3FFQA

Hcn2i 443-640 apo-state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
184
Chain Sequence
SRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 51
structure length 184
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ffqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ffqA02
2Q0AA 3FJSA 5FLHA 2N7GA 3EO6A 5E1RA 4LTAA 3QACA 1J58A 3ES4A 1NYWA 1X8EA 4QGLA 4EWDA 1FT9A 1NZCA 2DCTA 5KHGA 2ZCWA 5BV6A 4AXOA 1CAVA 3ELNA 1O5LA 1V70A 4WBBA 2UY9A 2VQAA 2QNKA 5I8SA 3PNAA 4XF3A 3H9AA 3I7DA 4MZUA 3KGZA 1RGSA 2GAUA 4MV2A 4AVAA 2QVSB 2UYBA 3LA3A 1O5UA 2EAAA 4QXKA 2ZKLA 1ZZBA 2XGXA 1IPKA 4X6RB 4KWLA 4HN0A 2HJIA 3RDIA 4J1WA 1TQ5A 5I0TA 3NJZA 1DGRA 4HSJA 4LA3A 5KHHA 1VR3A 4AQ2A 1ZREA 1CAUB 3FFQA 5D1IA 3IWZA 1UIKA 4Q29A 4MGKE 1JUHA 4HZFA 4UBHA 3ACLA 4JVAA 5BUVA 5FQ0B 4IEZA 5KBFA 3M3IA 4MGZE 2F4PA 2HKXA 1EP0A 4KU8A 2Z69A 1ZVFA 3D0SA 2QJVA 3NW4A 2D93A 1SQ4A 1OMIA 2PFWA 4MGIE 2Z2SB 1QWRA 2XKOA 3JZVA 3LZZA 3SCFA 3WW4A 2PTMA 4XFCA 4E2QA 1YHFA 1QXRA 5JR7B 5FCCA 4I2OA 4IEOA 5T3NA 1ZNPA 5FPZA 1YUDA 2PAKA 2QDRA 1X8MA 2EA7A 2OA2A 1O3QA 5F1RA 5KHKA 3MPBA 1WLTA 4XFHA 4AQ6A 5I91A 3E6CC 2XL9A 4QGNA 3QOPA 3TNPB 1ZRFA 1YFWA 4FAGA 1XE8A 1CGPA 2K9ZA 4I01A 4IEQA 4WVZA 1CAWA 2PYTA 1J59A 4PIXA 2H0VA 2OZJA 4YARA 4O9GA 3H1WA 4R52A 3HQXA 1CAVB 5JSRA 4YRDA 4E2SA 2ET7A 3IBMA 3ROUA 2PHLA 3E5QA 3OD0A 4BHPA 5JAXA 2UYAA 2B9UA 3M70A 4HLTA 4EROA 2KXLA 1ZZCA 3H1MA 5CADA 1EYBA 4PIYA 3C3VA 5LEKA 1FI2A 1YWKA 2BNMA 3HT1A 4JV4A 4Z07A 2MPFA 1YFYA 2GU9A 1WGPA 4IESA 5E16A 3IIAA 3E6DA 5JCTA 1Q43A 2B5HA 5CU1A 1Y9QA 3SCHA 3H8UA 2IXHA 3UKTA 3IDBB 5CVRA 1J3RA 3CO2A 1H1IA 1H1MA 1Q5OA 2GC2A 5KHJA 4X6QB 3RYKA 4EWEA 4LEJA 4YYOA 1UIJA 4LULA 3EQEA 5I8TA 5I0SA 1CAXA 2VPVA 1ZRDA 2CAUA 3OF1A 2IXLA 2I45A 4MX3A 4XFAA 4BYYA 3PLQA 2XL7A 4XF9A 4D7TA 4GULA 4XF0A 3E6BA 1VP6A 3GBFA 4HMZA 3ETQA 3KMHA 1X82A 3R6SA 2XHKA 4HN1A 2FMYA 1DZRA 4IEWA 3U0ZA 1ZX5A 1CAWB 3LWCA 1XE7A 1ZRRA 1O3RA 4HSLA 2Q4SA 3NKTA 3IDCB 2PQQA 3CL1A 3CLPA 2PAEA 2D5HA 2GC0A 3PVBB 4MH0E 1RL3A 4XFGA 2V09A 3BB6A 4RD7A 1X7NA 3I59B 4IEVA 2CV6A 2GZWA 1O3SA 1LKNA 3FX3A 1RUOA 3RNSA 4QMAA 4QM9A 4IEYA 4F7ZA 3KCCA 4UXAA 4UBGA 1RUNA 1J3PA 1L3JA 4MUVA 2GC3A 4XF1A 4Q0SA 1O4TA 4OFGA 1O7FA 1YFXA 4QX5A 3O14A 3EBRA 3HT2A 3WW3A 2IC1A 2EVXA 3NSTA 5K8SA 3LA2A 3S0MA 1ZZ8A 2QCSB 3CEWA 5J7MA 5I0UA 2O8QA 3H50A 2IXCA 3H3ZA 3TNQA 4Q0VA 4JTNA 3B02A 2H6CA 3WW1A 1UCXA 3CF6E 2Q30A 4META 4IEXA 5JSPA 2B8MA 1O3TA 1ZRCA 1PM7A 3H7JA 3NVCA 1EY2A 2BYVE 3E5UA 4ZU5A 1NE4A 3BU7A 2MNGA 3G7DA 5C6CA 1U12A 3BCWA 1LRHA 4IEPA 1FXZA 2GC1A 2CGPA 4LUKA 1VJ2A 2WFPA 3ST7A 2BEOA 4AVBA 4EWAA 1EPZA 4I02A 1Y3TA 3SHRA 5HI0A 3LA7A 1J3QA 1GQHA 3FWEA 2PHDA 4J1XA 3WW2A 2MHFA 2XLAA 3DN7A 3EHKA 3E97A 4XF4A 1GQGA 3SMHA 1ZZ6A 5J48A 1RC6A 4FAHA 4NVPA 2OPKA 4XETA 5BXXA 1OD5A 2P17A 3VHRA 4ZU7A 1UPIA 5LRSA 3U10A 5EFUA 2IXKA 3DV8A 4P9GA 3S7EA 4YNIA 2ET1A 2GH2A 4L2NA 4CYDA 3USSA 2K0GA 2VECA 3MDPA 3U11A 3D82A 1RTVA 3H7YA 3DL3A 3NL1A 2IXJA 1UW8A 3KGLA 4FBFA 5FLJA 4IETA 5KHIA 5FDBA 4A2UA 1G6NA 2BNOA 2D40A 2ETEA 1IPJA 4TLFA 1Q3EA 2OZ6A 4I0BA 3S7IA 2Y0OA 5JSOA 4KL1A 4QGMA 4N9IA 4XEZA 3I54A 4XFFA 2BGCA 2O1QA 4MGYE 3RYRA 3L2HA 1SFNA 1XRUA 1UD1A 3ZDSA 4HBNA 1OI6A 1DGWA 1J1LA 4ORFA 3ES1A 5BPXA 1PMIA 3FZ3A 2IXIA 4LUMA 4KWKA 1OFNA 4IERA 3RPQA 2XLFA 1YFUA 3UKVA 4LLOA 1I5ZA 4N9HA 3N4MA 3SXWA 4I3PA 4L11A 4EV0A 2XKPA 3RZZA 1QY4A 3SCGA 3H1YA 4I09A 3D0JA 2PAMA 3KSCA 5AVPA 3DKWA 4I0AA 4HVRA 4HVQA 2BNNA 1NE6A 2OYZA 1HW5A 1I6XA 1CAXB 2D5FA 1WA4A 1NXMA 3GYDA 2C0ZA 1YLLA 1CX4A 4BIFA 2PA7A 1LB2A 4FT8A 5I0RA 3OTFA 1QXJA 4B29A 4JTOA 4E2GA 4HVOA 1DZTA 3FE5A 3MYXA 4K8FA 4BH9A 4ZU4A 1CAUA 3BPZA 1ZZ9A 5EZWA 4DINB 4XFBA 4R8HA 4PIZA 3H3UA 4KWJA 3LOIA 5LEJA 5FQ0A 3HIFA 5J3UA 3MZHA 4Q0UA 4Q0PA 2WC2A 2ATFA 4Z82A 5C8WA 4OLLA 2UY8A 3FHIB 4LA2A 4Q0QA 3I59A 4XFIA 3EJKA 5FLIA 4IEUA 4F8AA 3OCPA 5I93A 4ONUA 5LRRA 1SEFA 1LR5A 3UKNA 2Q1ZB 3CJXA 4O9EA 4KU7A 4YSFA 1ZZ7A 2H6BA 4QM8A 3E5XA 3BALA 5FPXA 4H7LA 3LAGA 2E9QA 4D7SA 2CAVA 5I8YA 5BY5A 4WZCA 2XLGA 3RYPA 2FQPA 3OGJA 4AVCA 4PJYA
chains in the Genus database with same CATH superfamily
3FJSA 2YIBD 3RS6A 2FCTA 1J58A 4YY3B 3POSA 1SLAA 1HRI3 3P1IA 1Q8SA 3POWA 1HNWB 2ZGKA 2X8KA 1XHZA 3ZXFA 1ULOA 5FMCA 4DK0A 3BVOA 2UUCB 4AVAA 1QNWA 4J9ZB 3AKQA 2YBSA 3MPPG 3N9MA 4J1WA 3VGIA 3CD6V 1DGRA 1GRJA 2R6QA 1JUHA 4QIWF 1NY71 5BUVA 4ZI7A 3S3XA 3ZFFC 1MZ5A 4I30A 1FJGB 3OUIA 2F4LA 3D36A 1PZ8A 2XJVA 3WP5A 2PTMA 4FFGA 1YTFB 2Z79A 5E79Z 2X5IB 2CHHA 1WLTA 3H1HH 1XE8A 4CZSA 1NA1A 3PL0A 4IW3A 1OLRA 2GMMA 3J4UH 2BSKB 3ABZA 2VWJA 2ZGNA 3FBYA 2DN9A 1A6CA 1CZVA 2BRTA 2WN2A 4XJ8A 3WG2A 4AHZA 3WP6A 5FXXA 4HLTA 2HWD1 5KR7A 5GTHZ 4MVUA 1D0GA 2RS11 1PNMA 2E3CA 3S30A 5C4WB 3ZN0A 4X65O 1H38A 2OWOA 5EQUA 4CCEA 2CDOA 1Q43A 4C7UA 4CCLA 2Y4UA 4ES9A 4TUYA 3UKTA 5J2TA 4D69A 4W50A 1VF7A 4M4PA 1BCCH 4JGZA 5FK7A 1XOYA 3FB7C 5L7OC 3A7QA 1HIXA 2OUHA 1K5QA 4D7TA 4WM7C 3PJYA 4J42A 3B94A 3BODA 1X82A 3WEZA 2YPDA 1OJHA 2OCCB 2JEMA 1EBOA 3AMHA 4MW8A 5L19A 2DVGA 4IEWA 3LDDA 3FAVA 1GH6A 1ZRRA 2KA3A 1Y76A 1BQPA 3B8MA 