3FFQA

Hcn2i 443-640 apo-state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
184
Chain Sequence
SRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 51
structure length 184
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ffqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ffqA02
2PAEA 3UKVA 3IBMA 3U0ZA 4A2UA 4YSFA 3SCHA 3LOIA 5AVPA 3GYDA 3H50A 2H6CA 2I45A 4ORFA 3GBFA 3OTFA 1CAXA 2ETEA 1I6XA 1GQHA 2CV6A 2GC1A 3I54A 1UD1A 4KWKA 2PHDA 4UXAA 4MGIE 3S0MA 1ZX5A 3D82A 4XF0A 1QY4A 2MNGA 2CAVA 5BV6A 4LUMA 1L3JA 4HMZA 3HQXA 3BPZA 2MPFA 2ZKLA 1WLTA 4MX3A 5CVRA 4Q0VA 2OZ6A 5JCTA 4Q0QA 4R52A 4XETA 3CL1A 2QNKA 3ELNA 3IIAA 4XFHA 4UBHA 3RYKA 1QWRA 4Z82A 3I59B 4IEYA 1ZRFA 2WC2A 4I09A 3E5UA 4KU7A 5I93A 2ET7A 4IEVA 3OGJA 2XLFA 5I0RA 2GU9A 2BGCA 4NVPA 2OZJA 4I3PA 4WVZA 3O14A 1ZZ8A 3PNAA 1RUNA 1ZNPA 3USSA 4JVAA 2XLAA 2B5HA 4X6RB 1LR5A 1YFXA 3UKTA 3MPBA 1O3RA 4JTOA 2MHFA 5I8YA 3B02A 2Q4SA 5E16A 1PMIA 5T3NA 4R8HA 4MH0E 4FAGA 3CO2A 1NXMA 2FQPA 3LZZA 1QXJA 5CADA 1NE4A 4PIZA 1SEFA 4LUKA 3LAGA 1DZTA 1Y9QA 4RD7A 1IPJA 2D5FA 3IDBB 1CAWB 1CAUB 4KWLA 3E97A 3H1YA 2B8MA 4I0AA 1Y3TA 4P9GA 3FFQA 3LA3A 1U12A 3QACA 2BNNA 2PQQA 1RUOA 4ZU5A 1J59A 3LA2A 4MGYE 2H0VA 2OPKA 4KL1A 4IEZA 4XFAA 4H7LA 1J3PA 4AQ6A 5EZWA 4QMAA 2XL7A 2PYTA 4QGLA 3E6CC 1FT9A 3ETQA 3DV8A 1O7FA 3BALA 5KBFA 3DL3A 4QXKA 1Q5OA 3RPQA 1SQ4A 5K8SA 1VJ2A 3LA7A 4QM9A 5FLIA 5I91A 1LB2A 2GC0A 3U11A 5FLJA 5I0UA 4FT8A 4HZFA 4FAHA 3TNQA 2K9ZA 2EA7A 1YHFA 3HT1A 3NJZA 3IDCB 3LWCA 3ES1A 4YRDA 5FPZA 3BCWA 1FI2A 4EROA 1EPZA 3BU7A 5I0TA 3C3VA 4IEOA 4HSLA 1ZVFA 4J1XA 5JAXA 5CU1A 1DGWA 4I02A 4BH9A 4Q29A 2Q30A 1TQ5A 1O5LA 4IEQA 3H7JA 4PIYA 3H3ZA 3KGZA 5KHHA 4HBNA 3TNPB 3DN7A 5F1RA 4QM8A 3HT2A 2QVSB 3I7DA 4N9IA 1EY2A 3FE5A 2IXKA 1YFUA 1ZZ7A 2VQAA 3H9AA 4KWJA 3R6SA 5C8WA 4AXOA 3EO6A 2PA7A 1VP6A 2GAUA 4OFGA 4IEUA 5J7MA 1CAXB 2DCTA 2K0GA 1NE6A 3RNSA 4ZU7A 4IEPA 3NW4A 1RTVA 3HIFA 4HN0A 1QXRA 1ZZ6A 4L2NA 4MGKE 4YARA 3SMHA 3OF1A 1IPKA 5FCCA 1ZRDA 2IC1A 3EHKA 4D7SA 5BPXA 4MGZE 5E1RA 1LKNA 5C6CA 2O8QA 2D5HA 4YNIA 1O3SA 2D40A 4HVOA 2B9UA 2QCSB 3FWEA 4E2SA 1HW5A 1O4TA 4IEXA 4WBBA 1YUDA 3PVBB 4D7TA 3WW4A 2UY9A 5I0SA 3JZVA 2D93A 5JR7B 5I8TA 2Q1ZB 2UYAA 4B29A 2HJIA 4E2QA 3UKNA 2QDRA 2CAUA 1O3QA 1XE7A 2QJVA 4XFIA 3KGLA 3EJKA 3L2HA 1CX4A 1XRUA 1UW8A 4Q0PA 1YWKA 3E5QA 2UY8A 2WFPA 3CF6E 2P17A 1DGRA 1VR3A 2OA2A 1OFNA 2E9QA 4DINB 1J3RA 4XFFA 4TLFA 4HVRA 3RYRA 2XKOA 3SCGA 2GZWA 1ZZBA 3G7DA 4XF9A 3WW2A 3E6BA 4KU8A 4IEWA 5J48A 4XFGA 3WW3A 1OD5A 4BHPA 1ZZ9A 4L11A 4EWEA 1J58A 1X8EA 4XFBA 5EFUA 3MDPA 3CJXA 4MUVA 4GULA 5BUVA 3RZZA 4MV2A 3ROUA 3NL1A 3D0JA 3FHIB 5BY5A 2O1QA 2XGXA 3CLPA 1CAVA 4LULA 4Q0UA 4AVAA 1J3QA 1OMIA 4META 2FMYA 4ONUA 3FZ3A 4IERA 2F4PA 5LRRA 2VECA 4IESA 3SXWA 4J1WA 2IXHA 2HKXA 2EAAA 3H1WA 2OYZA 4X6QB 1ZREA 4QGMA 5KHGA 2IXJA 1LRHA 5KHKA 5LRSA 1UCXA 3PLQA 3RYPA 1UIJA 3ES4A 4LTAA 3H1MA 1WGPA 1DZRA 3H8UA 4EWDA 3H7YA 1YFWA 4XF4A 3I59A 5KHIA 3KSCA 1OI6A 2PHLA 5D1IA 1WA4A 2GC3A 5FQ0A 1CAVB 4O9EA 1J1LA 1GQGA 3IWZA 1UPIA 4OLLA 4LA3A 2PFWA 3CEWA 2VPVA 5FLHA 4N9HA 2C0ZA 3NSTA 5I8SA 3N4MA 3S7EA 4AQ2A 4BYYA 5KHJA 4EWAA 4F8AA 3WW1A 2XL9A 4E2GA 2BNMA 4XFCA 1O5UA 4K8FA 1RC6A 2Y0OA 3FX3A 4QGNA 3ZDSA 1EYBA 4HN1A 5HI0A 2IXIA 4AVBA 3SCFA 2BNOA 4IETA 3E5XA 3MZHA 4BIFA 5FQ0B 4XEZA 2KXLA 2BYVE 3E6DA 2ATFA 3M3IA 2PAMA 4F7ZA 4UBGA 4QX5A 3D0SA 5JSPA 1X8MA 1H1MA 3NVCA 4I2OA 1CAWA 4I0BA 4EV0A 1CAUA 2V09A 1SFNA 1NYWA 2IXCA 3KMHA 2UYBA 3M70A 1FXZA 2PTMA 3NKTA 3U10A 3QOPA 1Q3EA 2ET1A 2N7GA 1X82A 2EVXA 4JTNA 4MZUA 4WZCA 2XLGA 2GC2A 2PAKA 5LEKA 4LA2A 1XE8A 4LEJA 5FPXA 4AVCA 2XHKA 1Q43A 3S7IA 4YYOA 1H1IA 1G6NA 3OCPA 2Q0AA 4I01A 4XF1A 1CGPA 5BXXA 4Z07A 1RL3A 3OD0A 4JV4A 4XF3A 5J3UA 3MYXA 5FDBA 1JUHA 1V70A 2BEOA 1I5ZA 5LEJA 2ZCWA 1RGSA 4HLTA 1YLLA 4O9GA 3EQEA 4ZU4A 5JSRA 1NZCA 4CYDA 3BB6A 2Z2SB 3KCCA 1ZZCA 3SHRA 1ZRRA 2H6BA 3ACLA 4HVQA 3EBRA 3H3UA 4HSJA 4LLOA 3VHRA 1X7NA 4PIXA 5JSOA 1EP0A 1UIKA 3DKWA 3ST7A 4FBFA 2GH2A 3FJSA 2XKPA 2Z69A 1YFYA 4Q0SA 1PM7A 2CGPA 3RDIA 1ZRCA 1O3TA 4PJYA 2IXLA
chains in the Genus database with same CATH superfamily
1PMHX 3IB3A 3TRSB 5DPNA 3GBFA 4BQXA 1IZ3A 4MW8A 3ZMVA 1HR0B 4TYSA 4PQ9A 3RN4A 1ZX5A 2VCMA 1LENA 5ABJA 4BK4A 5FPVA 1R1A1 4LH6A 1SLAA 1GSLA 3B5LB 2AYHA 3TBDA 1POQA 3S6PA 1SLCA 4U2AA 4UBHA 1BBT3 3W7WA 4LP8A 3A4UA 1IXMA 2Q8VA 3BGAA 4I09A 4PLMA 3OGJA 4NYKA 3RMXA 3H42B 4KBBA 1BVVA 5DEDA 5AC91 1UXXX 1ZZ8A 4XHBA 3AMNA 4P9JA 4I55A 2XLAA 1F2NA 4K0KO 3NNGA 1YFXA 2QBXA 4GYCB 3POFA 3UKTA 1Q8OA 2JGDB 2Q4SA 1KJRA 2F93B 2DV9A 1T5EA 1IBMB 3JATB 5LBQA 4LUKA 2DFBA 4UFJA 3ZSLA 3BKZA 1SBDA 1GK9A 4FM2A 2A6XA 2NMOA 2YU2A 4CU7A 1O4YA 1AYM1 3QO5A 1FAFA 1QHDA 5DDJ3 2C9AA 4AQ6A 2G9FA 1Q6UA 3FLPA 1XMQO 1G4YB 1YXBA 5DZEA 4I5SA 2LRPA 3KWVA 1HNZO 1K3IA 4BDVB 4FT8A 3HT1A 3NJZA 3W7XA 3OE7G 2P5OA 2WNEA 1US6A 3IPVB 5B3SB 5LBCA 4MOAA 2AEZA 5FXXA 4XE9A 5FZOB 2YROA 4LFAO 3K3WA 5ACA3 4CCOA 5HFMA 3NAPB 1E5SA 2FHRA 4D6RA 1CN1A 1RUG3 2VQAA 2BERA 3T09A 1AJOA 4E4HA 3THPA 5T54A 1ACCA 2W68A 2HWF3 3AZYA 4IEUA 2JG9A 2UXXA 2OX0A 