3FFQA

Hcn2i 443-640 apo-state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
184
Chain Sequence
SRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 51
structure length 184
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ffqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ffqA02
2HJIA 2VECA 2QJVA 3ACLA 1CAUB 5KHJA 4HVRA 4LLOA 3DV8A 3FHIB 5KHIA 1GQGA 4MZUA 4O9GA 5CADA 3USSA 2VQAA 1QY4A 4UBGA 1J3PA 3UKNA 5BY5A 1OD5A 3I59B 4Z82A 3LZZA 1ZRFA 1ZRRA 3WW2A 5I8SA 3HIFA 2GC1A 3SCGA 1UCXA 1YHFA 2Y0OA 3LWCA 3DKWA 4MGZE 4A2UA 4KL1A 4MGIE 3GBFA 4IEPA 4FT8A 3ELNA 4AVCA 1CAVA 4MUVA 4META 1OMIA 1YFXA 4NVPA 2ET1A 1RGSA 2OZJA 1RTVA 4JVAA 5AVPA 2BNNA 4YNIA 3IBMA 5LEKA 3H7JA 4LA3A 3BALA 2PAMA 4D7SA 1NE4A 4Q0VA 5JSRA 4IEVA 4I0AA 4KWJA 2F4PA 1ZREA 4QM9A 1FT9A 3PVBB 2OYZA 1CX4A 4YYOA 1QXJA 1ZRCA 3OF1A 5LRRA 1YFUA 4HVOA 3RDIA 3FZ3A 3EJKA 2IXIA 2K0GA 3KMHA 3LOIA 3WW4A 1OFNA 4ZU4A 1H1MA 5HI0A 2B9UA 5CU1A 1O3RA 3U11A 3CJXA 1Q3EA 1ZNPA 2GH2A 4L2NA 4QGLA 4BH9A 4DINB 4BYYA 4ONUA 1U12A 3RYKA 3MZHA 3CO2A 4HN1A 1XE7A 1VJ2A 3FX3A 2O1QA 2PFWA 2XHKA 3IWZA 3N4MA 4I02A 3EO6A 3E97A 1HW5A 2IXHA 2MHFA 2Q30A 3RPQA 2Z69A 5C8WA 2BNMA 1QWRA 4LUMA 5BV6A 4Q0UA 2CAVA 3CLPA 3UKVA 4P9GA 3NW4A 3E5UA 2IC1A 3FE5A 4MV2A 5KHKA 2Z2SB 3U10A 2ATFA 2QDRA 4TLFA 2XL7A 4AQ2A 5KBFA 1X8MA 1EYBA 1OI6A 2GC2A 2BNOA 4I2OA 2VPVA 1DGWA 4KWKA 4YSFA 5FQ0A 2IXJA 3LAGA 1J3RA 1FI2A 4XF4A 4IESA 3M3IA 4IETA 3JZVA 1PM7A 4N9HA 3O14A 2OPKA 5CVRA 1ZZBA 1Q5OA 2ETEA 3I59A 1EY2A 5F1RA 3WW3A 4HBNA 2MNGA 3OTFA 5I93A 1VR3A 2GU9A 4J1WA 2QCSB 2XKOA 3ROUA 1J58A 2PQQA 2XLGA 4HN0A 2UY8A 1G6NA 1CAWA 4ZU7A 2UYBA 1SEFA 4Q0PA 2WFPA 4KWLA 1O4TA 4XF3A 4LULA 5E16A 3R6SA 1LRHA 4XFCA 4F7ZA 3KCCA 1X82A 2GZWA 1ZRDA 3QOPA 4QGNA 5FLJA 5E1RA 2FQPA 4XETA 2H0VA 2XLFA 1Y3TA 1QXRA 2PAKA 3NJZA 3G7DA 3MPBA 2GC3A 1O7FA 3EQEA 5I0RA 3DN7A 4HLTA 1RC6A 5FPXA 1EP0A 2B5HA 2B8MA 1J3QA 3H50A 3HT1A 4E2GA 5KHHA 2PHDA 4LEJA 3U0ZA 3S7IA 2XGXA 1NZCA 4IEYA 3DL3A 2H6CA 3B02A 3BCWA 4AQ6A 4Q0QA 5JSOA 4MGYE 1TQ5A 2I45A 5LEJA 4XF9A 3SHRA 4JTNA 4I01A 2D5FA 5FDBA 1UPIA 4XFIA 1ZX5A 3CL1A 3NSTA 4I09A 4IEOA 3H3ZA 5I0TA 3SMHA 1J59A 1IPKA 1X7NA 4OFGA 1XE8A 1EPZA 3NL1A 4D7TA 4AXOA 5JCTA 3RYPA 5I91A 1WLTA 3LA3A 2DCTA 4PIYA 3BPZA 4EWAA 3HT2A 2ZKLA 4E2QA 1NXMA 4XF0A 4K8FA 3E5QA 3WW1A 4IEWA 5FLHA 3UKTA 2EAAA 3M70A 3S0MA 1I5ZA 2EA7A 4RD7A 3S7EA 5K8SA 1RUOA 1PMIA 2PHLA 2P17A 1LKNA 1YLLA 4EV0A 3H1MA 4EROA 3NVCA 3D0SA 2E9QA 2OZ6A 3D0JA 3SXWA 4IERA 4MGKE 4QXKA 1J1LA 3VHRA 5D1IA 4HSLA 3SCHA 3KSCA 4HSJA 4HVQA 2CAUA 5FLIA 3RYRA 4QX5A 3GYDA 3LA2A 3E5XA 4N9IA 4XFAA 4UBHA 4EWEA 3C3VA 3KGZA 3H7YA 1O5UA 4AVAA 4H7LA 1DZRA 2Q4SA 2MPFA 4ORFA 3H3UA 1Y9QA 2D5HA 4YRDA 4PIZA 1CAWB 4F8AA 3FWEA 3I54A 5FPZA 4IEXA 4AVBA 1I6XA 2XL9A 5KHGA 1UIJA 2BYVE 4XF1A 3HQXA 3OGJA 4QM8A 1IPJA 2GC0A 3KGLA 5LRSA 3H1WA 1LB2A 1DZTA 1YFYA 4I3PA 5J7MA 3CF6E 4R52A 3QACA 4JV4A 4ZU5A 1SFNA 4L11A 1CAXB 1CAVB 5JAXA 4XFBA 1UD1A 5FQ0B 4MX3A 3BU7A 4IEZA 5J3UA 3SCFA 5I0UA 4HZFA 1NE6A 4IEQA 3CEWA 3H8UA 2WC2A 2XKPA 1O5LA 4E2SA 1UW8A 3FFQA 1ZZ6A 2PYTA 1GQHA 4CYDA 1CGPA 2IXCA 4O9EA 1WGPA 4I0BA 1L3JA 3OD0A 4OLLA 4UXAA 4LA2A 5I8TA 4Q29A 2C0ZA 4IEUA 1CAUA 4R8HA 3ZDSA 3EBRA 1Q43A 4PJYA 5J48A 1RUNA 3IDBB 5I0SA 2K9ZA 2QNKA 3FJSA 4LTAA 4PIXA 5BPXA 2KXLA 4KU8A 1UIKA 1ZVFA 5C6CA 2O8QA 1NYWA 1YUDA 2PAEA 3L2HA 2D93A 2XLAA 4FBFA 2UY9A 2GAUA 2N7GA 5FCCA 3IDCB 4X6QB 3H1YA 4MH0E 4FAGA 1YFWA 5JR7B 4HMZA 2OA2A 1FXZA 2H6BA 4WVZA 4GULA 1YWKA 4XFGA 1O3SA 3ETQA 3E6BA 2HKXA 5BUVA 2ET7A 3TNPB 4JTOA 4X6RB 4J1XA 3RZZA 1O3QA 2Q0AA 1LR5A 1VP6A 2IXLA 3ST7A 3RNSA 4YARA 1ZZ7A 3IIAA 3OCPA 3ES1A 4QGMA 3PNAA 5T3NA 4Z07A 5BXXA 2EVXA 1H1IA 4XEZA 1DGRA 2CGPA 1SQ4A 2QVSB 5EFUA 5EZWA 2PTMA 4Q0SA 4LUKA 2ZCWA 2IXKA 3D82A 4EWDA 1O3TA 3LA7A 4XFFA 3E6DA 3PLQA 4KU7A 1CAXA 2D40A 3H9AA 1ZZ9A 2UYAA 1JUHA 3MDPA 2BGCA 4XFHA 1V70A 3I7DA 4QMAA 2CV6A 2FMYA 1RL3A 1ZZCA 3E6CC 1ZZ8A 1WA4A 3NKTA 4BHPA 3TNQA 1XRUA 2V09A 1X8EA 5JSPA 3BB6A 4FAHA 5I8YA 3MYXA 4WBBA 2Q1ZB 4WZCA 4B29A 3EHKA 2PA7A 2BEOA 3ES4A 4BIFA
chains in the Genus database with same CATH superfamily
2VECA 4GB33 4JGYB 1L7QA 2W3JA 5B1NA 4WFAV 1DF5A 2QM8A 1ST8A 3A23A 4M4RA 4E9KA 3RBZA 4JC1A 3WINE 4X64O 1TUBA 2JGDB 5F5AA 3UL2A 1VARA 1ENSA 2E6VA 3F5TA 3K3NA 5FYIA 2FDIA 1WMFA 4GWNA 1XYOA 3ABLC 1R3JC 3J7AU 3T0DA 3J8F1 4FZ1A 2WA3A 2VMHA 1IXMA 3U07A 2C5DA 5FZLA 1LULA 3SPHA 1C5HA 2WS91 3VBRC 1MSWD 2FMLA 3K77A 1XU2A 3AKPA 1J95A 1IPSA 4C0BA 3DC5A 1QNYA 2X05A 1ZRCA 4WM7A 4HK9A 4V2VA 3Q4HA 1ASJ3 3LOIA 2PXJA 1FJGO 1GNYA 5F5CA 3J7HA 5KUMA 4BPZA 1LEDA 3U11A 1LAJA 2OUJA 1VQ6V 1OLMA 2WQ4A 2ZM6O 3QD6A 4D8MA 1PGL2 2BERA 1XE7A 5LGNA 1R73A 2RMU1 4K9SA 1LUVA 1H6YA 4AQYB 5E88A 4BXFA 5KMGB 3ZS8C 4OHZA 1J5EB 1GZ9A 3JCIA 4P5YA 1SZTA 1K5MB 2RR11 4AE2A 2X6BA 1HQNA 2A71A 3U10A 1PMJX 2BQPA 3O7OA 5BZBA 3WHUA 2J1RA 4PLOA 3FLRA 1YQ6A 5KWRA 2ZD9A 4BAYA 2IXJA 5GONA 1UN1A 2VMGA 3DEMA 1GM8A 1AL22 5CFCC 1PD3A 5LYJA 4E4SA 2X5IC 4AILC 1MACA 1RM1B 2ZGTA 1RUG2 5FZ4A 5H5NA 2CTVA 4FPHA 2ARAA 3DXTA 5FL7G 1HB2A 1M57B 4XTMA 