2PAEA 1PV0A 5KX5B 2DYSB 4KG0A 1ZTEA 1MSDA 5F3IA 1UU5A 1LKNA 2W52A 1W0KG 2ZXQA 1G8MA 3V0AA 1SZBA 2E5LB 4WV8A 5LHGA 2XBO2 4YVSC 4A3XA 4OULA 2QTOA 1NAEA 1H2LA 5JH7B 3E8GA 2HP8A 3NSTA 2EALA 1VALA 1AR81 2ORXA 4OZOA 1NH2D 4FLTA 2NR5A 4MTOA 3DGTA 3VBUB 1DBNA 5IUQA 3ZEDA 3OM3B 5KA6A 5EP9A 4IE4A 1BMV1 3AYEA 4LF7B 2Q30A 3OBRA 2B8MA 2DE0X 2W92A 2W6IG 4QAWA 4GXLA 2VOTA 3D6EA 5IJ9B 5C70A 3JBG2 5FZGA 4XQ4A 2QJ1A 3M8LA 1E1RG 2Y69B 1ENRA 4G9SB 2NLJC 2R0FA 4TV9A 4ZZ8A 5BNOB 2FDGA 1LENA 1TEIA 4NVPA 4HKOA 4TV8B 1LOGA 4FPJA 3U10A 2IH3C 2DQ0A 1R6NA 4MTXA 4NTYA 1YXWA 5CG8A 3UJOA 2Q9LA 2XJTA 4YPJA 1N33O 1W9WA 4AILC 4DR6O 1PP9H 2ZR3A 1L8DA 1UOBA 5ACA2 5BNNB 3LSDA 1LOCA 2F23A 1FPN1 5K0UA 1TMF3 2OZ6A 5AFBA 3WHTA 1BMFG 2ZDIA 3E22A 1RB8G 3T1HO 1F31A 1K5JA 1GZWB 3L2YA 1C5HA 1EV12 5B3SB 3K9AA 4LO8A 3UKVA 1MS0A 3WNOA 5JIAA 3N7JA 1WNSA 3SCGA 4YLZA 1ND3B 2RR11 4HVQA 1K5MA 1NE6A 2UWBA 1GAXA 2R073 5C3OA 1N1YA 3B2EE 4A45A 2HWF1 5FY7A 4HVOA 3FE5A 4E27A 2WLJA 3M7MX 1YJ9V 3OYWA 2VUAA 3QVNA 2HWB1 5GLUA 1G1XB 2GH8A 4R9AA 2OIIA 2CTQA 2BTVC 2RE9A 5JJJB 2D6NA 5A3PA 5CB4B 4FPGA 3BKZA 3AYDA 4CC5A 2DFBA 2Q1ZB 4LO4B 2VXRA 4YSFA 3GWKC 5FPXA 4CS3A 3KZ4C 1KU9A 3TB0A 4AVSA 2CAVA 1UZYA 5JOYA 1DQ5A 2Q0AA 4L87A 2W87A 3JAKB 4JGSA 3NKGA 1V55B 3OEEG 4IV1A 1QLNA 4PLMA 2WAOA 2DCTA 3ETPA 2E6VA 1UPSA 2VU9A 4JGYC 1OXCA 2VQAA 2F17A 4P9XA 3UKMA 2AACA 2R1DA 2ZGOA 2RDRA 3I2HA 3W58A 1HDKA 2Q68A 2D3RA 1RUE2 2UYBA 1AI4A 4I0XA 3VBFA 4K21A 4OZXA 4O2BB 2VM9A 4RS5C 3ILRA 1UU4A 1AJOA 4MS2A 4JI7B 1COV1 1W8UA 2O0OA 2YMZA 1AYM3 1X9TA 2LS6A 4PA4A 1URXA 5IJRA 2PLV3 4KNCA 5LA6B 2ZGMA 2RDSA 3ASIA 1ULPA 3VD4A 4D6SA 1CWPA 2Z5UA 3UESA 1U5ZA 4U3FH 4TV9B 3GBWA 1LGCA 3CPWU 4CDXA 1M4WA 4CU7A 3AMMA 5KMGA 3USUA 1YQ8A 1RUJ3 2B46X 3ABTA 2VOXA 3H3LA 4GKKO 1HNZO 3THDA 1HQWA 3H1WA 4HZ3A 3OPWA 1QXPA 4FZ0A 4MTFA 4DR7B 2IZWA 4AQYO 4ZKTB 3HT1A 1HB2A 2LTNA 2CTRA 2E32A 2OTLV 1R092 3AG1C 1M4UA 3E35A 4Q4V1 1ZBA3 3M8AA 3SJBC 2WNUC 4AGRA 5A6XA 5EYYA 5CA1A 1UIJA 3GCWA 2Y64A 2OQ6A 4P9YA 5FMBA 4J6GA 1AL22 1PL0A 1VQKV 3OFNG 5DG2A 4ARXA 3C7HA 2WSVA 4TWTA 3KF5A 2G9GA 2M7WA 3B8NA 2AZ2A 1F4HA 3OYWB 5F6LB 1MZEA 3I2IA 5LK7B 5GKAC 1AR62 4Q26A 4QD2A 4NTWA 4LFBB 4UWDA 3WQ1A 5A7PA 4Q2FA 4JKKA 4BQYA 4W65A 1B06A 4I4TA 4IGGA 5KAFZ 5CA0A 3QCWA 3IC9A 4DV7O 3P6BA 4AHCA 4CXWA 4ZONA 4F7ZA 3KCCA 4JI4B 1J1TA 2Y6HA 3E1F1 4X62B 4DK1A 1MMMA 5GLWA 4TYSA 4FOYA 2B9ZA 4J25A 4B1MA 2BWAA 1ENQA 1YFXA 1UQXA 4NIGA 1PO11 3WW3A 1W2NA 1HQNA 1ND2C 3MW2A 5LMNO 1SZXA 5HV4A 4PD4F 5C5UA 3U4XA 2J1VA 1PD3A 3WD5A 2RDNA 5KXDA 3THCA 3SPGA 2WS92 1WW6A 1GV9A 2QKSA 3CF6E 5FOJB 5JSPA 4XOGA 4TN7A 3CCVV 3CQOA 4GH4C 4RQPC 1S77D 4DRRA 1Z7S1 5FXVA 5C9AA 4RGKA 2WZPP 5FR3A 2RM22 4J1XA 3K46A 1OH4A 4NPLA 4AI9A 2Q6AA 4DR2O 3A0RA 4D6QA 3PMEA 3PUSA 3FL7A 3H1KH 3S5QA 2P17A 1EAH3 1KFUL 1R64A 1XL4A 2J1SA 3H8RA 4WFAV 1WW7A 2A75A 2JKBA 5BNPB 3VBOC 4AFBA 1UYYA 3CHXA 2YBPA 2JGUA 3ZSMA 4EN6B 1MG1A 4GALA 3J80N 2BERA 1NQDA 2D6MA 5FZOB 4B4QA 2PI5A 1IGOA 1YRZA 3AXEA 4UVBA 1PX4A 2A9HA 2GMEA 3E8HA 1VQ5V 3AK1A 3VHOA 3VDDB 3H42B 3RZZA 1QY4A 2XG3A 3H1YA 5H5NA 2AR6A 1AJQA 5GM0A 5F3GA 4JPRA 1WUVA 3PMSA 4ARYA 1SLTA 2WWSA 2Y60A 4Q4Y1 2HHHB 4JI2O 4XFBA 4YM1A 1AI7A 5FQ0A 4NROA 1XNKA 2Y6GA 1VLNA 4Q0PA 5E88A 2HKOA 2GDFA 1UMIA 2UXCB 1HXS3 2VZUA 1SLLA 3BALA 3CCSV 5LCWL 2AEZA 4U2AA 4XE9A 2XLGA 3CRRA 3OUJA 1A8MA 4WVVA 1D5NA 2ARAA 4QB1A 1GK9A 4M4RA 1N34O 5FLHA 2WYSA 4JQTA 1S0IA 1LECA 3BRCA 3TETA 4LFAO 3FN9A 2VMGA 1V9U3 4DW0A 4EWDA 2KB1A 3K3OA 2HEWF 3RZKA 4JI6O 1O5LA 3JD72 4G2KA 4GWNA 2VMDA 1W6MB 4D8MA 3HKBA 1Y66A 3KGZA 5C93A 1PNKA 4HK9A 2GAUA 1W6NA 3T1CA 3LA3A 5FY4A 4NXMB 2RMKB 5CA6A 1CXZB 4LHLA 2P6HA 3BHPA 2XPJA 3VD9A 3NJZA 4LA3A 5JJNB 1YQ5A 3QO8A 3UQ8A 1JPXA 3BAAA 4O2AB 5J2UA 3ZIXA 5EYXA 4JVAA 4FK5C 4BWOA 2D6OX 4NUBA 4IHJA 1KECA 2F66C 3QTCA 5FY8A 2IU0A 3D0SA 1H8TB 5K4LA 4K8XA 4HPKA 1O6UA 1WW4A 5IW0A 4XBLA 1NA1C 1A78A 4UCOA 2E63A 3J8F1 4CTEA 5KHKA 3I3BA 4FLVA 5LY2A 1RUC3 3ZYPA 4QGNA 3QOPA 3RI8A 2PYTA 1J59A 4XIOA 5EJ1B 2VCMA 3G6EV 2VE1A 3VZLA 2OTJV 4B3MB 3CJHA 2WRAA 1M9NA 3A21A 1UOJA 5KUKA 4FCAA 4OYUA 5IWFA 3NAPA 3WFVA 2YS8A 4N7IA 5FPLA 1IBKO 4XDQA 4J11A 1PGL1 2GSYA 4JGZC 3HD8B 3AZYA 4AHXA 5KXBA 2C2AA 2VNOA 3RVHA 2IXHA 4OPHA 3CXCU 4LNVA 5LP6A 2GC2A 4P5HA 4B3TO 4YYOA 4IXLA 1MZ6A 1CAXA 4Y20B 2WKKA 1SQPH 3UO2A 3ZFEC 1NBMG 4R6ZA 1I1EA 1H6XA 3U07A 1OPMA 3WT3A 1W99A 2WLQA 4FPEA 4LK7A 4X8NA 5FZ8A 1KMIZ 2B7YA 1Y4MA 2ZE5A 1TME1 3KM5A 1L7LA 1RM1C 4R4ZA 4FTSA 1IXBA 3IIIA 4AAPA 2HWC3 3MIGA 5B66Z 3BB6A 3EVKA 1K92A 2E7TA 2VQUA 1F51A 3C7FA 4LLFA 4JAAA 1K3IA 3FBMA 1KP2A 2B42B 4IEYA 5FUPA 2GNTA 5T52A 3A4UA 2DDUA 2K1EA 4LC1A 1XL6A 2Q7HA 3KQRA 2AUYA 1XYNA 3N9QA 2X0LA 4JDOA 3CCRV 2GALA 1YVWA 5FZ7A 1VAKA 1CJDA 1MABG 3HKBB 5FPOA 4UCVA 1QCEA 3K77A 1W6NB 4EFEA 2YIBA 2E75B 4QDSA 4D6RA 3JD4A 4YG3A 3F95A 2VNGA 2Q1FA 4BISA 2LW1A 3BCWA 4IEPA 1QQP3 2J22A 3NNFA 4ZHQA 1XNQB 4DR1B 2DYRC 4JI8O 3SEEA 2W1QA 2YI9A 3B4SA 2OYQA 2JGDA 2XUEA 4HPKB 1Z0HA 2OPKA 3WNXA 4MXVA 1IBLB 1Z5WA 4HG6B 1U5IA 3R65A 5DAPA 2XAGA 4YNIA 4L2NA 3ZMTA 2YXHA 3ZSJA 