4IEPA 3K0GA 2XJTA 3O1MA 3JAWB 3OR6C 3IIIA 2YEVB 3MW4A 5FJHA 4WFBV 4MGZE 3NV2A 3R4UA 1J5EB 4BLJA 4DUYB 1DDLA 5LXTA 1WKYA 1BL8A 2JD9A 4NPLA 1YO8A 2C9KA 1CR7A 3JBG2 1OHHG 4B8EA 5A33B 2EIEA 2YY1A 1W2AX 3CMEV 1XE7A 2A3WA 4FPJA 4MG2A 5T55A 3WUDA 1JFFB 2WNOA 2CL2A 2GMEA 1ALYA 3VBSA 5E8AA 3O1RA 1D0GA 3NJXA 3CS5A 2VMIA 2YDEA 1DQ6A 4AI1A 2X29A 4BIZA 2WS92 4ZS3A 3DYMA 2DYRC 5B4XA 4JGSA 2I74A 4O4HA 3ON7A 3I2HA 3K46A 3I4IA 2IJKA 4DV6B 3G6BA 3ZO0B 1Q82W 5FNVB 1YIPA 4BHPA 5A7WA 1OKQA 1J58A 5CFCC 3NMBA 4RS5C 4K1YA 5LA9A 3WR0A 1U96A 2O1QA 1V9U2 4COYA 1RB8G 4QHOA 4LHLA 4DS0A 2YYOA 3JQWA 3LEMA 4RFRB 2HKXA 1WW7A 2TBVA 3C90A 4GX2A 2WT1A 3ZFEA 4Q8KA 3S3XA 1VQMV 2ZE5A 4FPPA 2VZ1A 4JZGA 4D8MA 2WDBA 1WA4A 2GC3A 4O9EA 1SPPA 1VQ6V 4DR2B 3JCUZ 2OUJA 1YI2V 4KP4A 5C5TA 1LHUA 4E2GA 3POWA 2NN4A 3FX3A 4PT6A 3ASOC 4HN1A 1NVPB 2VMFA 3DGTA 4BIFA 1OJHA 2EXJA 1VLNA 1P84F 4CCNA 3PHMA 4YJ3A 3E6DA 1VQKV 5LA6A 1S5HC 1YF2A 3K03A 3NVCA 4FTBA 2ERFA 1UZVA 1N32B 4ZOLA 4LE4A 1PL4A 1DYKA 5C3OA 2F1MA 3JCZA 4WBNB 1ULCA 2IUWA 4HKLA 1Q3EA 4JTNA 3L71H 5LEKA 4B7EA 3MFAA 1UYPA 1DTOA 1HX6A 1HRI2 1YI9A 1Y9MA 3OCPA 3SYAA 2ITDC 4BLIA 1CGPA 1VMFA 4MGSA 3DPRB 3OD0A 4DV1B 4LKSA 3UT5A 4JASA 3VBUB 1YJNV 3PDQA 5HFLA 1H8VA 2CTPA 1B3QA 3UQ8A 4TOIA 5JSRA 4CA9A 4FPGA 4BQ5A 5A7NA 4AEMA 1GLHA 3N36A 3SHRA 2ADEA 5H6QA 3OPTA 1XXNA 5FUPA 3QH6A 2Q73A 2CGPA 2RM22 2LUWA 4UCUA 2DBIA 3LSQA 1HJGA 4WM8C 2OIIA 2XVKA 3NNFA 3FBMA 4I7ZB 2KG7A 4F6RA 2ZAAA 1HB2A 1OH4A 2PHDA 3ALQA 3HPLC 4AQYO 2DQ0A 3JD72 1L3JA 4LNUA 5FY0A 5KXDA 3ETEA 1XNCA 4XJZA 4FK5C 3ZHQA 3PTYA 1NOVA 4B3TO 2JG8C 4CDWB 2Q68A 3AP6A 4R52A 3FHQA 1N36B 2AENA 3QCWA 1YJ9V 4RHV3 3TOJA 4J7JA 2R043 1RP3B 4AGGA 3WG1A 2EIKC 1ZUQA 5EIBC 3ZRXA 2VQEO 1B35B 2VNOA 4LBNA 3KF5A 4H33A 4JTOA 2DCKA 3TB0A 5E16A 1YIFA 3HKBB 1XDCA 5T3NA 4OVEA 5JZGB 2EULA 4G4FA 3AXEA 2PLV1 3POEA 3FYEB 4I0AA 4XC9A 1Y7BA 4GH4A 5EHDA 4ZU5A 1J59A 3ZYPA 2VC9A 1W2NA 4CUAA 1LEMA 1YHQV 4XDKA 1NLSA 3HEIA 2PYJA 1SQFA 3HMYA 1ND3A 4YW3A 4LFBB 1BCCH 3CXHF 4DV5O 5IYBO 3CB2A 3KT1A 2W52A 1FOD2 3T1YB 3LDKA 1M56B 1FYUA 4F83A 3OUHA 2BBVA 4Q4W3 1GN6A 3WOGA 5C8YA 3ORJA 4L99A 2P90A 5FP4A 3UM7A 1QR9A 1SZBA 2HP8A 1W6PA 3K5LA 1OCCB 2JDYA 2Q5TA 2UWAA 4X64O 4ICGA 1NX9A 4LKEA 4B4PA 4OYUA 5BZBA 5CBGA 1YFUA 1ZZ7A 3CYOA 3DC6A 3WCRA 3VHNA 5GALA 4NIHA 2QE3A 4N21A 5EIBD 4LHSA 4RUFA 4S2GA 5BNNC 4L87A 2WLQA 3U37A 1V55B 2GHYA 3STLC 4WM7A 2DUQA 1GBGA 4XZUG 2QJ1A 3VHPA 4IL7A 2DVDA 2O8QA 1O3SA 5J37A 1PX3A 4GKKO 2DUPA 4HVOA 5DG1A 4X89A 4BJ0A 4RQEA 1OA4A 3DKQA 5B1AB 3CDZB 2UXBO 1WCUA 4BA6A 1I94B 1O4ZA 2WLLB 2Q1ZB 1PVC1 4E2QA 4Y1YA 3BI3A 1O3QA 4CP9A 2QJVA 4LF9O 1C8M1 4XAAA 4NXNO 5JCOA 4QPGB 2E51A 4FXKB 5K4LA 1W6QA 1WLWA 4L8JA 5JXJA 1UN1A 1OHFA 3N9MA 3H3LA 3ZRSA 3O12A 3I2JA 2QM7A 3NNJA 1US3A 2W3JA 1S77D 2Q8OA 3ZDVA 4BZ4A 4MVQA 4XUPA 3PN1A 3WB0A 4GD4A 4N43B 5K0UC 1OD5A 4QU2A 1H2LA 1JA8A 5JWPA 1VBD3 5IYYA 1X8EA 4LITA 3BCCH 3RZZA 3V64A 3ATGA 1PGW1 3HKDA 3ILNA 4DV4B 1BLZA 3SKJE 3VZKA 4EFBA 3ZM8A 2Q8CA 2Q6AA 1QLEB 1FJGO 4Y5SA 2IWGB 4IYIA 4G2KA 1D4VB 1S5JA 1IBKO 1LRHA 3QF7A 1RUJ1 4DRXB 4UT5A 4GX1A 4QPKA 4WVMB 4F3JA 3T1CA 5KAIZ 4Q4X1 1IS3A 3DXRA 5KC5A 2E3CA 3CSXA 3TWIA 5FZBA 2BRTA 2P6JA 1TME2 1K5QA 1ZL8A 3WFVA 4E2LA 1NA1B 3JARB 4PDRA 4JC1A 5FFOC 2E53A 1MSDA 1K5MB 3B8MA 1W8HA 3WV6A 2ZDIA 2UXDB 1AR93 2GDFA 1G1XB 1DYPA 1QHTA 2R9AA 4K40A 3LNMB 2DURA 4XZPA 3KM5A 4NIGA 3D0SA 2RVAA 1X8MA 4O4IB 2WZR1 4J25A 2WNVB 4HZ3A 3I5DA 1BKZA 4EV0A 3VUOA 1FFTB 4CDXC 2ZE8A 4ZHQB 4HPKA 4ZZ8A 2AW9A 3RYFA 4D3WA 2XT9A 4AF9A 2YXHA 1GN2A 2N7GA 4ZONA 2WO3A 1MS9A 1BVP1 5CKNA 2YUAA 1AHSA 4AVCA 1ZBE2 3NRUA 2GV9A 2QWPB 1KQRA 4XW3A 3AZWA 2WLIB 1OT5A 1S2KA 4QPWA 1ZM1A 2XWBB 5DUUA 2JIZG 2PF4E 1PHMA 4CPBA 1RGSA 2Q8EA 4XQDA 1Z7S2 1VMGA 1JQ0A 2VOXA 2JE7A 5G05L 4UW5A 2EINB 2C5DA 5T52A 4G9SB 1W04A 2HFEC 2ARXA 4NXMO 3OGRA 3WQ0A 4A6SA 3DECA 3L2YA 2YI8A 4PA6A 2HVKC 1HWYA 1R093 3DCQA 2E32A 4RO2A 3ZFGB 3I54A 3AG2B 3MO4A 3BHPA 3OTOO 4LO5B 2CAZC 1DLLA 1QCEA 3CZJA 1TMF3 1AJNA 1F8VA 4TLGA 5K1PA 1GM7A 4FZ1A 1KYOF 1PKXA 2XJPA 5FZ3A 1RPOA 4X62O 1X36A 4P00B 3LB9A 4HOOA 1EV12 2RS11 2ZEWA 1S76D 4GUNA 1GWKA 1LOCA 2WC2A 3WUCA 3C7HA 3G80A 3OR7C 1ASJ1 2DCZA 4IEVA 2UUCO 4QX8A 3AYCA 1N8RW 2F4VB 4DUXA 1C5IA 5F5QA 1KXGA 5BNNA 2R0FA 5C33A 4LBEC 1QLNA 4MHRA 3PNAA 3MICA 1RUD3 4CS2A 3RMYA 4AOCA 5CFDA 1D2SA 1GYKA 5B1NA 5JLVA 4MH0E 1F51A 5LASA 2WLPA 3FAVA 2X10A 1Y9QA 2CDYA 1IPJA 5IK5A 2VG9A 5B1BB 1CAUB 4X9QA 3ZOIA 4OHYA 1JYTA 1TEIA 5LZ6A 1W59A 2ZM6B 4UV8A 4CUGA 4Z8BA 1VB2A 5CAZA 1VBB3 1XBFA 5A6ZA 2E7QA 1AF9A 5FZ0A 3CRMA 4OX9O 5FZ9A 2UU9O 4DV7O 5DMYA 1DK1A 1W3XA 5EYPB 5I0UA 2IJJA 5LY2A 3S57A 2A6ZA 4NUBA 1KFUL 5FZKA 2RHPA 1R1A3 1N34O 1TVGA 5I0TA 1AXZA 1NG0A 5JPNB 4Z2WA 4UFKA 5HCBA 5CIRA 3IMNA 4H14A 5CZKA 2Y4TA 3A22A 5IT9N 1Q56A 4BH9A 3K77A 1VBE2 2Q7HA 2WA3A 2WBKA 4GB33 2ZGSA 1LOFC 1WW5A 5L73A 4XHXA 3TN92 4CSWA 4WF9V 1KECA 2AACA 1BXHA 5AC93 3CP1A 3P3PA 5GKAC 3UKMA 2JEXA 5CB4A 4ZPIA 1S0BA 1PMJX 3PUSA 4CCDA 1VPHA 5DZGA 5ABJB 5A3MA 1FYJA 5HV0A 3VZMA 4GMP3 2QWNB 3K08A 2VQFO 3CU7A 4OHZA 4DFSA 