3PU3A 4ARXA 3JYCA 3BFRA 4I3GA 2BTQA 2XHBA 5IT6A 1NS1A 2XBO3 4MVTA 2Z5WA 3WG7B 1RVF2 1MMMA 3U0ZA 2PY5A 1V54B 4PBPA 3VBRB 2I45A 2WLLA 3L71H 2P5BA 4OUEA 4CH5A 1Q86W 2V4DA 4I55A 1FFTB 1PPJH 1WLCA 1W0JG 1V0AA 2JJ1G 1OPMA 4CCOA 2NLJC 3I3DA 4GMP3 1XE8A 1VRH1 4UW6A 3ICXA 2ZTNA 3X29B 2ORXA 2W1SA 2BFUS 3BRCA 1N34B 5C8CA 3B69A 4UF0B 4RWUA 3TETA 3R05A 4FZ0A 2GNTA 5K8SA 1LKNA 2VBPA 3W5MA 3D0SA 3SJQC 4ZOLB 3ABMB 4UCUA 1VBC1 2J1EA 4URTA 4CP9B 4XDJA 4YIPA 1RUJ3 2W52A 4CEWC 4QDQA 1S0VA 2B1IA 3ZXJA 3WQ1A 5FUIA 5LBBA 1NI8A 5A6QA 1U5YA 2MEV3 1URFA 5GTIZ 4X89A 2XQXA 4AVBA 2XPJA 1PIV1 4J9YB 4HANA 1FXKA 4BQ1A 2HEWF 2OTJV 5DUWA 4ES9A 4L11A 1ZUQA 5LL6Y 3LEGA 4XFBA 3WDVA 5JH7A 2CH7A 2QKDA 4WFGA 2PLV1 2LFSA 4GAZA 1GWLA 2YYOA 1PM4A 4DOUA 1F4HA 1T2XA 4GMP1 1I9RA 1ULEA 3HWJA 1GLHA 4CDXA 4E4DX 2JDMA 3ABZA 4I0WB 4CCNA 1N36B 1O91A 4PQ9A 1POV1 1S0GA 2QNKA 3K03A 3THCA 1KDKA 5FYYA 1DGWX 1D4VB 5SV5A 1BEV1 2DYRC 4OQ9A 1HNWO 4A5UB 1COV1 1CPYA 1AR83 2G1MA 4QKBA 1Q56A 3E2EA 2H0BA 5A9GA 1O3SA 4CH6A 3OBAA 1EAH3 2WAAA 1D4M2 2EALA 1H2LA 5CAZA 1QOOA 3GZTB 1QOTA 2VCBA 4GKKB 4DUVA 4UT5A 2ZNJA 3V0AA 4EN0A 4BR6A 2UYAA 3O1TA 3MV11 5KXBA 1JTZX 4DV3O 4UCTA 1ZZCA 4UOJA 1MR5A 4CDWB 3E6CC 1WA4A 3NV4A 5C3SA 4UVBA 2CAZC 4JGZA 2R9IA 1XDCA 5ABJC 1Z78A 1YEWA 5I8YA 3ZIWA 1JQ0A 5T5OA 4P02B 3L72H 4J9ZB 2HWD1 1CX1A 1TZOA 3DV8A 2EIMC 3GCWA 2RS51 1GZWA 1OA3A 2JJ6A 5FZIA 4QAWA 5BY5A 5I0DA 1WUVA 1WW4A 3QBQA 3VOUA 3G6EV 3MW4A 2G38A 1ENRA 1ZLZA 2GC1A 3OJBA 1VBD2 1S3JA 2G9GA 5EYPB 3RN4A 1Y43B 2DCJA 3GBFA 3ELNA 1Q6IA 2W1WA 3K0DA 3CZJA 3I2HA 1QMJA 2DFCA 4NVPA 2A3WA 1SQGA 4CDWC 3W7TA 5DG1A 2LW1A 1QJY2 2EXHA 3A0NA 2JD4A 3CKHA 3FN9A 4CE8A 1N34O 2Q0OC 4LH6A 2CTQA 4KWJA 1XL4A 1ZBA2 3M7MX 4H2AA 4MGTA 1F7YA 4MTXA 1HDKA 3G6BA 5IVBA 1WB7A 1YI2V 3CE2A 3B94A 3H0OA 1Z7S3 4ZU4A 2VNRA 1H1MA 1RPRA 1C5IA 3IKWA 3K57A 5LBQA 3WDUA 1GKBA 3GNEA 4DO0A 1Y67A 3SYOA 1W8UA 1JOBA 3SJBC 2FZ2A 5AC93 1QWRA 4LUMA 1MABG 1GICA 1XEQA 1HB3A 2ZX1A 4GD4A 3UKVA 5T5JA 3N9PA 3PJSK 3O1UA 1UY1A 4HNAA 5C4WC 2XR4A 2VQFO 4LF8O 3FLTA 1I5YA 4KFMA 4RFT0 4LFAB 2GC2A 4D6TH 3POYA 4DR5B 3RFRA 3K0GA 4R9BA 3RYFA 4N21A 2OPKA 4J7JA 4QX8A 3POIA 3ZCCA 1K5SA 4HBNA 2GP5A 2J1SA 1VR3A 1VBD3 3NJXA 1W3XA 3ZN6B 2DOSA 4GZ9A 2DCZA 3HPLC 1LGNA 2O57A 4CXWA 5IT9N 1BMFG 2VOVA 5LA9A 3DKQA 1O9GA 1XNDA 3AK1A 2H0VA 1Y3TA 3FKSG 4MVMA 3CX5F 1CJDA 5KHHA 1XQNA 3ASOB 4DR4B 5DAVA 4GWJA 4LCUC 3I8TA 4JI2B 3T2QA 1IBMB 3ASIA 5LEJA 1BBT3 4QPWA 3HKCB 1ZX5A 3NSTA 1IPKA 1H8EG 1MVQA 1SFPA 2QZ3A 1F8VA 1L8DA 3ZYIB 2YC0A 1IBKB 4CS2A 1UOBA 2D6PA 4U3FH 1O8PA 4QU2A 3RZLA 4LQRA 4E2QA 2Z0AA 1ULCA 2R9RB 5KAIZ 3GVMA 4K8FA 4YZ5A 2J1VA 2R042 4S2HA 3S7EA 4RS5A 5CB4A 3WNPA 4I0XB 2CGNA 1PK6B 2W47A 2EIJC 5BNOC 5GLTA 3PIGA 4PDRA 2E9QA 2JG9B 2OZ6A 1ENVA 1W99A 5DG2A 5B5EZ 2X8KA 5K9YA 5CA0A 4P00B 3WG1A 2P6HA 4EN8B 4LP8A 4L8QA 3KV5A 2A79B 4XIKA 3CXHF 5JCOA 3DYPA 2PHTA 4CSWA 2RJLA 1FNYA 2Y34A 4PELA 4ZOLA 2V1DA 3QO5A 4I4TA 3NAPB 2QE3A 3GB7C 4Y20A 4XJWA 1QNMA 4HZFA 1JVMA 3VZLA 4DV1B 3AG2C 3C3SA 1POV3 4CZSA 5JQGB 1BCXA 3BGAA 4O9EA 2X29A 2WNEA 4LKDA 2FDHA 2C6SA 4QKFA 2XJRA 1IG3A 4B08A 1FPN2 4BQ5A 3WP3A 1QJX2 2GMPA 5B4XA 3S5AA 1Y74B 3N2GA 1B06A 1AR71 1NY71 4I55B 4GKKO 2OKXA 3KG2A 5BPXA 1C57A 3IAYA 1KQRA 2LS6A 4NIGA 3ZMUA 1PO23 4FSJA 2VW0A 2RS11 2JWPA 2E5LO 1UL9A 1U97A 3ETGA 1JYNA 4JI6O 2UY9A 4MVZA 2GAUA 1NLSA 3T0AA 3ZFFA 3AM2A 3H1YA 4MH0E 4OUMA 2BTQB 1VQ7V 5F3CA 1C4RA 2VOTA 1AR62 4Q8KA 5DEDA 3CRQA 1VP6A 4I50A 4NXNB 1W2OA 1XBFA 1PX3A 3B5LB 1AJKA 2OWOA 1K3EA 3PHMA 3ORJA 4FP2A 2AXTZ 5FO8B 5JZGC 1KC8W 3SH3A 3AVRA 3I49A 3LSDA 4K0KO 2DFBA 3RMXA 1H1AA 5FWEA 1BBT1 2UWBA 1JCHA 2TBVA 4BXSV 4DR7B 3UYJA 5FOJB 3SEPA 4LBQA 4AGRA 3WP5A 2VQEO 1WMXA 1LR1A 3K9SA 3MIHA 4AWDA 2ZEZA 2YEVB 3L2YA 4S2DA 4WBBA 3CCMV 3FB5C 4X62O 3W7UA 1JOPA 2W6IG 3CJHB 3I2OA 3NRUA 3BHPA 4W50A 4B3TB 4MZUA 3K08A 1KD1W 1I94B 5AFBA 2HWE1 2OT5A 1DGLA 3IB3A 2G4IA 5B2GB 4ZPIA 4PHZA 3WW2A 4CS4A 1KKDA 4JYAO 1AP6A 5JZGB 1RYYA 3B77A 1SMVA 3I3EA 4K40A 1ZX3A 1Z5VA 4Q4W3 4IEPA 2ARCA 2E74B 4JRLA 1L7LA 5C3OA 1AROP 1K92A 3J81N 2OUHA 4W6YA 2EIDA 4Q0VA 5LGTA 2XVLA 2Q7EA 1T5EA 2ZHMA 4YY3O 1NT0A 1CX4A 2XBO2 1WKYA 1YQ5A 4YYOA 5B3SB 3OF1A 2E7AA 1SRYA 1NVPD 2NMOA 1AYM1 4SBVA 2OTLV 3JD0A 3M8AA 3W7SA 4KUMA 4ONUA 3MZHA 4JI0O 4Y1XA 4IYHA 3SH4A 5JMCA 2GTSA 1MQTC 4WVWA 4O2BB 2JS3A 5T5PA 2JKXA 1QQCA 2W94A 3N4MA 2A9HA 4ET7A 3OGVA 4XHXA 1RSOB 1VQ9V 2B5UA 4IQPA 3NW4A 3PUQA 4DV1O 1UJWB 3ZYPA 5B1OA 3MHHC 4TQFA 3AJYA 4LNUA 1PO12 4FMTA 1X9TA 2BNOA 1GR3A 1NA1B 5EYPA 1DGWA 4X1IA 4XF4A 4OHVA 3STZC 2WNVC 2DBIA 2YXSA 1GAXA 4JDMA 5FYUA 2RNBA 2XOMA 3EXUA 3ZR6A 5JMOA 2GU9A 1GZWB 3RYIB 4DRXA 1Q81W 4BU2A 1J58A 4FM1A 4AFDA 1MS8A 3VBUC 1YI9A 1SEFA 4H37A 1SQBH 1AXZA 1OOPC 4AHXA 3JATA 3VD4A 4B8EA 4O4JA 3ZXAC 3C2UA 3GWKC 4UW4A 3RZHA 3DN7A 5J2TB 1HX6A 4IV1A 1C8M3 1J3QA 3KLSA 2PHDA 4PF1A 2XGXA 3A22A 3K06A 1YSCA 1CZSA 3WV6A 2Q73A 4JDOA 3M99B 2WFF3 3AKSA 5CB7A 2A7WA 1PX4A 1YQ2A 2WNVB 1AR63 2JDNA 3ZMOA 1G9DA 1PGW1 3CNAA 3MGUA 1AJQA 3ABTA 5FP7A 4K8RB 2RDRA 2ZX3A 3B01A 3MHSC 2UU9B 2WWJA 3BN6A 