5K0UC 5IVYA 2ZDIC 5DECA 3AVRA 4BB3A 3AFKA 4FLZA 3UT5B 1R73A 4LHSA 3ASNC 4C0HA 5AFEA 1YJNV 3NO8A 4I0BA 1W6OB 4KL1A 3EXUA 1FXKA 2X6AA 1S0CA 3HQRA 1TMF1 3NR7A 2O1QA 4JI5O 1Q82W 1W6PB 3NAPB 5FYVA 1DGWA 1SS3A 4N21A 3BIWE 1RUF1 3N9LA 1OKQA 3FZ3A 1UF2C 1Q81W 1GN3A 1O59A 5FJKA 5A6YA 1V6KA 2X6BA 3IPVA 3MFCA 2RS33 2OPWA 2DFCA 3JB4C 5LP6B 5CFDA 2VNVA 4BU2A 1SBDA 1CAXB 1DQ0A 1G9BA 1CONA 1VQ6V 2RS12 1HN1A 4HXCA 1TGOA 5IK7A 1ZZ9A 4KWJA 2LO1A 2X09A 1MEC1 1W0NA 3SJQC 1I5YA 4B7EA 2IU3A 2A7AA 2ZMNA 4XFIA 2WL1A 2YY1A 5I93A 2ORZA 5IVJA 1BEV1 5LL6Y 1POQA 1NR7A 1LOFC 4QM8A 3J81N 4RGAA 3WNPA 4IV1C 1LTEA 4WZCA 3ZYFA 1REDA 1QJU1 5CG9A 4N43C 1F4NA 3KV5A 3N7KA 4BIZA 1FOD1 1UKGA 1X33A 2DU1A 5FWJA 4QU2A 3N35A 1FMD1 4DV1B 3ELNA 4UFMA 3VBFC 5FZLA 2PYJA 2UY9A 3EB7A 3MLJA 3PNAA 4QPGA 1NS1A 2HG5C 5EC2C 4XF3A 1WB8A 2FD8A 2JJ6A 2ITCC 3T1LA 5T50A 3IAYA 4YZ5A 4HL0A 4QXKA 4KWLA 3AYAA 3I56V 3O1OA 1OOPA 4HSJA 5KHHA 4YGDA 1VMJA 4X64B 1BHBA 4UXNA 4LP8A 3D3QA 1RPOA 2F4PA 5IYCO 1EP0A 1S1AA 3VZNA 1AYM1 4CDXC 4QQ2A 1JQ0A 3ITQA 4XPVA 4LF9B 1GO3F 1FXVA 1AR82 4XJUA 1SETA 3IGAC 4D6TH 3FHAA 1MPXA 1QXRA 5F32A 3VHNA 2JGDB 1LHOA 3LD8A 5FPZA 1HN0A 1YUDA 2EA7A 1NJIW 1POV3 1IQAA 2CGNA 1BMV2 1NX9A 2ZACA 2NYYA 3APQA 1CGPA 1QHTA 1C57A 5HFMA 1RUJ1 1UYZA 3J7AU 3HBKA 1QH7A 1W9YA 3JAWA 5B1BC 1JZ6A 1PZ9A 3K48A 1DIWA 1POV0 4FFKA 4DR3O 3AC0A 2ID4A 4XDOA 5LATA 2E53A 3PUIA 2R49A 2QQOA 4IESA 3OT7A 1FXKB 2NN8A 2J7MA 3ZFGB 5CNAA 1R3LC 1ROPA 4DR6B 1XJAA 4OUMA 4IE0A 1OQ1A 1ZBA1 2WZR1 3IMMA 4F6RB 1IKQA 1F4AA 3W20A 4LBEC 5CA3A 2ADQB 3WB0A 1DGRN 4Y5TA 1JCHA 4QQOA 3RYIA 1FPN2 4GULA 3NNJA 4FXKB 4QXCA 5IYYA 3OEBA 1JYCA 4GD4A 3FB8C 2YI8A 2W1UA 2Q7GA 1XE0A 3GGLA 4HN1A 4BMBA 3PVNA 4UW4A 1UY0A 5D21A 2JIJA 2XAHA 2VTFA 2PQQA 5LB6A 2VUDA 1ENVA 2HFEC 1JX9A 2JG9A 1G9FA 2EF6A 5F2WA 3BYWA 1O9HA 2RR12 5A3MA 3W7WA 1ZBE2 4CDWC 1SQXH 4LKDA 3JCUZ 4PF5A 2XASA 4AEDC 3RMXA 3T1MA 1NLRA 2QM7A 4OFGA 1K4CC 1DF5A 3GF6A 4QB6A 3VDCA 4ET7A 1YHQV 5A7WA 4M0HA 1TUBA 5CZKA 1LULA 4K40A 5F6KA 1N36B 3TNQA 4JTNA 5C9AC 4KMQA 2A3QA 5LBBA 3NVCA 1VQ9V 1WB7A 3BU7A 2MNGA 1OOPB 1KFXL 5GTIZ 4G28B 1QJX3 4JKMA 3Q8BA 5F3CA 1RUH1 2LROA 3ST7A 4AVBA 2WN3A 3ZJZA 3AG2C 1GQHA 1NOVA 1WW5A 3SC7X 1XNRB 4QJFB 4WBNB 5EWSA 1V6NA 5IYBO 2V4VA 1O4ZA 1JOBA 4OI0A 5IWAO 2VO5A 5LW9A 4XQWA 5C71A 5JVDB 4P9GA 1UU6A 4FOWA 1QJFA 5DQ0A 3N9NA 3D8CA 3D82A 2EIJC 2LM3A 1PK6A 4NOTA 5LGNA 4M3CB 1COV2 3CJIA 4DR4O 2YGMA 1OCRC 3UYJA 1Q3EA 2Y0OA 3LEGA 4QGMA 2KSDA 3UO3A 5E8AA 4MGYE 1WCKA 1SFNA 3M3OA 1MVEA 3TEZA 4WF9V 5AC93 5IT6A 3HWJA 4YW5A 4JYBA 1REFA 4IL6Z 4XAAA 1I5ZA 3VOUA 1J84A 5C7GA 3GHNA 1U0AA 1U5YA 3RSJA 2JXAA 2V7QG 3MHZA 1W59A 5L3EA 5A33A 5L3FA 4I9QA 4BH9A 3GM8A 1GWMA 1Q86W 3I3MA 2XOMA 1LODA 3EFFK 1A3KA 3HIFA 4U7OA 4CCOA 4Q4V2 4LA2A 1VIBA 2Q5ZA 4KBBA 1HR0B 3UGFA 1UZ0A 1ZZ7A 2ENRA 4R9DA 4QPIC 1SLBA 4WFFA 2ZX0A 1YNAA 5EZYA 1JUIA 1Q7YW 4WZFA 1RVF1 5FKCA 3WF4A 1VEWA 1YO8A 2ZCWA 1CAVA 5JOWA 2I07B 2D43A 2IJIA 3I7DA 3SPIA 3HJRA 1IS4A 2XGXA 3ABUA 4Z1VA 2Q8CA 5I0DA 2LUWA 2HEYF 5JZGA 4KG8A 5EC1C 4PCRA 4AGVA 4Q29A 3KV9A 4LR4A 1N1SA 1QJY3 4YY3O 3OOXA 2ZE6A 2EIMB 1HNWO 1MS9A 4JDMA 2QJVA 2D93A 5FZFA 2JJ1G 1PO12 2RS53 2UUCO 4CCDA 1URFA 3ZMOA 1C3HA 3RZHA 2VW0A 4UCSA 1O4YA 1OC1A 4XABA 1QVFU 3WZ1A 2QBXA 3NWKA 4GQ7A 4ASMB 4PV1B 1UOGA 1X8MA 1WLWA 4XUQA 4XFHA 2XL9A 4H0LB 4OI2A 2G19A 4GKXA 4K8RB 1RJ7A 2FMDA 4J7ZA 5GALA 5H6RA 5CISA 4AE2A 1FJGO 4HKWA 4OMDA 5JSRA 4I5SA 1IVSA 5CB7A 5E6HA 1Z7S2 1PK6B 2PHLA 1XNTA 2P3KA 5C8CA 3WCSA 4X9QA 1CJPA 1X36A 2IM9A 5BR8B 5C3QA 1JYXA 1HB3A 2M6YA 2RDCA 4R50A 4ZKIA 1DF4A 4BMEA 1EM1A 5DUUA 5J36A 4LKSA 3RMYA 1PIV1 1W8ZA 2B5HA 4JRAA 3ZHVA 4NHXA 5FZHA 3O9OA 4FQ4A 2WPDG 4P2ZA 4DXSA 4CP9A 2GN7A 1Q5OA 1JA8A 3WDWA 3SYOA 4JRLA 5I8TA 2WO7A 5J9PC 3OF1A 1K4DC 2WAAA 3HKEB 4XF9A 3ZXGA 3PJQA 5A9GA 5JCOC 2PQSA 1MQTA 2VMIA 5A33B 1SZTA 2DUOA 1OCCB 5LZ6A 1AR71 3CZUA 5IATA 3H1JH 3ZYJB 3HPNA 2QQIA 3CL1A 5FV3A 2VMHA 4ATEA 3GVMA 2GC0A 4UOJA 1X7NA 2WLIB 4NHYA 4YZ2A 2HWC1 2XHNA 1RUOA 3V0BA 3H8OA 2W0XA 1YQ2A 4BZ4A 4GX1A 1S0BA 2XAJA 1G8WA 3G4SV 1SQGA 4Q4Y2 4XVHA 1O4TA 5JIUA 2K2SA 2P3IA 3BOWA 4LXLA 1JYNA 5ABJA 1OZ0A 1UWWA 3VD5A 4BE3A 4JTCB 3CEWA 1FFTB 3I55V 1AJNA 1PO23 1EUTA 1O8PA 1S72V 2X53S 2MK3A 4FM2A 4FP3A 1NKDA 4F6EA 1F2NA 5L36A 2E5LO 1P49A 3PIJA 3B02A 3ML0A 2H6CA 2XJSA 1UCXA 3HKDA 2ZX1A 2CNAA 1I9RA 1EY2A 5JZGB 4WVWA 3X2QC 2Y38A 3H01A 2GC1A 3AP5A 3FHQA 2BOIA 4LNUA 3F2ZA 3TBDA 5KUMA 4Y5Z0 4UVCA 1WD4A 3UETA 1OHFA 4I50B 1ASJ3 5A32B 3GWOA 3T4VA 1ODMA 4K3AA 3K51A 1RMU1 1HB1A 3AMNA 3DN7A 5JVVA 1ULFA 1RC6A 4QX1A 4O65A 3VBHC 3VHRA 4GMP1 4IGOA 4LF7O 3TN91 3DV8A 3HKCA 5LA0A 4IL7A 1Q8IA 5ITZB 1CEZA 5FZIA 4D94A 2QUOA 3MDPA 1PPJH 2P06A 5BNOC 2VL4A 5FYCA 2BNOA 2D40A 1SG3A 4A4AA 5FNVA 3VL9A 3BU0A 4X66B 3QD6A 2C9AA 4WVMA 4LK6A 3BI3A 1UL9A 1F35A 4PDMA 4EYUA 4B4RA 1M57B 1US2A 5CFDC 4ORFA 3J8F2 2ZEXA 2IXIA 2O57A 4DY3A 3RPQA 1M56B 2TUNA 1XNDA 1DCSA 1P7GA 1OLME 3HR9A 3ZLIA 1DZQA 2P5BA 3PUQA 3RRDA 5IVEA 2RS31 5B1AB 1PMJX 3AP7A 3URFA 1WA4A 3GYDA 2CK3G 1VE0A 1ULCA 1DZTA 5BNQA 5KLVH 3KVAA 1SCRA 2D7FA 