1VQPV 4ITCA 2O14A 3OPZA 1KB9F 5E1RA 2W47A 1W28A 5C6CA 1SQBH 4DEVA 2AUYA 2MEV1 1RXGA 5SV8A 4GZRB 2E76B 2B39A 3F2ZA 3JZVA 4FPLA 2UYAA 1KKCA 4PDMA 3UKNA 2FTKA 2C26A 3KGLA 3EJKA 4Y5TA 3T1HO 4I55B 1OFNA 1T6BX 4TLFA 2C24A 1XOUA 5FPUA 2AHYA 4QKFA 1W8FA 2C1FA 1MVQA 5LK7B 3IN9A 1TUBA 4JTCB 4L11A 4PBPA 4B3RB 4DO0A 1WMFA 4FIPC 1NXD1 5BUVA 1UL9A 1AXKA 2B9VA 4K3AA 1GNHA 5JOYA 2AZ0A 5F7UA 2YICA 2VECA 3RYHA 5FZCA 3ZMTA 2VUJA 1CZTA 2J1SA 2A73B 5FKBA 5FJKA 1UCXA 1ZAUA 3RYPA 3ICXA 1WGPA 2DTWA 2ZGPA 2ZGKA 3PIJA 1PK6A 1VBA1 2XAQA 2W92A 2XB6C 2LROA 1PL0A 5GW7A 4DR6O 1KJLA 4NPRA 2Z79A 1ENVA 4LNVA 2ZMNA 4XFCA 3ZLIA 5FXVA 1B09A 1BQ0A 3AKRA 3ETDA 4AVBA 4KXRA 1JZ2A 2WABA 4FPOB 1BQZA 3H01A 3F95A 3V65A 2YBPA 4Q1RA 5FQ0B 4UW6A 1OF3A 3ZYBA 1H2SB 2JG9B 1H9PA 4JDMA 1F15A 5H2FZ 1W6OA 4N23A 2A06H 5FY5A 3CE2A 1E5HA 3M3QA 4X65O 4XUNA 2D3RA 2VW0A 3J7NA 4IDZA 5F32A 5LXTB 4LEJA 3THDA 2E63A 1RHI2 3RYIA 4LO6B 4I01A 1Y4WA 1AR73 4YJ2A 1VIWB 4QXBA 1Q6IA 2YUEA 2Y0PA 1Q8VA 2Y69C 3VBSB 3CCSV 1AR62 3ABMB 1WUVA 1Y74A 1JYWA 4O4HB 3VHRA 3I3EA 2JKXA 3AG4C 5FZFA 1ZRCA 4E4DX 3VBFC 4PJYA 1XNBA 5A7WB 3C2UA 1GP4A 3BA9A 1Q8SA 2JB8A 3OD4A 3GHNA 4OGQB 2W6JG 2RDCA 4TV8B 1LUVA 1RJ7A 2WYSA 3FUQA 1I7FA 4LWSA 1QJX2 2R70A 2GSYA 5JI9A 4Z1MG 4FO9A 4JGZA 1BEV2 1UWWA 5DAXA 3C7EA 4NHYA 3GNEA 1H8EG 4YW1A 5A3WA 3ZFEB 2LJ2A 2BW8A 2VL4A 4UCVA 4DPNA 5D5PA 4V2WA 4MSWC 1LOFA 2Z3YA 3MPPG 3OGSA 1W9WA 1W9TA 3POGA 1JU3A 1SPPB 1J84A 5JXHA 3QBQA 1I08A 1PVXA 4YG6A 2G38A 1Q8IA 4ZBMA 2EF6A 2WZPP 4QE7A 3LD8A 1E1RG 1YQCA 3LFIA 2ZBJA 5DN2A 1PZ8A 4TWTA 3FX7A 1ULEA 3T1MA 4L92A 3APBA 1HXS2 4YJ3B 1QXJA 1GTOA 4GX0A 1NE4A 5LA6B 3SQOA 1ZBA2 4RUEA 4ES8A 3CPWU 1UYZA 5IAVA 3ZX7A 4S2HA 4PA4A 5LOVA 4KWLA 4ZOLB 5HXVA 2AXTZ 4JI1O 5CA1A 3VDDC 3B93A 2BNNA 3RT3C 1WAZA 1WLCA 4GWMA 4I9WA 4H7LA 3J26N 2R7EB 2GP5A 2PI4A 3WF3A 4WCEV 4FFGA 1RUE2 2D6KA 1UY4A 1O7FA 4DNYA 4IGGA 1SQ4A 1W90A 5HXMA 5L7OC 4DQAA 4HZFA 5A6XA 4FAHA 1YZBA 1JI6A 3UT5B 3IDCB 2VMCA 4LR3A 5TSWA 5EZYA 3SPGA 3VD4A 5CMUA 1RUI2 1XHZA 4AVTA 1VB4A 2E5LB 2YB7A 3A7QA 1IGOA 1POV3 4NRPA 2D6LX 4X88A 3M3EA 3MW3A 4QQ2A 3VZLA 2VOVA 4NTXA 1SQVH 4LOSA 3R6SA 3KCYA 5C8WA 1VP6A 2KG7B 4F6RB 3UGGA 1BS3A 1SF9A 2R9RB 2QQMA 4ZU7A 3JBG3 1UKRA 4HN0A 4L2NA 2P4VA 1LGNA 2B42B 4LNUB 1Q6HA 1XL4A 1KD1W 3T4VA 1OQDA 1US2A 2R30A 3K2OA 4XJ9A 2D5HA 4UCOA 3FWEA 3FD9A 1XYNA 5D2AA 1XNKA 3T2OA 2WO2A 3WW4A 2RS32 1L0LH 4K3UA 3QNEA 2DE0X 3D3AA 3SJBC 2UY8A 5B4NA 1MZEA 1RHI1 4K8ZA 4K0KB 4R9AA 3L9JT 2RN9A 2WNUC 4YHHB 4YIPA 4YY3O 5CA0A 3E8HA 4X66B 2RDSA 3J7AU 4HXCA 5EFUA 4GULA 4GH4B 3J7LA 4SLIA 1RIRA 3SITA 2DYSB 5IYCO 1W6NA 1VEWA 4DUWA 3LQCA 2O0OA 1XMQB 4DUZB 1ND3B 3B69A 5LY1A 1RUF2 1OPOA 2IXJA 1NBMG 5IW0A 3I97A 3ILRA 2HR3A 2VCAA 5KHIA 3WP5A 3WG4A 2AZ2A 1I5PA 3M8LA 1S1AA 4GWNA 3MHHC 3ZHVA 3AFKA 3CEWA 4D94A 5C8YB 3ZSJA 4AQSA 5IJRA 4Y4RA 3N9LA 1LEDA 3WW1A 3H1KH 1W6PB 3IAPA 1O5UA 3PUIA 4UCSA 2IXIA 2VY0A 4JI8O 3E5XA 5A2QN 1VE0A 2YXYA 2IU3A 5HCFA 4AAPA 2GMPA 2DQ3A 4YZ5A 1W06A 3MLJA 1CJPA 1RUH1 4NRMA 3E8BA 1H30A 1YSCA 1XNDA 1AX1A 4NN0A 1HRI3 4J6GA 4LF7O 3KVBA 3OOXA 1GKFA 3G4SV 1A8DA 1V54B 3MF9A 4CDQC 1MG1A 4IE6A 4CU8A 4LF8O 4WM7B 1ZLZA 2GSMB 1UJWB 2EXIA 1BBT2 3RYCA 3THOA 1ZBA1 4OZOA 2NLRA 1PNMA 2UUBB 2WPDG 3BY6A 4AFCA 2G19A 1OCRB 2BP6A 4WVWA 1O59A 3LPGA 4I0WB 4BW9A 2GNTA 4JV4A 5JOWA 4UFLA 5C8CA 4Q26A 2ARAA 4Y1UA 5FZ8A 2Y0IA 1S0IA 1W6QB 3WDYA 3PJQA 5FMCA 2Y6JA 4B1MA 4V2VA 1JYVA 5LGNA 1C28A 3U78A 3AZVA 2BOBC 4CUCA 1XQNA 1PGL2 2O8OA 3JD73 4FBFA 2JICA 1MS1A 1GKBA 5KC6A 1WNSA 1COV2 1RUI1 1JHNA 1OCOB 5L7OA 1QJY2 4UV9A 5L19A 3TGUH 1CEZA 1H2NA 1OFSA 4ZXEA 1JCHA 4L97A 2ZZJA 3HKDB 2XJUA 1SFYA 2IZWA 3TEWA 2VTFA 3S0MA 5L3DA 3CCQV 4XF0A 2Y4UA 5CBHA 4K8XA 4LUMA 4HMZA 1IKPA 2AHZA 1MOFA 5GONA 3MIBA 5AFBA 2P6CA 4EZHA 4XTPA 4CCMA 4XETA 3ELNA 5A1LA 4ZS2A 3J7MA 4X1YA 3F7YC 1ZRFA 4X8NA 3D3IA 1IBLB 3ACGA 2VD7A 2YI9A 5F2SA 1ZL8B 3GDBA 1OOPB 3KD4A 4GJYA 1ENRA 4OPAA 1LU1A 1RUG2 3HNMA 3NO8A 1H9WA 1LR5A 4JI0B 3LGRA 3OBRA 5I8YA 2DVGA 3HAGA 2VOKA 2LP7A 2FQPA 1QR8A 3T0AA 2ARBA 2H94A 4XUOA 4COWA 2E75B 4ATEA 4GCZA 2D44A 2QM4A 1FOD3 3QACA 2TUNA 3RYFB 3VQVA 4KL1A 2GALA 3CEIA 3AG1C 4J11A 1Y76A 2W1QA 4JI6O 1O9HA 4AEDA 1SERA 5C9AC 3BVCA 1AL22 3BALA 3POBA 4MTOA 3GF6A 3WDUA 2W91A 4HG6B 1WZXA 3LA7A 4JI3O 1U97A 1LOAA 4ES9A 2ZD9A 3EVKA 2EA7A 1ULFA 3LWCA 3JSNA 4QDSA 4QKNA 5DAPA 3P30A 3PJSK 1QH6A 4DV0O 2ZMKA 2YIBA 2ADDA 1UMIA 4I4TA 1NQDA 2OUHA 2VMGA 4I02A 4Q5OA 3I2FA 5KAFZ 3MIGA 3HR0A 4LE3A 4JQRA 2OPWA 5FUNA 3BN6A 4UB8Z 2JXAA 5A7QA 1ULOA 1MQTC 1EUUA 1NE6A 4IE4A 5GZCA 3NW4A 5DABA 4XQWA 4K1ZA 3JSLA 1A32A 1I5XA 4FPCA 2PMWB 4QPIC 5GLZA 2LTNA 2B9UA 4PA9A 5D8AC 1F7YA 4PI0A 1D7PM 3KF3A 5HCHA 2JKBA 1JMKC 1WCQA 5H9RA 1DP0A 5BNPC 3N27A 2VZPA 1WP8A 2HH9A 3D4KA 1DGSA 4SBVA 3TAYA 1BMV2 4FOVA 3A0BZ 2VBBA 1XU1A 4Q4V2 1RUC2 3K58A 5CFDB 4EN7B 3ASNB 4RQPA 5F2WA 4M4PA 4FLYA 4LHNA 1WA8A 2GMMA 3FAVB 4XF9A 5B5EZ 4CP0A 3VKOA 3C3SA 1DQ2A 2JECA 3ASIA 2GTAA 3AM2A 4XFBA 3JU9A 4I0XA 5BY5A 5A1FA 1CAVA 2PY5A 1OMIA 3JB4C 3KCXA 3H8XA 2VZRA 2XVGA 4LBQD 3KZIZ 1TME3 3AKSA 3CJIC 4NHXA 