA 3HB3B 4PT6A 5IWAB 2QA4V 1PVC3 2P3YA 4EN0A 4TV8B 1P49A 1HNWB 1PHMA 3ZIXA 5SV8A 5GLZA 2CDOA 2DFBA 1F35A 2K1EA 4FPFA 3GHMA 1MABG 2Q1FA 2RS53 3I2DA 1R1A2 1JA8A 1PMIA 3LIGA 3P3PA 1QNYA 2ZE5A 1E5SA 5BXXA 4ASKA 3GVMA 2FCTA 1H1IA 3CNAA 5GJ6A 2XAQA 2HBUA 3AK0A 2NLJC 4XHBA 2RS13 1F9KA 1VEWA 4DXZA 2ZGSA 3CC2V 2WT0A 1QOOA 4AFMA 5LBCA 1LUWA 1DK1A 2R061 1FMD3 5L9BA 1A8MA 2UUBB 1GICA 2EF6A 1KDMA 1UPIA 2GTSA 5CA0B 4LF6B 3T30A 1SZXA 2PHTA 4QE7A 1AB3A 1AR93 1ND3A 1R093 3RRDA 3OYWB 3JD1A 3KMHA 3MGUA 2CTRA 3SCFA 5KXCA 1JH5A 3CRQA 1OF3A 4D6SA 2VTXA 2ZZJA 1CP9A 4X89A 5KMGB 1X8MA 4XQDA 5JZGB 4I4TA 1R1ZA 4LITA 5KC6A 5EP9A 1ULDA 4BMBA 1MG1A 2B9VA 1ULPA 4M3CA 5KUMA 1AUYA 4QQHA 2P4VA 2RR13 4X9QA 2NLRA 1JHJA 5DDJ2 1PO23 2YHJA 4LKDA 1NOVA 3LDKA 1GO3F 1AX0A 2PUSA 2WYSA 3POGA 4UBHA 4RR3C 1V00A 4GT1A 2E26A 4JI3B 4PA7A 4Z2AA 5FAXA 3T1HB 1PVC1 4FPOB 2ZE7A 1Q8PA 2YBPA 4COZA 2HH9A 2GNMA 1YQ6A 4QXKA 1H8TB 4UB8Z 1Y67A 4N43C 1CAXB 2YFZA 1V6OA 1SQXH 2CWSA 4FOYA 2VZUA 4MVTA 2LGQA 4J42A 3E86A 3U14A 2F23A 2IVJA 1W6NB 4UB6Z 4LF8O 3DYPA 1YRZA 2XJUA 2WSVA 5A3LA 5FZHA 3MIEA 2IJKA 2HEYF 1DG6A 4AG4A 4U3FH 5FMOS 5IK4A 4MVUA 2MNGA 4XXPA 2FHRA 3K75B 1Z2GA 3RYCA 2ZMNA 1O5UA 2V5DA 5F5IA 3JXSA 5LRSA 3HKEA 3ZDSA 1S0BA 3UKNA 4G9SB 1XU2A 3FUOA 3X29B 4JHTA 1ZA4A 3B9IA 2YSUB 2EICA 3CDZB 1B6QA 3OR7C 3UK9A 3JB8A 2QQLA 2WLPA 4U36A 4MHRA 4N7UA 3TGUH 3USUB 1OOPC 2RM22 2DYRC 1ZRDA 3H1YA 1YTFD 5LMUB 1GZTA 1FOD2 3ZFGB 3ABUA 5K0UA 5FWEA 2F6BA 3VGIA 2EILB 1KFUL 3K9SA 4DINB 4AF9A 4DR4O 2K0GA 3K46A 1ZBE2 2JECA 2VU9A 2VVFA 2D98A 2Q7HA 4JASA 2AH2A 2P4EA 5GZDA 4D7SA 4GX2A 4YGBA 1TUBA 3ZHUA 1N33O 5DZEA 4QX8A 3W7TA 2BVVA 3HAGA 1ZAUA 3O9OA 2BW8A 3JBG3 4W65A 4A44A 5FPRA 1ZBE1 4JTAB 1QNMA 3CRRA 1I5ZA 5DAQA 4AXOA 2X0LA 5APAA 1AR72 1DLLA 2RV9A 1RUG1 4COWA 5F1RA 2Y4UA 3O12A 4QXHA 1XMOO 1ZZ7A 1YQ8A 2KA3A 2XJVA 4GMP1 2JG9A 2BSKB 1SZTA 4AI2A 2VMGA 1PX4A 4IE0A 1XHXA 2AZ5A 4M00A 3SCGA 4O4LB 1WP7A 3HPLC 4FFGA 4ISQA 5FYIA 3FLPA 4MVMA 1H30A 4QHOA 3OGVA 3UV9A 2OTLV 3F7VC 5LBQA 4X6QB 2QZ3A 3BABA 3CYOA 2VL4A 3NNJA 1SLIA 3L9DA 4GKXA 2H0BA 1LOEA 3NJXA 1WLCA 3LEMA 3NJYA 1SBEA 4U7OA 4UFKA 3PDQA 4XFBA 5GZEA 5IYZB 4C90A 2YS8A 1L1FA 3E83A 2W1UA 2QWPB 1R1A3 3ZSLA 1EUUA 5KA5A 3ZN6A 5DG1A 4FPGA 2Q8CA 4DEVA 1RUC2 1OUXA 1GBGA 3A7QA 1Q6IA 1XMQO 4XAAA 5KMGA 4WM8C 1HNZB 3MAQA 3SJBC 2A5ZA 1RC6A 3VBUC 3CWBH 3UQ8A 5ACA3 1TG7A 5EIBC 1D0GA 3IDBB 1APNA 1EP0A 4MTGA 3CCJV 2JG8A 3ZOIA 2E51A 1SDWA 2RR11 2D6LX 4EFEA 5HCFA 3KV6A 1TME2 1GZCA 3QACA 4FI9A 3R05A 3THPA 2PHRA 3G7DA 5C3RA 4LK6A 3ZR6A 2ZR3A 1JW6A 3WB0A 3N35A 2ZE8A 1AJPA 4IGQA 4MVSA 4O2AA 3E35A 2A0LA 2VE1A 5LCWL 1ST8A 4YM0A 2VMHA 4Q29A 4LO7A 3FAVA 3B8MA 3A2FA 5CKNA 3LEKA 1O3SA 2AEYA 1GQHA 2V73A 5FZCA 2VQFO 1S0DA 4YG6A 4META 1MS5A 3WG2A 1S77D 1PP9H 1K73W 2VULA 2WNVB 2WZ8A 1GOFA 1IKPA 4OLLA 4N23A 1US2A 1BT8A 1H8HG 4YVWB 2WFPA 4E8DA 5KWRA 3SQOA 4HNAA 4KWJA 2XJRA 2Q67A 4X20B 3VHNA 1AI7A 4WFBV 3ZMTA 1XXNA 4LFAO 4YSFA 4NXNB 3BRCA 2SLIA 2Q69A 3ML0A 3TEYA 4LIVA 4Q4Y1 4MGSA 5A6XA 4X64O 1DZTA 4Y1UA 4EV0A 4Z2WA 2P17A 4LF9O 3K59A 3B77A 1V9U3 3KVBA 4Y5TA 1GRJA 4BW5A 4Q4W3 2E7QA 5FO7B 1RGSA 4XCAA 2DWDC 4CCMA 5JCOC 5C9AA 2CGPA 4ZONA 3VDCA 3J8F2 1EZVH 3B8NA 3O7OA 4IV3A 3GALA 4QGLA 4E4DX 2FZ2A 2WNUA 3ETQA 1E5IA 4QU2A 5DN6G 1AF9A 3ORJA 3HMYA 2Y6KA 4PELA 5IATA 1XEQA 5EFUA 4IETA 3SDLA 4LHKA 3AG1C 3BPZA 2UWBA 3EXAA 4F6RB 1YLLA 4NTXA 1RUG2 4CDWC 3LB9A 1SFPA 2C2AA 2C5DA 5DUUA 1IX9A 1DQ2A 2RE9A 3VBFB 2XXZA 1CVNA 5FZOB 4I5SA 2Y0IA 2JDUA 1AR83 1N0JA 4MXWA 3CJHA 1ZBA2 2BTQB 2XB6C 3DSQA 4KGGA 1NT2B 3R0RA 2F93B 3VUOA 1X82A 1HDJA 5LA9A 2W3JA 1S3JA 2JENA 3AZYA 4AL9A 3GZTB 1NKGA 1RUI1 2ZGLA 1RUOA 4JI8B 5F6KA 4XDKA 