3FFQA

Hcn2i 443-640 apo-state
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
186
structure length
184
Chain Sequence
b'SRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal transport
total genus 51
structure length 184
sequence length 186
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3ffqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ffqA02
1XRUA 2UYAA 3CF6E 2H6BA 3N4MA 3UKTA 5T3NA 5C6CA 1X8MA 4MX3A 4D7SA 3WW3A 1RUNA 1I6XA 4QGNA 3NKTA 4AQ6A 5KHKA 5LEKA 3ETQA 4WBBA 3C3VA 1RL3A 3H8UA 2Q1ZB 1JUHA 4JTNA 3OCPA 4XFAA 3IDBB 1QXRA 1Y9QA 4B29A 2QJVA 1HW5A 2QCSB 5LEJA 4I0BA 1X82A 4XF0A 3OTFA 1FI2A 1O5LA 2VPVA 2PYTA 3HT2A 3LZZA 1DGWA 4FAGA 4AVAA 2Q30A 1EYBA 1YWKA 4QMAA 3VHRA 4XETA 1QXJA 3D0SA 5FLIA 3H1WA 3H3UA 4X6RB 1EP0A 4QXKA 4Q0QA 1ZRRA 4ZU7A 1YFXA 4XEZA 3ROUA 3MYXA 2UY9A 4QM8A 3WW4A 1QWRA 1CX4A 1YFWA 1Y3TA 3FX3A 3SMHA 3RPQA 4META 1J59A 4IETA 5BUVA 2MHFA 3I59A 3KCCA 3H3ZA 4KWKA 4Q0SA 5KHJA 2GH2A 5FCCA 1H1MA 1O5UA 2D40A 4DINB 4EROA 1UIKA 5I91A 2PQQA 2IXHA 3H50A 3ST7A 4F8AA 3BU7A 1UW8A 3QOPA 2PFWA 3S0MA 4KWJA 3RNSA 1J1LA 5LRSA 2GC3A 5FQ0B 1CAXA 4N9HA 4KWLA 4I02A 2KXLA 3SXWA 5J48A 5K8SA 2ET1A 1IPJA 3EBRA 4Q0UA 1FXZA 1ZVFA 4I0AA 4MUVA 4ONUA 1O3SA 4Q0PA 4JTOA 3H1YA 1ZZ7A 2ET7A 4I2OA 4OLLA 1EY2A 3LOIA 1ZRCA 1ZNPA 2E9QA 1RGSA 4QGMA 3U11A 2N7GA 4HVRA 3RDIA 2P17A 3RYKA 5LRRA 2PAEA 4IERA 4PIZA 2UY8A 4FT8A 5JR7B 5J3UA 3SCHA 1LRHA 4UXAA 3QACA 3OF1A 3D0JA 5EZWA 3S7IA 2EVXA 1XE8A 1CAXB 5I0RA 1WGPA 1SEFA 3JZVA 2WC2A 4MGIE 1WA4A 3U0ZA 5F1RA 2ATFA 3NJZA 3E5XA 2IXCA 4Q0VA 2XLAA 1CAWA 4H7LA 1CAUA 2XKPA 1Q5OA 4YSFA 4XFBA 4YRDA 1J3PA 1YFUA 5KHHA 1CAVA 2VECA 3BB6A 3NVCA 4QM9A 2UYBA 2CV6A 4BYYA 3R6SA 3EJKA 2BNOA 3NL1A 1PM7A 2ETEA 3UKNA 4R52A 5E1RA 1YFYA 3RYPA 3EO6A 2DCTA 2MNGA 2XHKA 5I0SA 1ZZ9A 5EFUA 5BXXA 3KGZA 4IEPA 5FPZA 3B02A 1X7NA 2GC0A 5JSRA 1LKNA 5BV6A 5JSPA 4AVCA 5C8WA 3FFQA 1J3QA 4LTAA 2ZCWA 2BYVE 3D82A 4YYOA 4AQ2A 5J7MA 2K9ZA 3TNPB 2PHLA 4BIFA 1L3JA 3LA7A 4J1XA 2CGPA 1CAUB 5FLHA 3GBFA 1NE4A 4Z07A 1NXMA 4FBFA 1ZREA 2V09A 1CAVB 5BY5A 1O7FA 2XGXA 4HSLA 4HVOA 4PJYA 3DN7A 4HN0A 4O9EA 5I0UA 3USSA 1J3RA 4AVBA 3E6DA 3ZDSA 2IXKA 4IEUA 2Q4SA 4PIYA 3FJSA 4XF4A 1NE6A 5I8SA 4I3PA 2OYZA 3E5QA 2FMYA 1OI6A 1TQ5A 2BNMA 3MDPA 1ZRDA 4LLOA 2ZKLA 3S7EA 2QVSB 4R8HA 2CAUA 3E6BA 4KL1A 1Q43A 4GULA 2GAUA 1V70A 1O3QA 2B9UA 3HIFA 2XLGA 3LA2A 5I93A 2D93A 2B8MA 4L2NA 2PAKA 4ORFA 4UBGA 4X6QB 1G6NA 2MPFA 1LR5A 3I59B 4IEQA 3RZZA 5D1IA 3H7YA 3KMHA 5CADA 4HBNA 2OA2A 2D5FA 3WW1A 2O8QA 4J1WA 2IXIA 4JV4A 3CJXA 4Q29A 4P9GA 3MZHA 3E5UA 3LA3A 1UCXA 1XE7A 2Q0AA 4HVQA 1LB2A 1UD1A 3U10A 2K0GA 1DZRA 5JSOA 3PNAA 1EPZA 4WZCA 3DKWA 3EQEA 2Z2SB 2HKXA 2PAMA 2XL7A 4FAHA 3I54A 4CYDA 4BHPA 3SCGA 3BALA 4OFGA 4N9IA 3IBMA 3G7DA 4MV2A 2QNKA 4O9GA 2IXJA 4IEYA 4XFGA 4E2QA 2WFPA 4MGYE 1DGRA 2PTMA 4IEZA 3HT1A 4NVPA 2QDRA 1GQGA 5CU1A 3WW2A 3CO2A 4XF3A 3SCFA 4HZFA 2FQPA 3NW4A 4IEOA 2EA7A 1RTVA 2VQAA 4LA3A 2GC1A 3H1MA 1OFNA 2F4PA 4E2SA 3E97A 3ES1A 4JVAA 3ACLA 5HI0A 5FLJA 4YARA 2EAAA 3NSTA 3E6CC 1ZRFA 4IEXA 4MGZE 1SFNA 