5KHGA 4O2AA 2HWC2 3PUHA 3WF1A 4MVOA 4LTAA 3ES4A 3AG7A 1HRV1 3W59A 2GNDA 4R4XA 2E31A 2R062 1H6YA 4LF4O 3IWZA 1UPIA 4OLLA 4LA3A 2VPVA 5C4WC 3VBOB 2VZUA 1V0AA 4MSVA 1GMMA 3AYAA 4NHKA 4LFCO 5ITZA 3AVRA 5J2UA 4X64B 2G1MA 4YVSC 4LOTA 1I0HA 4B3NA 2VJXA 1UZZA 1YC61 4EN8B 2G4IA 1VRH2 1OLRA 5CB4B 4M0HA 4I2OA 3PVOA 5LGUA 1CAWA 2CTVA 3CQOA 1H2MA 4YIOA 2V09A 3WNXA 1S4CA 1U5XA 3CRAA 4NRQA 3RWKX 3ZXGA 1MNGA 1Z7S3 4MZUA 3RZHA 3B01A 1GMGA 2B9ZA 4LO4B 2VUCA 4K20A 3OUJA 3AZZA 2CWSA 3DC5A 4Y1XA 2R042 2UXBB 1YEWA 2OCCC 1S0EA 4DRVA 5GTIZ 1VAVA 4JZRA 3GJAA 4XYXA 2WIIB 5LMNB 1SQXH 2BEOA 1I5ZA 4HONA 4JKLA 5EBLC 3H1LH 5IWAB 1FKAO 3GCWA 3EQEA 1NY71 4Y22A 5FKCA 4YG0A 2VBPA 4H13B 1HKDA 3WHUA 1F31A 3W7SA 5KR7A 4COVA 1TUBB 2VWKA 4NWWA 4CH4A 1URXA 3U0ZA 4JV5O 3LOIA 3DUIA 3GYDA 1EV13 4DR3O 2I45A 4P9YA 1GQHA 5KWRA 1JOPA 4KWKA 2D43A 4LORA 1QY4A 1XSQA 4GALA 3CJHA 3RYHB 2VNGA 3BPZA 2VZOA 2QGNA 2BJSA 2A6WA 1N33O 4L0PA 2ZX0A 1FXKA 2HLDG 3JALA 3MLKA 1GZTA 2ZXWC 1KITA 1Y9GA 4JI2O 2BDRA 1PK6B 1RM1C 1V6JA 1MQTA 3GWKC 4I30A 5FYUA 2QQWA 2GU9A 3OGIB 1WBLA 1NTZH 1WMEA 3VBRC 4HFSA 1AR82 2LGWA 3DXUA 3ABTA 1EN5A 3I2KA 2ORZA 1EAH1 4IQPA 4C8DA 3G6JB 2B5HA 4X6RB 5CA3A 4QHZA 3MPBA 2G9ZA 5JMOA 1NCQB 3L75H 4K6BA 1AI5A 3CWBH 5FK7A 1HDKA 4MVZA 5D8AA 1SEFA 1BMV1 3H1HH 1U5IA 1GNYA 5FYHA 3AKQA 4QX2A 2B45X 1N3OA 1W6OB 2B8MA 1PO22 3FFQA 4O4LA 2DWDC 1W2BU 3L73H 5F6LB 1VP7A 1ZSPA 1O8PA 3RYIB 1OPMA 2P34A 4KUMA 4TN7A 4XABA 4YGEA 2Q5ZA 1LCLA 4AL9A 1J1TA 3ZSEA 3WNOA 4YJ2B 4RN5A 2HEYF 2R6QA 2ZJCA 1ENSA 3BOPA 1SDWA 4FM1A 1AROP 5IVFA 1A3KA 1FATA 2Q1FA 2AH2A 2A3YA 5FP3A 2HWC1 1Y74B 2GNMA 4TV9A 2F43G 2EIMC 1TQ5A 4XTMA 3N9QA 2EX3A 3H7JA 1VBD2 3F5WC 2F6BA 2XWJB 4FP2A 4NXMB 2IU0A 1ZA4A 4DR1B 5F1RA 2R061 1UZ0A 2XBO1 5GZGA 1DF5A 5IFTA 4YM0A 4JAVA 1G8WA 2PA7A 5JJEB 3ZFFC 2K0GA 1QQP2 3ZX6A 2QQLA 2Y6FA 5FBJA 4OCTA 4LWSB 2UXCB 4XIOA 1GOGA 2EIDA 3GJBA 3OTOB 4JGZB 1XSRA 4UFMA 2OXBA 5JIAA 1HDJA 5C4WA 4PDWB 3ZN6A 2PHWA 4AVSA 4D7SA 5BPXA 2HWD1 1VRH1 2RCVA 3UT0A 4YNIA 1CP9A 4UCRA 1O4TA 4C1XA 3M3OA 3PVBB 1MACA 1K5SA 1LUWA 3VBHA 3ABLB 1M4WA 2ZGQA 4JQTA 1GV9A 4CVUA 3K48A 1F5JA 1OH3A 5KXBA 4DXTA 3L70H 1XU2A 5LBFA 5F9TA 1VMHA 2K9PA 1NU1H 1LTEA 3CF6E 1HN1A 4XJWA 5EPAA 5KMGA 3GWOA 5KX5A 3R4DB 4AI9A 5FPRA 3HVDA 2CTWA 5JQGA 4MADA 2JB4A 2ZGUA 3U07A 2BVBA 5LOVB 3X29B 4GKXA 3V56A 3ZYFA 5CA1B 5FYMA 1K97A 2OQ6A 2DVAA 2Y6HA 1K45A 1GM9A 4JYAO 3GB7C 3PUAA 1UU5A 4IERA 4JGYC 2VXJA 3ZXKA 1UY1A 4N53B 2X5IC 1QJU1 4XXPA 2P3YA 3WDWA 4FCAA 3AEIA 3VQWA 3OFNG 5D21A 3AKPA 2CGOA 2ZR3A 4HANA 5EZYB 3KSCA 2WJSA 1N34B 4GKJO 1J1LA 4A7ZA 2GN3A 3AJZA 2PFWA 2KR2A 3MV11 2ZGLA 5A3OA 5JH7A 2Q4PA 2EALA 4BYYA 4GLXA 1NR7A 2N74A 1I5YA 5FYYA 1C3HA 3JASA 3MZHA 1AJQA 5LA2A 1NJIW 2WRAA 4XEZA 5E89A 2RS52 1RHI3 1AR81 5JSPA 1G9BA 2RJ2A 3JAKB 3D8CA 1W8WA 3KMHA 2UYBA 3K4ZA 3ZYHA 3AP7A 1PV0A 4C0HA 4WZCA 4LMFA 1AR63 2JJ1G 4XMAA 2OW4A 5BXZA 2XHKA 3AFGA 2KM2A 3S7IA 2A6VA 4E4ZA 4W6YA 3QO8A 1G6NA 1LOGA 5A80A 1RUD2 1I9RA 4XF3A 1WMXA 5LYJA 4PBOA 2ZABA 1KD7A 1KU9A 4O9GA 2Q0OC 4CYDA 1A78A 1HR0O 2ZEYA 1ZZCA 3ZMSA 5LW9A 2R1DA 3MIEA 1X7NA 1QJX3 4CXYA 4IV3A 2WFF1 4EN6B 5DN6G 5CA0B 3RDIA 2VMHA 5H9PA 3SPCA 2Z42A 3DYOA 3MIFA 3HNBM 1PZ9A 1XILA 1W6NB 2D3PA 5EWSA 5J2TA 2ZHMA 1XNQB 2ZEZA 3JB8A 1ROPA 3AJYA 1VALA 1AX0A 1IKQA 1XB9A 2D7FA 2XJVA 1VF6C 4GIQA 4EKWA 1IBMO 1AI7A 5FOBB 1JYIA 1HXS3 3KQ4B 3ZS8C 4FLXA 2J1EA 2ZXQA 4CCEA 3CCEV 5IVVA 3O0WA 1ZBA3 2HEVF 4DR6B 1R3JC 4JHTA 2ZX1A 4A7YA 5AC92 2IVIB 3POIA 2XAGA 4TQDA 1TA8A 1CIWA 1RUE3 4R8HA 3K06A 1GM8A 1NXMA 1JZ7A 2WSVA 3HOBA 2QDOA 2LQTA 5AVAA 4BCUA 1M1KW 3BTAA 2PQQA 1GZWB 1L7RA 3E35A 3RYCB 4MT8A 5FUIA 1AYM2 1RUI3 2PYTA 4PDLA 2W95A 3DL3A 3M7MX 1JHJA 3POJA 5T5PA 4CS4A 3ZXJA 4LR4A 3BAAA 4H0LB 4X1KA 5C8CB 4PF1A 5FPZA 1RMU1 3VKLA 1UOFA 4PLOA 2IVJA 4XCBA 4YGDA 5BR8O 2JIGA 1PM4A 4HSLA 2GH8A 3PURA 3APOA 4J9ZB 5F37A 2BWCA 3AZXA 2IBZH 5FL7G 3ZEDA 3HKEB 5LK5A 5M0TA 2W1SA 2JDNA 3H3ZA 4JGYA 3TNPB 3DN7A 3RZJA 2VRZA 5L9VA 1J5EO 5F3CA 4DUYO 4FXGB 2P06A 1Z0HA 2LGQA 4NROA 4BE3A 3ZHRA 1UZWA 4OFGA 2Y48A 2GP3A 4U7NA 4X8AA 3H8OA 2VR4A 2RS33 5EXOA 1OCZB 4IE0A 4A44A 3W58A 5GONB 2W9XA 2EZPA 1LU2A 2IC1A 4CEWA 3CC7V 5FZLA 4CEYA 4JYYA 2ZKNA 2F95B 3SEPA 2WAMA 3BIEA 1SLLA 3ETPA 5JR7B 4FLZA 4P2ZA 2HJIA 4NR1A 3P1IA 3S5AA 1F4HA 5B3SC 2QWQB 1CX4A 3R4SA 5J09A 1CESA 1UOBA 3EXAA 1JU4A 2ZKOA 3WF2A 4IGPA 1RINA 4Y24A 2YZ4A 3NAPC 1SA0A 2A79B 2X0LA 4LCUC 3WW3A 1RUF3 4HKOA 5IY5B 1V6KA 5FTTC 4B3SB 2V73A 4IV1A 1R3KC 2CNAA 1E5RA 4DR2O 1Y76B 4META 4AEDB 1H1AA 1D2QA 3AG3B 4BWOA 1BK1A 1K3EA 4DY5A 3SXWA 4L8QA 3SYPA 2ZMLA 5T5OA 1BHBA 2CHHA 1MZ5A 4A6OA 1WD4A 4CDUA 3PLQA 2LFRA 1HQNA 4FPHA 3S5QA 4XF4A 3R65A 2R072 1UMZA 4I4TB 5JJNB 1M9NA 3BRCA 3DYPA 2OKXA 2AC1A 4R9CA 1OURA 3PMSA 4P5HA 1ND2A 3N3HA 4M3CE 2UXNA 4BR6A 1EYBA 3W5MA 2VM9A 4JI5B 4U3FH 5JI7A 5SV5A 3NV3A 3OY8A 1E79G 1M5IA 5IJ0A 3LSSA 3N35A 4PCRA 3WP3A 2ATFA 2YV8A 4DXSA 1EZJA 3KLSA 4WFHA 1RJ8A 4DV1O 1V6OA 1TZOA 3WHTA 3RVZA 3IC7A 5FY1A 1GAXA 4UAPA 3SPHA 4UVCA 3GCXA 2XQXA 3KZ4C 3SPJA 2EZOA 1C57A 3TXSA 1M4UA 1JPXA 2VZQA 