2JJ1G 3C7FA 5C33A 2HHHO 2Q5TA 1WMEA 3TEXA 2P2KA 2XKOA 4R9AA 3MFCA 3KGLA 4CA9A 4YW1A 4P9JA 3Q8AA 3PUIA 1F51A 3MUZ1 2MK3A 2JEXA 1UX6A 4EN6B 3LPFA 2JE7A 5IWFA 1OCOB 4JGSA 4O4HB 2ZNJA 5IVVA 1W2UA 3U1XA 1JYNA 3E5UA 3MW4A 3P6BA 1NLRA 4G3YC 5C6CA 1X36A 1HRV3 1QVFU 5JIAA 3A0NA 5KA6A 2X7RB 3OGIB 5A3OA 1VBA3 1V9U1 4B4QA 4CCJA 5FPUA 4L9BA 2JG8C 1ND2B 2WWJA 3B4SA 3WW3A 4PV1B 3FHAA 4JCKA 3OJBA 1OHFA 3LDBA 3IKWA 4YG3A 4MXVA 2NN8A 1AYN2 2XHNA 2D3RA 3E1F1 4WVWA 1HV0A 2LQTA 5C8YB 2WLIB 4NWVA 1DDLA 3ABMC 1O91A 3M3EA 3FB5C 4YW2A 3I2OA 4Z07A 5FP4A 1VMHA 3I3EA 5FYTA 5CBGA 2R042 2DYCA 2ZX2A 3I54A 3FB6C 5FV3A 1J95A 1OLMA 5BNNB 2BTOA 2B4KA 2CDYA 1ZX3A 2QDNA 3DEMA 2ZGOA 5JMOA 2D6MA 5BZBA 4OMCA 1UY2A 2BQPA 2QQWA 3B7MA 5T3NA 4ET7A 2JDHA 1U12A 1CAWA 4C7UA 2UURA 2P06A 3AKRA 2ZD9A 1WA6X 1NXD1 3ZYFA 4TV9B 4CU6A 1EN6A 2VW0A 3VZNA 2QZ2A 4HK9A 1CZSA 1RUI3 2D5HA 1IBKB 1W0JG 1PO22 2YU1A 3MFAA 1CAVA 1YJNV 4GJZA 3K5NA 2HWF3 3WD5A 3HKDA 1W6NA 4LF4O 3WG1A 1JQ0A 4WM8A 4LHSA 1R082 3AMQA 4YJ3B 1X9TA 1DBNA 3ZSMA 1RXFA 4NHLA 1VAVA 4CH3A 3FJSA 1MVQA 3STLC 4BQ4A 1JZ2A 1K45A 3I5DA 3DN7A 1HQNA 2C26A 4YFWA 4MG2A 5EYYA 2BRTA 2DQ3A 1PZ9A 4CP9A 3K08A 4W50A 2Q4SA 5GW7A 1AJQA 4DUWA 5JOWA 2HWE2 1QHDA 1N3OA 1PK6A 2BP6A 3RMXA 4CDQA 2Y6JA 1J84A 4UOJA 1PM4A 2YIBD 3O1MA 2FTKA 3KGZA 4D94A 1OCCC 2UUAO 3OAAG 3OMNB 5GZCA 2WNUB 4HL0A 5CB4A 4A7YA 3ZHVA 4JX0A 3LGRA 4NHKA 5G04L 1VB4A 4QM9A 3QCWA 4X1KB 3HWJA 2Q0OC 4DV7O 1NR1A 2YB7A 3ES4A 1FPOA 2P6JA 2AHYA 3VBFC 2W9XA 1HRI2 4DUVA 4A7KA 1N0NA 4I4TB 1FAFA 3C7HA 1PZ8A 3OM3B 1NH2B 5FZ1A 5JJEB 4E4ZA 2ZNIA 1VJ2A 2A6XA 1NA1B 4P30A 4M3CE 3LIHA 4PBPA 4QGNA 3KM5A 2JD4A 4Q4X2 5LB6A 2QQJA 2VO5A 2EX3A 2CL2A 1AJNA 3D82A 4Y4YA 1W0KG 4MSWC 2C9AA 3LEIA 1IQDC 4XYXA 2WN2A 2EIDA 2P4KA 5L3EA 2VMCA 3RT3C 4R8CA 2DMXA 5LA6A 1COV3 3GBWA 4FVVA 1PMJX 1FYJA 2VZRA 3VZOA 2Q73A 1AR4A 1DF5A 2OVUA 1C1FA 4AR2A 1NVPB 2IXLA 4IEZA 1SG3A 5FCCA 1GR3A 5JPNB 1A78A 1R64A 1AR81 1WW7A 1A6CA 3H1JH 4GKKO 2YUEA 3JAKA 3S3XA 2PAMA 1XQ8A 3N2GA 1RPRA 4YZ2A 2GZWA 3IIIA 3D36A 3VBRB 1HNXB 5LBEA 4B3SO 3DXRB 1ZZCA 3D0JA 1AYN3 4A2UA 1YYNA 1H2LA 2XHBA 1URXA 2Z42A 4PI0A 1GU3A 4GMP3 4NMIA 4MTXA 3SR2C 1RYYA 1YFUA 4O4LA 5FJHA 4K8RB 1OQDA 4QHZA 2PHXA 2Q1ZB 4YG0A 1BYHA 2Z4FA 3LCPA 3AYDA 3AZZA 5CKQA 2IJJA 1HXS1 4E4HA 4DR1O 5FMBA 1IBLB 2GC2A 2BV4A 4BB3A 1OMIA 1VRH3 1VBA1 3AYCA 1VRBA 4LHNA 5AVAA 5HPOA 2UWAA 4CC6A 5GTHZ 2YBSA 4AI3A 1Q8OA 5EHDA 3U37A 3RVHA 5LWBA 1CXZB 1OC1A 4KWKA 3M3CA 3IPVB 4PDMA 4YJ2B 4F4LA 4ZKIA 4CE8A 4I0XA 4TV9A 4GKKB 3GHNA 4HPKB 5E16A 3TNPB 2OPKA 1KECA 2LS6A 2Q7GA 1BQZA 2ZGPA 1WLDA 1XE0A 2C4XA 4MGTA 3ZYPA 4WCEV 1G9AA 2IXCA 5JXHA 4HPKA 5FYYA 4Y3OA 1KFXL 2WSSG 1U96A 4PA3A 2OQ7A 2QQVA 2IJIA 1HN1A 3Q8FA 2P3IA 1GH6A 2W6JG 2D6KA 1UIJA 4CH5A 1OBNA 1LNSA 1XNKA 5IDJA 2A6VA 1H6YA 2VM9A 5HFMA 4FPCA 1IG3A 2WO7A 4YM3A 2TEPA 1BCXA 5D5QA 3EFFK 4JKLA 1BCCH 4V2WA 4G28B 2QTSA 1UY0A 1V6KA 1QLNA 3OGSA 5JVDA 2YXLA 4DIQA 5C8CB 1NR7A 1SQ4A 4JKKA 2N74A 4N9HA 3STZC 1CAVB 4CUAA 1OCZB 2JGDB 3JZVA 1YJWV 2FCUA 3VBSB 1LHUA 5FPXA 3POSA 1RMU3 2QGNA 3UNPA 3ME2A 4IGGA 3KCYA 1N3QA 4DV7B 1G86A 2QTOA 1F8VA 4OQ8A 4GD4A 5IYDO 3IGAC 2Y4TA 1QKQA 3FBMA 4S2FA 1I5XA 1EN5A 4MADA 2XAGA 2WZR3 1A3KA 2VCAA 4MGQA 3RZJA 4PLMA 3CJXA 1LENA 5KHHA 1BGYH 3L73H 2ADQB 1JU4A 3HKBB 1VQ9V 3AVSA 3ZFFA 3CC4V 2OKXA 2LROA 4QQPA 5G05L 5CFDA 3SYCA 1XE8A 1QH6A 1MSDA 3JASA 1H2GA 1WPXA 3JYCA 3MF6A 2WABA 5AC93 3ZFGC 2HYKA 1U5YA 3ABKB 5B4XA 3AZVA 3U75A 5KXBA 1F4NA 5L19A 4KHPO 1D5AA 4CSWA 4DRRA 5KHGA 1JYCA 5J96B 3IMNA 2CGOA 1SQPH 4NB5A 1TUBB 1GMGA 3MW2A 1RUF2 4LFBO 3SC7X 5HBAA 3VBSC 4G4FA 3LSQA 3M99B 1WLWA 2LO1A 2WNOA 4A4AA 1LULA 5A33B 2CTPA 5LY1A 4I3GA 1IS5A 