1ONAA 3POEA 4LF7B 1B3QA 2EAAA 4Y22B 4BW5A 5B1BC 2QQPA 2Y64A 2R1DA 3RVHA 2BFUL 1SKVA 3MPPG 2VG9A 2CTPA 3WG7C 2ZX4A 2BPA2 1K45A 4RYDA 5KC6A 4XFAA 4UBHA 5LATA 4H7LA 3ZJZA 1EM1A 4CDQA 4JI8O 2VZRA 3I54A 5F6KA 5IK5A 1SQVH 5HV4A 3PUHA 1E57A 1BHAA 4DV2O 5IDJA 3KGLA 1ND3C 3H1WA 3CCJV 1ND2A 4N43A 3E1F1 2VH9A 4PD4F 3RJ2X 1GWMA 1AR5A 3QACA 1KU9A 4ZU5A 3DCQA 2O14A 1N3PA 5A3MA 2VTFA 5JH7B 2X0LA 2RS13 2ITCC 1PO21 5FMCA 4Z2AA 4JI6B 1UW8A 1GQHA 2DW4A 1AR81 1VQNV 4FTBA 3GJAA 3WG3A 3B9IA 4KBZA 2C0ZA 4IEUA 2ARBA 2P1BA 2QWRB 3EVKA 4L97A 2P4KA 3ZRVA 3URFA 4OX9B 1RMU3 2P4VA 3ABKB 3BTZA 1W04A 4P30A 1VQOV 4KU8A 3N9LA 2GP3A 5C6CA 3O9OA 5IYYA 2BOBC 5CKNA 2ZEXA 3UJQA 3HKEB 4YVWC 2LROA 4QXCA 1RUH1 3AKTA 4D6SA 1YIJV 4RQPB 4X6QB 4FAGA 4WCEV 2OCCC 2Q5ZA 2VMCA 3LEMA 4DV4B 2RDCA 3CB2A 2F43G 4L9BA 2WT1A 4X6RB 3VBFA 3EYPA 3ST7A 2J42A 5L73A 1IURA 4JI5B 1HRV2 1JZ7A 1JJOA 3OCPA 3CQOA 4GKJB 1HB1A 3AG4B 2CGPA 2ODMA 1XPWA 5JOWA 3OE7G 4PT6A 4EN9B 2E3CA 4OZOA 1O3TA 3JALA 3WDXA 2BUKA 1M9NA 4X66O 1VE0A 1CAXA 4HT1T 4UAPA 1S0CA 1SG3A 1JUHA 5HFLA 1CIYA 3HQRA 1AP5A 1NBMG 3LD8A 1HJFA 4LNVA 4IHJA 4N23A 3PTYA 1AF9A 4CCEA 3FD9A 4NXMO 1VBE1 3B2EE 3AK0A 2WLIB 2Z79A 3ZSJA 4WM8A 1FAYA 2JDKA 1K8AW 3N2KA 1W9SA 5IK4A 3ES4A 4UFKA 5IK8A 3ZFGB 4NWWA 5KHJA 3MIBA 1PIV2 2XDVA 1LEMA 3AG3B 1GQGA 2QUOA 3I2FA 5CZKA 5BNPA 4JI8B 1WLWA 1OD5A 4COUA 5FKCA 4DXTA 2PF4E 3KV4A 2V4AA 4TT3G 3SCGA 2EIEA 2UXCO 2MEV2 2Q68A 4A2UA 5GONB 4M0NA 2J1AA 4LBNA 1YHQV 4FT8A 2HP8A 2IH1C 5FNVB 3AFGA 4GX5A 2AENA 2IFWA 1VMJA 2HWB2 1CESA 3KWVA 4LF4B 4TV8A 5FZOB 2F4VO 1FYUA 3WUDA 5AVPA 3RYCA 3D36C 4S2FA 3T1CA 5GALA 3CSXA 1YF2A 4UFMA 4YHHB 1GM7A 1X4TA 1U96A 1AUYA 1FXVA 2Y69C 3VKFC 1W06A 4DUXA 1LODA 2HLDG 2JDPA 3MFCA 1OFNA 2JX9A 1FFXA 2WZPP 1HQLA 1JBCA 3VD7A 1AL21 1FATA 4BH9A 3IC9A 4H33A 1EN4A 5L3CA 3HKDB 4U2AA 2B39A 3VBHB 4J6GA 3ZMNA 1FPOA 2VQFB 2MHFA 3UJOA 2Z69A 5LBFA 3BKZA 5BV6A 1BVP1 4Q0UA 1ZBE1 2UWCA 2XAHA 4CEYC 1UYPA 2ITDC 1YTFB 3FLPA 4YZ4A 5GKAC 4QPJA 2YBPA 4GJZA 4TWTA 2WO3A 1XNKA 3PVOA 4LK6A 5A3LA 4NXNO 1S0FA 2GDSA 4AAPA 5LA6A 1G8WA 1SLLA 4JQRA 5LBEA 2XG3A 4CEYB 2JDZA 2PMWB 2QQJA 2HWF2 2XLGA 4HN0A 3WX5A 4LORA 1I5PA 3UM7A 5E16A 3CCVV 3R6SA 5A3TA 3MI8A 5FLJA 3FAVB 3OR7C 1APNA 3EQEA 3TN93 4ZY9A 5ANNA 3QO7A 3UGHA 1QXPA 5KX5B 4NR1A 3X2QB 3R0RA 4CCJA 1TMF3 4ZZ5A 4IDZA 3TEWA 4YPJA 4Y5SA 4FPFA 3KQRA 1ND3A 3JU9A 1GANA 3ZYGA 3IIIA 2R073 4PV1B 2IZWA 4IYIA 2Q1MA 1H8TA 3OGRA 1VMFA 4PDMA 1ZM1A 4LPLA 4XTPA 3TN91 3V0BA 1ULFA 1TME2 2PHLA 5DN6G 4LF6O 3NO8A 1QJY1 5FYTA 1GNHA 5C5TA 1PKXA 1ROPA 2XNDG 3ABLB 3HNMA 2CAUA 3C3VA 4JZRA 2A70A 1AVBA 5F37A 1OSGA 5IJ0B 1RFYA 1HJGA 2VUCA 1NQTA 4IEXA 3N9NA 4HK8A 1YNAA 3AP9A 4UI9L 5ITZB 1UY3A 4AHZA 4N53B 1PO11 1REDA 3LCPA 1AR91 4XHBA 5TSWA 2ZM6B 3E22B 3NQHA 3CD6V 4NAMA 4JHZA 1I94O 5FPOA 5BY1A 2XKPA 3H8UA 4AK3A 1VAKA 2PYTA 1J5EO 2EINB 3HR9A 3AG1C 4JV5O 3C7HA 4I0BA 3LSUA 2Y0PA 3FB6C 4M3CB 2Q8VA 3B8NA 2RS53 4D3WA 1XMOB 4AI0A 2ZDIC 1JHJA 5EQUA 2FMDA 3U1XA 2SLIA 2F4VB 3G71V 5B1AC 1MS9A 1H30A 3NKGA 5FZFA 2CSGA 4A45A 3G67A 3BAAA 5BNOA 2C1FA 5L7OA 4BQYA 5DDJ2 3JD4A 3LDCA 1IQDC 5J1XA 2W6JG 3HR0A 1K5JA 2VZQA 4ZKIA 3ZYJB 4ITCA 1COV2 4ASUG 4IE7A 3WEZA 5H6RA 2R062 1ZZ7A 4K1YA 4ZI7B 2UXDO 3BA9A 1NU1H 2KG7B 2ZIMA 1LU1A 2WR9A 5BXXA 1H1IA 4GYCB 3DC6A 5ACA1 4L87A 1ODNA 4LUKA 4LO5B 5C8YB 1RUG1 2R6QA 4KU7A 3H9AA 3E83A 2VUAA 2P4EA 3LDRA 1W39A 3T2OA 3PDQA 4TLGA 2K46A 5LMUB 5LHHA 3WHTA 4TSVA 2QQWA 1SA0A 4DV7O 1CJPA 2YPJA 3ZYRA 4EKWA 1GOHA 4BHPA 1Q90D 3ZXKA 1R082 3D3QA 3GHNA 4ZS2A 4FLVA 5IJ9A 2IFRA 2AZ2A 1XOUA 2YXHA 4TWKA 2PA7A 3LFMA 1NQDA 4B3SO 4HVRA 3ACGA 1EPWA 3JAKA 4QE7A 4J7KA 4X20B 3VBSA 1AI4A 3J80N 1N3QA 1J3PA 5CYYA 4Z82A 3WF4A 3CCSV 5T52A 2P3JA 4C0HA 2E33A 3RSJA 3IPVA 3FYEB 4WFHA 5EP9A 4MUVA 4A3XA 1GYKA 3ZFEB 1WAZA 1FMD3 3WG4A 2WWSA 3APQA 2VVFA 4LT5A 5LEKA 3BALA 4O4IB 2JDYA 1AZDA 4CU8A 2F4PA 3MW3A 4OQ8A 3MW2A 2VMFA 2L6LA 1C3HA 2XHNA 4QB6A 5JLVA 1MNGA 4A7KA 5HI0A 1QVGU 4S2GA 1R1ZA 5IYCO 5EJZB 5L3BA 1QEXA 4BYYA 1H9PA 2ARXA 5GM0A 1RUE3 1OCRB 4QDRA 1ULGA 3EO6A 1HW5A 3Q8BA 4AQSA 2Q30A 1X59A 1W6MA 1R3IC 5L3GA 4UVCA 2ZEWA 2QR4A 1VF5B 3E5UA 1GBGA 4MV2A 1S2KA 2HG5C 1DLLA 1UOFA 2K1EA 2BSKA 4CPBA 4FLYA 4MXWB 4I2OA 4O4LB 2AHZA 2OIEA 4IIJA 4IUGA 4NHMA 5IYZB 1PM7A 1WPXA 4J80A 3RVYA 1RMU1 3E89A 4LBQD 3CRMA 3LDDA 3OTFA 3B3QE 4LBJA 4N7UA 1TG7A 3OY8A 1OC1A 4XPVA 5D5PA 1V54C 2WFPA 2JJ2G 3AYCA 1HNZB 3D3IA 4MSVA 3OSDA 1UMIA 2WLPA 1Y76A 5A3NA 3SPJA 1OCOC 1AR1B 2F6BA 3VD5A 2VBBA 4XYXA 2WUHA 1CIWA 1YYNA 4EEQA 5EJ3A 2A6XA 3ACFA 4MHRA 3ZRWA 4DYLA 4HZ3A 5CEHA 4JTCB 3OUJA 2CL2A 4LE4A 4YJ3A 1ASJ1 1ENXA 1UPIA 3ZHRA 4IEOA 4I09A 4DXSA 1EPZA 2QWQB 1R1BA 4LF7O 3AJZA 1V6LA 3ZN5A 5F9TA 2DCTA 2WZR3 5EC2C 4GQ7A 4EWAA 2QQKA 3DSQA 3JBG2 4CCKA 5GTHZ 4AGGA 4K20A 3UKTA 4UCRA 1G9AA 1JFFB 2KM2A 3J9SA 5IVYA 3H9VA 2EJ7A 2DVBA 4LF5O 1EFRG 3L9JT 3TJTA 2Q4PA 2GV9A 4R4ZA 1I7FA 4GT1A 3M4FA 1RUF3 1OZ0A 4IV3C 2WLJA 3VGIA 2R041 3LNMB 1UY0A 5GW7A 4WVMB 5KXCA 2C26A 4OPAA 3VHPA 3ZXDA 5DQ0A 2W1UA 5LA2A 2XL9A 5KHGA 1N1YA 4XF1A 3HQXA 4ZHQA 3FC0A 4X65B 4MT8A 2XUEA 