3KS7A 4D3WA 2MEV3 4R8HA 3MLLA 4NIHA 1VP7A 2DURA 4XJWA 5C3RA 1ND3C 1VBE3 4KHPB 3WSOA 5L3BA 3N7LA 4CDQB 5IY5C 1K73W 3STZC 2XH6A 3R0RA 2CY6A 4B1LA 2ZABA 3AM2A 3WF3A 3IZOA 4O9EA 2NN4A 3POEA 3C7EA 3OR6C 4CU8A 4PJYA 2UUBB 3SGIA 4MHUA 4QPGC 4DR5B 4MGSA 5LGTA 4L8JA 4JYCA 5JLVA 3A23A 1TME2 1R3JC 3ILNA 4CCKA 1AYN3 2QNKA 4S2DA 1OCZC 2TEPA 3Q8AA 4FXGB 2BCCH 2R063 3BIEA 1O5UA 5DUXA 4FPOB 2ZKLA 4JCKA 1IPKA 5SV8A 2C4XA 1BHAA 3VD3A 4LF5B 1OLMA 5L7OA 1CQ9A 4AQ2A 3FFQA 5D1IA 2YXLA 4HK8A 2E51A 1AVBA 4URAA 1BHGA 4M01A 3JCIA 1ZVFA 3LCPA 2RJKA 5FXWA 1LUWA 3Q8EA 4LWSA 4O4JA 3WP3A 4PA7A 1Z5VA 1GN4A 4YW4A 3SCFA 4AFMA 4K7JA 4CEWA 1Q90D 4RGGA 3WU2Z 3VV1A 3QLQA 4NHMA 2WLLB 4HNAA 4JI7O 3MW3A 1ZRFA 5DDJ3 3AKPA 4QDQA 3WQ7A 1REEA 3AB0A 3FUOA 4YARA 3HQXA 1DTOA 2J42A 4UV8A 2VQEB 1H9WA 2XVKA 4QNHB 4P08A 3LIGA 5GZCA 2BZDA 5LA9A 1SPPA 3C3VA 2ZXWC 4DW1A 4MVMA 1HJFA 4K6BA 1WGPA 3GALA 5E16A 5B1OA 2FKXA 4GIQA 3CRCA 3T0AA 1LCLA 5JXIA 1N3OA 3F5WC 1QKQA 2YU2A 4LF8B 2DWDC 3RJRA 4X1YA 4CH4A 3NXSA 3B01A 4UCRA 3R4DB 2Q0OC 4EQVA 4RFT0 2G9ZA 5GZFA 2BWCA 1DK1A 2J1UA 4L9BA 2BGOA 3ZFFB 2HEPA 5K1XA 3B69A 3CC4V 2XXZA 1TMF2 1X9PA 2JG9C 4BQ1A 4FPYA 2VUCA 3CS5A 1CD3G 1CAWB 3QBQA 5A70A 3O0XA 1AP5A 3DCQA 2BPA2 4QU1A 4AFCA 2EICA 1KJRA 3NJXA 2HLEA 3JASB 1JFFA 4IEVA 4CEYC 4Y22A 1W2TA 4DUVA 2C5DA 4COZA 2ZGLA 4QM9A 2VOKA 2AGSA 3ZRWA 1YXBA 2YC2A 3ZXAC 2R072 2WLNA 4GX5A 2BBVA 3TJTA 3HAGA 2GC3A 4FVVA 1IBMB 3ZX7A 3DXRA 1O8SA 3PU3A 2EVXA 3KD4A 2UWAA 2P37A 1RUG3 4MXWA 4YIOA 2R16A 2VULA 3NRUA 1UZWA 5J7MA 2ZR2A 1QJZA 5IT9N 1BEV2 1R083 1S0GA 4JI4O 1E57A 4X62O 1QJU2 3F7VC 2ZS6B 1NE4A 1ZLZA 5FP9A 1W8OA 2YU1A 2FDHA 3QG5A 3QH6A 2E26A 3LKJA 2BEOA 1HV1A 4WM7B 1Y3TA 1YIPA 5L3DA 3OGCC 4O4LB 1QJX1 2FBEA 1W2BU 3KHCA 1VAVA 1FMD2 3FWEA 2YIAA 2W95A 1A34A 5FY1A 2PI4A 3E97A 5LXTB 2LGWA 4OX9B 2BDRA 4FAHA 1LEDA 3MIFA 3AFGA 4DV3O 1UPIA 1KYOF 1S2BA 1COWG 2LQTA 5L73A 4HANA 1UJWB 5EBMC 3ZXLA 3WNNA 1KKDA 4IETA 5A3WA 2XJQA 1RUE3 2E7AA 1AYM2 4IIJA 4YVSB 4TLFA 4JGYA 3S7IA 5E89A 1IS3A 4DZGA 5BXZA 5FYBA 2W5FA 2RG4A 1SKVA 4MO3M 2WNVC 1XRUA 3WF0A 2ZKNA 1OI6A 2EIEA 5CMUA 3MD0A 3K03A 4MADA 3K06A 5F5CA 4MYEA 1OFNA 5FYYA 3THPA 4RS5A 4ZY9A 3N4MA 3OMIB 4B08A 4A42A 5HPOA 1RUJ2 4X1YB 3LUTB 2DF7A 3NNMA 3SH5A 2CH7A 3KSCA 4RFRB 4G27B 3G6JB 2ZIOA 1CX4A 4NAMA 2P34A 1WP8A 3I49A 3ZXEA 1XREA 3ZHQA 1DYKA 3LOIA 1DLLA 1L0NH 1NCQA 5FZCA 4Z82A 4YG6A 3SQOA 4PQQA 3S3WA 1XU1A 3DXUA 1K42A 4DV6B 3LNMB 3EJKA 3VZMA 2ZEWA 3AL6A 3ZOIA 1ZBA2 2VVFA 1W9SA 5CKMA 4KBZA 3K57A 1QR9A 2W39A 2F43G 1KUQA 3LAGA 4Y22B 3RYPA 4DIQA 4Q20A 4BLIA 1DU3D 3P5BA 2ZGUA 3EO6A 2XQRA 2HHHO 3WG7C 3ZRWB 4LR3A 1NZCA 3SH3A 3AK3A 2QWOB 5KHGA 3B40A 3LSSA 4B3RB 3DXRB 5ANNA 5FZBA 3CC2V 3TOJA 2BOBC 1Y9MA 3DSQA 2XMLA 2UXCO 4GB33 4YXWG 3FC0A 4QX8A 3RG0A 1PGW1 4UB8Z 2IFRA 1VF6C 1CPYA 1E5HA 1E1QG 2ZNJA 4G4FA 3C3SA 1GNZA 5LOVB 2YBKA 1FFXB 4AEMA 4O4HA 5FP8A 3VQYA 3KVBA 5BMVB 5EJZB 1R1A3 1OURA 2NNUA 4BXFA 1AR63 2QQPA 5FYTA 4DEVA 1X50A 1Q6HA 3IN9A 3ZYIB 2RS51 1V6LA 4NXMO 4ZOLA 1ZM1A 4I7ZB 1SMVA 1JI6A 5F1RA 3MPBA 5C8CC 4FAGA 3AKSA 4CCJA 1ZRIA 3LSUA 2EILC 1SACA 1LU2A 1Y74B 1JZ5A 2WJSA 5L3CA 3LSQA 4COWA 3CNAA 2WABA 3JQXA 1OF3A 4QXBA 3BTXA 3H1MA 3PIGA 1EYBA 3MHSC 1ND2A 4O4IB 4IIJB 3ZN5A 3Q9OA 2ZINA 4PT6A 5F7UA 5T5PA 3MGUA 1LEMA 3E6DA 1AUYA 1H6YA 4GJZA 5J1XA 2YV8A 4DOUA 2HYKA 2RM23 1EAH2 2LJ2A 2L35A 4RS5B 4GH4A 1XHXA 4B3MO 2MW2B 2KG7B 4NIAA 1JYWA 1JBCA 2K9PA 3O12A 3JD0A 3A0NA 2D3SA 2IXLA 4QPKA 3E6BA 4Z92B 1Q56A 2BUKA 4LH7A 2YG0A 3RW0A 4Q4X1 4AVVA 3R6SA 4RL7A 1RP3B 1ZL8A 3J7HA 2BFUL 3SYCA 2WSSG 4EN8B 2H94A 1MS4A 5EIBC 4DMIA 2WBKA 1WCQA 3THOA 5JQGA 4QX3A 3W9AA 3RI9A 3KG2A 4N53C 4BLJA 2EIKC 4DRXA 1L7RA 4R4XA 3LEKA 4UXAA 1JS9A 3JALB 1W6QA 1SA0A 5ABJC 4S2HA 1VBD1 3G6BA 4XF1A 3K5LA 3M4FA 2AC1A 3CZJA 4QHZA 1GM9A 1AX0A 1H4HA 2PHRA 3VQVA 2VD7A 1DHKB 4J7KA 1W2OA 3QH7A 5K1PA 4PELA 2CWSA 2AW9A 5K8SA 3CKHA 2VZSA 4YG0A 2GBOA 3S0MA 3AG1B 1KC8W 4FO9A 3OTOB 2WNUB 5IYZA 5KA5A 4H3WA 1PO21 2N04A 1JYTA 3ON7A 3WW1A 1HRV3 4META 1GP6A 1HXS2 3PUAA 2QQVA 1PM7A 1HKDA 4W8JA 3D4KA 2FB5A 4JI0B 1IURA 2OT5A 1BVP1 4URTA 3OBZA 4O4HB 1RVF2 1X59A 2OS2A 1EPZA 3T30A 3HPLC 5FFOC 4IV3A 2PHDA 2QQMA 3MF6A 3EHKA 1ASJ1 4UB6Z 2JDZA 2D3PA 1ZZ6A 2Z0AA 5J48A 1RUD1 4C91A 1RXGA 1D2SA 2JWPA 3M3EA 2N05A 2GH2A 1GZCA 3VZOA 1PM4A 4FPKA 2BJSA 3JD73 3NNGA 1GNYA 1GZ9A 4DY5A 3OY8A 1B35A 3K3WA 1XNQO 5A3UA 5FKBA 3K04A 4DR1O 2DBNA 1BS3A 3WG1A 4OHYA 4K1YA 5FWEA 5L9VA 4Z1MG 1I7FA 3I2DA 4X8AA 4PLNA 4FPCA 2LRPA 3SPHA 5IK4A 3RFRA 3CIHA 5BY1A 1WMFA 1IBLO 5A1LA 1L0LH 1ND2B 2QEXV 3ASOC 1JU4A 4YZ4A 4HBNA 1PMIA 3WDYA 2VMCA 5FYIA 3WB2A 3Q4HA 3I2GA 2LW8A 1C28A 2WT0A 2XUMA 1CIWA 4EB6B 2WT1A 1S5LZ 2VZQA 2YXYA 3D0JA 2ERFA 2VVEA 3IMNA 2ARBA 4RQPB 5JDBA 1DQ4A 1WLDA 2HEVF 5I0RA 2VW1A 5J96B 1S0DA 1YJKA 5EZWA 1RUI1 4R7CA 1C8M3 1KP3A 3ZXDA 4YJ2A 1E5SA 1C5IA 2GV9A 1PIV2 4QKFA 4MHRA 3MZHA 3OGVA 2IUWA 4Q0UA 1DLCA 3AL5A 2V4AA 1DF0A 2ATFA 2BGPA 2J1AA 4FVMA 5FZMA 1VBE1 5IAVA 4COUA 5LRRA 3UKNA 4IGPA 5IHRA 4LF6B 4FFBA 1SHWB 4X89A 4DUYB 1NTKH 3VBOB 2DVDA 4DS0A 3LB9A 1TVKB 