4MV2A 3KV4A 3OEAA 3RWRD 5FLJA 1B09A 4NIGA 1JOJA 3VBFA 3ZIAG 4AQ6A 2BGOA 4YZ3A 2Y48A 4HYOA 2ZAHA 4FM2A 5F3CA 2X6BA 3N7JA 2JJ2G 2QQUA 3H1LH 1VMJA 5I0RA 3ZRWA 1HNZO 2EIKB 3SPIA 1SS3A 4LUKA 3OEBA 2WNVC 3K4ZA 3TRSB 2BZDA 4IE4A 3LQCA 3WB1A 5JXGA 2ZBJA 2X5IA 3LSSA 4K21A 4B7EA 2I07B 1OUSA 1KYOF 2UXDB 2DWRA 1UZVA 1XPWA 2VOVA 2ODMA 3UM7A 3OUIA 1QNWA 3SH5A 4LH6A 2YI8A 3U0ZA 1YSCA 2ZIOA 4LNUB 1NS1A 1ZSPA 1DQ4A 2G4IA 4XETA 2EALA 3P3NA 1ZWIC 1QJEA 4OUEA 2DBIA 3MHHC 2X09A 1NE6A 2ZHNA 3ABMB 4CP1A 3ZDVA 5IJ9B 4HFSA 4H14A 4UUJC 4JGZC 5A7WB 2VCBA 3RQ0A 1RB8G 4JRAA 4MW8A 4P00B 1G9DA 1F31A 2EZOA 1FYUA 3IZOA 4NR1A 2DN9A 2Y60A 4P14A 1AVMA 4E4SA 3ZS8C 1V9PA 3GBGA 1WD3A 4FO9A 3I2FA 4KGQA 4A45A 4FPPA 2GNDA 3R6SA 3WINE 2XNDG 5C8YA 4CH6A 3WP5A 1W06A 2LRPA 3VD5A 3SNMA 3T4VA 3P5BA 4TSVA 2PMWB 2IWGB 3AXEA 1S2BA 4RAIA 3H3ZA 5C71A 3NQHA 3S5QA 4OX9B 1W99A 3B3QE 1CGPA 4K35A 4F8AA 2CTQA 1ZTEA 2P5OA 5FXWA 4P2ZA 2Z79A 5F39A 1AR91 3WZ1A 3ZXDA 1YUDA 2VUDA 4FLYA 4DR7O 1C4RA 4I0BA 4AW7A 5FY5A 1UAIA 5H5NA 5ANNA 3RI9A 2QQNA 1ASJ1 3SKVA 2LM3A 4BQXA 1BMFG 1VMFA 4ZU4A 3ZYHA 1RUH2 3NV1A 3RZMA 3IB3A 1VP6A 5BMVB 3C3VA 4IEPA 4CDUC 2J1VA 4BDVB 3BU0A 3T0DA 3KF5A 5H9RA 5FJKA 3RYFA 2PF4E 5J3UA 3WUDA 5GKAC 4X64B 5JLVA 2A7WA 4GWNA 4EN8B 4DR5O 2WFF2 4IUGA 3VBHB 2KXLA 4F83A 4B3SB 1JFFA 4WFAV 3NNGA 1NBMG 2FDIA 3O1RA 3MEPA 2LW8A 1G8MA 4LE3A 2WO3A 1GWKA 1X8EA 4IIJA 2LUWA 3R4DB 2N7GA 4NROA 3HBKA 4JGYB 5F3GA 3CU7A 4YYOA 3NJZA 3ABTA 2E7TA 1NZCA 1BSMA 3MW3A 1RUC3 3ETEA 2WZR2 3H1HH 2DDUA 3FKSG 3I2JA 4EWDA 5DDJ3 4FAGA 5KAIZ 2GUZA 3VZJA 2XL7A 4FLVA 3WB2A 4H7LA 3WNPA 5EC2C 4EEQA 5JIUA 2B39A 3D8CA 5EZYB 1W90A 2O14A 5L7OC 4JI4B 2AREA 1G6UA 5FDBA 3M7MX 1YZBA 2PYJA 2K46A 4M4PA 5IVFA 1CD3G 1DZRA 3DCQA 1O3RA 4QDQA 1JYVA 1R092 4EYUA 1P7BA 1QJY2 4HKOA 4QPIC 2UWCA 1PGW2 1WCKA 1MZFA 3WNLA 5LA6B 2WLHA 1PNGA 4JDOA 1SKVA 2ZM6B 1N32B 1KXGA 2WS92 4KFMA 5BNNC 2W08A 3AMMA 3DECA 3WEZA 4FFIA 2YZ4A 3CCRV 3TEZA 2YXHA 1F4AA 2XPJA 2BDRA 3KV5A 4S2GA 4FT8A 4XACA 1ZZ6A 3V0AA 2WLJA 3F5TA 4CS3A 4YW3A 2Z0AA 1JZ8A 1V55C 4GUNA 2RS52 1E5RA 1W39A 3A23A 5CEHA 1W6PA 5CA3A 2WUHA 3CPWU 4GX0A 5CBHA 1ZREA 3PU3A 4H33A 4A6OA 4HETA 3NJVA 2R16A 3HQXA 4GA9A 2DYSB 3G67A 1Q90D 1B35C 4B3RO 3E5QA 4BU2A 1DU3D 3SEEA 1FFXA 1TQ5A 2E5LB 4NN0A 1HXS3 3B93A 2ARBA 3ZXGA 4CS4A 4QPKA 5FZAA 1R1BA 3KCCA 2BOJA 5AG2A 1OD3A 2WL1A 1J3PA 5FY0A 2EINC 3I59B 2A9HA 3T2PA 2A3WA 1DQ1A 2UY8A 1RUC1 3ZHRA 4XMAA 1PMHX 1OV9A 5JDBA 2VG9A 4XILA 1AXYA 4Q8KA 4L0PA 1B3QA 1PZ7A 2CGNA 3JQWA 5C5UA 2W2IA 2OUJA 4JDNA 5L3CA 4B1MA 1EPWA 3ETPA 4R6ZA 1AJOA 2WC2A 5AC91 1S76D 2ID4A 3AK3A 1Z5WA 3ECQA 2QE7G 3VD9A 2WNEA 3Q4HB 3EXUA 4C91A 4CEYB 5GZGA 1SF9A 1HQWA 4QX5A 2F95B 4IYHA 4CUCA 1ENSA 4U3JB 3NL1A 5IYCO 4DV0B 3QNEA 2H0VA 1W9YA 1OFNA 1BEV2 1V6IA 1I3HA 2UY9A 2XOKG 2A79B 2B5UA 2Y69B 1OLRA 4DR2B 2QFEA 1CN1A 3RVYA 4W6YA 5FO8B 2GN3A 3LAGA 3D6EA 4WBNA 1YXWA 3AG3B 4CU8A 1TAEA 1KGYA 1REFA 4NYKA 3CXHF 2ZKLA 1RUD2 2CHHA 4E2GA 1GNYA 3FB8C 1JMKC 1WA8A 4FM1A 2ZX1A 5BNQA 1I08A 2VZ3A 3DTUB 2Y6GA 1J5EO 4PA6A 5JXJA 3DUIA 2HLDG 1FPN1 3QF7A 4YW5A 4CP9B 1BHAA 3TCUA 2WSUA 1KKDA 1RITA 1YO8A 4XHXA 3AJZA 1XE7A 5FOBB 2W95A 1KMIZ 3NVCA 4DR5B 4Y5Z0 5CBLA 4HANA 1BMV1 1VQ5V 1HRI3 3MYXA 2EIJB 5FLXN 1LTEA 1JYTA 4YZ1A 3L2HA 4P9YA 1VBC2 3I7DA 1BL8A 2OX0A 3VKLA 4XABA 4PIZA 1NA1A 5D1IA 3CCMV 4DY3A 2PHFA 3VHOA 2W47A 4UWDA 2IM9A 1MQTC 1RINA 3RYIB 4XBNA 1U97A 2ADEA 4CP2A 1G7YA 3WV6A 3I2HA 4TWTA 2GH2A 1A32A 2PZSA 2LW1A 4TXWA 1OCZC 3SYPA 2R0HA 4XFGA 1RHI2 3UT0A 4FMTA 2GC1A 2GMEA 4P02B 3N9OA 3MIGA 1MZEA 3AZXA 3VKNA 1H1AA 3RYHA 1EBOA 2AC1A 2A3QA 2VXRA 4Q1RA 4CXYA 1EAH1 4E2LA 4XTMA 3EHBB 4XFHA 4MVQA 5BNOA 1RUD3 1YJKA 2UU8A 