1DZTA 3CRCA 1I3HA 5CFDB 4BMBA 1R1A2 2VM9A 1CAVB 2XXZA 4TN7A 1VQLV 3SYPA 3ON7A 1AJPA 3K04A 2DBNA 2F1MA 1O4YA 5JWPA 4FFBA 4QPYA 4H44B 1DGSA 2E51A 2AHYA 1BZKA 4UXAA 3LDEA 4R9CA 1TA8A 1K7DA 1HQWA 4CBCA 1Q43A 1MS1A 3UNPA 3VHNA 1RUNA 3FJSA 5FZMA 1MEC3 4FPCA 3OMAB 1FAFA 3L2HA 5HV0A 2UUCB 1BEV2 1JHNA 2ZAHA 3RZMA 1XSQA 1NCRA 5CFDC 1HR0B 3PUSA 4XCAA 3TAYA 2ZGNA 1RPOA 3A0RA 3ZHUA 3OG2A 5GZGA 2KA3A 1OVSA 1GN3A 1FPN1 2ZGMA 3PMEA 2WFF2 3FBYA 3KS7A 2QJ1A 2XASA 5D5QA 3DXRA 3ZEDA 4QPIB 1AJNA 2LQTA 3W5NA 3H1JH 4GUNA 3B93A 5FPBA 3KHCA 1MS5A 2IVIB 3CCEV 3J26N 3J7LA 2J1TA 4D6QA 4DK0A 4XAAA 4LKSA 1S5LZ 1QIQA 2UXCB 1WJZA 1RL3A 1FMD2 2B9VA 2OW4A 4BZ4A 4NWVA 4DUZB 1FV2A 3BVOA 4WZCA 1CQ9A 4HAMA 4AVVA 2VE1A 2G9ZA 2HJIA 2QQVA 2AEYA 1KITA 5EYYA 3WF1A 2WO2A 3N27A 1QY4A 1BCCH 4DR3O 3AX4A 5FIXA 2HR3A 3OPWA 3OB8A 3WNKA 4DR2B 1TVGA 2ZBJA 4XXPA 1LNQA 1H8TC 3JSLA 4CPBD 1GSLA 2YIDA 1KJRA 4X1KA 4YJ2B 5EC1C 3R66A 4D7SA 4JI4B 4FPPA 5C93A 4QDSA 1WWYA 3S6PA 1JW6A 4FK5C 4BMEA 1ENQA 1B04A 2F93B 4I7ZB 2YG0A 1M90W 5JOZA 4ZKTB 3UGGA 4DINB 1Q3EA 4L2NA 2ZPXA 2DV9A 3GGLA 2RDQA 2HHHB 1HNXO 5DDJ3 4BA6A 4LITA 4PA4A 4NRMA 3FX3A 2WSSG 1OF3A 4YW6A 4Q4X1 5C8WA 4YIOA 3ME2A 1WD3A 4XDLA 1XNQB 4KG0A 2E53A 2ENRA 3SJCC 1JMUB 3E8HA 2JDAA 4JRAA 3JD2A 4PBOA 2EX3A 2D3RA 3M3EA 1UU6A 5A7PA 3VKLA 1X8MA 1ZYBA 1E1RG 3AZZA 1WZXA 1WA6X 5CN0A 3H8OA 1J3RA 5IATA 5GZCA 2PLV2 4N9HA 3O14A 4O4HA 4DV5B 2RR12 5F1RA 2D6LX 5TISZ 4NTXA 3ROUA 4DR1B 4F6EA 3O1OA 1G6NA 4DIQA 3OUSA 1XU1A 1J83A 4R9AA 5GLWA 4Y3OA 4ZZ8A 4A42A 1XI1A 3JARB 1OCOB 4JF3A 4FLXA 4Q4Y2 4JV5B 4TSFG 2R9AA 3CC4V 1W2NA 2JDUA 2VBDA 5I0RA 1B09A 4X1YA 4YLZA 3IAPA 1DIWA 4PF5A 5IVVA 4OHYA 5BMVB 1S0BA 4FFKA 3BCWA 1ZL8B 4Q0QA 4HPKA 2GDFA 3M8LA 4XF9A 3SHRA 5CBLA 4LBLA 1I0HA 2QTOA 2WABA 4YVSC 5C70A 4CUAA 4YVWA 4JI4O 3SJAC 3TEXA 3RWRD 1XYNA 2JG9C 4FFFA 2GSMB 2WJSA 2EZPA 5KUKA 2EIBA 1FXHA 1XMQO 2HWD2 5J98B 3B40A 3AC0A 4JAUA 5EZYA 1OCRC 3LEIA 2OCHA 2N05A 1VLNA 2EF6A 1MZ6A 2P90A 4J10A 4PI0A 1LENA 5D1IA 4HVQA 4AHWA 3OUHA 4QB1A 2XAFA 2ZGRA 4AVAA 2WN2A 3RI9A 1WPBA 1CP9A 2VU9A 2X09A 3SKJE 1QJFA 4M3CE 2D5HA 3ZSMA 1GP4A 2ZXWB 5IFPA 2HJFC 5F8PA 1FOD2 4OHWA 3FL7A 3BABA 2JEMA 2BBVA 1GU3A 5CFCA 2JB8A 4OUSA 4TQDA 3RWNA 1NT2B 4KQ7A 3MIFA 1MQTB 3FMGA 5EBMC 4IEZA 5FAXA 1VF7A 4DR3B 1NA1C 4UV8A 3AP6A 1N33O 4HPKB 3BY6A 2YHJA 1ZL8A 2CWMA 5ANQA 2FL4A 2XBO1 2RG4A 5DAQA 2Y0IA 4OLLA 1SC5B 2GHYA 3LEKA 4Q8LA 1QQP3 3T1HO 3CC7V 2HYXA 2DUQA 4PJYA 3L75H 2VRZA 1M56C 2Y6JA 5J36A 1NKGA 5I0SA 1GO3F 3ZXLA 3ZN0A 1WMDA 1HB4A 2ADDA 4UFLA 2VVEA 1MSDA 4Q4X2 1SLCA 1UU5A 4YG0A 1OHHG 4O4HB 3VBUB 3TEYA 4IGQA 1BT8A 1NH2D 2OA2A 3ETPA 3HPNA 3WDYA 1XUQA 1QJY3 1W8TA 4GMP0 1AX0A 4OHXA 4WVZA 3L74H 3WP4A 1TE1B 1O3QA 3BUCA 3F5WC 2IXLA 1GM9A 4DV6O 4QX3A 1W6NA 5L9VA 2EBOA 3BA8A 5IVFA 1J84A 4LO8A 5H2FZ 1YJKA 2KR2A 4UFIA 3CMEV 3VZKA 2ZX2A 5DAPA 4E2LA 3GDBA 2B7YA 3ML0A 4XFFA 4AEDC 1U5IA 4DPNA 4Q4Y3 2D6MA 1UZ0A 1HV0A 1SDDB 1VBB1 1TUEB 3LIHA 5D8AA 1ZZ8A 1E5SA 1R64A 1W8FA 4P08A 3QTCA 3T4DA 3BTXA 4QX7A 4QNHB 2ZGOA 5A7WA 3UT5A 3OGIB 5B66Z 3JBG1 4KXRA 1J1TA 4EYUA 1SHWB 5B1BB 1DQ6A 4BIZA 2BGPA 3IDAA 2VL4A 4A6OA 5KHIA 1LOAA 3C8XA 3TEZA 1SLBA 3AZVA 4O9GA 4LF9B 4GXLA 1XHXA 1OCZC 4K3AA 1KFXL 2P2KA 3LZZA 2UXNA 4PDLA 1HRI1 1UKRA 1R3KC 3UKMA 2ERFA 5KR7A 5FZEA 4K1ZA 5JJEB 2QBXA 1YFXA 4NTYA 2WZ8A 3WF3A 2ZCEA 1L0NH 5B3SC 3JCUZ 3WNXA 5AVAA 1NVPB 3NR7A 4TV9B 1H8VA 2V72A 3SITA 4E27A 1AI5A 3ZRXA 4H13B 3WNMA 5IAVA 1G7YA 4BK5A 1JZ2A 3HMYA 1QJU2 1WD4A 5FZ1A 5LGUA 3JAWA 2CHHA 3OEBA 3KVBA 3OEEG 3GZAA 3SH5A 2OVUA 4Q27A 3CO2A 4FCAA 4Q4Y1 3VDDB 4IXLA 5GJ6A 1JMKC 4NJ4A 4NXMB 4JAAA 4Q4W2 2IXHA 1RB8G 1A3KA 2PLV3 4CDUA 3THTA 3KT1A 3AG1B 5A32A 1W2BU 4B3NA 4JGSA 4BQ4A 1MVEA 2ATFA 4RS5C 3JBG3 1KQSU 5FMOS 5FYCA 1JPXA 4M01A 2VPVA 3JQXA 3LAGA 3HBZA 1FI2A 3KV6A 4EB6B 1RUI3 2X6CA 4C1WA 1UMZA 3BYWA 1SLIA 1K5MC 2MNGA 4MSWC 4N90A 3UT0A 1VRH2 3TK1A 4RR3B 4FM0A 3AYEA 3ZVXA 1SQFA 4QPIC 4AEDA 1MG1A 2AZ0A 1ZAUA 3KCCA 1LGCA 1UMHA 3OM3B 4B3MO 2QM7A 2FQPA 1BS3A 2VOXA 4GCZA 1IG0A 4HLTA 1SPPB 1RM1C 2IUWA 3H50A 3S5QA 4NPMA 1XNBA 2ZOEB 1LOCA 1EV13 1YVWA 3BOWA 1MA1A 1RUE2 3H01A 1FNZA 4IGPA 3I2KA 3CL1A 3DF0A 1H8TB 3NXSA 3H3ZA 1W6QA 3NL1A 4P14A 1FD9A 5IVEA 1GWKA 1MZEA 3VQWA 3N7JA 4FQZA 4PA6A 2B1GA 3LGRA 3CCLV 2VZTA 4YVSA 2IBZH 1NXMA 1W8OA 4XF0A 2QTWB 2ILMA 5DAWA 1N4CA 3T1YB 3FBMA 1OF4A 3FYIB 2R0FA 3GZEA 3VBHC 3K5OA 2AH2A 5F39A 5H9SA 4F4LA 2FCUA 5LOVA 5LMNO 2WDBA 2IU3A 3WNLA 2A7AA 3D0JA 2VNOA 5D21A 1NTKH 3MBWA 1A6CA 4HSLA 2UXXA 4W4ZA 2VZPA 2XUMA 2UXBO 5AFEA 4MVOA 3FAVA 4D69A 5F3GA 3KGZA 1NUKA 3JUUA 5F5QA 4EFBA 1LOBA 2YY1A 3ILFA 4D6RA 3FWEA 1CD3G 2CYFA 1YJNV 2ZA9A 5FYZA 2HWB1 3AKRA 4PDWB 1VBC3 1MS0A 1F2NA 1B35A 5IWAB 5J7MA 3DYOA 3PJQA 2QQLA 4MX3A 4YJ3B 2W91A 1ZA4A 3CMAV 4C8DA 5KLVH 2L35A 1CN1A 4K35A 2P67A 1CZVA 3POGA 3ZRWB 1ZZ6A 1WCQA 2WAOA 1NAEA 1HXS2 4GKXA 1F51A 1L3JA 1ZWIC 1HRI2 3W58A 1YJ9V 2FYUH 3PIJA 3VD3A 3ZDSA 3TYJA 4XBLA 5LZ6A 2WLHA 1LCLA 4BLIA 2VULA 4QHBA 4YM3A 1MOFA 1HRV3 1HR0O 3WNNA 5H9RA 4QXHA 1IS3A 3M1HA 1YUDA 2RS32 3K48A 4YW4A 3ZSKA 3VQXA 