2LW1A 1COV3 2ZCWA 1BMFG 1QJY3 3ZHSA 4HLTA 1FFXB 3QH7A 3V0AA 3KCCA 2Y64A 1OKOA 2Y34A 4RQPB 5A1AA 1F5FA 4XDLA 2VZTA 3SJQC 1WA8B 1HRV3 1UIKA 3I3QA 1VF5B 2KSDA 1PM7A 3K3NA 1N36O 2PAEA 3IBMA 2ADQB 4I0XB 5F5IA 2WQZC 3VZJA 1AUYA 2H6CA 4RR3A 2GC1A 4A3ZA 2ETNA 2FB5A 2JGUA 3B94A 3K9SA 4BPZA 3U1XA 2VOWA 4PF5A 2VQUA 4YVWA 1YQ8A 5JCTA 4O2AB 3WY6A 5IK4A 3IIAA 2FZ1A 1IQDC 4U3JA 1MS3A 3LPFA 3OGCC 5LA0A 3N2GA 4IEYA 4MGQA 3DPRC 3JATA 3VBUC 5I0RA 3LIHA 3MHZA 3PVEA 1FNYA 3HJRA 2XOMA 3PIGA 1AP5A 4YFWA 2YMZA 3HBZA 1IS6A 3H1IH 5IVEA 4QDRA 3USSA 1G86A 3LEKA 5ITZB 2DMXA 1W0PA 5J2UB 3VL9A 2B1GA 2SLIA 4JI8B 1SQPH 4RFT0 4YZ4A 5CNAA 4DOUA 2HJDA 3KVAA 5BNOA 3THCA 1AL23 1FPOA 1NCRB 4X1IB 5FY7A 5CN0A 4H2AA 4WV8A 2XXZA 1CAWB 1V6IA 4HETA 2NN8A 2PLV2 3WG2A 4BOWA 5FO8B 3LA3A 5EJ3A 2QQNA 4LF8B 4AR2A 1U5ZA 4D0QA 4AFBA 4Z2AA 1ZWIC 5DUXA 3B40A 2VW2A 1NVPD 1W0NA 4QGLA 1FT9A 1W8ZA 2HHHB 5KBFA 4QXKA 3RPQA 1R1ZA 4CDWC 5FO9B 3VQYA 3NNMA 4YW7A 1LOEA 5DDJ1 3ZMNA 2K46A 3ES1A 5LBBA 3FHAA 1U0AA 4IEOA 2DWRA 2EJ7A 1HNWB 4UF0A 1MEC2 1DGLA 5IDJA 4Y22B 4BQ2A 4KBZA 4TSFG 2DDUA 4XMIA 4LPLA 1VIBA 3MIHA 3JAWA 4IEQA 1B35C 3RWRD 4QU1A 2R071 5C3SA 4P02B 1EY2A 3E2EA 3AP4A 5JZGC 3OW2U 3CMAV 3NR7A 2IXKA 5C70A 3SKVA 1CPMA 5E79Z 2RMU2 1I94O 4MXVA 3AX4A 3KS7A 5ACA1 1R3IC 1LECA 4QAWA 1QXRA 5FZ4A 2IJHA 3CJHB 3HD8B 2YPJA 3O7OA 3RQ0A 3PU8A 4QE9A 1FXKB 2HWB2 4Q4V3 2ZA9A 1RUC3 2D40A 1BT8A 3JALB 3FB5C 1QVGU 1P4RA 4B3MB 4KMQA 3HQRA 4XPVA 4NPMA 4CP2A 5C71A 1YQ6A 4CE8A 4XFIA 1M56C 2XMLA 1PVC2 2JEUA 4Q0PA 1ZA7A 1C8M2 1VR3A 4QJFB 1V9PA 4A45A 2EICA 4DV4O 5CB7A 3Q8AA 4O7XA 1OCCC 3B00A 1S5LZ 4DXWA 3E86A 4NB5A 2EIBA 5FLXN 3RZKA 1K8AW 2XPJA 2HWC3 4O4LB 2R32A 4TZDA 3FHIB 4O4JA 2KKWA 4IT5A 5T50A 4FTEA 2R063 1PGW2 1V55C 4JI6B 2WN3A 3SH3A 1XMOO 3FB7C 2JE9A 1MA1A 2EIJB 3D6EA 4GAZA 5B1AC 3O1UA 3SH4A 2UXDO 3WNKA 4CCJA 1RUJ2 4QHBA 4J41A 4Q4X2 2HYXA 1VRH3 1NQJA 4RSUA 3JD4A 3NSTA 5A70A 4YW5A 3N4MA 3S7EA 4QPGC 1JODA 4OXSA 4TV9B 1REDA 4DR4B 2RJLA 1XNRO 3WXPA 2X6BA 3JD3A 3C7OA 2QWOB 3SCFA 1DG6A 4IETA 3BEHA 1SLTA 1HN0A 5DAVA 3AC0A 2WSUA 4IW3A 3X2QB 3BYWA 2E6VA 3MIDA 4N43C 1IVSA 1XJAA 1AJKA 3WQ7A 3OEHG 1WN7A 5AG2A 5EJ1B 4I0BA 2P3IA 3BABA 2DJVA 2WZR2 3VBUA 4K8RB 1K4CC 1GICA 4FFIA 3TEXA 5C4WB 3NKTA 2ZR2A 3ZN6B 1Y66A 4CC6A 4X8PA 2QKDA 2XLGA 2J42A 1QLEC 4QWNA 4NTYA 4Q27A 1R082 3VBHB 2BTQA 4X20B 2VMEA 3F7VC 4OHVA 3IZOA 1V70A 3WNPA 4NO4A 4IHJB 4P9WA 4B08A 1K12A 1SACA 3O65A 3URFA 3I3MA 1NA1C 5KMGB 5KX5B 4AI0A 4HVQA 4Z1VA 5A3LA 3FN9A 1K5MC 2QZ2A 1XI1A 5LMUO 1YJWV 1MEC1 2IM9A 3AMMA 1XYOA 5FZMA 3D5OA 3UGFA 5CFCA 4RS5A 3TEZA 5IVYA 3KT7A 2WNVC 2CV6A 4LBMA 3WDVA 3L74H 2F4VO 4OQ8A 3D82A 2KQXA 5C5UA 4CH5A 3OMNB 2X7RB 1GP5A 2BVVA 5F3EA 1QJFA 1C8NA 3QO7A 2CH7A 1AR83 5T5LA 2DUOA 2RMU1 4AEKA 3ECQA 1B35A 3M99B 4BM8A 2QFEA 4K7JA 1ENQA 5JZGA 2ET7A 2BWAA 2RS12 5A32A 4NVPA 4KH9A 1ASJ2 3GALA 2HWB1 1W99A 3ZSMA 4ABMA 3VHOA 1MR5A 4NE9A 4QXCA 4J80A 1PO23 4DRRA 4PJ0Z 4W6WA 4BXSV 3O0XA 4RHV1 1UFIA 2EINC 2MHFA 3JASB 1I3HA 5A6YA 2OIGA 3ZN4A 4KWUA 4FAGA 1THZA 2NMNA 2WLKA 2P7TC 3B2EE 3IDBB 3B8NA 1UZYA 4PD4F 3E97A 4QX0A 5JXGA 2WFF3 4XFAA 3ZFGC 3HNYM 2XDVA 4DV2B 3CC2V 3OB8A 3ZXLA 3I56V 1YCIA 2UUAO 3T30A 2GC0A 5IJ9B 2A7AA 5FLJA 4JDNA 4K21A 3D36C 1YHFA 5F3GA 5LYJB 4YRDA 4EROA 2RNBA 4P30A 3BU7A 4H55A 3DTUB 1NT0A 5E6HA 4J7KA 4JX0A 1K73W 5A3PA 3ZMUA 1QQP3 2JDAA 4FPKA 4EYUA 3J8F2 2Q30A 4XJ8A 4DXRA 4IV3B 3PUQA 2HYKA 4FFHA 3MEPA 5HCAA 2GNBA 4CBCA 4Q4W1 5A6QA 2HEPA 5FBZA 4ASMB 1JS9A 2V5YA 1VRBA 4LQRA 4WM8A 2B7YA 3S30A 4B4QA 5B1BC 1CPYA 1UMHA 1EUTA 4J9YB 5J2TB 2YSUB 2ZNJA 4PA7A 3H9VA 3B9IA 5JOXA 3ZHTA 1FPN1 1Y6XA 4PELA 3EHKA 4ISRA 3FLRA 1EFRG 2JG8A 4HKWA 1GN4A 4XQ4A 2BQPA 4E8DA 2MEV2 4HK9A 3SYQA 3WG7B 5I8TA 5JJJB 3BTYA 3LSUA 1BHAA 3ZVXA 2QDRA 2A1XA 4EZ4A 2BZDA 2WYFA 1LNSA 5EIYB 3P3NA 4NJ4A 2HWE2 5K1XA 3ILFA 3JQXA 3HN1A 2P17A 3OEAA 4WFGA 1TAEA 2VH9A 1R081 3NJVA 4EEQA 1ZRIA 1RSOA 5LP6C 4DINB 1FX5A 3J9SA 4HVRA 2ILMA 4YG3A 3MW2A 1RMU3 4R4ZA 3FMGA 2ZINA 1XUQA 3WW2A 4IEWA 1OVPA 1OVSA 2A0LA 4BW5A 4DRXA 1I1EA 3W5NA 2PHFA 3E1F1 3RS6A 3CC4V 3ZN0A 2FDKA 1J3QA 3KQRA 1H8TB 5ABJC 3UNPA 2EAAA 2OYZA 3BODA 4YFZA 2CU5A 2RG4A 3VOUA 2JJ2G 3DF0A 1AR5A 2RR12 5A7SA 4X1KB 3CMGA 4EWDA 3ZBHA 4Y3OA 1OI6A 1GNZA 3PVNA 1JYNA 2RS53 2DBNA 1A34A 3WDTA 3KB5A 2XHNA 1VBA2 3T08A 2LS6A 3AK0A 4F8AA 3ZMOA 4K8FA 1DIWA 3WB1A 5FZEA 3OM3B 3EXUA 4RYDA 5DQ0A 3I2GA 4AAXA 4F7ZA 4XOGA 4O2BA 1JOJA 2AZ5A 4UFHA 2ORXA 1AR91 2I07B 1G7YA 3THTA 1X82A 4CEWB 4CEYB 4COUA 1B04A 1XE8A 1PO12 4FM0A 2SBAA 2VW1A 2WT2A 4IYHA 4YYOA 4EN0A 4FVMA 4FLTA 4KHPO 3GM8A 1A6CA 3ZIWA 2WWUA 2JVDA 4FFFA 3ZSKA 1Q8QA 4R6ZA 1SC5B 1H2KA 1HB4A 1R1BA 1P7GA 2PI5A 2CE4A 3QVNA 2FCVA 1WW6A 3O1SA 1LHVA 3WSOA 1AYN2 2VAUA 2VULA 4YM1A 3I3BA 5EQUA 4URAA 1VBC1 4Q8LA 2G9GA 1YYNA 2E26A 3PTRB 3BVOA 1SA0B 5EBMC 5IT6A 2WINB 1JXNA 5K0UA 1JX9A 3HQUA 4FPEA 2ZT9B 5CBLA 2J1VA 4BIUA 3O1VA 3CKHA 2JG9C 3J8F1 1CAXA 4IV1B 1AP6A 3SGIA 1D5AA 2EJRA 4JYAB 2FDJA 1XPWA 3CNAA 3FYIB 5BV6A 1S3JA 4FOQA 1XOYA 1WLTA 2VUAA 1R091 1QJZA 3CX5F 2F17A 4CDUB 1FNZA 5BMVA 3NQHA 