4D6RA 4DUZB 5IAVA 4ZI7A 2BNNA 4BQ2A 3CRAA 2YXYA 2DU0A 2QR4A 1FMD1 2PXJA 1LOFC 5JI7A 2DF7A 1HWYA 4DR3B 1MMMA 1SACA 4CPBA 1MA1A 2L9LA 3POYA 4Y22B 4LO6B 4XJ8A 3KT7A 1IXBA 3GCXA 4I3PA 1L8DA 1VIWB 4LK7A 1R091 3OMIB 2VXJA 1F23A 4G27B 4DW1A 3IC9A 2FD8A 1XNDA 4Y1YA 4UFMA 1CESA 3RGBA 4YHHO 1UY1A 2BUKA 5GLTA 2QM4A 1OCRB 4W4LA 1NLQA 5D2AA 5IFTA 3AP6A 3U10A 1NQDA 1W6QA 2F4VO 1B04A 4LKFA 4N43B 2HWB1 2F4PA 4AEDA 4XEZA 3U4XA 3FLRA 1UMHA 1PIV3 5JPMB 3THOA 1O8PA 3UYJA 3ST7A 2LP7A 5J7MA 3IPVA 2DU1A 3ZCCA 4D7YA 4RQPC 4OYUA 5CIRA 1GP4A 3IMMA 4IHJA 1UMZA 3CS5A 4YZ5A 3AB0A 2ZKOA 1MEC3 1OKQA 3NNLA 1SMVA 1PX3A 1DP0A 3IIAA 1NZIA 2VC9A 3TAYA 1YEWA 4JC1A 2EIKC 1COWG 1HRV2 2Q8VA 4LFCB 1UFIA 1X9PA 3LE0A 2Z69A 4UW6A 4QGMA 4NPMA 5L3BA 3OUSA 2IUWA 1XBFA 1LHVA 1O4YA 4JV5B 1AYM3 2BTVC 1S0JA 5FYBA 4NIIA 5DMYA 3ZFGA 3FYIB 4BXFA 5K1PA 1RMU2 1WCQA 1W04A 5FZBA 4JHZA 1X7NA 3AKSA 2ZGMA 1FNZA 4KG8A 1JUHA 3DKQA 4JI5O 1KP3A 5GTIZ 5DUVA 2PLV3 1I0HA 3GF6A 2WS93 3SJAC 4WBNB 3NAPC 1I94O 4LWSA 1CPYA 2W94A 5H6RA 4D8MA 1GAXA 1SQFA 4LBQB 1XHZA 2BVBA 5FZ8A 2XT9A 3UT5A 3POFA 4XBFA 4BIUA 1YIPA 1SCSA 3RYIA 1RP3B 5HFLA 1HIXA 2O8QA 4QWNA 4CTEA 2QQKA 3ZJZA 2C24A 4NXNO 2XLFA 4M01A 5KXEA 3RJRA 4GB33 2QKAA 3PVNA 1C8M2 4OMDA 2OXBA 3LDDA 1YJ9V 1BK1A 5BR8B 2XBO2 2B9ZA 3E89A 5BY5A 1FT9A 5A3WA 1WZXA 2AGSA 3PVEA 1XB9A 1ENRA 2W92A 1FOD1 4PDVA 1VAKA 4C1XA 3WG4A 4Q4X1 3MUY1 1RM1C 4EZHA 5FZKA 3F95A 2QQMA 1K4DC 1QXRA 3BTXA 4Y4RA 3RN4A 3S6PA 5FP8A 4GXLA 1DF0A 2YROA 2HEVF 3K2OA 4ARYA 2AENA 5CFDB 3AC0A 4DR3O 3LKJA 3THDA 1PVC2 3IWZA 4FVMA 2MPFA 4QNHB 4AEMA 2NZ9A 4NRMA 2HEWF 4CBCA 2WR9A 5FPZA 3BU7A 1Q6HA 5C4WB 2WQ4A 5A3PA 2D7FA 1AR1B 3AP5A 4ZPIA 2WQZC 2I74A 2R1BA 1N8RW 3AMHA 3A4UA 4IW3A 4LPLA 4C8DA 3HEIA 4LQRA 5EWSA 3D5OA 4CP0A 2QTWB 5JCTA 2WFF3 1VQPV 1O5LA 3WNKA 2GUZB 5E1RA 2ZPXA 4JZ2A 4N7IA 5L9VA 2L6LA 2OUHA 4MW3A 5B3SB 1H9WA 1IS4A 4BLIA 1YHFA 1K4CC 3T1LA 1GK9A 4FLXA 4P5YA 2V72A 1XNQB 5A1FA 1YXBA 1XMQB 5IWAO 3PUAA 1XJAA 4LFCO 1RUH3 4O4IA 1PO11 3NO8A 4YY3B 3OY8A 4E4EA 3WP6A 2QQPA 2ET7A 2JDZA 2HWD1 2NNUA 5FTTC 3HVDA 1N1YA 2ARCA 1FXVA 3OUHA 3SKJE 3VBUB 2XVLA 1OCRC 1S5HC 3N9QA 4EJRA 4R7CA 3J81N 3W9AA 3K77A 2QUOA 4O2BB 2VZSA 1OPMA 4GKJB 2CAVA 4Q0VA 4QD2A 3I3QA 1SBDA 1VIBA 4Y33A 2QKCA 5FXXA 4ZOLB 5DAVA 1KJLA 3LDEA 5C8CA 3ZKUA 1VQ7V 2G9ZA 1VLNA 4X1IB 3IDAA 5JUVA 1UCXA 3E22A 4UCUA 4IYIA 3OCPA 1AXZA 3S30A 2ZINA 1WCDJ 4MH0E 4NRPA 4AAPA 5EIYB 1XILA 3RYKA 3POIA 1PGL1 5I8SA 4MT8A 3O1OA 1TE1B 1U5XA 2KSDA 1PV0A 2AXTZ 4MX3A 4XMIA 5K0UC 3E8GA 1IVSA 2P90A 3HKBA 4J11A 3E8HA 3QG5A 5BXZA 2MEV3 5FZLA 1GKFA 2J1TA 3IT8A 3KS7A 3IAQA 3RNSA 4ASMB 2VQUA 4MGZE 3SYQA 4JI2O 2RNBA 2A6WA 2ZGNA 4RHV3 4P9PA 5CG8A 2WAMA 1VBC3 3K4DA 5FPOA 3SPJA 1W28A 2IW5A 5BNNA 1U5IA 4DO2A 5CFDC 3E6CC 3WFVA 2VUAA 1YI9A 1GSLA 3JSNA 3BCWA 2X8KA 4GULA 5A7OA 2EIMB 1UXXX 4NHXA 4XJAA 4WV8A 2G19A 3K3NA 4KI5M 4PDWB 4RA0A 2M7WA 5CVRA 4TN7A 3V65A 3AMNA 2ITCC 3J7MA 1SA0B 2UXXA 5LA2A 1L0LH 1D2SA 2Q8EA 2RHPA 3QH7A 3VD7A 3O5SA 3R66A 2WINB 5CG9A 1T6BX 4LC1A 3ACFA 3H1WA 3K57A 2XOMA 1PL4A 1LOBA 4OPHA 2DYSC 1DFQA 1CX4A 3ZFEC 3I55V 1DGRN 4KU7A 3WUCA 5FMCA 2DVAA 3THTA 3C90A 2JK5C 3I2GA 1QLEB 5BPXA 1Y6XA 2DVDA 4B7KA 1KEXA 4QM8A 3K06A 3SPGA 1JBCA 5BR8O 2XUEA 1C3HA 1GMMA 1NT0A 4MVRA 2EIMC 1FPN3 2BNOA 2ZX4A 1RUJ2 3OUFA 4ZS3A 4BXSV 4R8HA 2BFUL 1IURA 2YC4A 1GLHA 3HBZA 4DS0A 5K4LA 3GWKC 1DHKB 5C8CC 4LBLA 1UY4A 2OT7A 1BJQA 2UXDO 1TGOA 2E63A 4ZXKA 3BI3A 2Y6LA 2PGGA 4RR3B 1YF2A 4DRXA 2NP0A 4F6RA 2X53S 5FZ9A 1W2NA 1XOUA 1UZYA 3WX5A 3EQEA 3ZRVA 1LESA 4AGVA 2RN9A 1W6OA 4Q4Y2 1TMF2 2RS32 4K40A 4XDOA 4DV5B 1QU0A 2W1QA 4KBZA 4H0LB 5FFOC 1BS3A 4L11A 5A7WA 2WLNA 3N9LA 2WO2A 1XNTA 1JZ4A 