3ES4A 4F7ZA 3FHIB 1O4TA 3MPBA 2IC1A 1YLLA 1CAWB 4MH0E 1OMIA 2Z69A 1VJ2A 3L2HA 1NYWA 3BPZA 4EWDA 2D5HA 3HQXA 1GQHA 1QY4A 3CLPA 3BCWA 4I09A 5AVPA 1X8EA 5FQ0A 1UPIA 5JAXA 3OGJA 4IEWA 2OZ6A 3OD0A 1IPKA 3H7JA 4ZU5A 4E2GA 4A2UA 4HLTA 4TLFA 3I7DA 4LUMA 4LEJA 3IDCB 4K8FA 2XKOA 3CL1A 4Z82A 5KHGA 5FPXA 1VR3A 3IWZA 4RD7A 1NZCA 3EHKA 4XFFA 1YHFA 3FZ3A 1FT9A 1ZZCA 2C0ZA 2PHDA 4UBHA 1ZZ8A 1RUOA 4WVZA 2OPKA 3TNQA 1DZTA 4BH9A 3FE5A 5CVRA 3SHRA 2H0VA 1Q3EA 4MZUA 5BPXA 4YNIA 3M3IA 4IEVA 3H9AA 5KBFA 2O1QA 4KU7A 3UKVA 1O3TA 1CGPA 4HN1A 4MGKE 1VP6A 5KHIA 4XFCA 1YUDA 3ELNA 4EWEA 5JCTA 2I45A 3M70A 1RC6A 2BEOA 1ZZBA 3KSCA 2HJIA 4IESA 4LA2A 2IXLA 3DL3A 3RYRA 2CAVA 5E16A 2PA7A 4HMZA 4PIXA 4XFHA 3IIAA 4XFIA 1U12A 3LAGA 3LWCA 2OZJA 4L11A 3FWEA 1SQ4A 2BGCA 3GYDA 1WLTA 5I0TA 1UIJA 4LULA 3O14A 4QGLA 4EWAA 5I8YA 4QX5A 1O3RA 4KU8A 3PVBB 4AXOA 2B5HA 4ZU4A 5I8TA 1I5ZA 2XLFA 2GC2A 3DV8A 2Y0OA 3PLQA 1PMIA 2GZWA 4D7TA 2GU9A 2XL9A 3CEWA 1ZX5A 4HSJA 2BNNA 3KGLA 2H6CA 4LUKA 4EV0A 1ZZ6A 1H1IA 1OD5A 4I01A 1J58A 4XF1A 5FDBA 4XF9A
chains in the Genus database with same CATH superfamily
1XYPA 4LJHA 3K08A 1HJGA 2XBO3 3N4MA 2XJTA 5SV8A 3S3XA 4K1YA 4Q4V1 1LJ7A 1UJWB 1SCSA 1XILA 3TCUA 4XYXA 5B1AB 4XFAA 3AG1B 5LP6C 1QXRA 2RR12 2BUKA 5AFBA 4D6SA 1QHDA 4Y1YA 4B3SB 4JI0B 1V6MA 2OCCC 2YFUA 1Q7YW 4UOJA 1YWKA 4J9ZB 1HDJA 5DDJ1 3H3UA 4X6RB 1SQVH 1B6QA 3VL8A 3N7JA 4HAMA 4FIPC 1BMV2 1MA1A 1O4YA 1OF3A 5C8CA 4FOQA 5B3SB 3VHPA 3CC2V 1ENXA 1YFWA 3T0BA 3RPQA 2EXJA 2W1UA 1C8M1 3UESA 3K51A 5JXJA 2Q1MA 4HNAA 4FPYA 4DUVA 4UFMA 3ITQA 2Q69A 3H50A 3ST7A 5FUPA 1BSMA 3MW2A 1CJDA 1QLNA 3SJQC 2QQNA 3AZZA 2GC3A 1CAXA 4N9HA 2C24A 3VD3A 4DW1A 1IDSA 2YI9A 4GYCB 4LKEA 2GV9A 4GIQA 2Q7EA 4MTXA 5FXXA 3CNAA 2X5IC 2E9QA 4GKJB 3U11A 5FWJA 4Y24A 3ZMZA 4RL7A 2QWQB 4Q4V2 1H2GA 2LROA 3K5LA 1MSDA 3CC7V 3QACA 3KT1A 5H9PA 1GKFA 4Z8BA 3ZFEA 3OB8A 3UKMA 4P02B 4AFCA 3U0ZA 3DXRA 4LORA 3WV6A 4ASMB 1F7YA 3OEHG 4JI4B 2EAKA 4HKWA 1KXGA 5DDJ2 4F3JA 2AEYA 2FDKA 1LGCA 3R6SA 4UW4A 5F32A 3IC9A 3QO5A 2R70A 3UT0A 1TMF3 2J1EA 5EPAA 2B1GA 5B1BC 3WP6A 1C8M2 1JA8A 3JSNA 2ZZQA 5BV6A 4J42A 1NTZH 3NV1A 4YW5A 3G80A 2EIDA 1CAUB 2YBSA 4UVAA 2VNRA 4QPGA 1IS5A 1VQKV 5KXDA 1Z7S3 1O7FA 3FLPA 1W9TA 5K0UA 4NPMA 5CFDA 1JXNA 4RHV1 5JI9A 1JZ8A 3SYQA 3S5QA 1O8SA 2EIJC 1XSQA 4KFMA 4XQ4A 2Q67A 1IVSA 2OXBA 1N32O 3ABTA 2FMYA 1LR1A 3BU0A 2JDUA 1W0NA 1MOFA 5HV4A 2J1RA 5FY9A 4LWSB 3DYOA 4I4TA 3E6BA 4GMP3 3CPWU 1V54C 4XBFA 4ZOLA 1O3QA 1SLBA 2VNGA 1V9U1 4Y1UA 5K4LA 1DCSA 4OI4A 1WMEA 1GBGA 3ZHVA 4ATFA 5D2AA 4J1WA 1NQJA 4Q29A 4YWAA 5JCOC 5DMYA 2DYRC 1MPXA 3ABMC 1UCXA 3R4SA 3T1LA 4M0NA 1Y74B 1DQ5A 4BQ1A 3RYHB 2WZR3 3VBOA 3JAWB 3ZMUA 1N33O 4IHJA 2VWJA 3I54A 3G6JB 5FYBA 1MVQA 1RUG3 1UOFA 3B69A 1OKQA 3MIEA 1UX6A 2RMKB 2XHNA 3MUZ1 5JZGC 5FYZA 4LR4A 5ACA3 2VS0A 2FCUA 1ONAA 1J5EO 2DCYA 4TT3G 5A7NA 1N0JA 5HCBA 5J2UB 4RHV2 3CJIC 5A7QA 1P49A 4D94A 1AR4A 2ZD9A 3NSTA 3MIBA 1MMMA 3B77A 2IH1C 2E51A 3GNEA 3UJQA 5FO9B 1STMA 3BIWE 1BHBA 3T2TA 3O1SA 3T2QA 1Z78A 2AACA 1PO23 1V9U2 3PUSA 4MLOA 1U5ZA 5IATA 4FQ4A 3K46A 