3Q4HA 2OQ7A 3RZLA 3RYKA 1AZDA 4FSJA 2Y6LA 3KV5A 4KG8A 1TMF1 1EM1A 3RZMA 1UKGA 2XNDG 1W3VA 4CCCA 3KG2A 4ASKA 4WVZA 1UOGA 4N7IA 1ND2B 1COWG 1K9MW 3VBSC 3U4SA 1ZNPA 3ABMC 5C3PA 2OWOA 2QSAA 5DAQA 4AG4A 5LB6A 3B02A 3JCIA 4QQHA 4P9PA 2DW4A 3OY8B 5IJ0B 1AYM3 2X6AA 1QOSA 4PIZA 3RVYA 2WA4A 2HWE1 3FLTA 1TNRA 1UO9A 1AR1B 4F6EA 3SLIA 1YTFB 1H38A 4P9GA 4QDQA 4CDXA 4S2DA 5L3CA 2KA3A 1WJZA 4LLFA 1J3PA 2YPDA 3E89A 2UU8A 4AGVA 3SDLA 1N1YA 4JAAA 2RJKA 2TNFA 1MPXA 5LP6A 1VJ2A 1LB2A 2ZE7A 3ZFEC 2VCCA 3CD6V 1HQLA 1LULA 1VBB1 1TG7A 4RAIA 3P5BA 1YDXA 1RPRA 1V6NA 4DR7B 2K1EA 3V0AB 4WFAV 5FP9A 2ZQMA 1OUXA 2B46X 4JDOA 3E83A 2RR11 1O5LA 2PELA 2R1BA 5CA6A 1UOJA 2EILB 1FMD2 4M4RA 1JYXA 4MTGA 5FREA 2JJ6A 1NR1A 3I7DA 3FE5A 3ZPYA 3WZ1A 5APAA 2CK3G 4AXOA 1MZFA 3BA8A 2PYLA 5J7MA 4RR3B 4QPYA 4D6QA 4GB31 2XAHA 2C6SA 4YARA 3MUY1 4LIUA 1ZRDA 5FY4A 1W8UA 4YVWB 3G71V 4DV3B 2GN7A 1LKNA 3OBTA 4DW0A 3LDRA 2Q9LA 4U3JB 2YFZA 3VGIA 5KXCA 3UJQA 4AHYA 3N2GB 4YHHO 5K7PA 1KFXL 4GMP1 2DOSA 5I0SA 5FP8A 2XTAA 5ANNA 2CAUA 3WDXA 1D4M1 4X66O 2NQYA 1URFA 3LKJA 3JUUA 3ME2A 1UW8A 4ET7A 1YWKA 4E8CA 4FP3A 3IFXA 3IKWA 1PO11 2DU0A 2DYCA 3LSDA 2ZX4A 5A3TA 1QXPA 3WQBA 4UCTA 4KQ7A 4IE7A 1NH2D 2WLMA 1SHWB 2FDGA 1CQ9A 2ZHNA 4DUZO 1N4CA 1O8SA 5BNOB 1IG0A 3QG5A 1Z5WA 1LOBA 5J48A 1GQPA 3LDDA 5J1XA 1AYN1 1EBOA 1N3QA 3IAQA 4RA0A 1DGWX 3B9CA 3D0JA 2ZNIA 2BBAA 2R073 1F4MA 3B3QE 2LM3A 2ZGNA 1VARA 1N47A 3CCLV 2FMYA 3N9PA 4FQZA 4GA9A 4PI2A 1GZ9A 4J1WA 2IXHA 4D69A 1WWYA 4YGBA 1OQEA 1QU0A 1JYCA 3MBWA 2CSGA 1AX2A 3R66A 3VV1A 4AI3A 5FQ0A 5B2GB 4UF0B 1VQNV 5BR8B 1GQGA 1HB3A 2KD7A 2C0ZA 1UPSA 5H9QA 5DUVA 4AQ2A 4FZ0A 5DXDA 2FDFA 5H5NA 2XL9A 2CDOA 1J83A 1RC6A 2Y0OA 5IHRA 2F23A 2ARCA 4UWDA 3N7JA 2UUBO 2D98A 4JAUA 4AQTA 1H1MA 4LIVA 2OTLV 1RUH2 1DGRN 1AL0G 2A6YA 4GH4C 2DYSC 1DCSA 1WD3A 1C1LA 4LH7A 3H8RA 3HKCA 3MFCA 4LF6B 4QX1A 1ND3C 4M3CA 1V6LA 2VQTA 1QQCA 3TETA 4Z07A 1UPGA 4LC1A 4AW7A 1B06A 3B4SA 2Z5UA 5LGTA 1L0NH 5FPLA 4W4LA 1F4NA 5JIUA 2Z2SB 4TV8A 1SZXA 1AR71 2H6BA 4LF5O 2W6IG 4TUYA 1HJFA 3ZXEA 1GANA 1PZ7A 2NNUA 1O3TA 2ZS6B 4JF3A 3LCPA 3VDAA 2VS0A 3N2KA 1ODNA 5FPOA 4PA3A 3KKYA 2C2AA 1EN4A 2QQOA 1JW6A 1ONAA 3H50A 4YXWG 4O4JB 2FCTA 4OMCA 1SRYA 5HV4A 1V54C 1IBLO 1OQ1A 1GZCA 1S2BA 1FMD1 4WM7C 3OUSA 5FY9A 1WW4A 1SG3A 1K42A 4JI0O 2DF7A 1N1SA 1UY2A 1SCRA 1UY3A 1OCRC 3MD0A 1QWRA 4QX3A 1DQ5A 3WB2A 4LBJA 2H8PC 3FB6C 4MVTA 3N9NA 1IOAA 3WNNA 4P9OA 4Q20A 2OZJA 5EP9A 3HB3B 4UFZA 5JCOC 2XAFA 3A0NA 2ZX3A 5FYIA 2PLV3 1RUNA 2WT0A 2Q7EA 4Y26A 2JK5C 1NUKA 3N9OA 4UFIA 3R0RA 5DG2A 4W4KA 4YGCA 1PMIA 5FXZA 3OSDA 1S0CA 1U5YA 5CADA 4Y33A 2PN5A 3VDCA 4RD7A 3A23A 5FXWA 1OCOC 2XASA 3NWKA 3H1YA 2PXJA 1Y3TA 1H2GA 3FB8C 4OUEA 2J1UA 5FO7B 1SFPA 4IEZA 4AGRA 3KV6A 1VQ8V 1MEC3 2RDNA 1KEXA 2VWJA 1QOOA 1SKVA 4TQFA 2BTQB 3UESA 3ACIA 3IT8A 1FI2A 2QDNA 3C3VA 1ST8A 1DHKB 3LDBA 1BYHA 2RMU3 2PZSA 2VMDA 1JUIA 1OBNA 1OOPC 2DYRB 1HNZB 4PIYA 5GLTA 1IS4A 2ZDIC 2HG5C 4K9SA 1IS5A 3K3OA 3VBFA 2HWB3 1KBHA 2OTJV 1POV1 5CFCB 1W8OA 1QNYA 5LL6Y 4RS5B 3K5MA 2RJZA 2XUEA 3ZHUA 1RTVA 1KKDA 1ZZ6A 1LGCA 4LFAB 5HPOA 3VZNA 4IGOA 5JPMB 1QVFU 4A41A 3OF1A 4XUQA 1PVC3 3Q8FA 2RMKB 5FIXA 2CH7B 4PLNA 3K57A 1C8M3 1YRZA 2QCSB 3JBG1 4N7UA 4V1PA 1HW7A 4IEXA 2P6HA 3I55V 3HN3A 3NNLA 2UY9A 4AK3A 3CIHA 2Q7GA 3ZYGA 5A32B 3OGVA 2QQIA 4M3CF 2WWWA 3P32A 4XDPA 3E5QA 2WS91 3IC9A 3AK2A 2VU9A 3INAA 4MTFA 1VQOV 5KA5A 2V72A 3ASOB 4I50A 2B1IA 1JZ3A 5CEHA 2WQ4A 3SCGA 4P14A 4AHCA 3G7DA 2LALA 3AYEA 4CP9B 2J1RA 4Y1ZA 4LBOA 4AHWA 3WF0A 3MDPA 1W2UA 2FMDA 2VE1A 1V9U1 3VDDA 2YC2A 1RUJ3 1UXZA 2QA4V 4LULA 4AVAA 1PNGA 3WINE 4Q4X3 2NP0A 3K04A 5FMDA 2ZGTA 1IDSA 1AVBA 1YI7A 4LBKA 1RVF2 2ZHKA 2ZHLA 3ETGA 1ULGA 4AEJA 1GWMA 4KFMA 4CP1A 1CJDA 3ABZA 1DZRA 1OUSA 1SS3A 1FPN3 4MYEA 3NXSA 1CZSA 4JI7O 2EAKA 4JRLA 3ZYRA 1HIXA 1HRV2 5GLVA 4MVUA 1W9SA 3RSJA 2JWPA 4UB6Z 2WZR3 3WVJA 5CFDC 4OQ9A 1OLQA 3ASNC 5DZFA 4JTDB 3DXRB 5A3UA 4CPBD 4JPRA 4WM8B 2I2SA 3WP4A 4OPHA 1R083 2BCCH 1W0KG 2BFUS 1NQTA 5LMNO 1MS8A 2XONA 3C7FA 2VNVA 1GOFA 3AYDA 3E22A 5GTHZ 5IWAO 1IXBA 2H0BA 1WBFA 1CWPA 1R73A 2JG8B 1HRI1 3FFZA 1WA6X 3T0DA 4ZKTB 5FYCA 5CISA 1PP9H 2Z0AA 1H1IA 1QDCA 4LKFA 2BOCC 1L7LA 4UXNA 3A21A 1N3PA 4TTGA 5FAXA 5FMBA 1RL3A 4HPKB 3AKTA 3WNMA 2EIKB 4Q4Y2 4HT1T 1W05A 3BTXA 2RDRA 4OHWA 3M8AA 2H3OA 3UGHA 2OT7A 4DY3A 3AK3A 3Q9OA 3VBOC 3AP9A 2NYYA 1RSOB 1NY72 3WX5A 4FLUA 2V7QG 2QE7G 1QH7A 2RM21 2WNUA 1AB3A 1AILA 1JJ2U 5B1OA 5L3EA 1VQLV 4FFKA 3NV1A 3VB9A 4YSFA 5CG8A 3Q8EA 1B6QA 1KGYA 2ETEA 4GQ7A 2YG0A 3JD71 4TWKA 2BV4A 1UD1A 3O1PA 2RS13 1NS1A 4OUSA 4IIJA 2R16A 4TSVA 4YPJA 1ASJ3 3W9AA 2PHUA 1OOPA 1XMOB 2CTRA 1Z5VA 2AGAA 2E33A 4XBQA 1IQAA 1DFQA 1NKDA 3IDAA 4QXHA 3UYJA 3T0BA 1QDOA 5F5AA 1E57A 4JYCA 2BOJA 5T5JA 4Z82A 2ZGMA 2R9IA 1W2OA 2BGCA 4YZ1A 1C1FA 3GZTB 3VKMA 4AQYB 3AL6A 4BIOA 1F23A 2Y8KA 2OCHA 1KDMA 1XNRB 4B3TB 1STMA 1EAH2 1MS0A 1QEXA 3K4DA 2Y38A 1APNA 3LZZA 3VKFC 4MXWA 1SESA 4CZZA 4O2BB 4DK1A 4YLZA 3RFRA 3M7AA 2PQSA 5BNNB 1W8NA 2VTXJ 4FVVA 1VBC3 4CDQA 2VQEB 5LATA 1U12A 3GGLA 4N90A 1IG3A 3W7TA 4UUJC 3RJRA 1HNXO 3H0OA 2CY6A 