1VBE3 4OZXA 2ARAA 3KHCA 4AFAA 1QU7A 2YEVA 2A75A 5JWPA 1H6XA 1QQP1 2JE9A 5LGTA 1GQPA 2RVAA 1WLTA 1DGWA 1H9PA 3F7YC 4LNUA 1PK6C 5T52A 2ERFA 1W6OB 3AKQA 4JZGA 1RUNA 1C8NA 3MLJA 1LUVA 4UVAA 4EZ4A 2FDKA 1NTMH 4UVBA 2XBO3 1RFYA 2WWUA 4R9DA 4FFBA 4H3WA 3P1IA 2VR4A 1UYXA 4XOGA 4DB5A 3DPRB 5LL6Y 2B46X 1ASJ2 5A3MA 3DXTA 5IYBO 1GN2A 2HBTA 2HWC2 2HWC1 1NCRC 3ZSKA 4HVQA 2JDAA 2UYAA 3SEPA 2X29A 1NQJA 1OSGA 5B3SC 5IT9N 3P32A 3G6JB 1Q8IA 4EWAA 4K8XA 1W8TA 2XHKA 3GZUC 5IYZA 5FPLA 3OUJA 1FMD2 1FD9A 3UESA 2VMDA 3VKOA 1J1LA 1WPBA 3JD3A 3HJRA 1GOGA 1DLBA 5DEDA 4LR3A 1KRIA 2P3JA 3TEWA 4Y1XA 3BB6A 3HNBM 3BIWE 5FYZA 1O7FA 3RYPA 1AL0G 1Y9GA 2D2CB 2DUQA 4E2SA 2XQXA 4MGIE 3S7IA 4GWMA 2X5IB 2MW2B 1VBE2 5FY7A 1QCEA 2VH9A 2DURA 3WY6A 3T1MA 1XYPA 5IVYA 2A06H 2QQOA 1R3JC 1Q5OA 3Q9OA 4OUSA 2V4AA 1GN6A 2HKOA 3CCEV 5LMUO 3QO8A 3OB8A 4PCRA 1V6JA 4H55A 2A7AA 1H8VA 1WB8A 3CRMA 1ULOA 4IIJB 4JYAO 1NLSA 1QDOA 5ISLA 1CAWB 3L70H 1R73A 1CJDA 5I8TA 1UY3A 2R6QA 4XC9A 2JX9A 4NIAA 4DV6B 4B3MO 4E8CA 3R4SA 4G2KA 1EPZA 4Q4V3 3MDSA 4BIZA 3RYCB 5LGNA 3ZSEA 2O0OA 3DGTA 3NV2A 1STMA 4Y5SA 3KZIZ 1V6NA 4GLXA 3LNNA 4AHYA 2GSMB 2EILC 2SBAA 1Q8QA 1NCRB 1IBMB 4RQPB 3ENRA 3K0DA 1XI1A 4I2OA 2ORZA 3ASNC 3USUA 4OGQB 4LEJA 3RYRA 5C3PA 3VD3A 3ZYIB 3PJQA 4LF7B 3AFKA 2WLQA 2R9AA 3SMHA 2A70A 2P3KA 1BK0A 3UGHA 2VBDA 3VDDB 1HP8A 4Q4V2 1C5HA 1JOPA 1RIRA 4FPHA 4AI8A 3AZWA 3E8BA 1HNWO 2LTNA 1PO21 5FXZA 3K4AA 4J7JA 4YIPA 1EAH2 4KBBA 1J5EB 2E33A 1KS5A 1QJX2 5CISA 2A3YA 3AK1A 2E53A 3K9AA 4R9CA 1WKYA 5BNOC 4NIDA 1F5JA 4WZFA 4CUGA 3VOUA 2QNKA 1KQSU 3J7NA 2XAJA 3KSCA 4LO4B 1UN1A 4Q4X3 1IDSA 2XVKA 2AGAA 2NM1A 3TN91 4XAEA 2NR5A 2J7MA 4ZZ5A 4Q20A 4FIPC 1UOBA 4NPLA 3V64A 2K9PA 2ZXQA 2GU9A 1QOSA 1JN2P 4LE4A 4HONA 3FL7A 3JAKB 5HXVA 3THCA 2WDBA 3VQXA 1GYKA 2E31A 3VB9A 3M8LA 4AVSA 1SLLA 3AMPA 1RSOB 2ZX3A 5FNVB 5JJNB 4O65A 1N34B 2QCSB 3H1KH 4XFIA 1REEA 4DK1A 4RGAA 5DM6V 4M3CB 1PGL2 4TQDA 3LPGA 1JZ5A 1Q81W 2RJ2A 2XJPA 4R4ZA 2WJSA 4RWUA 2VQEO 2HWE3 4UFLA 3Q8BA 4LR4A 2VQTA 1R3KC 1ODMA 5T54A 4MVOA 3DF0A 1YIFA 1RXGA 5LATA 4J25A 4CDQC 1QJX1 3ILRA 3NV4A 1R083 4NVPA 3T2QA 2BCCH 3B00A 4K3AA 2KG7B 3SLIA 4BZ4A 2Y6FA 1BEV1 4ARXA 2XUMA 1RUI2 5JJJB 2P67A 5E1AC 1MS9A 2XGXA 2KG7A 1EV11 4K8FA 1AI4A 1FOD3 1FXKB 4WFGA 3AVRA 4RYDA 5FYSA 5A9GA 5C70A 3AL6A 3FMGA 5F32A 2VRZA 3QVNA 3K5LA 5CFCA 4Q4Y3 1J1TA 1HV1A 3BN6A 5J2TB 1PGW1 3C7GA 1NTKH 2VVEA 2VWJA 5FYHA 1K3IA 5JOZA 1VBC1 4YVWA 1LGNA 3NKTA 4RN5A 1N1SA 4WM7C 2FBEA 1SCRA 5IW0A 4LOTA 5KUKA 2D6NA 3WSOA 3JD2A 1SEFA 3Q4HA 2IXKA 3LA3A 4BLJA 1LU1A 2V4VA 2OIEA 2B45X 4KNCA 1S5JA 1DGLA 1Q6UA 1RHI1 4FZ0A 1UWWA 3J26N 4U3JA 5LOVB 5FZEA 4BWOA 3KCXA 4K3UA 5EQUA 3JARB 4IQPA 1YHQV 4HVRA 1R6KA 2RCVA 3OSDA 3OR6C 4OVEA 2IH1C 1CEZA 1DQ0A 2ZT9B 5FBJA 4L97A 4K0KB 5A2QN 3VQWA 2RS51 4JV4A 3B09A 4XZPA 3LEGA 1PNKA 3OMAB 2HVKC 1HXS2 1ZRFA 1LOFA 1O9HA 2JGDA 2C1FA 4XFFA 1B35B 4HN1A 1UKGA 3UGGA 3SYOA 3BCCH 2XONA 2NN4A 1IZ3A 1XNQO 4LFBB 4EB6A 3WDYA 2XLAA 3ZN5A 4V1PA 4KWLA 5D5PA 3W21A 1THZA 4CDQB 3AX4A 2TNFA 3AG3C 1AI5A 3HOBA 2ZE6A 3BUCA 2OT5A 2P6CA 4EKWA 4LWSB 1XSRA 5DG2A 5GZFA 1LRHA 4AQ2A 4RS5C 3RZLA 4QPYA 4QJFB 3BPSA 1O3QA 1QQP3 3WLUA 1AL21 3CB2A 4P9OA 4OPAA 1D7PM 3AEIA 3E5XA 2EIEA 3QLQA 1ND2C 3T09A 1UU6A 4BISA 1F7YA 3GZAA 1HDKA 2BBAA 2PQQA 4XE9A 4BIOA 1WCSA 2VNRA 3D3QA 1WN7A 2YMZA 4QPJA 3UKMA 1Y7BA 4GKYA 2JDKA 4CCEA 4L8JA 4WVVA 5DPNA 1OKOA 2VNOA 2WA4A 5A7PA 1Y3TA 4B8EA 5IK5A 4JQTA 4CH4A 3LUTB 1ZL8A 2CH7A 3OTOB 2VZOA 4QB2A 3PMEA 5I0UA 1K5JA 5JOXA 1M4UA 4JI1O 5FLIA 1GV9A 2E6VA 4UYBA 3HN1A 1GWLA 4GZRB 4PF1A 4LF7O 1Y4MA 5IK7A 5FZ7A 4DV3O 3H7YA 3TYJA 1N1TA 3CMAV 3VHPA 4MYEA 1AR61 2RDCA 5J98B 2D3SA 4ISRA 1H38A 2B8MA 