1YIFA 4QJFB 3GWOA 1DDLA 2CTRA 1VMGA 1ZSPA 2ET7A 4PDVA 1OQDA 4DXZA 2VQUA 1WA8A 1GZTA 4JKKA 1LOFA 3A8TA 3OMNB 2ORZA 4BOWA 2XWBB 4TV8B 4XQDA 1UZWA 1D4M1 2BZDA 3ETDA 3I2DA 2PYLA 5K1XA 3TOJA 2RM22 2QQNA 4LIUA 3R4UA 2ZCWA 3R4SA 4QHOA 1XMOO 4B1MA 3TXQA 1K4CC 2EILC 1MZ5A 1JJ2U 1SESA 2ZGUA 3HJRA 1B35B 2IJKA 4RUFA 2Z42A 4B3MB 4JAVA 1UU4A 2DQ0A 3GJBA 1OJHA 1AYN3 4LFCB 1V55B 2KD7A 1P8JA 3S57A 1YJLA 4UVAA 1OOPB 5DM6V 5T54A 2B42B 2XJPA 2IW5A 2IWGB 4QPGC 4GH4B 1N1TA 2W39A 2BCCH 1Y4WA 1PL4A 3RJRA 2OIIA 5FJHA 2P3KA 2VQAA 1I08A 1YTFD 2CDPA 2E5LB 1OCZB 2VTXA 2Z5UA 4MTFA 1ZRRA 3RZJA 1JZ8A 3LWCA 2PI5A 3JALB 4ASLA 3WVJA 3VZMA 4DUWA 5FZCA 4AL9A 3OBTA 3KKYA 3VBSB 4RQFA 3DTUB 4DR6O 5E89A 1TME3 4WF9V 4QKDA 3BVCA 4XJ9A 1H2MA 3SYCA 1N32O 3DPRC 4LXLA 2JKBA 2WS92 2SBAA 3JASB 2CUGA 4P9OA 3CS5A 1QXJA 5LRRA 4HVOA 3VL9A 3SDLA 1OCCB 2H8PC 2VGDA 4FOYA 2IJIA 1JOYA 3C90A 2QZ2A 1RMU2 5C71A 4QGLA 4FLTA 5HCBA 4YG3A 2D6KA 2LUWA 4AI9A 1YXBA 5C8YA 4MOAA 4FLZA 2I07B 1VQMV 5FZGA 3NNGA 1Z7S1 4N8MA 4R8CA 4G4FA 5CA1A 3CLPA 3PURA 4P9GA 1ZA7A 2FBEA 1U5XA 4FTSA 2VQEB 3JAMN 4AEKA 1E5RA 4D7YA 4YGBA 1SQQH 2F4LA 5IW0A 1XOYA 1OUSA 2GN7A 5A6XA 2VXRA 1BVVA 5JJNB 3KCXA 1EYBA 5LHIA 2JEXA 4MS2A 4XCBA 1FPN3 4CVUA 1KP3A 5BNOB 1ZZBA 4N43B 1ZBA1 4SLIA 4NROA 2JENA 2CTWA 3GHMA 2VW1A 5CA1B 1QR9A 3B8MA 3ZXEA 2UY8A 1S0IA 4CDUB 4B3TO 2W95A 2WQZC 4FTEA 1KFUL 4CDQB 1DFQA 1TME1 4Q4V2 1O4TA 1UXXX 1W6OA 4LULA 3CJIA 1LRHA 2ZE8A 5G04L 1S1AA 1P84F 4GKYA 5A2QN 4NO4A 1A8MA 2WFF1 5K4LA 2PAKA 1GK9A 1OHFA 4FPOB 5LK5A 5FYVA 3KF5A 1KGYA 2LW8A 1PMHX 2R063 2GMEA 4QQOA 3P5BA 2J1UA 4LHLA 1YITV 3OW2U 4OFGA 5T50A 2FDJA 4N53A 2WLKA 1BHBA 2R1BA 2VZVA 1ACCA 5IY5C 4X8NA 1BE3H 1IVSA 2D3SA 1DQ4A 3IAQA 4X62B 4KI5M 4A4AA 4MYEA 5C3RA 4MO3M 1IOAA 1UX7A 4TYSA 2ZGLA 2YUEA 3RG0A 4H14A 1SF9A 3B00A 1FKAO 2GTAA 2AW9A 2QSAA 4EV0A 3NVCA 3BIEA 4HFSA 4QXKA 3T09A 2P6CA 2BTOA 1I5XA 3RYRA 1D2SA 4EWEA 4CXYA 1Q8QA 3QG5A 4YFWA 1N47A 3DPRA 4Q6GA 4MG2A 1SLAA 1XQ8A 4XUTA 1Y9QA 3VL8A 4YRDA 1O8SA 4F8AA 3U78A 3RYIA 3OD4A 1R1A1 5D8AB 2VQ0A 4LKFA 2OYQA 1SFNA 4JYAB 1UD1A 4GA9A 3FHQA 5J3UA 1WW7A 5I0UA 2X10A 4LR4A 3BI3A 1XREA 4ICGA 4MTOA 5A1FA 4D0QA 5BNPC 1VF6A 1V9U1 5BXZA 1JYXA 3ZPOA 2QKCA 4V1PA 3UCSC 3K5NA 2RS31 3H3LA 3KQ4B 1VEWA 4DUYO 2QWPB 3FUQA 5DAXA 3UETA 1LUWA 3QO8A 3O0VA 1X9PA 2LGQA 4AI3A 5JIUA 4CEYA 2NQYA 5J2UB 3JXSA 1ZBE2 2X5IB 1ZTEA 5J37A 2HKXA 2VZUA 3CC2V 2WAMA 2XTAA 2E7QA 1R6KA 3CRAA 2BOCC 2AYHA 3K4DA 1CXZB 2WLQA 2BGOA 4K3UA 3L9DA 4H55A 5FPLA 1QJX1 5IE9A 2X7RB 3MAQA 3SLIA 3MO4A 1AYN1 1DGRA 2Y4UA 4G9SB 2XH6A 4CDXC 2HWC2 1M4UA 1DZQA 1H8HG 4Q0SA 1VQ8V 5DZGA 3LA7A 2HWC1 5JZGA 5K0UA 1QF3A 4ISQA 4EZ4A 2WKKA 3K79A 4XDOA 3WCRA 3RVZA 1Q8OA 4E8CA 2RCVA 2DURA 1HDJA 1AX2A 2YDEA 2RS12 1KP2A 4YW1A 1YDXA 2PGGA 1HIXA 3AYDA 4O2AA 1XRUA 2V09A 1T6GC 3ZMVA 1W8ZA 5GZDA 2LFRA 1E5IA 3C7FA 2BEOA 4DK1A 4CS3A 4ZONA 5H9CA 1JZ5A 2YIBA 3UGFA 5A1AA 4IE0A 1F35A 5JVDB 2Q8DA 2RV9A 1VBE2 4LBQB 3VDBA 3RYCB 3MIGA 1UZVA 2UXBB 4NRPA 4AZZA 1SCRA 5JXGA 3I59B 1S0JA 4OGQB 2E31A 2OXBA 2E63A 5I8SA 3G6JB 2P7TC 3RZKA 4LH7A 3AMHA 4R9DA 2ZJCA 2VTXJ 4CP2A 1IZ3A 4WV8A 1TNFA 2Q6AA 4GJYA 2A3YA 4LF8B 1LOGA 4ZHNA 4Q1RA 5EHDA 1HNXB 4BQ2A 1JN2P 1W9TA 4LOTA 5FP9A 1JX9A 3PUIA 3PJYA 2G9FA 2A73B 4W6XA 2A6YA 3F7VC 4N7IA 2DUOA 4MGQA 1WCSA 5KAFZ 1XXNA 4MLOA 1O3RA 2CDOA 4DZGA 2I74A 1R092 5LP6A 1U12A 4DR5O 5FRAA 5EPAA 4Y5TA 4P9XA 1VBA3 3C7EA 4HN1A 2C9KA 3W59A 3RPQA 3ASNC 4MW8A 3VBOB 4HKLA 1TAEA 2GUZA 3T1MA 4LBOA 1P49A 5JQGA 3ATGA 2JEUA 2ZE6A 1H0BA 1S2EA 4NIAA 1RITA 2FDFA 4EB6A 5F6LB 3AP7A 3VBFB 4TZDA 2YGLA 2DYSB 2WNOA 4FQ4A 4LMFA 5DDJ1 4I4TB 1RUC1 2HBUA 1V00A 1EY2A 3HKEA 5BR8O 2F66C 1KS5A 5I93A 1DYOA 2XKOA 5IYBO 3LDBA 1NJIW 1D0HA 3U4SA 3ZKYA 3WDWA 1LNSA 1PO13 2ZDIA 2ZMNA 2P34A 3CJIB 1DF4A 2GZWA 1ZRDA 4K8XA 1UYXA 2R061 1SQPH 2CU5A 2V73A 1D2QA 1GZCA 1QJU3 3ILRA 4JI1B 4LE3A 5FXXA 2CNAA 4W4LA 2W5FA 4XURA 3O5SA 1DQ1A 5AC92 4I0XA 3ZRSA 1W0PA 1GP6A 2WIIB 4KG8A 2D5FA 3BU0A 1IBLO 3J4UH 3NV2A 2A6ZA 1C8M1 3D3AA 3C3TA 3B7MA 2AACA 1OLME 2QFEA 3PVEA 4AYUA 4QQHA 2LGWA 1SBFA 3O1SA 1K34A 2JE9A 3S0MA 2YC2A 3KCYA 5CISA 3I55V 4PLNA 3VDDA 3OMIB 2QM4A 2BJSA 3H1MA 2JD9A 1BQPA 1POQA 4X8PA 4WZFA 1XILA 4QQLA 3SC7X 5BNQA 1R6TA 2YI8A 3JASA 4Y22A 5BYNA 2ZINA 1DZRA 4DFSA 2BBAA 4COWA 1V6JA 1RUC3 2ES3A 3M3OA 1F15A 5D2AA 4DB5A 4B1LA 3AXDA 5FZKA 1BJQA 2BYVE 5JXJA 4UCSA 2VQTA 2VMIA 2XJTA 3OPZA 5FY7A 3T2MA 1AR4A 2FCTA 4LBKA 4JV4A 1JZ3A 1ULDA 5FPAA 3BU7A 3I2GA 1US3A 3I5DA 2WO7A 3VLBB 1GH6A 4FFGA 2D3OW 3K4AA 4HNAB 3KZ4C 2R30A 4INDA 2IXCA 2Y33A 4H0LB 1EUTA 4GH4A 4RO2A 3ZHSA 4QXBA 3STLC 1KBHA 4DQAA 3H1LH 1W9WA 1IGOA 3UT5B 2EINC 4EQVA 4K0KB 2EIMB 2R071 4AEMA 1BGYH 4DR7O 4JI1O 2Y60A 1DP0A 1VQ5V 1ZBA3 4LHSA 5FYHA 5F2VO 3B09A 1S55A 3MUY1 4Z92B 4HMZA 4YW3A 2BRTA 4HKOA 2H6BA 4ZXKA 1YWKA 3IC7A 3E6BA 3WCSA 1AR82 2K2SA 4KP4A 4J1XA 4DR6B 4IE5A 1XYPA 3JD73 3WF2A 4FP3A 1OA4A 1X36A 4TTGA 4JI3B 4GB31 1PO22 4K7JA 2ZIOA 3WUCA 1RHI3 5JPNB 2LP7A 3PNAA 3ZLIA 4Q5OA 1UOGA 5A3PA 4JKMA 5EZWA 3ZOIA 5KA6A 2JDIG 5BR8B 1QKQA 3AL6A 2DWRA 4LF4O 2IXKA 