3FD9A 2WZ8A 4QHOA 4K0KO 2EULA 4D7YA 1N32B 4XBNA 1LNQA 1X8EA 1SA0B 2EIGA 4OHVA 2VQ0A 1AR72 4EN9B 1VBB3 4WM8A 3U75A 2RCVA 4H44B 2J1TA 2XT9A 2QZ3A 2C6SA 5A6QA 1AYN1 1PNLA 4CUAA 3PU8A 2CE4A 3VHPA 4N90A 3BN6A 1WMXA 3CBNA 2HWC2 2WSUA 2WO1A 5GJ6A 3ZFEA 3VBRB 5IYZB 1C8NA 1CAUB 4JHZA 1UIKA 1FV3A 2WZEA 3BCCH 1IOAA 1QNMA 3U14A 5F5AA 2HKXA 5FY5A 4CEWC 4DV1O 1YJLA 3GJBA 3TK1A 2VMFA 5CKQA 2BTQA 4JZ2A 3JZVA 4K9SA 1OQDA 2EZOA 2WLKA 1D4VB 4GZRB 2EXIA 4I2OA 4AL9A 3RWNA 2YC0A 4CSWA 1O3QA 4XJZA 4X64O 3TNPB 4IEQA 5FY9A 3ZPYA 4WVZA 4CUGA 2H0VA 3AMPA 4JI3B 2QWNB 3RYFA 1MA1A 5DDJ1 1SDWA 1RITA 3OY8B 4IUGA 5FPBA 3AZVA 3K08A 3OD0A 3ZSKA 4LF9O 2UYAA 1N4CA 3A0HZ 2G1MA 4PI0A 5CADA 2W0FC 3D3IA 3JATA 2JB4A 4IE7A 4COYA 2WLHA 5LEKA 1RMU2 1ORQC 2WR9A 1YIFA 1RIRA 2IFWA 4H33A 3LPGA 5FZ1A 2D3OW 3TN92 3J7MA 1O9GA 2WA3A 3H8UA 3VN4A 1UX6A 4ZI7B 4JYAB 5D8AC 2VQFB 3N2GA 4LEJA 4LULA 1BQ0A 4L99A 5A7SA 3Q4HB 1VAMA 1W8WA 2HJDA 1NCRC 1MZFA 5K9YA 2JDUA 3T2OA 4PDWA 3WDXA 4LIUA 1S0VA 1J5EB 4XBQA 2VZ3A 3K4ZA 1PL4A 5LA1A 1NA1B 5DABA 2Q4SA 2JDIG 4OQ8A 4UCTA 2JDMA 3E83A 2ZGQA 5HCFA 2QFEA 4BJ0A 4MH0E 2BFUS 4RWUA 2D97A 2PXJA 2OVUA 3FMGA 3E8BA 2DQ3A 2RS32 3SPCA 1ZYBA 4PA6A 2OQ7A 4ASLA 3KZIZ 4UBGA 3AG4C 2ADPA 1V54C 1AXKA 4MUVA 4TUYB 4OHXA 1NLQA 3GXUA 4QX7A 3ABKC 1LOAA 3JSLA 4P9LA 5J2TB 4QX5A 2R7EB 2VY0A 3QO7A 3LDRA 5JI7A 2VC9A 4AWDA 1P84F 4JGZB 1ZBE1 4JZGA 4JASA 1W39A 2HWD3 3ZXKA 1WBLA 2L6LA 4J9YB 5BYNA 2RS13 1RUG1 1AVMA 3H50A 1RHI1 3MF9A 3ZRXA 2W3JA 1QLEC 4XW3A 3OGGA 1E79G 3ZFEB 1LRHA 4NMIA 4NWVA 4GJYA 5CYYA 3FAVB 1BKZA 1Y76B 4CUCA 2R32A 4LO5B 1MR5A 1JOPA 5JMCA 4I55A 2BTQB 1UXZA 1S5JA 4MVRA 1BE3H 1N36O 3V0AB 3BABA 2QQUA 1WA8A 1LOFA 3MEPA 3K3NA 4UI9L 3AG3C 1PX3A 2A6VA 4TT3G 3MFAA 4N43A 3SISA 1UW8A 3IKWA 2ZGRA 1VBA1 2V72A 1IPJA 1JOYA 1XNRO 1KS4A 1F5JA 2Q73A 1QF3A 4IYHA 5JOZA 1AILA 3FB6C 2W46A 2BP6A 4CCMA 3SNMA 1PHMA 4MGTA 4B3SB 3VBBA 1YDXA 4DUZB 1H2NA 2WUHA 1Y4WA 4LLOA 3DXTA 3M7AA 1XU2A 1AR83 4EV0A 2IWGB 3NJVA 3CE2A 2VS0A 1XSRA 1AL0G 4IE6A 1V6MA 1RFYA 2QE7G 4JV5B 4JHTA 4CP0A 1S0FA 4BIFA 1NCQC 1LB2A 2YDEA 2YGLA 4RN5A 1W9TA 4EN0A 3TGUH 4NRMA 2DYRB 1BBT1 1QU7A 1LAJA 2VNRA 2ZX2A 5G05L 3H3UA 1GM8A 2RNBA 2ZE7A 4LO6B 1VRH3 2C24A 4LO7A 4FZ1A 1KQRA 5CKNA 3ALQA 1OLQA 1G86A 4LITA 2BTOA 1LR5A 5B2GB 4K8ZA 3U37A 3O7OA 5K0UB 2H6BA 2YHJA 1JU3A 3E22B 4AVCA 1FYUA 4OPAA 3HBZA 2FDIA 2YROA 3ASNB 2A6WA 4A3ZA 2HH9A 4Y24A 1V70A 2ZZQA 5I8SA 5DPNA 1HB4A 4Q4W3 4MZUA 1WAZA 1QJEA 1HR0O 4AQSA 1K5MB 3AP4A 4GB31 1GLHA 1MACA 1HJGA 3ZKUA 1BCXA 3V65A 1TQ5A 5SV5A 1ZREA 3QF7A 4LBQA 3J26N 1OBNA 4XUNA 2ZM6O 3V56A 1VPHA 2DUPA 1JW6A 4K1ZA 2Z69A 3CMEV 4XUTA 5A3TA 1CZSA 3DECA 5HCHA 2RR13 3RYCA 4XFCA 1YHFA 1NU1H 1T6BX 3IFXA 3D3AA 2HWF3 3VBSA 4IEOA 5T3NA 1JZ4A 2OA2A 1EN5A 3WQ0A 2RHPA 1PVC3 1GOFA 1T6GC 2K9ZA 1WA8B 2HWB3 4CDWA 4IV1B 4AAXA 5HBAA 3ZPOA 3OBTA 4AEDA 4YRDA 4N43B 1XQ8A 3TEXA 2XDVA 3G71V 3C90A 4BHPA 2GNBA 1WMEA 1QJX2 5CFCA 2CGOA 5A7NA 4DV3B 2DCKA 1UXXX 4MVOA 3ZYRA 4JV4A 4I0XB 3VBFB 4YM3A 4AI8A 3SKVA 3ZHUA 5C8YA 3W5MA 4MSWC 4N23A 4OMCA 2W08A 1PM9A 4X20A 1W9FA 3AKRA 2ZA9A 3HN1A 3EQEA 1TVGA 3AVSA 4CH5A 5A2QN 3DPRA 5JXGA 2PHFA 5BR8O 2XL7A 5H2FZ 1TUEB 5DM6V 4E2LA 4P9PA 4CDXB 1YEWA 3GBFA 5KMGB 1VBC3 4QT6A 3KMHA 3USUB 1W03A 3IM0A 1PNFA 3OJBA 3ZCCA 1COV3 3AJYA 3WOGA 2EINC 3L9JT 4QPJA 4CU6A 2Y34A 4HSLA 3CLPA 2RN9A 3WUDA 4ZHNA 2DWRA 4W4KA 1QOSA 5DUVA 1SRYA 2PHTA 5F8PA 5B1BB 4EJRA 3T2QA 4FOVA 5F9TA 3MBWA 4X1KA 1U97A 1AR93 5IVBA 3OMNB 1VMFA 4P9JA 5A3OA 3LPFA 2QA4V 2ARCA 2QQLA 3EBRA 4AW7A 2ZHKA 5T5OA 5FP4A 5CA1B 1N0JA 1A32A 1ZZ8A 4E4DX 5EXOA 3RZLA 1WPXA 4CP1A 5IYDO 2BVBA 3MICA 5EYPA 4KH9A 1KBHA 5JR2A 4FTBA 4YZ3A 3H3ZA 1BT8A 4Y4YA 1P4RA 2BYVE 3E5UA 4IV3C 1LU1A 1G9DA 3H8XA 3LQCA 2XVLA 4XACA 2PYLA 4GUNA 3OUHA 2Q4PA 1RYYA 1W90A 5H9PA 1UN1A 3THTA 1VJ2A 2WFPA 1LHUA 3MO4A 2WO2A 3OAAG 4I02A 4ES8A 2GUZA 3LGRA 3LA7A 3BA8A 1S2EA 4F3JA 4FLWA 1OUXA 1W8FA 4CDUA 4DXZA 4I4TB 2LALA 5CA0B 1ULDA 1B35C 1PGW2 4BXSV 5JPNB 1VQNV 2UXDB 1DGLA 4YVWC 5C3SA 1GU3A 4CYDA 1WKYA 3ABMC 4QPIA 4A7ZA 3DL3A 3NL1A 1XYPA 1HRI1 4BQXA 4FP2A 4JTDB 4LHNA 3S6PA 5FLJA 1IQDC 2H3OA 5DUWA 3E86A 4CDWB 1KD1W 2YICA 1GN6A 2FDKA 3HVDA 1MS3A 3SPJA 1FATA 2BGCA 3ZBHA 2RS52 5GONA 2YSUB 3STLC 5LASA 2W1WA 4P02B 4W4ZA 1ONAA 4A41A 2F1MA 4XJAA 1JXNA 2PHXA 1P7BA 3WX5A 5C8YB 1PKXA 2W1SA 5ANQA 3ECQA 4PI2A 1YFUA 2W2IA 3WVJA 3SXWA 4FPFA 4CZZA 5C9AB 1AF9A 1H0BA 4RUEA 1VQPV 4FJCC 4NJ4A 2CAZC 1M57C 1GTOA 1NXMA 4X66O 3TRSB 4NRQA 2IVJA 4RSUA 4AEJA 3AG2B 4CU9A 4K8FA 3QO5A 4DV4B 4F83A 4E4SA 1GSLA 5J3UA 2GHYA 3O1TA 1KEXA 4UAPA 2WC2A 1C8M1 2WT2A 4XUOA 4P14A 4QQPA 1LESA 4FI9A 2Z5WA 3LEMA 2A3XA 1EZVH 1DG6A 4QX0A 2GTAA 2EIJB 4EN7B 2NLRA 1TNRA 1UPGA 1K5SA 3AZZA 3A22A 3WQBA 2DCJA 4WM8C 1OCRB 1XPWA 5B5EZ 3R4SA 5LHHA 3UL2A 1BGYH 4QX2A 5E1RA 1S2KA 3FYEB 1FYJA 4QGLA 4UT5A 3BTZA 4Q4X2 1AX1A 4AK3A 5FO8B 1J95A 4KHPO 2JVDA 4A7YA 3EXAA 1VBB1 1RGSA 1BZKA 1WZXA 4FFIA 2BOJA 4XDJA 4X6RB 5C4WA 1UY1A 3P30A 4V1PA 2UUBO 2P2KA 3PDQA 4DR5O 2AXTZ 3MV01 5JCOA 5FQ0B 2R0HA 1FX5A 4CS2A 1VBD2 4QKBA 3GNEA 1M1KW 1AXYA 