1M4WA 5L3FA 2XR4A 1MS4A 5IK8A 4IEYA 1VB2A 3BAAA 1XC6A 1F15A 3E6DA 1FS0G 2B1IA 2EIGA 2ORXA 4RS5B 4PF5A 2AACA 3D4KA 3MICA 2HP8A 4W4KA 1W3VA 1QQCA 1Q7YW 3VBBA 1NCQB 4FXGB 1SLBA 4C0HA 5IVJA 2XL9A 4IEQA 1XNRO 2HWB2 5FPVA 2XMLA 4NXMO 5ABJA 2CDPA 1XDCA 4X88A 4ZOLA 1RJ7A 1RUH1 3RZHA 4JYAB 3O1SA 1M9NA 3DPRA 3GBFA 3IBMA 3P30A 2E3CA 1KUQA 1ULFA 2W6IG 3G6EV 5C3OA 4JI2B 4B29A 3C7OA 5IE9A 1OJHA 2Q8OA 2V5YA 4YM1A 4GCZA 2R72A 4N53C 3LD8A 3EYPA 2DCTA 4XUQA 4XDQA 1M56C 3MLLA 4FOQA 2VQFB 4Q0QA 4DQAA 2Q7EA 4MGKE 5J2TA 3K48A 2QDOA 1H8TA 1OA3A 1PPJH 2BE3A 4A6SA 1BBT1 5B1BC 3MV01 3ELNA 1COV2 3AG2B 4YM2A 3LNMB 2OYZA 3ZPOA 1E57A 4MLOA 4BQ5A 5FKBA 4EFBA 4I01A 4EQVA 4CDXC 4ZIBA 2Q0AA 2BOBC 4X8PA 1D5NA 1AROP 5CFCB 3BY6A 3J7LA 4XF4A 4XTPA 1VBD1 5CZKA 1VBD2 1RMU1 4KWUA 3OEEG 3T1HO 2RJLA 4JKMA 5L3DA 2K2SA 2QJVA 4N53B 4LKEA 1Z5VA 1RVF3 5BUVA 1GFF2 2D43A 4AHXA 1VQOV 3DC6A 1RHI3 5D8AC 2ZX0A 5DN2A 5DECA 4Z1MG 4CEYA 2OWOA 4UXNA 5JMCA 1GN3A 1SQVH 2YDEA 3CE2A 3UL2A 1M93A 1SESA 4JQRA 4L92A 4OI2A 1PVXA 3WDWA 4ZXEA 3OBTA 4Y26A 5KR7A 4LBNA 4LJHA 4DO0A 4X1KA 3OPTA 1PK6B 4LOSA 4J7KA 3I3BA 5LHIA 5L7OA 1CPMA 4XBLA 3G4SV 1K5QA 1QHTA 3NMBA 1GQGA 1W8UA 4M0HA 2R30A 5DDJ1 1C57A 1POV1 1GP5A 3WQ1A 5EZWA 1NE4A 5M0TA 4GALA 2VNVA 2ZAAA 1Q43A 5FO9B 2HWF2 5KHIA 4P9XA 4Y20A 2ARHA 4D69A 3WQ7A 5BNPC 2YV8A 4R9BA 3TWIA 3PLQA 3B94A 3ZPYA 1OF4A 3APOA 3AK2A 4A7ZA 1JXNA 1MS3A 5F8PA 3ZXLA 3LOBA 1OHHG 2OCHA 4ZHNA 4M3CF 1TMF3 2RS33 3I2IA 3KG2A 2WLLA 3OYWA 1QMJA 4K9SA 2EINB 3U4SA 3T2MA 1Z0HA 2BWCA 3DXUA 1OOPA 1E1QG 3V0BA 3UETA 2P5BA 5FRAA 4RQFA 1QJU3 2V7QG 1W2BU 3HPNA 2R073 2OA2A 1UW8A 2R062 4ICGA 2QVSB 5H9CA 3ZN4A 2CH7B 5FK7A 1GANA 5CNAA 4NUBA 2E76B 2VBPA 4RS5A 1P4RA 2RJKA 2Q4PA 4B08A 2JIJA 3J7AU 1Q8SA 1RUJ3 3VKMA 2W39A 2R072 5LEKA 3B5LB 3LSUA 3H3LA 4DXWA 2JDIG 4A41A 3U07A 3N9NA 2EIBA 1HJFA 4QKNA 1W0PA 4DV2B 3WDXA 4DUZO 2AUYA 1D4VB 3MLKA 4AYUA 3VKFC 2GNTA 4YPJA 4IV1C 3CF6E 2WWSA 4LA3A 1W6PB 3JAWB 4YJ2A 1ENQA 2WLMA 2PI5A 3FUQA 4QPGB 3TETA 1W2OA 2JG8B 4AAXA 2JB4A 4HOOA 3APQA 1J83A 5FP7A 3W59A 3KQ4B 5EYXA 1OLQA 2ARXA 2GN7A 1C28A 4EN7B 4D6TH 4JV5O 1NYWA 3SXWA 2KD7A 2PN5A 3GNEA 1O6UA 1UZWA 4DUYO 2XJQA 4ZZ8A 2VY0A 1EV12 5F5QA 3MF9A 1K5MC 4CDXB 3ILNA 4HKWA 3HR0A 1K97A 2LJ2A 3WP3A 5IVBA 1NUKA 1M06G 2Y38A 2VW2A 5CMUA 3W20A 4AGGA 5B1AB 3H8XA 3AM2A 4X1YA 4QPWA 2HWD3 5FL7G 2C0ZA 2W5FA 1J58A 3RYFB 3BVOA 1TVKA 1HB3A 1QJY3 2Y6HA 3VBSA 4I0WB 2GAUA 4RHV2 4AQTA 5A3TA 4ZU5A 3HIFA 4DW0A 1TNRA 5K0UB 4HZFA 4HSLA 5H9QA 2X6CA 1NA1C 1KS4A 2QM7A 1JZ3A 3M7AA 4K1YA 4DMIA 1V54C 4AQYB 2RMU2 3VZKA 1GM9A 4TUYA 1S0GA 4NOTA 3JQXA 4NJ4A 1UKRA 2OIGA 1BZKA 1HX6A 1AVBA 1WBLA 3ZR5A 4Q4W1 4UCRA 5A6QA 2FQPA 3U78A 3N7KA 1AI6A 4CDUA 3FLTA 4UW5A 2ZR2A 3B9CA 1WA8B 2GC0A 5IUQA 1NH2D 2V4DA 5BNPA 3HT1A 4XURA 4WFEA 1NVPD 3T2TA 1GZ9A 4IV3B 3JATB 5F3IA 1FJGO 3HD8B 3CHXA 2NYYA 4FPYA 3N4MA 3T4HB 1QWRA 4BPZA 1GP6A 2XKPA 1J59A 4NHYA 4N21A 4ZHQA 1AR63 2W68A 4OXSA 1YITV 1LHNA 2UUCO 1Q3EA 1CR7A 2XG3A 2JRIA 2VOXA 3ZYJB 3B02A 3ZXJA 4DR6B 1M57C 1WUVA 3ICXA 3MPBA 4COYA 3K58A 4Q0SA 2JIGA 4YVSC 3OGGA 5H2FZ 3DYOA 1W2AX 5IJRA 4AVAA 5JH7A 2EBOA 2NPIA 4ZS2A 1DIWA 3IDCB 3HKEB 1PO13 4DR1B 1UZZA 4QMAA 2VCCA 3ZHSA 5T5OA 4B4RA 2FB5A 4IESA 1KC8W 2CV6A 4NRQA 1ZRIA 4IGPA 1JODA 4DRVA 4DXSA 3ZRWB 3JSLA 4YARA 1D2QA 2FMDA 5D8AA 5JCOA 4DK0A 1CONA 2VBBA 2XLGA 2I45A 3T0AA 4UCOA 5FUIA 3QO7A 3LFMA 2JWPA 4BE3A 1OLME 3VHRA 5A7NA 1QR8A 4XUPA 3WVJA 2HHHB 3EO6A 5JSOA 4PIYA 3OW2U 3RWNA 3TN93 1SDDB 2PHDA 2WIIB 3NW4A 4Z92B 2XAFA 4BW9A 2IVIB 3HT2A 5DZFA 2FKXA 5I0DA 1ALYA 3E6BA 4GWJA 3JBG1 4BM8A 2X10A 4FFFA 1BVVA 1S0CA 4H37A 1YIJV 1S0FA 5FZ6A 5FYCA 3TK1A 2YICA 1RSOA 4DV4B 1SQBH 1UU4A 