2A1XA 3W7WA 4OPHA 2WLNA 5FREA 3T1HB 3ZO0B 2Q7HA 2DCKA 1RXFA 3TB0A 2VXJA 4I30A 5DUUA 1H4HA 1GOGA 3PMSA 2CV6A 4HYOA 4Y4YA 3S3XA 3AFKA 1A34A 3A0KA 1N8RW 4QE9A 2UU8A 3TNQA 3FFZA 3SQOA 1X8EA 3MLKA 1SETA 4B29A 1LHWA 5IWFA 4NIHA 2DU0A 3ACLA 4JGZB 2GNMA 1T6BX 4WM8C 5LK7B 1NLRA 3FHIB 4CDWA 4DV6B 4UW3A 5CADA 4GIQA 2XJUA 1G8MA 3WQ7A 1DF0A 1LOEA 5FK8A 2W2IA 1S0EA 3OT7A 2AC1A 3ACIA 3WY6A 2UUBO 1BSMA 4FPLA 2RM21 3VKOA 1RUF2 1V6NA 2BWAA 4PDWA 3T4ZA 3NV1A 5K7PA 5FP4A 3K4ZA 4QIWF 5IVCA 1BQ0A 4YNIA 2NLRA 1QU7A 1EAH1 1EV12 1HLCA 3CDZB 4G28B 3H7JA 4CCDA 4DW1A 2E26A 3CRRA 3CBNA 3LPGA 2HWE3 3POJA 3N7LA 4FVVA 2YEVA 5FO9B 1C8M2 1CEZA 1FT9A 4FPGA 4KBBA 2OYZA 1JYIA 5JXIA 1RUD1 4AEJA 3ZX7A 3FZ3A 3K51A 4GX0A 3THDA 5CKQA 3ZHVA 1VQKV 4AHCA 4EN7B 1JI6A 2MEV1 1W8NA 1QJX3 2RVAA 2O0OA 2QGNA 2JICA 1Y76B 4CEWB 4RGGA 3VZJA 5FLXN 2Y6KA 3IWZA 1A8DA 4YVSB 1IDSA 1DQ5A 5FZ8A 3ASNB 1S2BA 3K75B 4G3YC 1S76D 4ZIBA 3JQWA 2IC1A 3TCUA 3BTAA 1C28A 1RVF1 4HG6B 2HH9A 3HOBA 5FO7B 1MS3A 3RS6A 1SBDA 4O65A 2BE3A 2KQXA 1RUE1 2VO5A 4OMDA 1RUH3 2Y6LA 3K3OA 2PELA 2LRPA 5CIRA 3ECQA 1UX6A 3VZOA 1VRH3 5EXOA 4FXGB 1KRIA 1UZZA 2HWF1 1P7GA 3D8CA 1RUH2 3AB0A 3IZOA 1Y74A 3N2GB 5ISLA 1YRZA 2Q5TA 5E1RA 1I1EA 3MPBA 2GC3A 2WQ8A 1F31A 2WSUA 4LEJA 1UYYA 1ORQC 4IEYA 2A5ZA 3DL3A 3VB9A 5JCOC 3ZM8A 4WFEA 1VBD1 2Y6GA 4YZ1A 4Y20B 3OUFA 5C8CB 1THZA 2DDUA 2E32A 1H2SB 5T55A 1X7NA 4UFZA 4URAA 4JPRA 4D7TA 4JI3O 1DG6A 2B45X 2VUDA 4XZUG 3HN1A 4YJ2A 1R081 4DUZO 4UW5A 3RMYA 2VC9A 3GBGA 1BBT2 3N7KA 2WPDG 4CDQC 1YO8A 3LFIA 4PQQA 4FVMA 1AX1A 3E5QA 3IPVB 1I5ZA 4XMAA 1PHMA 3RI8A 4MVSA 2P17A 1PGSA 3JD72 1UAIA 4GH4C 3VBOC 2HWE2 3APOA 1AR93 1N0JA 2JG9A 4EE2A 2XJSA 4HSJA 1FMD1 4IL6Z 3J8F3 3Q8AA 4K6BA 5A3OA 3H8XA 1GNZA 4RS5B 2OQ6A 4DR2O 2CGOA 4UFHA 3WU2Z 4ORFA 3ABUA 1UQXA 4PI2A 5IJ9B 1SFYA 3I97A 2W87A 1IX9A 5FKBA 3OGJA 2NYYA 1IPJA 4PA7A 1QQP2 4K21A 2VR4A 2VOKA 1RHI2 1URXA 2WWWA 3BEHA 3HNYM 3D4KA 1XC6A 2QKSA 2ZEYA 2D43A 5KMGA 3CCQV 3I3QA 1OQEA 4L0PA 5J48A 2W9XA 5A7WB 3VBFC 1CR7A 5F3EA 3ZMZA 2ZR2A 4OVEA 3R4DB 1SZXA 4QX1A 2O8QA 4JGYC 3WQBA 1QDOA 2EIGA 4XOGA 4FBFA 2I2SA 4WM7C 5CA6A 1JU4A 2N7GA 4WFFA 3NV3A 1PL0A 4F83A 4XFGA 1EZVH 4NHKA 3S30A 2Q0AA 3T0BA 4Q20A 2PHUA 2ZQMA 4R4XA 4YM2A 3Q8EA 2DN9A 1E5HA 3ES1A 2MK3A 4Z07A 1W6NB 4FIPC 2LJ2A 3THPA 1QCEA 4EFEA 1RUF1 2D3PA 1N33B 3LIGA 1NX9A 3MDPA 5GZEA 3H1IH 4NRQA 3VBUA 2EAKA 5FZBA 1SDWA 1EAH2 4TOIA 2EIKB 4A7ZA 2GUZB 3ZMSA 2D6NA 1ZBE3 4JYYA 5JVVA 3VBOA 4UXNA 4ASKA 1OA2A 2Q8OA 4P9IA 1SACA 3EHKA 3POBA 4WFBV 1V6IA 5LP6B 5IK7A 2UWAA 2YPDA 1KUQA 2H3OA 1G6UA 4RUEA 1UCXA 1YHFA 2Y0OA 3CEIA 3VDDC 1MQTA 5HFMA 1B6QA 4MGIE 3T2TA 2DYCA 2ADEA 1CAVA 1COV3 5LA0A 5EJ1B 3CMGA 1AI7A 2RMU2 2QA4V 1AJOA 1AVMA 2OZJA 1RTVA 1OD3A 4JKLA 4LF6B 1COWG 2QQUA 2R70A 3SNMA 4J41A 3WSOA 1ND3B 2QDOA 1D2DA 3ZIAG 3RT3C 1ZREA 1Q6UA 4QM9A 2VWJA 4WVMA 4B4RA 5DUXA 4CEWA 1FV3A 2VNVA 3QF7A 1U5ZA 4HONA 4NHYA 2TNFA 5E8AA 3VV1A 4FOVA 1R6NA 4EJRA 2B9UA 3NAPC 4RL7A 1W2TA 1LOFC 4AQTA 5HBAA 2QEXV 2QQIA 3NNMA 2AUYA 2PFWA 3AG7A 3AZYA 1H2KA 3VZNA 4O2AB 4QWNA 1HKDA 5FMBA 4W65A 4YVWB 5KHKA 1N0NA 3AP4A 3OBZA 2JS5A 1VF6C 3MFAA 1PV0A 1SLTA 4Q2FA 5FZ9A 2YICA 5LA6B 4NPLA 4O4LA 1EZJA 4AFMA 2HWF3 4IETA 4MXWA 3JZVA 1L7RA 3NWKA 5EBLC 2PQQA 4QPGA 2E76B 1DBNA 1PVC2 3LUTB 1S0DA 4G2KA 2QQMA 4I5SA 5DPNA 3WZ1A 3ENRA 1Z7S2 2XJVA 1X82A 1MS4A 4P9YA 3QOPA 3HKDA 2XLFA 2X5IA 4Y1UA 4I9WA 3NJZA 1O7FA 2PHXA 5J2UA 4PA3A 1FFXB 3ABMC 2YIAA 1G9CA 2H6CA 1TVKB 1UFIA 5JSOA 1H2GA 4JTNA 2ZXQA 1U0AA 2WA4A 3MLJA 3ZFGC 3EXAA 1MZFA 1F5FA 3AMPA 5EIYB 4WVVA 3HD8B 4XJZA 3ZFEA 1YIPA 2XB6C 4CP1A 5FLHA 4ATFA 3ZPYA 3UV9A 4LFBB 3TN92 2DU1A 2ID4A 1YLLA 4QQ2A 3P32A 4HL0A 2RHPA 2HWB3 3G4SV 4MGSA 4CUBA 4Y26A 2VUJA 2DYRB 4OI2A 5FYSA 3H1KH 3UESA 3LQCA 4FM2A 4XUNA 4XBNA 1P4RA 3CJIC 3I3MA 2YB7A 4CU6A 3DPRB 3SKVA 1K73W 4O4IA 2P5OA 2XWJB 3DUIA 4Y5Z0 2DVAA 4RA0A 4X1KB 2VCCA 1UIJA 2WLIA 1IBKO 2WS93 2B46X 2VCMA 1N1VA 3POSA 1IS5A 2HWC3 5APAA 5IWAO 1RINA 1AB3A 3TGUH 1V55C 4RHV3 1WBFA 3D5OA 1SBEA 4E2SA 4RFRB 3WP6A 2J22A 1OVPA 4GX1A 3WLUA 2D7FA 2WN3A 1QJZA 1DGRN 2ZHKA 1DQ0A 2CDYA 4LOSA 3P6BA 3AZXA 2D98A 5JI7A 1ASJ2 2L9LA 2EILB 1UIKA 1POV0 1OBNA 2BOJA 1JODA 4XAEA 1O9HA 2WO1A 2PAEA 5LYJB 4JYCA 4XZPA 3ZFFC 3IMNA 1OH3A 1SERA 1SA0B 3IDCB 3QVNA 3LKJA 4CA9A 2A6VA 3WOGA 5B4NA 1W6OB 3EFFK 2GNDA 4QPIA 1Z0HA 1NCRC 3DXRB 2VY0A 1WCDJ 1JZ4A 2UU9O 4ZI7A 5IY5B 4YXWG 2BV4A 4XEZA 5IYDO 2A06H 2PTMA 4DV5O 5E79Z 2DYSC 3E22A 2P3YA 1NTMH 2FD8A 1Z2GA 1KS4A 4LFBO 4W4KA 1PGW2 1MEC2 2IU0A 2ZKNA 2NP0A 1VIBA 1V70A 4XFHA 1AILA 5L7OB 4ARYA 5ITZA 4YZ2A 2ZHLA 3MLLA 1M1KW 1CPMA 3M3QA 1RUG3 3ZHTA 4IE4A 1NCQC 3EHBB 1HW7A 5JSPA 4BQXA 2HJDA 1H38A 1KEXA 2R49A 4DRVA 1FOD1 2ZHNA 4ATEA 3I2IA 4M3CA 2CWSA 2YFZA 5LMUO 1XNAA 2ZX0A 5FZ0A 1PVC1 2DTYA 1GP5A 5CBHA 1WP7A 3VBSC 3KM5A 3K9AA 5CA3A 3WQ0A 1AYM3 3E8FA 3N9MA 4QU1A 2WRAA 3K5MA 4MGZE 2ZE7A 3CYOA 5FK7A 2JGDA 1GN2A 2AZ5A 3HNBM 1NY72 4HOOA 1GN6A 4LWSB 1FYJA 3N3HA 1CWPA 3ZHQA 1LHVA 5ERLA 4H7MA 3OYWA 5IHRA 4LF5B 4YG6A 2DF7A 1UKGA 3V64A 2WT0A 4I0AA 3PVNA 4FLWA 4X88A 1SQXH 4A41A 