4PQQA 5JR2A 4GMP0 4M01A 5FYZA 2FL4A 3PMEA 2GUZA 4CXWA 3IGAC 4DZGA 2WL1A 1XQ8A 4QT6A 1WB7A 3K51A 1Q5OA 1FOD1 3J8F3 1G9DA 3WNLA 3TNQA 4DR1O 2QQJA 4NIAA 4OHXA 3AXDA 1EPZA 5JVDA 1PK6C 1PNFA 2JX9A 2Q1MA 4AWDA 2QQUA 3ACHA 2ZIOA 1GO3F 4FOWA 1RVF1 5CU1A 2UXCO 4KGGA 5HBAA 4Q29A 5EC1C 4YM3A 3TJTA 1H4HA 4HBNA 4DV5B 1EZVH 1Y4MA 1NCQC 5LMUB 3HT2A 4N9IA 3JD1A 4AHZA 4QNHB 5K0UB 2Y6GA 1UY0A 1PPJH 3OJBA 2XBO2 2E7AA 1CAXB 2FDHA 2MEV3 1UU6A 3J4UH 3ZRVA 2YC0A 3SISA 2GBOA 2HWE3 2MK3A 4EN9B 2ZEXA 2LW8A 3KV9A 3CCRV 5BMVB 4INDA 1JVMA 2V5DA 3Q4HB 5AFEA 2HWD2 1D5NA 4UW4A 3CXCU 4W4ZA 4XACA 2W1WA 2QTWB 1YITV 1S0GA 4I3GA 4MS2A 5IVCA 3T2MA 4N8MA 2WN2A 5J36A 2C4XA 5FWEA 1MS5A 5L3BA 1MVEA 2UURA 2VXRA 2V4DA 3O1OA 2JS5A 1YNAA 1H0BA 4Y20A 4LK6A 1HV0A 4GKKB 1J3RA 3Q8CA 3FUOA 3RYRA 4DUVA 3T2PA 2D6OX 3WF4A 3CRRA 3VBBA 2HKOA 4R8CA 4KU8A 2D6NA 4Q4Y1 4XFGA 5FZ7A 5LHIA 5DECA 4LF9B 3GBWA 4NXNB 2BUKA 4CDXB 5CKQA 2RR13 4XJUA 4TT3G 3BTZA 1K92A 4ONUA 2W94A 3A0RA 4JGZC 2E7TA 2ARHA 2F4PA 3WP6A 3SNMA 5C9AA 3M3CA 4PDWC 3VBOA 3GHMA 1NKGA 5LP6B 4WZFA 1VBA3 4X6QB 1ZREA 4QGMA 2UUAB 1REEA 3PJYA 2WZEA 1HP8A 1S0JA 5KHKA 2AREA 1QJU2 5IE9A 1OXCA 2DWEC 1IX9A 3ABLC 2YBKA 1T6GC 1TME1 3SJAC 5FPBA 1DU3D 4NIDA 4HYOA 2ZZQA 4BQYA 4N9HA 3ZKUA 1FJGB 2D2CB 4ASUG 3ZDSA 3HWJA 1IBKB 4MO3M 4XURA 5EJZB 4FFBA 1D4M3 4LBQA 4CCLA 3OYWA 4DK0A 2YGMA 5FYSA 5L9BA 3ZXFA 1LR1A 2D3OW 4NWVA 2F4LA 1QBZA 1PO13 2WWSA 4UBGA 4R7CA 4E4EA 4ARXA 4R50A 2QQKA 3OAAG 1CX1A 3TXQA 2X53S 4EE2A 1NYWA 2IXCA 3AMQA 1XREA 1FXZA 3LOBA 1H8HG 4GT1A 4QKBA 3UJOA 4HNAA 3MI8A 4KNCA 3I2OA 2GC2A 2WSSG 1ZBE1 1BQPA 4QPIA 4QB2A 4A4AA 2AGSA 3K5NA 2OVUA 1AYN3 5FP7A 2WO1A 3ZRWA 4N53C 1VQ5V 4XF1A 2YIDA 5BNPA 2J1TA 1Z7S1 1JUHA 1AI6A 2ZOEB 4DR5O 3UK9A 2EXKA 4E9KA 1PIV2 3S3WA 4XILA 4D6TH 1XNQO 5EYXA 4Q6GA 1SLIA 5JSOA 1EP0A 4O65A 1UX6A 3FJSA 2Z69A 2LW7A 4AHXA 2WLNA 2WFF2 4NKGB 4RQFA 5AVPA 4JI4O 4TXWA 4P9LA 1BK0A 4CCKA 2ZCEA 3BFRA 4MGIE 3SYOA 4BWAA 2CAVA 1HV1A 3HQXA 2ZKLA 2YBSA 3CJIA 3MUZ1 1EV11 3T3YA 2QNKA 3VD9A 1JH5A 1FV3A 4AFDA 2QWRB 2VTXA 1DLCA 3GZAA 1NCQA 3GVMA 1M57C 2VBDA 4ZI7A 1QU7A 5I93A 3ABKC 5EK0A 2XLFA 2VCBA 5EC2C 4PV1B 3RW0A 2FKXA 4XIKA 2Q67A 1V00A 4QKDA 5IYZA 2VZSA 4EB6A 1K7DA 4W8JA 1POV0 2CTQA 4HL0A 4X62B 3QTCA 4YVSA 4W6XA 1TE1B 1XC6A 1WLDA 5DM6V 2XOKG 2UUCB 2D5FA 2X09A 2A3XA 1GRJA 1GUIA 5JXIA 1RUOA 4MGYE 1DBNA 1YQ5A 2Y6KA 2OPKA 4JZ2A 2Z4FA 4LO8A 3AL5A 5J9PC 3HKCB 1FS0G 1ODMA 3E6CC 3VDBA 1KP3A 4M3CB 3LE0A 1OF4A 2W2IA 1WCSA 4FPYA 4RWUA 4QD2A 2BSKA 4KHPB 4UI9L 1W9FA 4YW4A 1FMD3 3W20A 4XJAA 3BCWA 3LEIA 4XDJA 4XDQA 3A2FA 1GFF2 1RMU2 2YXSA 4J1XA 3WU2Z 1VBE1 2K2SA 5FZAA 3L9DA 1DYOA 1BE3H 5DUWA 2HLEA 5A3NA 4AE2A 4OX9B 4TUYB 2UU9B 1R3LC 2QTSA 4DV7B 3RWNA 1WCDJ 4KG0A 3TN91 1D0HA 2HBUA 4NIIA 4PDWA 3WLUA 1NH2B 4H3WA 4QM8A 1UAIA 1W03A 5D5QA 3AVSA 3N2KB 3GZEA 2DVBA 5FYBA 2P37A 2GAUA 1K34A 5JVVA 2YFUA 2QQPA 2UWCA 3OUFA 1JZ4A 4K35A 2VZ3A 1AI4A 3LDCA 4IXLA 1Q90D 1JJOA 1IPKA 1ZTEA 1Y67A 3HBKA 1JN2P 2P1BA 4ASLA 1C5HA 3FC0A 1HW5A 2D97A 3VD5A 4UOJA 3K79A 1X50A 4D7TA 3RZGA 4FJCC 4GKYA 5C8CC 2P5BA 4ISQA 1XRUA 3EYPA 2VQFB 3VBRA 3OMAB 2WFPA 4XUTA 3PL0A 4B3SO 1G6UA 2R49A 4ZHNA 4C90A 1VQ4V 3M2MA 5IK7A 4GJZA 2GZWA 1BHGA 3OBAA 1HQWA 1NT2B 4MVSA 3I8TA 4N53A 4H44B 3LF7A 3DSQA 3EMRA 3JD2A 4EFEA 1PIV1 3R05A 3T1HB 1UF2C 2NZ9A 3G67A 2VO5A 1FD9A 2NM1A 3CLPA 3AP5A 3OEBA 2RDQA 1OCZC 2VNRA 5LRRA 1S0FA 2WKKA 4UVAA 1M90W 3EFFK 4P9XA 1BSMA 4IGQA 3C8XA 4JI5O 3RRDA 5IWFA 1OV9A 1DQ4A 1OLME 5GLWA 1YFWA 3I59A 2Y69B 4A3XA 2OS2A 5ANQA 4O61A 1RUH3 4KI5M 5KHJA 3JAKA 1EPWA 1PM9A 3F5TA 3FBYA 3AG4B 3VBFB 2JDIG 3IM0A 2KXLA 2WS93 4DO2A 3M3IA 2Y26A 4QX5A 1S0VA 3ZFFA 1R64A 2JDZA 2IFRA 5IY5C 1ZYBA 1SFNA 4LO7A 1KC8W 4AFMA 5IVBA 2ET1A 2P67A 4AYUA 2A7WA 4AEDC 2XR4A 3AG3C 2NPIA 4MHUA 3T1LA 2AEYA 1S72V 4DIQA 2OIEA 1V9U3 4L9BA 2X6CA 4CU9A 2YXLA 1YIJV 4W50A 4NAOA 4DXZA 3MYXA 1TVKA 1AR61 1OSGA 5LEJA 3ZIAG 4CH6A 4X65B 1YLLA 3N7KA 2CYFA 3KV4A 4I50B 3BB6A 1GOHA 1W2TA 5FZ1A 1HLCA 4B4RA 5L36A 3V0BA 2A70A 5FMOS 3ACLA 5JUVA 4LLOA 1G9AA 1S0DA 3DKWA 3M1HA 1AR4A 5FOJB 4Q0SA 3CHXA 4R9DA 3RBZA 2XJRA 4FLVA 1TGOA 1O6UA 3SCHA 1NLRA 1W6MA 4C91A 2BTVC 2XVLA 2D6PA 3VDDB 3OTFA 2FBEA 4ZXKA 1QJX1 2PHTA 1Z78A 4UXAA 1BEV1 1GR3A 4AFAA 4XBLA 2OT5A 5IFPA 2OZ6A 2J7MA 2X5IA 3CL1A 3I3DA 4GZ9A 5L7OB 3J7HA 4RGKA 5F6KA 4KU7A 4JHZA 2KB1A 2YIAA 1OC1A 2VGDA 2ZPXA 4Y1VA 5F8PA 4QB6A 2NR5A 5EV7A 1PGSA 1N1TA 3WEZA 3MAQA 1WPXA 1GZWA 1HXS1 3MGUA 4RQPC 4FOYA 4BMEA 4X1YB 2HHHO 3U14A 2QKAA 4DYLA 5CBFA 4DV6O 2HJFC 5C3RA 1DZTA 2Y60A 1O91A 2YIBD 5F2VO 2BPA2 1PD3A 1YJKA 5E88A 3USUA 1BCXA 2RM23 3E22B 1RUE1 1HNWO 4LHKA 1N0JA 2XL7A 2WUHA 3N7MA 4Q1PA 1K5JA 3NKGA 3ETQA 3OBZA 3DV8A 2GTSA 2VOTA 1DLBA 1UNBA 1LODA 5FLIA 4QM9A 5I91A 1W39A 3HKEA 4BK5A 3ZXAC 4YM2A 2JDUA 2PGGA 4HK8A 4MTXA 1X33A 1CIYA 3UL2A 4JI1B 1WLEA 2FZ2A 5DDJ2 1QJEA 5C93A 3ZCCA 3I2IA 3ZR6A 4EJRA 1R6TA 2OYQA 2ZIMA 1Q86W 4LF5B 5LBEA 2WNUB 5GZDA 3J81N 3H9AA 5I0DA 3EO6A 2ITCC 1NCRC 2NLJC 4B3MO 1D2DA 1NZ6A 4C7UA 5H9CA 4NHLA 1WMDA 4MW3A 1N32O 1OD3A 2WWJA 3RJ2X 4IIJB 1QOTA 3A8TA 3HIFA 