4LHNA 5LOVA 3SISA 1XNCA 3GHNA 4QPIA 1F4NA 2DCJA 1XE0A 1YI9A 4LK7A 1IKPA 4CCOA 2FCTA 4UBHA 4YHHO 1WW4A 3VBHC 1XNKA 3FB8C 3VHOA 3UJOA 3RVYA 4CZZA 3IJ4A 3WB0A 3N9QA 3USUB 1K3IA 3VZLA 1VRH1 2IM9A 3ELNA 5KC5A 4OHZA 3WNLA 1YIPA 2CAVA 3ZMVA 1AR63 2AR6A 3CEIA 3QCWA 2M6YA 1IQDC 3T1YO 1BK1A 4E4ZA 3RG0A 4BLIA 1PL4A 3KKYA 4LKDA 5ITZB 1ZX5A 2WR9A 3D4KA 1RJ7A 3EYPA 4XTMA 1RUNA 3ALQA 1FKAO 5FZMA 3N9NA 4YZ2A 5C6CA 5H5NA 4QGNA 4YVWC 1OH4A 1CPYA 3F5TA 1FATA 3RI8A 4GAZA 3O1VA 3TXSA 4XDQA 4YM1A 2VVEA 2BOJA 4P5HA 1JYTA 2XQRA 2UXXA 1YITV 1IHMA 1GM8A 3CCQV 2Q30A 1O59A 4OI2A 1IS4A 1Y6XA 4B3NA 4CCLA 3SPGA 1W39A 2WWSA 2BCCH 2ZGLA 4YW3A 1N36O 3POYA 3JAKB 1XMOO 1XPWA 3VBRB 2YXYA 2VD7A 2UY9A 1PHMA 4DR6B 4A45A 3T2OA 1VRH2 4LF4B 3FX3A 4BB3A 3IAYA 3WG7B 5BUVA 3OYWB 3TYJA 3KCCA 1W2AX 2OVUA 4DR1B 2LALA 2C2AA 2Y4UA 3AK2A 4O4JA 1KECA 4DINB 2AHZA 1JYIA 4J25A 2IXHA 4F8AA 3JYCA 1TVGA 1UW8A 4K8XA 1V9PA 5CBFA 3A0NA 1F23A 1B3QA 2QDOA 1VQ7V 5CA6A 4MOAA 3BABA 3MBWA 4BPZA 5FNVA 4W4KA 4FPGA 4CA9A 5LA0A 3R0RA 2R061 2RS31 4QX3A 3ETDA 2ZE5A 3FB7C 3RZMA 2HYKA 4RQPA 4ARYA 1JVMA 4Y5TA 4N53B 3JZVA 4O4LB 1WLEA 2J7MA 2ATFA 4UB8Z 5C9AA 1H9WA 4Q0VA 4PDWB 3SEPA 4DV0O 3LDKA 5ERLA 4OVEA 2WZEA 1NS1A 1JJ2U 4RS5A 3BB6A 3VZNA 5CFCB 1YYNA 2A3XA 3NL1A 3CMEV 2WT1A 3WNXA 1VMFA 1GNZA 1WW7A 5EFUA 5FPZA 2DYSC 1RUH3 1H8EG 1K4DC 1S77D 5J7MA 1FNYA 3PUQA 3LSUA 1WZXA 2PHLA 3LIGA 1PZ7A 3ZXKA 5HPOA 1BQ0A 3RYIB 2BVBA 2XAFA 2X6BA 4PJYA 1SHWB 3AMNA 4J6GA 4L92A 3HN1A 4A7YA 3BA8A 2EJRA 2ARCA 4HFSA 2WNVA 2X5IB 3E8GA 1QR8A 4A44A 3B00A 3ZFEC 3I49A 4QB1A 3ZMNA 4I55A 2BNMA 4NIIA 4YLZA 1JODA 4CEWB 1HJFA 2R062 2RS32 2GP5A 1JW6A 2R071 1DG6A 2GAUA 1K34A 1SA0A 3E35A 4P9LA 2F66C 4LFAO 4CUAA 5T5OA 5CKNA 3ZFFA 4JI3O 4UBGA 4JV5O 4X1KB 1LR5A 5F2WA 4ZONA 4DK0A 3RZZA 3HKEB 2UUCO 2VXJA 4AFAA 4E9KA 2D5FA 1V6LA 4CTEA 3QLQA 5HXVA 1K92A 4NO4A 2JDNA 4M3CA 1RUE1 2J1SA 3STLC 4NXMB 2R9AA 3N3HA 1K73W 5FZCA 5B1BB 4QPGC 3THCA 1Q6UA 4FAHA 4OFGA 1RITA 4N9IA 2GDFA 1SFPA 2FDHA 4IIJB 3P32A 2ZMLA 4CP1A 3BCCH 4EJRA 3ABKB 4J9YB 1R1A1 4RR3A 3V0BA 4IE6A 1GNHA 3JB4C 4XHXA 3SCFA 3DTUB 2WAOA 2JECA 3LPGA 4LA3A 2PHUA 1S4CA 5K7PA 1KU9A 2WAAA 5LCWL 1SDDB 3GM8A 1S76D 1E79G 2R72A 3FL7A 3RZHA 1FPOA 1RB8G 1RINA 4XDOA 3JXSA 1T6BX 3EFFK 1V54B 1JQ0A 2R072 1JMUB 3MFAA 2G9ZA 5FQ0A 4FLXA 3BOWA 2EIMB 5LA2A 4XQWA 4XQDA 2R0FA 3KZIZ 4V2VA 2VY0A 4X64B 1HRI1 4AFBA 1ULOA 2DF7A 3BOPA 4N21A 1WA8B 2V1DA 4V2WA 1OVPA 1RUE2 3FE5A 2VXRA 3WOGA 3ZHSA 1QJU3 4FTBA 5KBFA 4KU7A 2E3CA 2XNDG 1ZX3A 1RP3B 1VP6A 4L87A 3O1RA 2BEOA 1ZZBA 1RUC3 2QZ2A 4IXLA 4B3RO 5L7OA 1SESA 1R1A2 1XYNA 4OQ8A 3A23A 1D5AA 3L73H 3VN4A 4EWAA 5I8YA 3GBGA 4M4RA 4CDUA 4HG6B 5ISLA 3SJAC 2ZE7A 2Y0OA 2ZACA 3RGBA 4YGDA 4DR3B 4LUKA 5IVJA 4IE7A 4JTDB 1PGW2 3VD4A 3QVNA 1CPMA 2GBOA 2WQ8A 1RM1C 1R091 4GJZA 2FHRA 5F6LB 4UVCA 4QPIC 4ZHNA 1XOYA 3DPRB 4FO9A 1GFF2 4RFT0 4XMIA 3WDWA 4JI8B 5JOXA 2AZ0A 3OG2A 5D5QA 3I56V 1OCOC 2GNTA 2DDUA 3QH6A 4COWA 2WYFA 3E8HA 1JUIA 4QPWA 2KSDA 5EWSA 2EIKC 1HRI2 2VAUA 3ABZA 3LZZA 1DGWA 4LF5O 4Y20A 4YIOA 2M7WA 5FL7G 3CKHA 3POJA 3WSOA 