1BK0A 2VVDA 2P3IA 1KXGA 1YFUA 4Q1PA 2ZE5A 4FOQA 3WW4A 1D5NA 2WZR1 1W9FA 2DVFA 5E6HA 4Y1YA 4U3JB 2QE7G 3SEEA 3CJXA 1ZNPA 2FTKA 1R093 2HBTA 3SGIA 4CZZA 1JFFA 5BNNA 2WNUA 4PJ0Z 1DHKB 3KD4A 3RYHB 4R6ZA 3V0BB 4I02A 4YGDA 5A33B 4QPKA 1WLDA 4MVRA 5CKMA 4P9JA 2OIGA 1F5JA 3O0XA 3MIEA 4ISRA 4QKNA 2C24A 5FJKA 2JB4A 2OS2A 2YUAA 4TLFA 4IGGA 2YXLA 4LBMA 4AQ2A 5KBFA 1OI6A 3BOPA 3CCUV 5A3UA 2Y8KA 3SISA 1M57C 4Z2WA 4IESA 3M3IA 5K0UC 1QJEA 1VBA1 1PNKA 1XMQB 3I59A 5LXTA 4J1WA 1NQJA 5JVDA 1WA8B 2WSVA 2RE9A 4BQ3A 4X8AA 1TGOA 4CU7A 2LO1A 3VKMA 5FZHA 4O2BA 5DZFA 5LB6A 4Y1ZA 4XETA 4CC5A 4DV0O 1BMV1 4RR3C 3JD1A 2B5HA 3HT1A 4E2GA 1Y9MA 3I56V 4FFHA 3MEPA 1NR7A 1R083 2ZS6B 4AQ6A 1FJGB 4MGYE 1KYOF 4IIJB 3HAGA 2WINB 5K0UB 3S3WA 1J59A 3SMHA 1HNZO 1V9PA 1OUXA 2Y6FA 1N32B 1DK1A 3KB5A 5L9RA 5JOYA 3SPIA 3AMMA 3AG4C 2FZ1A 3JCZA 1DYKA 3R65A 2DCYA 3BPZA 1W6MB 1AI6A 1XNRO 1LJ7A 2JE8A 1K4DC 3N9QA 4RQEA 1O6UA 3WW1A 4C7UA 1W8HA 1D0GA 4IEWA 1H2NA 1JU3A 2YFUA 5FY4A 3QNEA 1YC61 3N35A 4EZHA 4CCMA 5BNPB 4X64B 5K1PA 3K46A 1EN6A 5L19A 4JZ2A 1G4YB 4V2WA 4QX5A 3LA2A 2H94A 1HP8A 4LJHA 3H7YA 2JIGA 4AI2A 4DO2A 5JIAA 3RW0A 4Y1VA 4LHKA 2YMZA 2MPFA 1F4MA 4U36A 4JZGA 5FFOC 5FMOL 2NN4A 5JUVA 3OPTA 5DXDA 4QM8A 2GC0A 3ASOC 4H3WA 1LU2A 2RDSA 4AR2A 1JH5A 5GZFA 4GX2A 2XAQA 1CAXB 5FNVA 2XONA 1RUD2 4LLFA 2QWNB 3SCFA 1Q82W 2YU2A 3L70H 1K12A 1NE6A 3CZUA 2WC2A 4CCCA 1CPNA 2YXYA 1AYN2 4X20A 2DTWA 2V5YA 1WGPA 1M06G 1JOJA 1V9U2 2W46A 4BISA 1RUI2 3OD0A 4AAXA 4LFCO 1VBC2 5FBJA 1VPHA 1W6QB 3OBRA 3UO3A 1OPOA 5LA1A 4AVSA 5GLVA 3IDBB 3RWKX 2A75A 3ZMTA 1PIV3 1HXS1 2YGMA 3TBDA 3MD0A 3ZFFB 2LALA 2ZMKA 2Y69B 3LPFA 5FBZA 3JB8A 1OCCC 3HQUA 4XIOA 1M4WA 1Y4MA 1FXZA 3VKNA 1UXZA 4GULA 3TWIA 3CPWU 4AEDB 4Z1MG 4K8ZA 2F17A 4B4PA 1XHZA 2VMDA 2JG8C 4YGEA 4OX9O 3KVAA 1DTOA 3AP5A 4YARA 1L0LH 2PI4A 2MW2B 1IS4A 1QH6A 1DYPA 5T3NA 3AK2A 1K3IA 4PCRA 4R7CA 1C1LA 4DY3A 5CBFA 5C3PA 4DR4O 3ETEA 3JD71 2BVVA 3NAPA 3I7DA 2VNGA 4RQPA 2FMYA 2RMU3 2GNBA 4XQ4A 4N43C 1QGLA 3ZXGA 5A32B 1IQAA 5CNAA 3WXPA 2ADQB 2YIBD 2PYJA 3Q9OA 5A3WA 5FPUA 2C9AA 4IL7A 3MYXA 4BIOA 4RAIA 2AEZA 4PA9A 2FHRA 4BIFA 2F95B 4NIIA 4ASMB 3WDTA 2XQRA 2JGUA 2DQ3A 1NR1A 2QTSA 5E1AC 1ULOA 5C33A 3E35A 3UKNA 4NE9A 1GOFA 3CCRV 4XACA 2DJVA 3VHOA 1PK6A 4BWOA 2FDKA 3LSEA 2VW2A 1OFSA 5CG9A 1DLBA 2NZ9A 2ET1A 3OEHG 3GALA 1GV9A 1ND2B 2BOIA 4JVAA 2WWUA 4CU9A 2Z4FA 1TMF2 4IEVA 5FXVA 1WB8A 2P06A 3HKCA 1KD7A 3TXSA 5FP8A 5FTTC 4NTWA 2Y26A 3W21A 1QHDA 5DN2A 4J42A 2EJRA 3DGEA 2R16A 4NPRA 5C4WB 3FX7A 2IVJA 4NHXA 4OCTA 1PNLA 1LHNA 4DXWA 4LIVA 4DEVA 3RYKA 3N7MA 2TUNA 1Z5WA 5LASA 4QX2A 2DE0X 1HN0A 3GXUA 5ACA3 4HXCA 1D7PM 1S77D 4W8JA 1AR72 1G9FA 1W6PA 1X33A 1OQ1A 4YFZA 1W8WA 5AC91 4DV0B 4UCVA 2WNVA 1NA1A 3JB4C 2HHHO 2A6WA 5FQ0A 5C7GA 2W92A 4LNUB 1US6A 3A21A 5CVRA 4KH9A 3A4UA 2YI9A 3A0BZ 3PU8A 3ZX6A 3SPCA 2E7TA 5J2TA 4IV1B 1OOPA 3BIWE 4OI0A 3WR0A 1QDCA 4XFCA 4JTAB 2LTNA 2EXKA 1QBZA 4YW2A 4DR1O 2NR5A 3OOXA 4XW3A 3RRDA 1D5AA 3G7DA 1JXNA 4DS0A 4QT6A 1RC6A 1EP0A 1WLEA 2DUPA 4DRXB 1H9WA 4OI4A 1FS0G 2C4XA 3FB7C 5C9AA 4XQWA 1NZCA 2UUCO 1EBOA 4AFAA 4I01A 2VZSA 4B3RO 4XFIA 1KDMA 1PNFA 2A0LA 3PN1A 3D6EA 1NOVA 4JTDB 4UV9A 1HWYA 4QD2A 3O1MA 3NNLA 3WB0A 1WBLA 3HT2A 5J96B 2ZR3A 4IV1C 2HWD3 4FPKA 3T30A 1NKDA 2LW7A 1Q8IA 3M70A 4FO9A 5FR3A 2DVGA 5FP3A 3E86A 1PZ7A 4LC1A 2OT7A 5FXWA 4X65O 4OI1A 1BKZA 2KKWA 3A2FA 5EV7A 2XOKG 4XDKA 2WBKA 2BP6A 1Y7BA 3FHAA 5CFCB 1DCSA 2Q69A 4DW0A 1FXKC 2WL1A 4XDPA 4WBNA 1IKPA 5BNNC 2Q4SA 2IM9A 3H3UA 5G05L 1RIRA 3C7GA 2ATKC 5C3QA 5FXZA 2X53S 1CAWB 3L73H 2WYSA 4FPEA 5FZOA 1JYVA 4NYKA 2HEVF 3P1IA 1QLNA 1BLZA 4DXRA 4FJCC 4I3PA 1VALA 4R52A 2XT9A 2ZZQA 2P6JA 4KNCA 1X50A 2UURA 1HXS3 1QVFU 3HVDA 4NHLA 4IEQA 4ZS3A 3AMNA 1QR8A 4JX0A 1CONA 1C8NA 3FFQA 1B35C 4LO4B 5IVJA 4AFBA 2D97A 3CIHA 3VUOA 1C1FA 4R8HA 5GLUA 4XXAA 1KMIZ 1ZVFA 1D4M3 5BMVA 2AREA 3B9CA 1PZ8A 4Q4W1 3T2PA 4X1YB 4E4EA 1VQ4V 3M7AA 4ES8A 2PN5A 3HKBB 5LOVB 4B7EA 4A44A 4KHPB 3JARA 2CE4A 4XE9A 1AR92 5BUVA 1IS6A 3BTYA 4C90A 1LR5A 3O1RA 2Q8CA 4LO7A 4XVHA 4QHZA 2ZGPA 1RJ8A 3C7OA 4QGMA 1V6KA 3K58A 4CDXB 1HRV1 5L9BA 1SQ4A 4Q4X3 4XJUA 4KGQA 3OR6C 4IW3A 4M0HA 2D40A 1ZZ9A 4BQWA 5CBGA 1NTZH 1VB2A 1EV11 1PNMA 3AG3C 1SPPA 4O7XA 4UWDA 5FMDA 5IAXA 2IH3C 3H1HH 5CA0B 2HVKC 1WCUA 4CH3A 1VBE3 1O4ZA 4RR3A 4CP9A 4UBGA 4BW9A 1ZRFA 5CB4B 2GALA 4RN5A 3K59A 3AG2B 2W1QA 3K3WA 2A3QA 5JJJB 1RUJ2 4BM8A 2D2CB 3ZSEA 1UO9A 1MPXA 2Q7GA 4META 4BDVB 1GUIA 1OKQA 1LESA 4IV3B 2EXJA 5DECA 1SZBA 4YM1A 3O12A 2VD7A 5HPOA 3NJYA 3KF3A 4COZA 5JR2A 3IBMA 1R1A3 2PAMA 1NE4A 4FLUA 1QNWA 2VZ1A 4BWAA 5C8CC 5EWSA 3B4SA 4NIDA 3J7NA 3ZKUA 4AOCA 3QH7A 3PVBB 4CRQA 3JD3A 3DYMA 1CVNA 2K0GA 4A7YA 1STMA 4AF9A 1PP9H 5CU1A 3JAWB 2HLEA 2RN9A 1PNGA 1V6OA 2VJXA 2RJKA 2GBOA 1VJ2A 4Y33A 2UXDB 1XL6A 3MV01 1EUUA 4JI2O 5L7OC 5C9AC 4JI5O 3WB1A 4TV9A 2ZGQA 3IT8A 5F2WA 1R091 1QLEB 1L1FA 4GLXA 3J7MA 3VBBA 1W05A 5M0TA 2ZZJA 4KWKA 5L3DA 1YCIA 3SR2C 4DV2B 2WZEA 5KC5A 1Q5OA 1RXGA 2QDNA 5FY1A 1JUIA 2QCSB 1K5MA 4QB2A 3VQVA 5A7OA 4Q4V1 3AYAA 3VN4A 1CAWA 3T1YO 1RUI1 4CUGA 3IJ4A 2RR13 4YHHO 1F4AA 