5ACA2 2WLHA 3FKSG 2BFUL 2FCUA 3E8FA 2ES3A 2ODMA 3CCJV 2RS31 2FDIA 1VF6A 4WBBA 2HWF2 3HPNA 1OZ0A 4ZZ5A 4R9BA 3DEMA 3T4DA 4YZ2A 2YC4A 4OI4A 5ERLA 4HAMA 3J80N 4J42A 1VF7A 3ML0A 2A5ZA 4WVVA 1DGRA 4FI9A 4I9QA 1LHOA 4XFFA 4CZSA 1FXVA 1PNKA 1KUQA 4J10A 3VN4A 1MSWD 1K33A 4GXLA 4MXWB 3E6BA 1T2XA 5FYVA 2O57A 1RVF3 3QLQA 3CJXA 4MUVA 4CDQB 3NL1A 2XGXA 1YQ2A 2A75A 4Q0UA 1CVNA 2GUZB 1RUF1 4IESA 1M06G 4DR4O 4D6SA 3K9AA 1C4RA 1FXKC 2ATKC 4YY3B 5F5CA 5GJ6A 1LHWA 4AVVA 2DTYA 3H1MA 3H7YA 4C0BA 5D1IA 5JVDB 1NI8A 1CAVB 2BU9A 4G27B 2Q69A 5BY1A 2P4EA 5IAXA 3RGBA 4NOTA 5TISZ 1XEQA 4EWAA 4CU6A 5LA1A 4BQ3A 1QGLA 5HI0A 1N1VA 1JTZX 4BAYA 2BNOA 2JGDA 2L35A 4BU2A 2XQRA 2QKSA 2IFWA 3UO2A 4BMBA 1P7BA 4URTA 5KUKA 1LGBA 5IYDO 2P2KA 3VKNA 1SDDB 1KDKA 2XHBA 1BBT1 3QD6A 3K4AA 2YGLA 4Z92B 1V6MA 2IH1C 4OZXA 3UV9A 2V1DA 1LJ7A 4Q4Y3 3SEEA 3FL7A 1FFXA 4OUMA 2EBOA 2XH6A 1X59A 5FPXA 4ARYA 1GWLA 4LFBO 4Y4YA 3MV01 5FZHA 1NLQA 3G6EV 2EIJC 4OULA 1OA3A 3T1YO 4LF7B 4H7MA 3O0VA 4QQOA 1O9GA 5J3UA 1ZX3A 5FDBA 3CCVV 3IPVA 1ENXA 3HR9A 3VZOA 2D6MA 4ZU4A 4Y20B 1JZ6A 4PHZA 1SQQH 4BXFA 2ENRA 1PGL1 1IURA 5FZOA 1ZRRA 3POYA 4BB3A 2W1UA 2ID4A 1GP6A 4HSJA 5F39A 1G8MA 1COV1 1Q8PA 4Y5Z0 3NAPA 2XKPA 1H6XA 1QJY1 3C7GA 3RG0A 5DAWA 4CTEA 4H37A 1M93A 1CONA 1BZWA 3POSA 2IXLA 4NHMA 3UKVA 3X2QC 4A2UA 3OT7A 1S55A 2YHJA 4ORFA 2DFCA 4IL6Z 1JMUB 3AMHA 3VD3A 5BNQA 2DU1A 2JEMA 2WZ8A 3AG1B 3ZXDA 4YZ3A 3WCSA 5C9AB 5ISLA 4CC5A 2YEVA 2MPFA 1NTKH 4Q0VA 3UETA 3CBNA 4XFHA 2R72A 1JBCA 1FXHA 1HB1A 1EAH3 4J7ZA 3VBHC 3BUCA 2XAJA 4AZZA 5A33A 3RI9A 4JI7B 1NCRA 4UW3A 4DEQA 4X1IA 2ZTNA 1ZBE3 1RUG1 1JFFA 3O14A 1SCSA 2N05A 1Z2GA 2P4KA 2HWF1 2PHXA 4JVAA 1UYYA 4LBLA 5FZIA 3SH5A 2ZX2A 3ACFA 4FFBB 4P5YA 4DV2O 4LBQB 4RHV2 3OYWB 4CXXA 2IH3C 4GWIA 2HBTA 1XHXA 1NAEA 2UWBA 1MQTB 4UYBA 4U36A 2VUDA 5H6RA 5FYTA 3T4HB 1PNLA 2ADPA 5FNVA 2F66C 3Q8BA 1JOYA 5EBWC 5G04L 3MDSA 3LA2A 1G9FA 1YXWA 4XXAA 1GH6A 4HNAB 1FV2A 1FAYA 4AI8A 2R0HA 1AL21 5EZWA 5KLVH 1KMIZ 4QPIB 3B7MA 2N04A 3JAMN 1QKQA 5D8AB 2QEXV 3ZRWB 3NJYA 4QQLA 3WG3A 2HVJC 5A9GA 4XCAA 1E5IA 2CWMA 2W08A 2K9ZA 3STZC 5BNPB 3WT3A 2FMLA 4Q2FA 3A0HZ 4M00A 4JTAB 4PDVA 1ZVFA 1NTMH 2XBO3 2HEWF 1DGWA 1REFA 3ZN1A 4W65A 4JI3B 3KGZA 4YW2A 3K5OA 1BZKA 4GWJA 3WQ1A 4LKDA 4ATFA 3GZUC 2ZE6A 4Q4W2 3W7UA 3CRQA 2HWD3 4DV0B 4DB5A 2DCTA 2Q8DA 1LHNA 3LIGA 3RNSA 3DGEA 3O1TA 3ZYIB 1F35A 3I49A 3OEEG 1DF0A 1OA2A 4WBNA 3E8GA 3CJIB 5EYYA 4OI1A 3KT4A 2CGNA 1UYXA 1FPN2 1BGYH 1DZQA 1XNAA 1XE0A 4JKKA 3LEGA 2YU1A 3CRCA 2EXHA 4G3YC 1G9CA 3L72H 3AMPA 1QF3A 4QB1A 4ZI7B 4B29A 2IW5A 2JDHA 3DPRA 5IUQA 2JIJA 4NMIA 3L2HA 4Q4V1 1RUC1 2RV9A 5GM0A 5IYZB 4P9IA 3ENRA 3B77A 2AR6A 4B1LA 4EB6B 1QMJA 1EN6A 2BGOA 2OA2A 2E9QA 2W39A 2DCYA 3MHSC 4YVSB 3ZMZA 2XKOA 5CYYA 4IV3C 3SC7X 1ZZBA 2W87A 3B09A 1VBE3 2QR4A 4AI2A 4EWEA 4MLOA 1L1FA 4MV2A 3JXSA 1QJU3 3CCMV 4G28B 3TN93 5KA6A 1WPBA 3OPWA 1HNXB 4BQ1A 2P3JA 3LNNA 3LSEA 4OI0A 1IHMA 2CDPA 4LXLA 1IPSA 4LK7A 5JQGB 1SMVA 3BOWA 3ZPOA 1X9PA 1DQ0A 3JD0A 2BSKB 4CDWA 3OMIB 2XG3A 2OCCB 1Y43B 5LRSA 5L9RA 2XJQA 1UIJA 3W21A 3H8UA 4JKMA 1Q81W 3WG7C 3A0KA 1VQ7V 2A3QA 5H9SA 4A7KA 4A5UB 5I8SA 3VQXA 3JYCA 4COZA 4LT5A 1TUEB 4QGNA 1WP7A 3VD7A 2JDMA 5GZFA 4IE5A 2W0FC 2B5UA 1TNFA 3HKBA 1XL6A 3IAYA 4MGTA 1L7QA 2BYVE 1F4AA 2PAMA 4ZIBA 2QKCA 3ZN5A 4LF4B 2QUOA 5FV3A 3ABUA 2WO7A 5JH7B 4X20A 5C3QA 3CZUA 3VL8A 2ZM6O 2PTMA 3C3TA 4IHJA 3SR2C 4LFCB 1R6KA 1AR92 1H8TC 4CUBA 2R041 1PIV3 1E1QG 1Q43A 3D3QA 2ZXWB 4JYBA 3GXUA 3UCSC 5BXXA 1SZTA 1RM1B 1ULDA 1W0JG 2W0XA 1QNWA 2CUGA 4UVBA 2IJIA 3OGGA 1DF4A 3VBRB 2ZGRA 1DQ1A 3AG2C 5J98B 1AVMA 3BIWE 5KXEA 1S2EA 1BJQA 5B66Z 1NZCA 4CRQA 2L9LA 4MVMA 3UO3A 3N7LA 2J1AA 4A42A 2MW2B 1SLBA 4WFEA 1CZVA 1VMJA 3EBRA 3H3UA 4PIXA 1L8DA 3PU3A 2GH2A 1VBC2 1GN3A 4DW1A 2WR9A 1YFYA 2DN9A 4WFFA 1QNMA 4AILC 3ZR5A 5CKMA 2X8KA 1JZ8A 1F9KA 5LCWL 1I6XA 3IMMA 3OG2A 1J95A 2LO1A 2JDKA 5K9YA 3TK1A 2DCJA 2MNGA 3K0DA 2WQ8A 4RL7A 4MX3A 5CVRA 4CEWC 4CEYC 4Q0QA 5FY8A 1SQGA 4LJHA 3ZYJB 4S2FA 1R092 5FWJA 4JV5B 5FK8A 5L3FA 2RE9A 3EB7A 2JRIA 2WLLA 3I59B 2V4AA 4DR3B 3E5UA 4NAMA 3APQA 1MZ6A 1TMF2 1SBEA 4QIWF 4QGPA 4I3PA 1CPNA 1JR9A 2ZGOA 3RI8A 4DMIA 4QPGA 2EIMB 2JD4A 1W8TA 1N33B 1X9TA 1O3RA 3NV4A 1YJLA 3I2DA 1XYPA 4ZKIA 3CO2A 5FRAA 2GDSA 5L3GA 1XNTA 4JI2B 3LAGA 3AK1A 1PO21 4N43A 3ZFFB 4QQPA 1M57B 5IJ9A 4B3RO 1KRIA 3ABKB 2Z5WA 1SBFA 2WLJA 4QPJA 3P6BA 4XBNA 2PUSA 2VVDA 3U75A 4IV1C 3ZIXA 2H0VA 4NTWA 3BPSA 2JDPA 4DR7O 4QMAA 1KS5A 3IDEA 5FPAA 3TCUA 1LAJA 2QTOA 5K8SA 5IVJA 1PX4A 3U11A 4CDUC 1KP2A 5LHGA 5J96B 4WVMA 4XBFA 1KS4A 5FZ6A 1BEV3 1W0OA 1TVKB 4FLWA 4P08A 5JOZA 2EIGA 4YW6A 2VVEA 1VBB2 4JRAA 5GZEA 5FZGA 4ZY9A 4EQVA 1KQSU 3H1JH 2DVFA 4DR5B 1AJPA 4XAEA 4M0NA 3O9OA 5JDBA 5JAXA 1ND2C 1VBD1 3V0BB 1NA1A 3JARA 2VVFA 2TEPA 4BQ4A 5KHHA 3AB0A 1K5MA 4DV3O 3LFMA 1VAMA 4FQ4A 2QVSB 1R1A2 2QZ3A 3OUIA 1RYYA 3SPIA 4KWJA 1QQP1 1RXFA 1W6MB 1P8JA 3U4XA 4O4IA 4JI4B 4RGGA 5F3IA 5JMCA 2WNVA 4BQWA 4F4LA 4JCKA 3T4ZA 3SYCA 5LWBA 4ZHQA 1RITA 1A8MA 4MGKE 3SMHA 4JGYB 4GB32 5FCCA 1MABG 1AXYA 5A7OA 2X5IB 3SJCC 2L6LA 4E2SA 1YVWA 5BYN<