1UY0A 3O0WA 1ODMA 1EAH1 1ZRRA 3BGAA 1GOHA 4NXNO 1NXD1 3ROUA 4XIOA 1ZA4A 2JB4A 4SBVA 2FDJA 3ASIA 3WEZA 3WW4A 1Y4WA 1IOAA 1FJGO 2DTWA 3JCIA 2WA4A 4LF9B 1GP5A 1VEWA 1W6PA 4KBZA 4TV9A 3N2GA 1CESA 5DPNA 2WLLA 2JRIA 3TRSB 4JRAA 1UYYA 1AL0G 4CH3A 4KWLA 5J48A 1IPJA 5BNPA 1YJWV 4JTOA 2ZHKA 4RN5A 4UCUA 1R092 2ET7A 5CA0A 1YJNV 4NMIA 3H1IH 3AX4A 1WMFA 4XJ8A 5FMDA 3GGLA 1US6A 5JR7B 3JD2A 3SCHA 4GKXA 3UT5A 3HR0A 1HB2A 1YQ6A 4Q2FA 1RVF1 1YTFD 5IVYA 2EVXA 3HKCB 5I0RA 5BR8O 3V0AB 1W2OA 5B2GB 1Q86W 3PUAA 3O1TA 3ZM8A 4H0LB 1ZWIC 3THDA 4AAXA 3LDBA 2Y0PA 2WS91 1EAH2 3BYWA 5JIUA 1COWG 4HK8A 4QM9A 3WNMA 3LE0A 3ZYBA 4ZI7B 1S2KA 3UKNA 4IV3A 1BLZA 4JGZA 2XHKA 4GWMA 4BZ4A 5IYCO 2GC0A 3L75H 4JYCA 1ULGA 4KQ7A 3EHBB 3AG2B 4Q27A 1H30A 4P9XA 5JVVA 4YJ3A 3HNMA 1XUQA 4FPLA 4DV5O 4W6YA 2HFEC 4HSLA 2P67A 2HWF1 2Y69B 3ASNB 3E6DA 1UQXA 1QVFU 1MS4A 3ZPOA 4LK6A 1W90A 2WABA 2JJ6A 4QQ2A 3SKJE 2QJ1A 5LWBA 3PUIA 1SZBA 5LYJA 4C90A 1N32B 5LB6A 2DE0X 5FP4A 1I5XA 3ZKYA 1GTOA 1V70A 1W0PA 3HIFA 3BVOA 4YM2A 4JI6O 1RUJ3 5C8CB 4YGBA 1RVF2 3TEXA 3AKSA 1L1FA 1VIWB 1CZTA 1VBD3 2FD8A 3WP4A 1VBA3 1YXWA 1ZBA2 3WW1A 2OA2A 1AR83 4OQ9A 4N7UA 1AILA 3TB0A 4P9GA 2WS92 2XXZA 4UCSA 4IE0A 3AM2A 2NR5A 4COZA 1LU2A 3QO8A 1UKRA 4M00A 2PHRA 5C8YA 2DYSB 5L3GA 1QJX3 2PHXA 4DUWA 3BALA 5A1LA 5KX5B 3VUOA 5B1OA 2PELA 2A6VA 3BAAA 2VQ0A 1S72V 2WQZC 2E7AA 2ORZA 2WNVC 4KGQA 4UI9L 5L9RA 1U5XA 4G9SB 2Q5TA 3LFMA 1GQGA 4R7CA 4WM7A 2HJDA 2FQPA 4GMP1 4LFCO 1AXYA 1POV1 3OUFA 2VR4A 3I55V 1X9TA 2HWF2 2PUSA 3FYEB 1P84F 3ACLA 4H13B 1FMD3 1XJAA 4QQHA 1RMU1 3M7AA 1N8RW 3ZFFC 3DXRB 1X59A 1O9GA 3B8MA 2JD4A 3BPZA 5FMCA 1OKOA 4UWDA 5IYZA 5FKCA 2HG5C 4JI7O 1I9RA 3DXUA 2MEV2 2A06H 3VBFA 2YSUB 4FPHA 1H38A 2ZX1A 4FVVA 2ZMKA 1PGL1 3MHHC 3PIGA 2HWB1 1PL0A 3WR0A 5A3UA 1YZBA 1ND2A 4RQEA 2VMDA 3NV3A 1OV9A 3IWZA 2V5DA 1DLCA 2GNBA 5FPRA 1QEXA 1EZJA 2BTVC 1N3QA 5ACA1 1NAEA 2IJIA 4GKKO 4QPGB 2Y6GA 1W9WA 5ANNA 3OGCC 1JZ3A 4CS3A 5LA6A 4RR3C 1S0DA 4OX9O 4IEVA 1IPSA 5K0UB 1KRIA 5CFDB 1RHI3 4XZUG 1YUDA 1Q8IA 3WP5A 2QM8A 1YQ5A 1WWYA 4KGGA 3ZX6A 2Y0IA 4DK1A 4X20A 1N1TA 4UW3A 3LAGA 4YG3A 1OVSA 1M4WA 3KV9A 1WLTA 4I4TB 4DY3A 4BE3A 2BW8A 4ZOLB 5I8TA 4PDRA 4PA7A 4QDRA 5D8AC 4O4IA 3OGRA 3OPZA 2GZWA 3CEWA 3JB8A 3ORJA 1RMU2 1QDOA 1ENSA 1GR3A 4LOTA 1W8ZA 2PLV2 1F8VA 3I2KA 3VKOA 2A7WA 4D7SA 5FZ0A 4FPPA 1JI6A 3ILRA 2DU1A 2WFF3 3DXTA 3VBOB 4KH9A 4IHJB 4P9PA 2QJVA 2HWB2 2JE9A 1GRJA 4X1IA 1O5LA 5L19A 3ZVXA 4F83A 3C7FA 2WLMA 1QXJA 2WLQA 4PA3A 1Q90D 5L7OC 1EP0A 4MHUA 3MYXA 3WDUA 3O0VA 1XMOB 5L9BA 1FXKA 2Z5WA 2VUDA 2F4VO 4IETA 5A32B 3AMMA 5JXGA 4JDNA 2XHBA 1PO11 2RS13 4KWUA 4B4RA 5FCCA 3K79A 2D40A 2OYQA 1UU4A 3SEEA 1SERA 2ARBA 2PQQA 3GZEA 1D4M1 4F4LA 1W8OA 5CBLA 3RZKA 1AL21 2VM9A 1Q6IA 2DCKA 1C57A 1J1LA 2NLRA 5LRSA 3TWIA 4QB2A 3ICXA 5J2TA 3ETEA 3BI3A 4DEVA 1UY3A 5LOVB 1G9CA 1ZZ7A 4AG4A 2G38A 3MLJA 5JI7A 5FK7A 4LF6B 3ACIA 4AGRA 3OPWA 3A22A 5KC6A 1ULFA 1QQP1 4DIQA 3AP5A 1AR93 4B3MB 2W0XA 5EZYA 1YF2A 1L7QA 5F1RA 3ZPYA 3G6BA 1MZ6A 5FPAA 4OHYA 4DV0B 5FZBA 2DWEC 4D8MA 2CV6A 2JEXA 5IW0A 2WWUA 3P1IA 