5DN6G 5TISZ 1OMIA 4PDVA 5H9RA 3OW2U 5DAWA 4MW3A 2DCZA 3UT0A 2N74A 3MDSA 4QB2A 4E2QA 2LFSA 2P22C 1W0OA 3RZGA 2YYOA 3PURA 5JXHA 4LF5O 2PAKA 2QDRA 4LH6A 1PO22 2KR2A 3MW4A 2ZBJA 2JRIA 4AF9A 1I5XA 1FKAO 2NP0A 3LFMA 4NRPA 4QPIB 3LDKA 2XWBB 1W2UA 5KX5A 2B9UA 3IAPA 3KT7A 1DQ2A 1ZZCA 5IVFA 4PIYA 4PDRA 4FIPC 2IW5A 1AXZA 1ASJ2 1V0AA 2QDOA 1H8EG 1RUD2 1NR1A 3OGSA 4DFSA 1LNSA 5JCTA 5GONB 4YW7A 5J2UB 3IDBB 5JH7A 4IHJB 5FY0A 2R1BA 1H1IA 3WDUA 4BQWA 4C0BA 2ARHA 5FZKA 1YITV 4EWEA 3BA9A 4PDWC 2VQEO 4IE5A 3LF7A 2ZHMA 3LDCA 4E8DA 4A5UB 1AI5A 3VBUA 4YM0A 4XFAA 1I94B 3PLQA 5CEHA 2XWJB 1GM7A 3WY6A 3BFRA 4QQLA 4HMZA 2RDQA 5C33A 2WFF3 1F15A 3CYOA 5KXEA 3VBHA 5IJ9A 1H1AA 2OT7A 4LF8O 1ZX5A 1APNA 4ISQA 1G7YA 1HDJA 4TSFG 4XFGA 3E2EA 3CJHB 4GKYA 5BNOA 1THZA 4QGPA 4BWAA 2GZWA 4I3GA 1ULGA 1IPSA 3RNSA 3ZO0B 4TV8A 2FDFA 1HV0A 4AYUA 3J8F3 4QE9A 3H0OA 4MVTA 2AHYA 1W8HA 2RMU3 1RUNA 2GP5A 3GDBA 3N9OA 1RUI2 1UY3A 1NZIA 3IB3A 1HLCA 2MEV2 5BNNA 1AP6A 3K2OA 1VBE2 4RR3C 5I0UA 2R071 4FPPA 3CCJV 4LBMA 1VQ7V 4RO2A 4K0KB 3POBA 4XHBA 1GZWA 2VUJA 3G7DA 1ZWIC 3I3QA 1IBMO 1WPBA 4W6WA 4RHV3 1QR8A 3QNEA 2ZOEB 2P4VA 4MTGA 1ND3A 1B6QA 4GX2A 3VKNA 2WWUA 3POJA 1N8RW 3ABLC 1AYN2 2VVDA 4CVUA 1XILA 4O7XA 3VKLA 4LFCB 2R062 1TME3 4ZS2A 1CP9A 1WCDJ 4ISRA 2VZOA 5FL7G 2A70A 4M00A 5FDBA 4XBFA 2B39A 5D5QA 4LBKA 5CB4A 1OCOB 4RA0A 5T5JA 5LBFA 1Q6UA 1JOJA 5DAXA 4OX9O 4CCNA 3KQ4B 3MIBA 1Y7BA 5CIRA 3C3TA 3IT8A 3BEHA 2ADEA 1TG7A 3ACFA 4IDZA 3JAKA 4JC1A 3ZDSA 3ZN4A 3WCRA 1I5PA 3OUSA 1V6OA 2Q8OA 4M0NA 2Y6KA 4FLXA 3W59A 4ZHQB 5FJHA 4L11A 2PLV1 2XKPA 4GWIA 5DDJ2 2B1IA 3X2QB 3I8TA 4HVRA 2IBZH 2QKCA 4PQ9A 4UW5A 3JARA 4FT8A 4O2BA 3T0BA 2QWPB 1S76D 3BPZA 4YZ1A 2ZJCA 3P3PA 1UMHA 3CCUV 2VCBA 3DGEA 1BSMA 3VBHB 4OLLA 1Y9GA 5LA6A 1XMOB 3I59A 3OPTA 5FLIA 3ME2A 1VRH1 4FM0A 2C1FA 4COVA 5FYSA 5HV0A 3C7OA 3HB3B 4FTEA 2VZRA 5BY5A 2CTVA 1OVPA 3SEPA 5FPVA 3ZVXA 4ZBMA 1OKOA 3N36A 1L1FA 1C1LA 2X29A 2RV9A 4NR1A 4UFJA 4E4HA 3IPVB 2UU9B 5HCBA 5DG1A 5LYJA 4DV6O 1XDCA 3B00A 4H2AA 3ZYBA 3CSXA 5CFDB 5A3NA 4Q4W1 3I3DA 1H30A 1DLBA 4OVEA 4KXRA 1LOEA 2JDPA 1JMUB 5IK8A 3ZYHA 1RUF3 1EFRG 1SFPA 2R043 2GDSA 4BQ2A 2WYFA 4E4EA 3VBSC 5LK5A 4B3RO 4XDPA 4MGIE 2Z2SB 5FYZA 3J7LA 5AVAA 2EAKA 2JDNA 2HWE3 4CEYA 1RUG2 2JG8C 4NPMA 1QOOA 5IY5B 3E8FA 1JTZX 2JD4A 1RHI2 5D2AA 3T1YB 4AQ6A 5CFCC 1A8DA 1MEC3 4BPZA 1R082 3AP9A 1PVC1 3O5SA 4CA9A 2ET7A 1GICA 2P90A 4QPGB 1BEV3 1UO9A 5JAXA 3WHUA 1GWLA 4ZIBA 3DYOA 2ZX3A 2JIGA 4RUFA 1QJU3 1K12A 1R6TA 4Z07A 3JUUA 3W7TA 3CMAV 1GWKA 3X29B 1W06A 3TXQA 4XYXA 1OCZB 3CC7V 1FOD3 3DPRC 4NAOA 3GHMA 2L9LA 1FMD3 2DVBA 3P3NA 1NH2B 3OD4A 5KHJA 3W7SA 1Q8VA 1YIJV 1LUVA 1ZRDA 3ZN6A 3N27A 1VBA2 3OBAA 1WWYA 1SQQH 3O1MA 3DUIA 2WO3A 4XF0A 2J1EA 4LIVA 2NMOA 1EAH1 2VBDA 2P4EA 1AJKA 3JARB 2HR3A 3LFIA 4CBCA 2WLMA 2FMYA 1VBC1 4UFLA 4LT5A 1AB3A 4JZRA 1GMGA 1YYNA 3JAWB 4B3NA 2ZIMA 2YFUA 4DEQA 1FXHA 3ETGA 1QU0A 3RZJA 5FPRA 3I59B 1D4M3 1UFIA 2P67A 1SQFA 2VZTA 4DXWA 4YFZA 5FREA 5DAQA 1F8VA 1BBT2 1J3PA 4GCZA 3K4DA 2WNVA 4N7UA 3HMYA 2ZXWB 3L74H 4PA3A 1N47A 1GKBA 5BNPA 3HT2A 1AR91 3JYCA 1UYPA 4P00B 4S2GA 3I2OA 3I3EA 4C1XA 5LYJB 2VG9A 5EHDA 2TNFA 1D5AA 3RYIB 5FZOA 3VDBA 2LP7A 4Q0VA 4HETA 4XCAA 3SR2C 4NYKA 3H7JA 2ZGSA 2Z4FA 2JICA 2V5YA 3WXPA 5GLVA 4CDUC 2JDHA 3ATGA 2FYUH 1UY2A 2HJFC 3L9DA 3B77A 2WZR3 1W3XA 3VDDA 1J3QA 3IDAA 1HXS1 2JG9B 3OTOO 3P32A 2WWJA 3SMHA 3A0KA 2E74B 3B7MA 5F3EA 1SF9A 3B9IA 5FP7A 1PZ7A 1OSGA 2IXKA 4GB32 1VB2A 2ZM6B 4C8DA 5HXMA 2G4IA 4CEYB 4JI0O 3MUZ1 1V9U1 4WFEA 2ATKC 3U11A 3AP6A 3OEAA 1RTVA 1QMJA 2W6JG 4EZ4A 3KGLA 3TAYA 1XUQA 4DYLA 3T3YA 4LPLA 3VB9A 2A71A 4BW5A 2P5OA 1R1A2 5A7WB 3VDAA 4KI5M 5CBHA 1GNHA 3OE7G 2Y6JA 1TUBB 5JSOA 4N9IA 2XJUA 3VKFC 4LOSA 3RVZA 4QQHA 4NKGB 3WR0A 1VF6A 1ODNA 1J1LA 2AHZA 5GZGA 4GX0A 3PVOA 4K3UA 4JX0A 5C5TA 1W6MA 4DV2B 2R30A 1EPWA 4DB5A 2NMNA 2D5FA 1GP4A 2FCUA 5FMOL 3ZN6B 1YLLA 3UCSC 4YGEA 5FZ9A 4AHYA 1J83A 3I2FA 2A73B 4I0WB 4LBOA 2KM2A 4EKWA 4YWAA 1K45A 1CZTA 3JQWA 3UGHA 4PBPA 1QGLA 4O2AA 4Y1XA 1RUC1 4R8CA 1OFSA 2D6KA 3WG3A 2JK5C 1B04A 4P9OA 1RUH3 1R1BA 1TNFA 2UY8A 3AXDA 2VTXJ 3CJIB 3Q8FA 1H8TA 2X5IC 2O8OA 5FIXA 4KU7A 1JJOA 2X10A 3E5XA 3T0DA 2ODMA 4GLXA 1I08A 4BR6A 5IVCA 1ZA7A 2YFZA 1K97A 1EN4A 2A79B 2OW4A 1WN7A 4DV5B 4PJ0Z 2W94A 3ES4A 3UNPA 1WJZA 1YI2V 2ES3A 1VQOV 3ZYGA 4AXOA 1OV9A 1R6KA 2B9VA 4FM1A 5C4WC 3VLBB 1O91A 2WNVB 4TTGA 2R9RB 4B8EA 3RT3C 4CPBD 1QDOA 3T4HB 4JAVA 4MV2A 1JZ3A 2Q8EA 4LF6O 2EAAA 3KB5A 4DUYO 1VB4A 1TAEA 1JJ2U 2HJIA 5I0TA 4NHKA 3K5NA 4LHKA 2CWMA 3IWZA 3RQ0A 4DQAA 1UZZA 1N32O 5A7QA 1W2AX 3ENRA 5EV7A 5KBFA 1ZA4A 1H2SB 4H55A 4CC6A 4GAZA 2RJZA 4QPYA 3MIEA 5JJEB 1B09A 3WDVA 1SLCA 4Y20A 4FMTA 2OCCC 3C7GA 3VBRC 2Q67A 2X7RB 4XTMA 4AOCA 3A0BZ 2VAUA 1GMMA 1JYVA 4OHWA 2ZEYA 4Y33A 2UUAO 5GLTA 5KAIZ 3ZRVA 1XBLA 4N53A 2O14A 1ULEA 4UYBA 4PHZA 2DYSC 5EZYB 1PMHX 3WF1A 5I91A 3K5MA 1YFWA 5LMUB 3UJQA 5EIBD 2OZJA 1HRV2 5JUVA 4K35A 1CAVB 4BCUA 3L73H 4LF4B 4E2SA 3AK2A 2F4VB 3ROUA 1BZWA 1LGNA 4WFGA 1YI7A 3WG7B 2Q7EA 3LDBA 2LFRA 5F5IA 4EROA 5IFPA 2W9XA 2FHRA 3BY6A 4FPHA 1FD9A 1K3EA 