3MO4A 4O2AB 4MZUA 1W3XA 5C3QA 3J80N 1LECA 4JI6B 3ALQA 1R1A1 1K5SA 2GBOA 4HKLA 1VRH1 4HZ3A 3VBHC 4LA2A 4DV1O 4QKBA 1NCQA 1FXKA 1SLCA 3AKTA 1NJIW 1DZQA 3RW0A 2D93A 4JTNA 3VBOB 5KLVH 1VQKV 2WBKA 3PJYA 4DNYA 1JVMA 4FTEA 3WCRA 2HWE1 3HKCA 3PN1A 1TEIA 3PU8A 3WDVA 1LAJA 1JZ7A 2A71A 3PNAA 1BBT2 4QU1A 5CB7A 3QBQA 3ZXFA 3POWA 1Y9QA 1RVF1 5JI9A 3JATA 5H6QA 3ACHA 4H7MA 1VPHA 3KT1A 2RJZA 1GUIA 1W8WA 3OD4A 1P7GA 3OPZA 4CS2A 1ASJ3 4FFHA 4WVMA 1U5ZA 2FCVA 2D6OX 1N36O 4AEKA 4OQ9A 4LH7A 2W1SA 3B2EE 1N34O 4RFRB 4BQWA 2YI9A 1PM9A 2WO1A 5BV6A 1AJKA 1V0AA 3FZ3A 1G8WA 4QT6A 4LUMA 4QHBA 4YZ4A 4FLZA 2EJ7A 3OPWA 4X62O 4TLFA 2JGUA 4O9GA 1H8TC 2ZIMA 2P37A 3ZN0A 3KQRA 1AR5A 1FFXB 1H1MA 5H9PA 1NCRA 1VF7A 3FFZA 1K7DA 2RDRA 4B3TB 5IJ0B 3ABKC 2J1UA 5GLUA 1VRH2 1JJ2U 4JI4O 1CZTA 3DC5A 5GLWA 5IJ0A 3SH3A 3VBOC 1JI6A 2VQ0A 1T6GC 5LYJA 4HG6B 2ZEXA 1BE3H 3MIDA 2XASA 1AYN1 3CJHB 5JVDB 4MXWB 3WW2A 3I8TA 2P7TC 5C5TA 3OE7G 1COV1 3KVAA 4BMEA 4YXWG 2PAKA 2R043 4JPRA 2UXBO 3H7JA 5J2UB 3A0KA 4UFIA 3BODA 1X50A 4NO4A 1W59A 4COUA 5JSRA 4LLFA 3WG3A 2WLKA 3B69A 5T5PA 4Y1ZA 5J09A 4URTA 1D4M1 3NAPB 2Z3YA 1QF3A 2RMU1 2JVDA 2PQSA 1G9FA 2JICA 1RL3A 2BSKA 2NQYA 3W5MA 1NQTA 2WWWA 2QWOB 1DGWX 2QKDA 3O1VA 2JJ6A 4I50A 2GMPA 1OCCB 4OFGA 5LMNO 3ZFEA 2PI4A 4PBOA 2Q6AA 2Y0OA 2XJTA 2IXHA 1YTFB 1NXMA 5J37A 2RDQA 2ZOEB 2GSYA 2BTQA 4E9KA 1B35A 2EXHA 1SZBA 3OEHG 3ZEDA 2ILMA 4XJZA 1SQQH 2BU9A 4DV1B 4J9ZB 4Z8BA 4EB6B 3ZFFC 1VQLV 4DUXA 5FZMA 1VF6A 5IAXA 1JYWA 2B7YA 1Y43B 4BOWA 3PURA 1SHWB 3C3TA 4YW4A 5LEJA 3ZX7A 3NNMA 5IHRA 1YFWA 1KBHA 4NTWA 2ENRA 1MR5A 1LKNA 3LA7A 5EJZB 1YC61 2F4VB 3K5MA 3OTOO 3UKTA 3R65A 3WNMA 1W0NA 4PQQA 1DYOA 3G71V 3T1YO 3ZLIA 1Q86W 1IXMA 3HQUA 2ZGRA 1UYYA 3CQOA 2IXIA 4LXLA 1GWMA 4HSJA 1UYPA 4LIUA 1V6LA 4LBMA 3VL8A 4O4IB 3WHTA 1V6MA 1EN4A 4XF3A 4ORFA 4F6EA 1NY72 4BA6A 3KD4A 3WXPA 4SBVA 3ZRSA 5J1XA 1IPKA 3N36A 5FOJB 2DBNA 1AP5A 1L7RA 1DGSA 5JH7B 4AZZA 4UI9L 5C3SA 5K1XA 2RS12 4BWAA 5FXVA 1UL9A 1W0OA 3FX3A 1O4ZA 2EA7A 4N8MA 3VBOA 4XF9A 4UF0A 2WNVA 2YUAA 1TNFA 4LNVA 2KR2A 5LRRA 3M3IA 3KZ4C 4HLTA 1IKQA 2VMIA 2EJRA 3B01A 4OHYA 5F9TA 2ZJCA 4XDLA 3VBRC 1K42A 4XCBA 4FFBB 4JAAA 2DQ0A 4CCLA 1EUTA 5I0TA 4PI2A 1RUE3 1XL6A 2W0FC 1L3JA 3ZIWA 3X2QC 1QJY1 4OI1A 3ZYGA 3H8RA 2ADDA 3AP9A 1I94B 3PUSA 5L73A 1XNAA 1N3PA 2ETNA 5FMDA 3MPPG 4JTCB 2BOCC 5LMNB 3A21A 2Y34A 5JVVA 3WT3A 5CN0A 3DKWA 3NNFA 5BY1A 4DXTA 4AEDB 3WG7C 3MIBA 3ACIA 4S2HA 1Q56A 3OG2A 4SLIA 2H6CA 1I7FA 4UW4A 2PYLA 4JGYC 4HMZA 4FOVA 5EV7A 1UXZA 4CDWA 1X4TA 2Z5UA 5DAPA 4IT5A 5H9SA 3S3WA 3H9AA 3T0BA 2I2SA 2D6PA 2HWB3 3RZKA 3BA9A 5F37A 1S0IA 4XW3A 1AYM1 4ABMA 5AC92 5J2UA 1S72V 3EBRA 4N53A 5J36A 4LBQA 4GH4C 1PKXA 1PGSA 5FZ3A 1VBA2 1RUE2 2TBVA 5KC5A 4CDUB 4P9GA 4I55B 3RG0A 4S2DA 4XFCA 3SJCC 4YWAA 5ACA2 4X65B 2YXSA 1FNYA 2DCJA 2VOWA 1TA8A 3SHRA 5HCBA 2PA7A 4XJWA 2E74B 4W6WA 2J42A 3AFGA 2VOKA 4AWDA 2GH8A 5A33A 4BQYA 5T5JA 3GZEA 5CA1B 1VQ6V 4KQ7A 4CCDA 3CCQV 4XPVA 4OX9O 4ZI7B 3SPHA 1SPPA 4FLWA 1CIYA 2DVFA 4DV2O 2HYXA 1Y66A 4PD4F 5CA1A 4LF6O 4PQ9A 2E75B 2VMFA 1POV0 4MGYE 5HCHA 3DV8A 1YI7A 1C8M3 4IEXA 5F7UA 4YNIA 4GB32 3L9JT 4AFDA 3RI8A 1RUE1 1AR82 1C1LA 2QE3A 5L3GA 3ZFFB 4WVZA 1AR71 1MQTA 1ZL8B 1V54B 1W9WA 3D0SA 3S0MA 2UXCO 4UCVA 2N05A 1L7LA 3JASB 2QWNB 3OT7A 2KQXA 4B3RB 2WS91 4JYBA 1WA4A 4JYCA 3TB0A 4L99A 3I49A 4F3JA 4O4HA 4CYDA 5HV4A 2PFWA 1QQP2 3ZBHA 3WF2A 2ZDIA 2WAOA 5EYPA 3JAMN 4CCCA 3O0WA 5AFEA 5LGUA 1RTVA 3CCSV 1W8ZA 4OI0A 2G9FA 1NG0A 1EV13 5KX5A 1VP7A 5JR2A 2H6BA 5LP6C 2JE8A 5JZGC 4FOWA 1QDCA 2XAHA 3RSJA 4AHCA 4QDRA 2RDNA 1ZBE3 2IFWA 5KX5B 2WZPP 3GB7C 1YQCA 1OVPA 1K9MW 4KG0A 5DAXA 5DQ0A 4LO5B 1ND2A 4B4PA 4QX1A 5K9YA 2ZQMA 4FZ1A 2VNGA 