3WQ1A 1K42A 2EZOA 2WWJA 4NUBA 2AYHA 3W59A 1U97A 3FLRA 1Z2GA 2JS5A 5LY1A 1PO12 4AVCA 5BNPC 2ZCWA 4YYOA 4NRMA 1RUF3 2X0LA 1WAZA 1D4M2 3URFA 1AL22 3K04A 2IW5A 1NXMA 3OGGA 5BY5A 5JMCA 3QBQA 4K21A 3RWRD 4QIWF 1OA2A 5GJ6A 4YW4A 4Q6GA 3WF3A 2P4EA 3FJSA 1I94B 2UU9O 1SQXH 1ULCA 1JOPA 4YFZA 1W28A 1K5MA 1PGSA 2FKXA 2EILB 1QQP2 4XJWA 3R4DB 2IVJA 3CWBH 4PD4F 5I93A 1W6NA 4CCJA 4CRQA 1FYJA 4GWJA 4X6QB 1PNFA 4JGZC 4JRLA 1OURA 1JHJA 5KWRA 2O8QA 4AZZA 3NR7A 4O4JB 3CJXA 2ZBJA 3PL0A 1QLEB 1SLLA 5FBZA 3PNAA 1OCZB 2IFWA 1KKCA 1DYPA 4X66B 2UU8A 4A5UB 2XL7A 2BZDA 4JZ2A 4LC1A 1OUSA 4J41A 3G7DA 2JE8A 1GOFA 5FNVB 4MGYE 2WIIB 5FTTC 4JGYB 4RO2A 4BK5A 4GQ7A 4H44B 5FZ1A 4XBNA 3JATA 4XUTA 4UW6A 4AQSA 3NW4A 2UXBO 2PHWA 1GZTA 4RWUA 1AJPA 4GB33 4RQPB 1YNAA 4CCMA 1HB3A 4ZPIA 1GLHA 4BIZA 1MNGA 2A1XA 1JFFB 5C9AB 5BYNA 4FPOB 4XURA 1OUXA 4FLZA 4S2GA 3VDCA 4RS5B 4PT6A 1DYOA 1C1FA 5T55A 3AK3A 1DGRN 4EN6B 4GJYA 4QHBA 5JH7A 1HKDA 1MACA 4CH6A 1X36A 2XWBB 3M3CA 3WG4A 2VOVA 3MV11 3RZLA 4LEJA 3S5AA 1MR5A 5FZGA 2YC2A 1XNDA 5KHGA 1RXGA 2Q8OA 1Y43B 3K03A 1WCQA 2QM7A 5GZEA 1HX6A 3B94A 1DF5A 2H0VA 2X53S 4O2BA 4XZPA 1GP4A 2A5ZA 4WM7C 1JR9A 4QX1A 3VKLA 4NB5A 5IK8A 5TSWA 1COV1 5KHIA 2FZ2A 1TNFA 2DOSA 2VC9A 1N3OA 4LA2A 1J95A 3UL2A 1ST8A 2PA7A 2ZAAA 4I55B 3ZXFA 4B3RB 4B3TB 4UXNA 1NVPB 4LULA 4QGLA 1E5SA 4IYHA 3FMGA 4LKFA 4AXOA 2B5HA 4FFKA 3ZJZA 2XJSA 5DAPA 5EQUA 3CD6V 3GJBA 3ZFFB 2HLDG 4HT1T 4WVMA 2YXHA 2YEVB 3LKJA 4CEYA 5DM6V 1J58A 3CB2A 2QEXV 1ZA7A 1F15A 4AQYO 3BY6A 5AC91 1MSWD 5I0DA 3CF6E 2VZVA 2VCCA 1YQCA 2ZR3A 1PZ8A 4NROA 1XSRA 4AQ6A 2YIBA 4H37A 5LEKA 1S5LZ 3C3VA 3ZBHA 2W91A 1GMMA 2ZXQA 5LEJA 2XWJB 4YW1A 1QJFA 4P9WA 1IG0A 3G67A 2RJKA 1U0AA 4B08A 1AR72 2YDEA 5CIRA 1CQ9A 2VZSA 3V0BB 1NH2B 4HZ3A 5FZ4A 4LBJA 4XEZA 2X05A 3EXUA 3K06A 4LO8A 1COV2 3CQOA 4MW3A 3ZHRA 4D6QA 1P7BA 1XOUA 3CCRV 1HR0O 4AI9A 4DXZA 3I2DA 2JDYA 2R16A 4DV4B 3W7XA 1H1MA 4EROA 1BEV3 3BRCA 2ZNIA 2D6MA 1F4AA 4TV8A 4BW5A 2PGGA 4DRRA 2WLKA 3RNSA 2C6SA 5FQ0B 3JQXA 1PK6A 4GX5A 4GWNA 2ID4A 1NT0A 4ONUA 1GYKA 5DN6G 1M1KW 3NJXA 1ASJ1 1K97A 1GWMA 2QQMA 4NPRA 5AC92 3LDRA 4EFBA 5IVVA 5KUMA 1RGSA 1BXHA 5JOWA 1HN1A 2P17A 4BWAA 3D3AA 4JDOA 1R1BA 3IPVA 5FXVA 3F95A 3IAPA 2B45X 5A3WA 3BTZA 2IVIB 2YBKA 3CCEV 3UV9A 5IK5A 5SV5A 4OHXA 4FOVA 4MGIE 4J11A 3WX5A 1JBCA 5L7OB 5C3SA 3PTRB 1CAVA 1OJHA 2AW9A 4XABA 4C1WA 2CY6A 4BYYA 4CDUB 1TAEA 3RYPA 5A3TA 1N1YA 2RHPA 4YZ1A 4P5YA 2EALA 1JU4A 2RS51 2WNUA 3ACFA 2QQVA 4BU2A 2UXCB 1QOSA 5EXOA 4F6RA 2I2SA 3VBSA 4QNHB 3MO4A 2F17A 4XCAA 1O4ZA 1M4UA 4J1XA 1NVPD 1UF2C 3UQ8A 2HWD3 3D5OA 2XJPA 4JGSA 3HNBM 3JCZA 4DV5B 3W20A 4MVUA 1W9YA 5DG1A 5CN0A 2GDSA 3ZDSA 4IEUA 1ASJ2 1CJPA 4LP8A 4UCOA 3E5QA 4O65A 1ZRDA 2D3RA 4JDMA 3M99B 2QUOA 4Y20B 4AI3A 4R8HA 1PD3A 2VGDA 2RNBA 4MADA 2E53A 1PVC1 3DC5A 1QKQA 1N4CA 1S5HC 2FL4A 2EINB 3QH7A 1BK0A 3CXCU 2D93A 3T4VA 4JI6B 2ADDA 1NR7A 3K3NA 5FK8A 2PAKA 5C4WA 4DUZO 4IEQA 1VQLV 3JD3A 5D1IA 1AI6A 5HCAA 3EVKA 2CH7A 3N2GB 4TV9B 2HKOA 1MEC3 2BDRA 3OW2U 1WD4A 1NH2D 5GZFA 1DZRA 4A4AA 1N0NA 1H0BA 3GXUA 1LOCA 1E57A 2BOBC 2HKXA 