5FZDA 3SYPA 1KRIA 3FLRA 2MPFA 2AH2A 3IIAA 1UMZA 2I74A 5CU1A 1RVF3 4NWWA 3MIHA 4INDA 4UFIA 4MT8A 3VBUC 1J3RA 4JI3O 1QQP1 2QQJA 4TOIA 1AR1B 2OIGA 2W47A 1HRI2 1WD3A 4BIOA 1JHNA 3PN1A 5DAVA 5IAXA 4L92A 4HFSA 3IAQA 4XDLA 3JAMN 2YXSA 2JEXA 1H2KA 3KV4A 2Y69C 3WINE 4GKJB 4XTPA 3ETQA 3NJYA 5B4XA 1MVQA 1YSCA 4JKLA 4TLGA 3FFZA 1YZBA 4J80A 1KDMA 1DZRA 2WFF1 2QQWA 3D36C 1QIQA 4JYAO 3F7YC 2VQFO 2D5HA 3PVBB 5H9QA 1X4TA 5C8CB 2QDNA 1EZJA 4OUSA 2EILB 1LJ7A 4TXWA 4QMAA 5C3PA 3N3HA 4XILA 4NTXA 4DV0B 2D6LX 5BNNC 1J5EO 1DQ1A 2FZ1A 1OD3A 3O1PA 1L3JA 4Q0SA 1DYPA 4OCTA 2RMU1 5DZGA 1Y43B 3UV9A 2HVKC 4CP9B 3CMGA 4IYIA 3UT5A 4Z2AA 3I4IA 1UAIA 1C8M2 4ICGA 4YHHB 2XJPA 1NUKA 3RGBA 2IJHA 5B3SC 1W6OA 5HFLA 2YIDA 4FOQA 1IG0A 1UY4A 1W6PA 1MQTB 1PIV3 5T55A 1AR5A 5T54A 5C6CA 1W8NA 2P7TC 1ALYA 1G4YB 4ZS3A 2ARXA 4QKDA 4YW2A 5HI0A 4RHV1 3WW2A 3K79A 1T2XA 4NIDA 3UK9A 1VBB2 4XF4A 1WCUA 2A3WA 1BVVA 3V0BB 3AMQA 1I3HA 4ZU7A 4XUPA 1CIYA 2KQXA 1XMQB 3S7EA 2EZPA 2OCHA 1RJ8A 3K0GA 1AR73 4NXNB 3ORJA 5JXJA 3JD1A 2V5DA 4N53B 2DV9A 3H7YA 2EIKB 2ZGPA 2JENA 2VZPA 4FBFA 1CR7A 1W28A 3LE0A 2VWKA 4A2UA 5ABJB 4JI1B 5EBLC 1V55C 1WLEA 2QKDA 2E76B 1Q8QA 2CL2A 3OEHG 1UD1A 3HKDB 3JSNA 4LUMA 5GW7A 4LBJA 4A6SA 1F23A 4LNUB 4UCUA 1GN2A 4XMIA 4LKEA 1HNXB 4Y26A 3W7UA 2OXBA 4I0AA 1UKRA 2OYZA 4N8MA 2XBO3 2C0ZA 2PA7A 4UFHA 1QXJA 4ZU4A 1POV1 2Y33A 3SH4A 3HKCB 1OA4A 5FMOS 3CCEV 4LE3A 4B3SO 1PVXA 5LEJA 4DUZO 3WV6A 4JAUA 4HONA 4DXTA 3OPZA 3FHIB 2SLIA 2A6ZA 3CX5F 3T2PA 5A3LA 4F8AA 1R1ZA 4FLUA 3K4AA 1RMU3 4Q8LA 4YW1A 1P8JA 4JV5O 5FNVB 4OQ9A 1JZ8A 4ZXKA 2HVJC 1JHJA 3LOBA 4TQFA 4D7SA 3JBG3 1N3PA 4WVMB 4GMP3 1WBFA 2ZTNA 4QE7A 3TN93 1OVSA 5A6ZA 1FNYA 2N7GA 5KXCA 3Q8CA 4NHLA 1NZ6A 1XB9A 4AQTA 3VKMA 5BV6A 3J9SA 1F9KA 1NQJA 1KDKA 3KF3A 3ASOB 3L71H 5G04L 3L70H 1NY72 5FOBB 4GMP0 1GOGA 3HNBM 2QVSB 5D8AA 3CU7A 1XBFA 2RJLA 4H13B 4HN0A 4LJHA 1S5HC 4A44A 1QVGU 2JS5A 3CCLV 3E89A 1NCRA 4P30A 2RJ2A 2WLPA 3MAQA 3NQHA 3ZFGA 4MGKE 4HZFA 5ACA3 1WLCA 4UBHA 3ACLA 3M3IA 5F37A 2P3JA 1K5MC 2R041 3POFA 4F6RA 3T09A 1SQ4A 5LWBA 1BK1A 1QWRA 2XKOA 3LZZA 2VH9A 1IKPA 2A6YA 1EV13 5FBJA 4X65B 4JTAB 3GZAA 2HWD2 3ICXA 5E1AC 4UUJC 3AK0A 2HWE1 4FFFA 3VZJA 1DP0A 4Y4RA 2OX0A 2DMXA 3BTYA 3TEYA 5KWRA 3KCYA 2HLDG 2NM1A 5LBCA 3BGAA 4M3CE 4ATFA 1H4GA 2PMWB 5HCAA 2FTKA 3ACGA 2BVVA 2D98A 1YWKA 4Q8KA 2YPJA 1UNBA 1YI9A 3DF0A 2W91A 2VZ1A 5L7OB 3H1IH 1NTZH 1G6UA 5FUNA 1AROP 4ASKA 4EEQA 2H0BA 1H1MA 3RYKA 2PELA 2GNDA 5FZ4A 5JMOA 3TEWA 2CYFA 3WUCA 2VPVA 4LWSB 4O4JB 4Y5SA 3M99B 1VIWB 2CAUA 2ZMKA 1W0PA 2C26A 5JI9A 4CEWB 3PTYA 2LW7A 3ZHRA 1LR1A 1VP6A 4BQ3A 5J37A 1FPOA 2WWWA 2DW4A 2JE7A 4TSVA 5F2SA 2ZAAA 4HNAB 4CRQA 2XHKA 3LWCA 3NKTA 3JD3A 2VCAA 4YM2A 3LSEA 3PUHA 1BK0A 1RL3A 2YUEA 4NPRA 1NI8A 3VKOA 2PLV2 4WBNA 4BOWA 1M90W 1AZDA 4ITCA 1OF4A 1O3SA 5FZ6A 3FX3A 2X6CA 1SPPB 5CN0A 2WINB 5BNPC 3FX7A 1D4M1 5F2VO 1GKFA 1VQLV 5JVDA 4LBNA 2D2CB 1CPNA 1DQ6A 3GZUC 3BPSA 1DFQA 4FPLA 5AC91 4M3CA 1JYIA 4YJ3A 2JDKA 2IC1A 3BTAA 1FAFA 2ZCEA 1KKCA 5IJ0A 1D2DA 4I9WA 2HBUA 1CN1A 1FAYA 1VRH2 3O1RA 2O8QA 5D8AB 2IXCA 5FAXA 1VF5B 3OGRA 1OHHG 2V4DA 3VDDC 1O3TA 4GA9A 1YF2A 4BM8A 3ACHA 1NCRB 4IT5A 4K20A 1N33B 3NNLA 1SQVH 2GSMB 4HT1T 1Q8OA 5DXDA 4EE2A 5CBFA 4F4LA 3MIDA 2UXBO 2ZD9A 3KLSA 5H9CA 1JFFB 2MHFA 4D0QA 2XAFA 2BOCC 2XLAA 2Y0PA 1U5XA 1R093 4OHZA 4YIPA 1GQGA 4LORA 2ZX4A 4GT1A 4Q4W2 4XJ9A 2YC4A 3T1HB 2ZAHA 5FZ3A 4S2FA 1SBFA 4PF1A 2NZ9A 4AZZA 1MS8A 2K0GA 2XOKG 4YGBA 4PA9A 3K75B 2D44A 1AL23 3RWRD 3AG4B 1WP7A 4KGGA 1V54B 3WP4A 4MXWB 1IDSA 2XONA 1CX1A 5F5QA 1NKGA 3ABKB 3SKJE 5H6QA 4XEZA 5JWPA 5DEDA 3O1UA 1XQNA 2UXDO 2DVAA 5BPXA 4FFHA 1QJY1 2QTSA 2HWF2 4NE9A 3ZMNA 1MSWD 2CUGA 3KT1A 1BQZA 2EJRA 1PVC2 3AZWA 3HNYM 1KQSU 3N7MA 1QLEB 4GZ9A 4LQRA 1SC5B 2HWB2 4BK4A 5AVPA 5JPMB 2BNNA 2E33A 1SLIA 3ZMVA 2A7WA 4SBVA 3ZR5A 1ENXA 3OMAB 3OG2A 3OTFA 4AI3A 4JTOA 1DGWX 2V1DA 1GOHA 3HN3A 1H8TC 1IHMA 2TBVA 3I2JA 1NG0A 4OI1A 5DZEA 1XNBA 4QPWA 3RYHA 2XHBA 2WS93 4IEUA 4AI1A 4CUBA 2H8PC 3UM7A 3AG3B 1F7YA 4V2WA 2ADDA 1SESA 4JGYB 4QXHA 3EHBB 4HKLA 2FQPA 4CS4A 5FPUA 2GTSA 4DV4O 3ZR6A 2VW2A 3RWKX 1TA8A 1VBC2 1VRBA 4MOAA 2VZVA 4X1IA 2QKAA 2P4KA 2VOVA 1H8VA 1D2QA 3H9AA 3CB2A 2CTPA 4YJ3B 2CH7B 4OGQB 3RN4A 1RINA 1XNAA 5IJ0B 4CCCA 2GP3A 4ZZ5A 4A7KA 2VTXA 2F95B 4LMFA 4GKKB 1HNZB 1BL8A 1NCQB 3HEIA 1N3QA 1HX6A 1WMDA 4C1WA 2PFWA 3WG4A 1B3QA 2NQYA 1AR92 4AQYB 4JDNA 3WW4A 3ZIWA 2AZ5A 3HKEA 2PZSA 5LGUA 1W04A 4AEKA 3TYJA 2IVIB 3W21A 3JD2A 4H7MA 2JJ2G 3VL8A 1N1VA 3E6CC 5FLXN 4I01A 2QSAA 4R52A 3T08A 4XXPA 3KHBA 3DC6A 3GZEA 3IBMA 2DCYA 1N0NA 3E5QA 4YW6A 3POGA 2WLIA 2IJKA 2KXLA 1F5FA 4Y1UA 3WB1A 2GU9A 4KFMA 5FP3A 4NO4A 1QHDA 3WF2A 5J98B 5LA2A 1H8HG 3VUOA 3O0WA 3SCHA 5CVRA 1M5IA 3CO2A 3CWBH 4RQEA 1V9U2 4NIIA 1JH5A 3CRMA 2P1BA 1Q6IA 1H2MA 3CXHF 1JZ7A 3AZXA 1LHVA 1GP5A 1MOFA 3I2KA 5L3GA 2I45A 4BQ5A 3I97A 4ZOLB 3PVEA 2BV4A 4DV7B 4QKNA 4QHBA 1Y67A 1GR3A 5IVVA 5CBLA 1G9AA 2Z42A 3LIHA 4A6OA 2P6JA 3FKSG 1XE7A 4LE4A 4YVWA 5A1FA 4I50A 3O1SA 5A32A 1OPOA 5LMNB 3C8XA 3RYHB 2XTAA 2CV6A 1IZ3A 4UV9A 1I94O 2AENA 2EIDA 3C2UA 5FBZA 3BVCA 