3LNNA 4RGKA 3ZDVA 5LCWL 3OEAA 1NCRB 4L99A 4NKGB 3ZR5A 1OH4A 1RP3B 2N74A 2M6YA 2ZMLA 4OZXA 2B8MA 4CDUC 1WW5A 5D8AC 3B02A 3Q4HB 5FUNA 2Q8EA 4X1IB 1H4GA 3RYFB 4XUOA 1JZ6A 4L92A 1VBB3 2ZKOA 5GLZA 2PHRA 4B3SB 4BIUA 1UNBA 3RYPA 3ILNA 1WLTA 2VS0A 1NCQB 3LA3A 1TMF1 4PIYA 3WT3A 1VBB2 4FFBB 4KHPO 2P37A 1WNSA 1M56B 1BHGA 4J7ZA 3A0HZ 2EZOA 1W03A 4JDNA 1XNTA 2HYKA 4XMIA 4XJ8A 3N36A 1TUBB 4OMCA 1P7BA 4CC6A 2FB5A 2JK5C 4W6WA 4MGKE 3Q8FA 1DU3D 4IE6A 4ZHQB 5FV3A 2O8OA 4KGGA 4OULA 3E5XA 1N36O 3THOA 5FUPA 3IFXA 3WB2A 3BODA 4C91A 1IHMA 4RSUA 4XBFA 3WG2A 4PIZA 5L36A 4QX0A 3POWA 3VD9A 5LW9A 2HKOA 1LTEA 4P9PA 5LMNB 3AK3A 2QQOA 1Q8VA 1NCQA 3ZSLA 1OLRA 3U37A 1YI7A 5F32A 1YFYA 1KECA 4UCOA 5ABJB 2GN3A 3GCXA 5FQ0B 5FWJA 3UQ8A 3V0AB 3LSQA 1CZTA 1YQCA 3ABKC 4JQTA 4E4HA 3OGSA 1PZ9A 3P3NA 4UB6Z 1CGPA 3CP1A 1W59A 4YW5A 5ACA2 4RQPC 3QLQA 3CJHA 4B7KA 5EYXA 4LA2A 1Q6HA 3ACHA 4Q29A 5I8TA 4DV3B 3ZXFA 1F9KA 3AL5A 3EBRA 4OYUA 3TRSB 1BQZA 2B9ZA 4UYBA 1S5HC 3APBA 2X6AA 1LHUA 1TEIA 2E75B 4YZ3A 2EICA 4MW3A 5LY2A 5C4WA 3OGGA 5A6ZA 4P2ZA 1H6XA 2D93A 5A7NA 2XLAA 2JVDA 1AHSA 1G86A 2R0HA 2JG8A 4PLMA 2XJQA 5FCCA 3T4HB 5AG2A 2GH8A 3ALQA 2ZGSA 5A7SA 1YFWA 5JR7B 5EZYB 2Y48A 3RZZA 3LOBA 4YY3B 3WFVA 2VZOA 2Y38A 3T4VA 1JR9A 2V4VA 5JOXA 2R043 3IIAA 4AVTA 2OX0A 1A78A 4I50B 3KV9A 3RZGA 3I2JA 5EFUA 2HVJC 2N04A 3RQ0A 1RUJ1 3AKQA 4P9LA 2JDHA 2GSYA 5IYZA 3D82A 2CH7B 4EWDA 3E6DA 3PLQA 4KWUA 2YROA 5DZEA 3W7XA 2WYFA 4LO6B 4L8JA 3KZIZ 3AMQA 4JGZC 1ZRIA 1BK1A 1UPGA 2Q9LA 1SCSA 4FAHA 4D94A 2UUAO 4NOTA 1UPSA 2OQ7A 3CWBH 3U75A 3ZYBA 3NNJA 3K2OA 2QJVA 2DMXA 3N9OA 4MVUA 3IDEA 4LLOA 5A6YA 2W68A 1OURA 4IV3A 3USSA 2YC4A 3QCWA 1QOSA 5C5UA 5FZ6A 3SYQA 3SYAA 3ITQA 2CY6A 1GN4A 3HIFA 5FOBB 3KHBA 3IN9A 2WT2A 4UF0A 3DKWA 3OAAG 4KL1A 3W9AA 2FDGA 3WF0A 3DECA 1OKOA 1BXHA 4IGOA 4XUQA 2PQSA 1GTOA 3WD5A 2BNNA 4A6SA 3I4IA 2ZGKA 4AW7A 5EK0A 3PL0A 4PDWC 2VAUA 3VBRA 1BZWA 3INAA 5FYBA 1OXCA 4U7NA 2BWCA 1IBMO 3VDCA 2IXIA 1WMEA 3KMHA 2Y6HA 2QWOB 3Q8CA 3ZYFA 4DY5A 1W9YA 4ZXEA 2HFEC 2GH2A 1RHI1 3FUOA 5FZDA 5CG8A 2O1QA 4M4PA 2XHKA 1XNRB 3E97A 2BNMA 2RS33 1K33A 3P30A 3GZUC 1HN1A 1VAMA 2ZACA 1ND2C 5FZAA 3FE5A 5F2SA 3GBWA 1PM9A 2VOWA 2Z2SB 1S72V 2XL7A 2ZT9B 2W0FC 1KJLA 1WN7A 4YWAA 4YSFA 3G80A 4J11A 3HKBA 4MVQA 3MUZ1 1G1XB 2PUSA 2ARHA 4NN0A 3U14A 2ETEA 4IT5A 3WW3A 2W08A 3X2QC 1RUC2 2YBSA 3UK9A 2RDNA 4RHV2 3UO2A 5CMUA 4DV4O 2KB1A 4GKJO 1XJAA 2UYBA 4Q0PA 4KWLA 1V6MA 3ZN1A 3F7YC 3USUA 2JECA 1NG0A 2GMMA 2R72A 3ZN6A 3IGAC 2BDRA 4FFIA 1YXWA 1OLQA 5FPXA 4M3CF 1K97A 1WP8A 5SV8A 5L3EA 5F5IA 1US2A 3S7IA 5FY5A 4GWMA 3ZIXA 4X66B 2Y4TA 2XAGA 1RJ7A 4XJAA 4HKWA 1VBA2 3EMRA 4I9QA 1BL8A 5FDBA 2V5DA 3MICA 2V7QG 1W0KG 1O59A 2ZAAA 5JCTA 1W2UA 5HXMA 2VWKA 3F95A 2HEYF 5LWBA 1XBLA 4G27B 2XVGA 2ZKLA 4NAOA 2NNUA 1NLQA 4WBNB 1Q7YW 2EA7A 1R3LC 1PMIA 4LK7A 5A70A 3PTRB 2UUBB 4BLJA 3LB9A 4MADA 2DWDC 3SXWA 4IERA 1J1LA 1YJWV 3VHRA 4OXSA 3SCHA 1FX5A 3KSCA 5FLIA 4AGVA 1ODMA 4BK4A 3OGCC 4MTGA 1LGBA 3M2MA 1DQ2A 1XNQO 2WNUC 4DUYB 5HCHA 2JE7A 3JSNA 1ALYA 2YSUB 3O65A 3RGBA 1Q8PA 1N3OA 1UF2C 3LE0A 5FPZA 1I6XA 5FY8A 1K9MW 1GKFA 1AL0G 4Y24A 2C2AA 2LM3A 3VQYA 5LRSA 2NPIA 4DEQA 3AEIA 4CP0A 2JRIA 4DV7B 3SPGA 4NB5A 4COVA 3CF6E 3K5LA 3AZWA 1UY4A 4Q4V3 1XNCA 1FOD3 1UWWA 1QJU1 4CUCA 1NZ6A 1PVC3 4Z1VA 3BPSA 2R32A 3CEWA 2J7MA 4Q26A 1O5LA 4DNYA 5CFDA 4BB3A 5C9AB 2K9PA 1AR61 3VDAA 3EB7A 1JS9A 3J8F2 4GALA 4FPJA 5HXVA 3BCCH 1VP7A 1JYTA 2BVBA 2BW8A 3V65A 5KXEA 4AI8A 2WNUB 2K9ZA 4LTAA 5BNNB 4XUPA 1REFA 2FCVA 5FPVA 4XABA 1VQPV 1NYWA 1UY2A 4Z8BA 1GMGA 5KX5A 1UOJA 5EIBC 1GQPA 5A80A 1LHOA 1YZBA 2D44A 3HN3A 3ETQA 2EULA 1BYHA 2RJZA 2F23A 2HEPA 3HEIA 3OYWB 1MEC1 3CHXA 2RQ6A 1W0NA 4JHTA 4LWSA 1W6PB 1IKQA 3ZBHA 1GRJA 1BEV3 2VCAA 2DWEC 4AFCA 2BU9A 2IJJA 3OUIA 2EIJB 1VAVA 2G19A 1AXYA 4B4QA 2BGCA 1VIWB 5FZ3A 3MF6A 4CH4A 5LHGA 2YS8A 2YZ4A 3OTOO 3NKTA 2TEPA 1BMV2 5IUQA 2OCCB 4HETA 3ZN4A 4BJ0A 1AXKA 2Q1ZB 4XILA 3VBHA 5FYMA 3KT7A 4AG4A 4KMQA 1PK6C 1CAUB 2Q1FA 4LHNA 4AI1A 4CXXA 3AVSA 3OY8B 4RHV1 1QQP1 1VRBA 2RMKB 4JYBA 4J25A 1QH7A 4QGPA 3QH6A 3NMBA 2R7EB 3I3BA 5DMYA 4QQPA 5J09A 2FKXA 4P5HA 1LECA 1Q8SA 4UUJC 1W0OA 4F3JA 3O1VA 2ETNA 3IM0A 4AVCA 2XMLA 1OMIA 1XB9A 3MIDA 1FXKB 1HNWB 2BSKB 1RGSA 4BCUA 1YQ8A 3MDSA 3O1PA 4X9QA 4TUYA 1N1SA 4R50A 1UYZA 4LA3A 2CK3G 1UZYA 5JSRA 4F6RA 5JXHA 4GWIA 5JPMB 3LF7A 1RVF3 1W3VA 4E4ZA 3CXCU 5FPRA 4JI7O 3RDIA 3EJKA 4NUBA 3ZFEC 2PHWA 5DUVA 3ZYHA 3NJVA 5HCFA 2WZR2 2P22C 1WCKA 4LF9O 4LR3A 5F7UA 3ZFGA 5H9QA 3USUB 1F23A 1V9U3 1ULPA 2NN8A 5F3IA 3N2KB 2BTVC 1AL23 4WM8B 2CAVA 4C1XA 4ABMA 4JI0B 3OFNG 1RUD3 4IHJB 3PUAA 3KT4A 3HBKA 2QDRA 5LY1A 1W90A 2WLLB 1QU0A 2EXIA 1NZIA 1WW6A 1JYCA 1AR73 2VZ3A 5JI9A 1REEA 4P9WA 1K42A 3JAKB 4YGCA 1KB9F 5L3FA 4ZU7A 1PVXA 4XF3A 4E8DA 2NM1A 4AQYO 4F7ZA 1QHTA 3OTOB 4QGNA 1S5JA 2AGSA 3LDKA 4XC9A 4JCKA 1QXRA 4XBQA 3E8GA 1OT5A 3NNFA 1W28A 2B4KA 3IMMA 4YW7A 1E1QG 1Y9GA 4EN6B 3E8BA 1TQ5A 2JIZG 4FI9A 1S4CA 1NH2B 4F6RB 2YBKA 5I0TA 5J9PC 2ZXWC 4AXOA 5I91A 3O0WA 5H9PA 3WNOA 1NXD1 2ZNIA 2KG7A 3D36A 1IBLB 1IXBA 4DRRA 4GZRB 1K5QA 2XAJA 5A7QA