3C7EA 4WF9V 2RS52 2VMIA 3WFVA 3SPHA 2A3QA 4MVRA 5CA0B 1WPBA 4OPAA 2EJ7A 4Z2WA 4NVPA 1PPJH 4XJ9A 2CL2A 1IKQA 2O57A 3UT5B 2X29A 3H1MA 1RUJ1 4NHKA 2GN7A 1H8HG 3DF0A 2EAAA 1ZRFA 3ZIXA 3SNMA 3AL5A 1W2TA 3L74H 2V72A 3M8AA 4JI0O 1BBT1 3CHXA 1SDWA 1AX1A 4ES8A 3DSQA 2HWC1 3NNLA 1PVC2 4NHYA 4NOTA 5DXDA 5LBCA 4C7UA 4DB5A 3HD8B 4IV3B 3ZRWA 4JZGA 2OZ6A 4AHXA 4PCRA 1QJX1 4ZU5A 3X2QC 1A6CA 5AFEA 3I7DA 4G2KA 2XKOA 2XMLA 3ZLIA 1FT9A 3IC7A 5IDJA 3D3IA 2C4XA 5A7WA 4TWKA 1C4RA 2P3YA 3PJSK 1N34O 2D6NA 2VBPA 3JBG1 1R081 4YNIA 3M3IA 3UKVA 1O3TA 4OX9B 1SZXA 1V00A 2P6HA 4PLOA 1B35A 1US3A 1RUD3 2JJ2G 3RYRA 4P00B 1A34A 5LYJB 5GONB 4NYKA 4L11A 4GKJO 4LO5B 3C7OA 3ETGA 2Y6LA 4GH4C 4BCUA 2JDMA 5B1NA 2VG9A 3UGFA 1ZLZA 3H1JH 1WCUA 3T30A 3K77A 5C3RA 3ZS8C 1L7LA 1UPSA 5L36A 1UY2A 4JASA 5L3EA 1A32A 2RDRA 1FAYA 4XF9A 5IAVA 2P22C 1BBT2 1PMHX 4HANA 2WWWA 4JI4O 3ZMOA 3Q8EA 5FZIA 2DV9A 2HWC2 3LD8A 1KQRA 1ULDA 4L8JA 1PM9A 2IH3C 1Q8OA 3CCJV 4ASUG 1SLTA 2Y48A 4FOWA 5C8YB 4CDWA 1FPN3 4QPYA 1LTEA 2ERFA 2W9XA 2W92A 1NKDA 1R73A 1EUUA 3GZTB 2JG9C 1R3LC 3AKPA 3JBG2 1R082 4BQXA 4PF5A 2JXAA 1W6MA 2AGSA 4FXGB 4P9JA 3KF5A 3WNPA 4AEDA 3T4ZA 2FYUH 2F4VB 3K5MA 1IURA 3ETPA 2HWE3 4W4ZA 4JZRA 1AR1B 4CEYC 5JJJB 1AI7A 1O5UA 1OFSA 3E8BA 4QPJA 2P1BA 3U14A 2XUEA 5IYZB 2BFUL 4JTCB 4RAIA 3SYPA 4AILC 3FAVA 1A8DA 1AX0A 3SH4A 1M56C 1IBLO 1KYOF 4XCBA 3VBFB 1W59A 2XOKG 1F4HA 1C3HA 4J7JA 2R9IA 1ND2B 1WMDA 2HVJC 5H9QA 3GZUC 1L7RA 4CH5A 2P5OA 3HBZA 4CU7A 2YICA 2FCVA 3JD72 1QGLA 1T5EA 2VMGA 5LA6B 3HBKA 3JU9A 4XBQA 2RJLA 2UURA 3ZSMA 3CJHA 5AVAA 3K4ZA 4U3JA 2LW7A 1SEFA 4K0KB 1HQWA 4EQVA 4Q4X3 1Z5VA 1JYVA 4PHZA 3K48A 4JYBA 5ABJA 5IY5C 4H3WA 4R52A 5T54A 4L97A 2WBKA 5I0SA 2QGNA 1PK6C 2J1UA 3B02A 1VE0A 1LKNA 4IT5A 2LGQA 5EIBC 3WY6A 3N35A 1XL6A 5FY1A 4BIFA 1L3JA 3AP4A 4D7YA 1EFRG 2Y34A 3DN7A 5I0UA 3JD4A 2R043 1UAIA 4LMFA 5FYCA 4LT5A 5T5JA 1UOBA 1KQSU 5KMGA 2OX0A 3LDEA 4X1IB 3WINE 3Q8BA 1K4CC 3OGVA 5GTIZ 5DG2A 3FFZA 1W8NA 2AZ2A 2J42A 2VU9A 5FPOA 4ZHQA 1TUBA 4XUNA 2KKWA 3H3LA 2PXJA 2VVFA 3F5WC 4DMIA 1FXKB 2R32A 5B4NA 2WZ8A 3E22A 2VRZA 4IGQA 3S30A 2WQ4A 3OGIB 1QJY2 1X50A 4QPKA 1URXA 2WNOA 3H7YA 2F95B 4URTA 5D21A 4TOIA 4LLFA 1XNBA 4YVSA 3VBSC 1LB2A 1HQLA 2Z3YA 5FOBB 2VMHA 3KT4A 3O5SA 5IVFA 1URFA 4NTYA 3K3OA 2Q8VA 3NMBA 5J2TB 4FP3A 4EEQA 2V73A 2N04A 5JWPA 3VBUC 4DNYA 1GM7A 2XG3A 4XF3A 3CZJA 2OW4A 3D8CA 2JB8A 1AI5A 3FUQA 1ZM1A 4ASKA 1Q8SA 3TN91 4MHRA 1H1AA 5EZYB 5CA3A 3K9AA 3O1PA 1OPOA 3ZYFA 1E5HA 1IXBA 1XNQB 2D97A 2V4VA 1NYWA 4BXFA 3EXAA 3BN6A 4I09A 4PBOA 3ZOIA 1OZ0A 1G8WA 3MEPA 1Y9GA 2O0OA 2X09A 2XJUA 1LEMA 3POSA 2W52A 1PNLA 3H7JA 3P3PA 5A1FA 3TETA 3KLSA 4DR1O 4RD7A 1KD7A 4C0HA 4R50A 3D36A 1W0KG 2PHDA 1V6OA 1ZZ8A 1XMQO 2F6BA 1DZTA 4FLVA 2VTXA 4TSFG 5BNNC 5JLVA 2O1QA 4GB31 5JCTA 3M70A 4IV1C 1RC6A 2A3WA 4LNUA 1Y76A 2Z42A 4B4QA 2ZHLA 2VJXA 2JX9A 1ZBE3 2VZTA 3TGUH 3FN9A 1K5MB 5FZLA 5FR3A 3RYCA 1ENQA 2OCHA 2VW0A 1JYWA 2DJVA 5JQGA 1W6NB 1H2KA 3TN92 4HSJA 2CAZC 3KGLA 3POGA 1PX4A 2E7QA 5IK7A 2QKCA 3WHTA 1LOFA 4XF1A 4MS2A 4YW6A 2YC0A 5LL6Y 4PLNA 1MS5A 