1I0HA 5ITZA 1LGBA 3G67A 4YFWA 2V73A 4FLYA 1O7FA 2ZHNA 1RUC2 4TWKA 1BLZA 2E7QA 5IK5A 1K9MW 2XB6C 4GH4B 3NAPC 4J7JA 5D5PA 4X1IB 4KUMA 4DR2B 1N1TA 1VQMV 2CTWA 2W68A 3OUFA 1GFF2 2ZT9B 2BU9A 1HP8A 3KKYA 4IEXA 1EN6A 1TE1B 4CH6A 5LP6C 4ZU5A 3UGGA 2VR4A 3WNLA 2MEV1 1U12A 4PBOA 1ZL8B 2CGPA 3B3QE 4CPBA 3JXSA 5B1NA 1KJLA 3JCZA 2XJRA 4AHWA 1JVMA 3R66A 1XSQA 4KWUA 1ST8A 2FL4A 5JQGB 5JOXA 2X05A 1RSOA 3LEIA 2EINB 2Z3YA 1VMGA 4Z2WA 3PHMA 4SLIA 1AI6A 4DUXA 4DRXB 5BXXA 1IXMA 2QR4A 2ZNIA 1T5EA 3W7XA 4RAIA 1W6QB 4Q4X3 4CXYA 4UF0A 4LOTA 5DZFA 1S3JA 2AZ0A 2VRZA 5KHIA 5KC5A 4CDQA 2DU0A 3LNNA 5FRAA 4RYDA 3RBZA 4PLOA 2ITDC 2Q69A 1GYKA 2R061 2UUAB 5EBWC 2EXHA 1LHNA 2R72A 1VMHA 1QH6A 3GZTB 3SJCC 3L2HA 4LFCO 3NV4A 3OSDA 4JI2B 3MV11 1VBD3 1VQ8V 3CRQA 1QNYA 1K33A 2FMLA 4JYYA 1OCOC 4X8PA 3A8TA 5APAA 1M06G 3POYA 2FCVA 4N9HA 1JR9A 1S4CA 4R9CA 4ASUG 4IV3B 3SLIA 2PAMA 3K5OA 2XR4A 3B5LB 3DKWA 4PDLA 4BQ4A 1HW7A 1OQEA 3T2TA 1XOUA 2P6CA 4TZDA 2B1GA 2B45X 3MYXA 2XBO1 2WQZC 1N34B 5LBEA 4DINB 3RJ2X 4LFAB 3KT4A 2PY5A 2JDYA 1RXFA 3WDTA 4JI6B 1B35B 2Y6FA 5C8WA 5T5LA 3DC5A 1QQP2 4L97A 4YVWB 4ONUA 3ABMB 3CJXA 4JF3A 4L0PA 4H7LA 1RUD3 5I8YA 1W8TA 2XQXA 4BW9A 3PTRB 3GJAA 4UFZA 2WLLA 1QEXA 3M2MA 3JBG1 1IX9A 4BK5A 3K0DA 4MVSA 4IGQA 2IH1C 2ZMLA 3J7NA 2WFF2 1XMOO 1KGYA 2B4KA 1FXKC 2UURA 1MS5A 3ZFGC 3NV2A 3AYCA 4AVTA 2VBPA 5L9RA 2YEVA 1VR3A 1NTMH 3SYQA 3SDLA 4H14A 3GB7C 1SCSA 4YJ2B 4IEZA 4KU8A 3F5TA 5ACA1 2KKWA 1S0EA 2UU9O 2RMU2 3NW4A 1XNCA 2JE8A 3CRAA 2D6PA 2VMEA 3ZFFA 4Y1VA 1LOBA 4FFBB 1G9CA 1RSOB 3ILFA 2DTYA 1WCSA 5FZEA 1IBKB 1ZNPA 2DYCA 2LGQA 1EV11 3VQXA 1IG3A 1OA3A 1RUI3 3K59A 2WA4A 1CAWA 4P9IA 4PIXA 1W05A 2J1RA 4O9GA 4UF0B 1PGL2 4W6XA 4B3TB 4Q27A 4WM8B 2UU8A 3WNKA 3JASA 2Q8DA 2JE9A 3M70A 4RHV2 3IC7A 1AX2A 3KWVA 4KGQA 3MUY1 1PGSA 1YFYA 1R081 5DMYA 2Y4TA 1MS1A 4RR3A 2DOSA 3T1YO 3L72H 1Y9QA 2P3YA 2Q5TA 1UX7A 4Y1YA 2JIZG 2JD9A 2ZKOA 1NLSA 4X6QB 1VARA 2EXKA 3DEMA 3K9SA 1AHSA 2EIBA 4DRVA 5FO9B 1RM1B 3SYAA 3MHHC 1OOPC 5FTTC 4RQFA 4MX3A 3U78A 3DKQA 1TZOA 3EYPA 1QDCA 1SQBH 1QQCA 3N2KA 4L8QA 4EFBA 3CP1A 1K8AW 4E4ZA 4X88A 4AFDA 1JODA 2E31A 2AYHA 4XC9A 3O0VA 5ERLA 1YQ6A 2QGNA 1O3RA 2I2SA 1XC6A 4WM7A 3ETDA 1Q8PA 3RYFB 1V6JA 4O4LA 1RUE1 1PNGA 4MSVA 2V09A 2AGAA 2FDJA 2JDAA 5LBQA 1E5RA 2ZEZA 4XXAA 5LXTA 1HQLA 4GWJA 3JATB 4OI4A 1KXGA 4JQRA 3GBGA 3ZRSA 3IDEA 2EBOA 2UXNA 2VOWA 2XAQA 4V2VA 3ZX6A 2QM8A 1YJWV 2PUSA 3TXSA 3ZSLA 2A0LA 4LCUC 3N2GB 2DUQA 4JI8B 4NB5A 2Y8KA 4IQPA 4YVSA 4U36A 2RQ6A 2ZPXA 4P5YA 4Z8BA 3EMRA 1UZVA 4PDWB 1SBEA 4Q6GA 2Y6LA 4DXRA 3CCMV 4B7KA 2YEVB 2A3YA 2QM4A 4O61A 2QQKA 4LUKA 5A80A 3SHRA 2DBIA 3NV1A 1Z2GA 1NVPD 2AEYA 1CESA 3O1VA 3AG7A 3AEIA 1GUIA 5HXVA 1JMKC 2ILMA 3KV6A 4DR7O 2JS3A 3RZMA 2DJVA 3FLTA 2R70A 4JI5B 5FYUA 3HQUA 1R091 4KP4A 4E8CA 5LRSA 2HYXA 3USSA 2WAMA 2WQ8A 2VECA 2OKXA 1NT2B 2JEUA 5EIYB 3ETEA 2IXJA 3O65A 5IE9A 4AFAA 5FYHA 1RUF2 2PHUA 1FPN3 3LDEA 1AL21 2YUAA 2R042 5TSWA 3GCXA 3I54A 1OH3A 1W0JG 3N9PA 3RYRA 1BXHA 2QTWB 4DO2A 3ZS8C 5GZDA 1DGSA 4XCBA 4CE8A 4KWKA 4RR3B 4Y3OA 2HWE2 1R1A1 4BIUA 3SJAC 4LKFA 1AR61 4QDRA 5KC6A 4LBQD 4I3PA 5FK8A 3ZSEA 3ACIA 1ZBE3 4I09A 1MEC2 2CSGA 5IFTA 1OA2A 4LFBO 2EIMC 3ZKYA 4I55B 1CPMA 5BZBA 1RHI3 4XMAA 4YGCA 4E2GA 5LOVA 1FV2A 1QOTA 1FFXA 2B5UA 2CU5A 2A1XA 2GMPA 3V64A 3N2KB 5BMVA 5CAZA 1U96A 1WA6X 4QWNA 1UYXA 4WCEV 2JG8A 3ABLB 1OUSA 1XYOA 3HNMA 4Q5OA 1AJPA 2Y48A 1STMA 3OB8A 4HOOA 4Q0QA 3HOBA 4DV2O 2QWQB 1FOD2 3OCPA 5B4NA 2IJJA 2WS91 2YZ4A 4C90A 1C1FA 4EZHA 2E9QA 3OGJA 5A7OA 1PK6C 1GQPA 4XQDA 1GANA 2VXJA 4LTAA 3CJIC 3QACA 3ZXJA 1R3KC 1XXNA 1NYWA 4GYCB 2EXJA 1FT9A 4KQ7A 2RM21 2F6BA 1IS5A 1Y74A 4WBBA 4U3JA 1VBA3 3CCQV 3ZMUA 5FO7B 4B4PA 4UFKA 2R9IA 4H37A 3AJZA 5K7PA 3AKTA 1H2GA 4O4IA 3S5AA 1BYHA 2A6XA 1ZZBA 2WNEA 1C4RA 3RDIA 1ACCA 5FYMA 3IJ4A 1JZ2A 3PJSK 4J41A 5H9SA 4CXXA 3OR7C 3U1XA 1R3IC 1D4M2 2VJXA 4DV5O 1NVPB 3H1LH 1S55A 1KS5A 4DO0A 2JB8A 5J09A 3AX4A 4MGZE 1L7QA 3ZM8A 2OUJA 2WIIB 1EUUA 3B9CA 3CEIA 5AC92 3FLPA 2DTWA 2KG7A 2ZQMA 3WNMA 3POIA 2XNDG 3L75H 1OCCC 3S57A 3B09A 1FS0G 4DR3B 3TWIA 2JKXA 5JR7B 2C9KA 1SERA 1KD7A 5FZ0A 5FCCA 3H9VA 2ZGTA 4J10A 2SBAA 2ZHLA 4R9BA 1BBT3 2VCCA 4Q1PA 5DN2A 5L9BA 4UW6A 3I5DA 5F39A 1LHWA 2UXBB 4HAMA 1V00A 1DDLA 3FYIB 4XZPA 1ZAUA 2DWEC 4XHXA 2A06H 2WZR2 3B93A 3BOPA 2BE3A 1FI2A 2PN5A 2BNMA 1FNZA 3APOA 2UXXA 4WFHA 3JALA 3M1HA 4Q4V3 1HRV1 4LBQB 1JN2P 2ZE8A 4YW3A 5LMUO 1W3VA 1CVNA 2HBTA 2Y0IA 3NV3A 2F93B 4BA6A 1UOFA 4LF4O 1MNGA 4ABMA 2F4VO 2DVFA 5I0SA 5JZGC 4G3YC 4MVZA 4P9WA 1ENSA 5FZAA 3DYMA 3WLUA 3RYCB 4AG4A 4BYYA 1SFYA 2WNUA 3SITA 3VBSB 4LBLA 1KITA 3VD7A 3G80A 1YC61 4CP2A 4AI0A 3NMBA 4DUWA 2KD7A 5GZEA 3D5OA 3U0ZA 3RVYA 3JD71 4MGQA 1S0JA 3IDCB 1QJY2 2RVAA 4AEDB 1GBGA 1OT5A 2WNOA 2JG8B 1NQTA 4UVAA 1NXD1 3DTUB 2CDYA 4RD7A 3JU9A 3K58A 2QE3A 5CFCB 2G38A 5FUIA 4E9KA 3T4ZA 5EPAA 3TCUA 2JECA 4GKJO 1PO13 3O14A 1QBZA 5FXZA 3ZDVA 3M3CA 4X20B 2EJ7A 4MVQA 3MI8A 3ZMSA 1M93A 3LA2A 5CBGA 4Q1RA 2K46A 4XZUG 2QCSB 3W5NA 4WFBV 1RUH2 2PGGA 4U3JB 3DPRB 4NN0A 1BJQA 1M56C 3CDZB 3R4UA 1YQCA 5IWAB 3VZKA 5FPAA 3HR0<