4J9YB 4RQEA 5FQ0A 2EAAA 2F43G 3WNOA 3SCHA 4A3ZA 3I4IA 4QPGC 4GH4B 1VE0A 2ZXWC 1H2KA 1W8NA 4B3MB 4YY3O 4QAWA 4QX7A 5D21A 5DZGA 1ZZBA 3ON7A 2DCZA 4AQSA 3RYHB 4J1WA 1H8EG 5T55A 2DOSA 2D97A 2ZACA 3NV3A 3PVOA 5FY9A 1MZ5A 4LF5O 4CPBD 2O57A 2VZVA 1O8SA 3TXQA 3BGAA 4BK4A 4I7ZB 2Z5WA 4FAHA 1BMV2 3H8UA 3ASOB 3E22B 4ZU7A 4HN0A 5CA0A 2WZEA 5AVPA 2XBO1 4CCKA 2VTFA 2ES3A 3PVBB 1TVGA 2UUBO 3CD6V 1P8JA 2IFRA 1S2KA 2OCCB 2Y69C 1FPN2 2IC1A 4QKDA 4W6XA 3C7EA 4I0XB 4FSJA 2B1GA 1F4HA 4MUVA 4UF0B 3ABLB 3I59A 3W7WA 3OBZA 4N90A 1DYKA 1UNBA 2YIDA 5KHJA 2ZGQA 2YC2A 2F66C 1EZJA 3R4UA 1SFNA 4IGOA 4O7XA 1UYZA 2HWF1 1E1RG 1WW6A 3M3OA 4LF8B 2IXJA 1S2EA 2G9GA 1LB2A 3JARA 1OVSA 1Y4WA 3WDUA 5CB4B 2JXAA 2AW9A 5DABA 4CDWB 3WCSA 3I3DA 5TISZ 2VECA 2RR12 1DGRA 4QX0A 2IBZH 1YJLA 1CJPA 4LT5A 1FXKC 4WVMB 2UXNA 4EROA 1HQLA 1US3A 3ZXEA 5C9AC 4PHZA 2JKBA 1LOAA 3UT5B 3ZN1A 1MPXA 3RVZA 1D4M2 2Q30A 4ASUG 4FPEA 4DPNA 2RMU3 3W5NA 1NKDA 1W03A 5C4WA 1WCUA 4DFSA 2OW4A 1EYBA 2VS0A 4DOUA 5LA0A 1W05A 1GM8A 1Z7S3 5A7SA 4LFAB 5B2GB 2PAEA 5F6LB 4KMQA 1YI2V 1QLEC 1BBT3 1YQ2A 1X59A 2B42B 4LLOA 2MEV2 4HK8A 3A0BZ 3N2GB 5FZIA 5IVCA 2W46A 3JB4C 4LTAA 1IPJA 4PDWA 4XUNA 5CYYA 3PTRB 3VV1A 2GV9A 2YBKA 1OH4A 2GP3A 3O14A 4U7NA 2AEZA 1VQ4V 2MEV1 3CLPA 4FPKA 5LBBA 3K0GA 2WZR1 1IQAA 1VBE1 3J8F3 4ONUA 5FLHA 4UBGA 2EAKA 3ASIA 4M0NA 4FBFA 1LGCA 3JBG2 3PIJA 2P34A 3L72H 3SITA 1KB9F 4IE7A 3O0VA 2HFEC 5B66Z 2PY5A 3N2KB 4QX2A 4DV4O 1OPOA 1FV3A 4B3NA 2QWRB 4GYCB 1UPGA 2ZA9A 4O4JB 5FZDA 2WYFA 1DLCA 4DRXB 4TZDA 3OGRA 1S55A 1S0VA 4TV8A 1O3TA 3O0XA 4I50B 2VPVA 1XRUA 4QDSA 2GDSA 1GM7A 4ZY9A 1W9FA 2E5LO 2YGLA 1W6QB 1HW7A 1NTZH 3LZZA 3H8OA 4GZ9A 5FY4A 1CAUB 4WM7B 2WLIA 1XNRB 3ZX6A 4LMFA 1W9SA 3OOXA 3BVCA 1WW5A 2FDHA 3ASOC 4X1YB 2RG4A 1IBLO 2DVGA 3BEHA 2BGPA 2IJHA 2EVXA 3AG7A 2R32A 1FV2A 1QY4A 1OA4A 3OD0A 4BAYA 2D3PA 3AXDA 1WB7A 2ETEA 2K9ZA 2R063 2OZJA 3H9VA 3FD9A 1TZOA 3JUUA 1CIWA 3BIEA 4GX5A 4XJ9A 5IVEA 3CO2A 3VBUA 5A70A 1Z7S1 3PL0A 3PUQA 4QXCA 2HJFC 1WD4A 2W87A 4H13B 1LEMA 5ACA1 4Y22A 3CJIA 1G4YB 4IV1B 2DW4A 3OY8B 4DXRA 5L9RA 1AR62 3ZXAC 2CYFA 1FAYA 1SLTA 2Q8DA 2PYTA 1YNAA 4YJ3A 1CZVA 5FQ0B 4LHLA 5FP3A 4OHZA 5FMOL 3M2MA 2CY6A 1HB4A 1HRI1 4TOIA 4MS2A 1PM7A 1IG0A 1V70A 3L2YA 4IE5A 4AI9A 1QXPA 3BFRA 1YCIA 4YFZA 1M5IA 2HJIA 3AYAA 3SH4A 4XJUA 3V0BB 4MTFA 3CMGA 5FWJA 3MZHA 2KKWA 4YIOA 3ABLC 1SC5B 1WAZA 1K5MA 4MVZA 2A6YA 1YWKA 4I09A 1MNGA 1ZUQA 3S57A 1ULEA 3RDIA 5DUWA 4L8QA 5F2WA 3C3SA 3MHSC 4HXCA 1NI8A 5FYVA 2Y26A 1SBFA 3RZGA 2D5FA 3PUHA 3KWVA 3M4FA 1AR92 4RQPA 1J3QA 2N04A 2UXBB 2JEMA 3AP4A 3DGEA 1GTOA 4Q4V1 4BK5A 2HWC3 4R50A 2HWD2 2DYRB 2Q68A 1AR73 4XIOA 3B40A 4HAMA 1VAMA 1ENVA 5LOVA 2JDPA 4UCSA 1WNSA 2IU0A 2LALA 3WQ0A 4Z1VA 5FZOA 4FJCC 5GLVA 4JVAA 3HNMA 1D0HA 3CCVV 1POQA 4UCTA 3KB5A 2JEUA 2ZDIC 3W58A 3ETGA 3POJA 3VDBA 1YFYA 1LR1A 2JKXA 2LFSA 3WR0A 4BHPA 2G1MA 3DL3A 3CZUA 2YYOA 2VWKA 3FAVB 2FDFA 4Q4W2 4FTSA 3LF7A 4CRQA 5FKCA 1NAEA 2R9IA 3VDAA 2YIAA 4GX1A 4XDJA 1ZX5A 2RM23 3I97A 4AVVA 4HVOA 4UAPA 2H3OA 1FXZA 3NKGA 3JD71 3KHBA 1F4MA 1T2XA 3TN92 4MSVA 1UOFA 4Q8LA 5JQGB 4JI8O 5FZGA 4HBNA 1BLZA 2QBXA 3IJ4A 2ATFA 3ZYRA 5IT6A 5LHGA 4QB6A 1BHGA 1RUJ1 2J22A 1LOCA 3KT4A 2HVJC 5A3UA 1UOJA 4RR3A 5EIBD 1KP2A 5D8AB 2IZWA 3ZRXA 4U2AA 5DXDA 4D0QA 2E7AA 3FBYA 5CKMA 5EBMC 4KP4A 4DV6O 4DR4B 3USSA 4I02A 5J9PC 3PTYA 2YC0A 1ZRCA 1IGOA 4RSUA 1QJU2 4IL6Z 3AG2C 4FQ4A 5IY5C 4QX3A 1K12A 4IDZA 1QJFA 4ATEA 4RD7A 4PJ0Z 1Q8VA 3CKHA 1MACA 2BERA 3E8FA 3WHUA 2A1XA 4CEWC 3LA2A 4XQ4A 2ZHMA 3VDDC 3U11A 2AYHA 3RMYA 3IAYA 1TME3 4AEJA 2WQ8A 5JSPA 3H0OA 3J4UH 5KAFZ 3N9MA 4QKFA 2Y33A 4IE6A 1DYPA 1X33A 4P9WA 4IEWA 2HLEA 1JCHA 2VW1A 2ZGKA 1M56B 1H4GA 3EHKA