5HFMA 1LGNA 5LASA 5CKMA 2YUAA 2XUMA 5LBBA 4X1YB 5LBQA 4MXVA 2SLIA 2ES3A 3B9CA 3RYFA 2Q1ZB 1AJNA 3X2QB 4Y1ZA 5H9SA 4BJ0A 1X82A 2B1IA 1LENA 2WYSA 3OBRA 3ZYPA 1EV13 2VW1A 1B35C 1LGBA 4AVAA 2GUZA 4K40A 3ME2A 4Y22A 1JYXA 4QXKA 3JATB 4ZU7A 2XJRA 3UCSC 1HN0A 2N05A 4FFHA 4C0BA 1C8NA 2EX3A 1NLRA 1QOTA 3VV1A 5IVBA 1M93A 1GV9A 5IT9N 3CMAV 2X7RB 2Y8KA 4WVVA 2VOXA 1HRV3 2PFWA 1CN1A 3CJIA 2KXLA 2ET1A 3DECA 2E33A 2UUBO 1OD3A 4OUEA 4PI0A 4CDWC 1EY2A 1CZSA 2ZAHA 4G4FA 4Z1MG 2LFSA 3NWKA 2VZPA 2OIIA 4QGMA 5FZFA 2RM23 4O2BB 4FVMA 4NXMO 3PJYA 2Q0OC 4NPLA 1L8DA 4G27B 4LHKA 4RYDA 4MXWA 4PA4A 1VBE1 1IXMA 1WGPA 1OCCC 5BNOC 1CP9A 2Q8DA 1OOPA 1W0JG 1FNZA 4AF9A 4E4DX 3VQYA 3VBHA 1BEV1 2JDZA 1EN4A 4QQOA 1IZ3A 2JG8A 5JPNB 2DQ0A 2Y4TA 3R65A 2MNGA 1NOVA 3N36A 1MS8A 5A6YA 4WVMB 5JUVA 3WF0A 2OQ7A 4CEYB 5JSPA 2HEPA 2XQXA 4DQAA 2BPA2 5LGTA 3WF1A 5LHGA 1G8MA 1QOOA 1QXPA 5FBJA 1DF4A 3QNEA 4D0QA 1OH3A 3SPIA 4EKWA 4E4SA 2YU2A 3NRUA 3I3EA 5F2SA 1TZOA 1Y67A 2P6CA 4X88A 2R7EB 1TQ5A 1APNA 4LLOA 2ZKLA 5EBMC 3S7EA 1VBC3 1KFXL 4ZXEA 1WBLA 2KA3A 4GULA 1M9NA 3SR2C 2CGOA 2ZS6B 2B9UA 2P3IA 2OIEA 4OZXA 5ABJC 5CISA 1SQQH 2JDPA 1VBE2 1PM4A 3ZR5A 4L2NA 4PI2A 1BT8A 3SC7X 3AYDA 1AYM2 5IVCA 5CADA 5CEHA 2IXIA 3MZHA 3C3TA 3ASOC 4JHTA 2GMPA 1O6UA 4AHWA 4TV8B 4LNVA 3MIGA 2HJFC 3VB9A 3PUHA 3MHSC 3OM3B 1BZKA 5CYYA 3R66A 1TME1 2Y33A 1PK6B 4OULA 1WB8A 3OBTA 3HR9A 4CP9A 2Q9LA 2WLPA 5BMVA 3AZYA 4O2AA 2C9KA 4NHXA 1SG3A 2XVLA 4IEZA 4UCVA 3BODA 2QDRA 1DZQA 3O7OA 4JI8O 2EA7A 1U5IA 3GHMA 4P9IA 2DWRA 1GK9A 3MPPG 4MGZE 5KXBA 1FXHA 5F5AA 3IMNA 4J7KA 3GCWA 1YQ8A 3L2HA 2VNOA 2DBNA 4JQTA 3DCQA 4YVSC 5LK7B 3MFCA 3AVSA 1C5HA 1IPKA 2ZNJA 4UCTA 2IZWA 4A2UA 1VBB3 2WNUB 4Y1XA 1ZL8A 1KEXA 3POEA 4Z82A 4F6RB 2HLEA 2QTOA 4LF9O 1VR3A 3VBSB 4LKSA 2XT9A 4RGAA 3ZN6A 1MQTA 1RUI1 4X89A 1H2SB 1BGYH 2RDCA 4GMP0 1POV0 4M3CE 1N34B 1TME2 4XJAA 1HXS1 4TYSA 4O7XA 3IM0A 3J7NA 3ZSJA 2HR3A 4M3CF 1MVEA 1U12A 3W9AA 1W99A 4K20A 3FWEA 2W6IG 3CX5F 4KU8A 2YIBD 2RR13 3KZ4C 1VMHA 1PMIA 2QZ3A 4D7TA 3WT3A 3OEAA 2BNNA 5C4WB 1HV1A 3MHZA 1SS3A 3KS7A 1OD5A 2VBBA 1HLCA 3RZJA 3GDBA 5LMUB 3HPNA 2CH7B 2ZXWC 3WHUA 4L99A 3WF4A 4CS4A 3DYMA 1MZ5A 2YFZA 3NKTA 3D36C 3IZOA 4OYUA 1GUIA 2YMZA 3GZAA 3OCPA 4LE3A 5F6KA 4XF0A 1RUD1 5EYYA 1JYNA 5DZGA 5FY8A 4MVQA 1FOD1 4XAEA 3NAPC 4QMAA 1WP8A 1D0GA 4BWOA 4JI2B 2TEPA 3Q4HA 2E32A 3KT7A 4A42A 3ATGA 4WV8A 4LBOA 1RUI2 5LXTB 4AGVA 1HXS2 1KGYA 4AYUA 1ND3C 1LEDA 4I7ZB 5L3FA 3I59A 3ZRSA 1KP2A 5EIBD 2BWCA 1JH5A 1LOFC 3VDDC 1BKZA 4Q4V3 3UETA 5DAWA 1QDCA 3W7SA 2GTSA 2RQ6A 1IBLB 3GJAA 3JD0A 4I02A 3SXWA 3ZRWB 3I8TA 3VKMA 4PDVA 2NM1A 5IWAO 4E8CA 4RQFA 2WNEA 5DAQA 5DDJ3 1K9MW 5H9RA 4K1ZA 5GTHZ 4CU9A 1NCQB 4PIZA 4OI1A 3AFKA 2JICA 4DR7O 4XW3A 1C8M3 1KDMA 2Y6HA 2WO3A 1B35B 1XE8A 1W8TA 4Y4RA 1WP7A 3IDEA 4DV3B 3OBZA 4PBPA 1FOD2 3HQRA 3ABLC 2VZOA 2R1DA 2XLAA 3ZFGB 1CAUA 5H6QA 1XQNA 3HVDA 1PMJX 5KHHA 3H1HH 2UUAO 1GZ9A 1DK1A 3K75B 2RMU1 4WCEV 1BJQA 2ZX0A 3P6BA 2BNOA 1PM7A 5E1RA 4LBMA 4OMCA 2DCTA 3VOUA 3U75A 1SQPH 4HL0A 1GKBA 1ZZ9A 1GN2A 3C2UA 4IEPA 1B04A 5C8WA 1J3QA 2BYVE 1C28A 2QQJA 4N23A 5FYVA 4XPVA 3WCSA 1QIQA 3LA7A 4UV8A 4BQ4A 1NE4A 4NN0A 1KJLA 2XGXA 4FPCA 3R05A 4TUYB 4HVOA 3CCVV 4QE9A 5A7PA 5FPVA 4CDWB 1W2UA 4QE7A 2E63A 5GZDA 3NV4A 3KV4A 1GN4A 1BCCH 1UX7A 1OOPC 4UFZA 3L70H 1Q43A 3RYHA 1B06A 1UZWA 2B46X 4H55A 1H8VA 2BJSA 4LF7O 3S57A 1DLBA 1CVNA 1W6MB 2DTYA 1OCCB 2A6XA 2W47A 2JG8C 4FTEA 3VQXA 3SKVA 3A0HZ 4AEDB 5JJNB 1VPHA 3MIHA 2RCVA 4Y26A 2WJSA 3NO8A 4XUQA 3B5LB 4CDQC 5FPUA 4LBNA 2Q73A 1JYCA 4L8QA 1UYPA 4QX2A 1QNMA 3FAVB 4K3AA 1UMZA 1UD1A 2RMU2 3UO2A 4RHV3 4MTOA 4DXSA 3L71H 1YJ9V 5EYPA 4WZCA 2ZT9B 2CTWA 4U3FH 2UXNA 2HYXA 4CP0A 1NCRA 4U36A 2ZJCA 1R6TA 1IG3A 2PF4E 2CGNA 2OT5A 2IXJA 1CIWA 2FB5A 4E27A 1NLQA 1A8MA 4CZSA 1MS3A 2Q8CA 1K8AW 4LOSA 4YGCA 3CXHF 2D6PA 1V9U3 3FHQA 4X8AA 3CJHB 3ES1A 1X9PA 2WSVA 4TTGA 1REEA 4BQYA 5FLJA 4U3JB 4YARA 4XJZA 1MS9A 5GM0A 4ISQA 5FYUA 3LQCA 3AMQA 4FFFA 5A6ZA 4XUOA 1S0JA 2YXSA 3USUA 1PIV1 4X8PA 5ABJB 1QY4A 5AVPA 1X8EA 1YIFA 2JGUA 3C7GA 5FUIA 1YRZA 4EB6A 5FZOA 1PV0A 5FREA 1S5JA 5GZCA 3OD0A 2BV4A 5IFPA 3FBMA 3AYCA 4HLTA 1WCSA 5KUKA 3G4SV 4UFKA 4CCCA 4EZ4A 1BHAA 1NZCA 1ULEA 5CB7A 2QWNB 2L6LA 4P08A 4Y5Z0 3AG3B 4FFGA 4BH9A 1JCHA 1XMQB 1GWLA 2XJQA 5ITZA 5BPXA 1C1LA 4AEJA 5FZ7A 5CNAA 1OLRA 5CBHA 1M57C 3ZCCA 3N7LA 4COUA 3H1KH 4BQ2A 1GM9A 5A80A 2P4VA 2E76B 4AEMA 2OTLV 4LF6O 4ZHQB 2VCMA 2C5DA 5FYYA 1JU3A 3OUSA 1TUBB 4ZU4A 2LS6A 2A3YA 3CRRA 5FYSA 3J8F1 5JPMB 4GLXA 4B3MO 5LP6B 3N27A 3KQ4B 1JZ7A 4PJ0Z 3J7AU 1N47A 1WJZA 2WLJA 4YW7A 4XJUA 5DUUA 2Y6KA 2VCBA 3OOXA 2OCCB 1KMIZ 5FYTA 1CIYA 1I0HA 2WL1A 3N9PA 1W3XA 1PIV2 4YVSB 2CUGA 2VZRA 2A6YA 3ETQA 1VRH3 3HKDA 3C90A 1RL3A 2B42B 1MQTC 5CG8A 2BTQA 4E2LA 4B29A 1HW5A 5A7SA 3FB6C 5IYDO 1FI2A 2N74A 1F5FA 3K0DA 3ZYRA 2DUPA 2FZ1A 1W8WA 3AK1A 3UNPA 5H2FZ 4FI9A 5T52A 3D0SA 3H1WA 2YROA 5FO7B 5J1XA 3KG2A 4J7ZA 4FSJA 1SLCA 4Z2AA 3LUTB 4XTPA 3RZGA 2A75A 2ZIMA 5B1AC 3W21A 3AG1C 3SMHA 4HKLA 3KV6A 2XONA 3LEIA 1UNBA 4QB6A 2OT7A 4JF3A 1I94O 5C93A 4W4LA 3MV01 4O61A 2GH2A 2ZX3A 3DEMA 4R8CA 2P34A 5I91A 4DO2A 2GHYA 4JI5O 4IL6Z 3FHAA 3J7HA 1VIBA 4W6XA 5CB4A 1IS3A 4NRQA 4KHPB 1NQDA 3J8F2 4OUSA 4N53A 2VOKA 5HFLA 2CWMA 4PDWA 1LAJA 1G6UA 4IGPA 4JAAA 3HOBA 2UUBB 2GMEA 2QBXA 4PLMA 4Q8LA 4X65B 3ZN4A 2ZHNA 2WDBA 1I7FA 1SZTA 1QNWA 3MI8A 3LEGA 3KCYA 4UXAA 3THOA 4QWNA 4LFBB 1XBLA 4D6TH 1ORQC 4X66O 1KD1W 4K8RB 5LA1A 2ARXA 4TWTA 1Y76B 1OPMA 3N9OA 4MSVA 3E5XA 3TEZA 1NT2B 3ML0A 3AXDA 2ETNA 3RYIA 2BTOA 1J3PA 1YFUA 2HEYF 4QQLA 4C1XA 3IKWA 2D6OX 2X10A 3EO6A 5JQGB 2B7YA 3INAA 1S55A 2BGOA 4S2FA 1LU1A 4ZKIA 2EIJB 2NZ9A 5BXXA 4DXTA 4Q4Y1 1O9HA 1X7NA 3M3OA 2XTAA 4DS0A 1SQGA 4JKLA 3O1OA 2R063 2RS33 4FP2A 3VZMA 4FZ1A 1OLQA 1UZ0A 2R1BA 1R6NA 4GX2A 2B39A 4KMQA 5FLHA 5JMOA 4Z07A 2VCAA 2XAGA 4Q4W1 3RYFB 3MW3A 5D8AA 2NLJC 3E89A 1LODA 2LTNA 4AVBA 2IXKA 1YTFB 2OYZA 1RFYA 4DR4B 2GUZB 1HB4A 2D3PA 1F9KA 2ZPXA 2A70A 2DYRB 4Y22B 3ABMB 4KL1A 4MTFA 3RWNA 2G9GA 4DFSA 4MVTA 2Y6JA 2G9FA 4PF1A 2XLGA 1OT5A 1GP6A 4JKMA 1WKYA 1SCRA 5A3MA 1KKDA 1YJLA 1FD9A 3T1CA 2WKKA 5L73A 2VMCA 3TAYA 2EICA 1JTZX 1ULPA 2XAHA 4ICGA 2QSAA 1UU5A 2BE3A 3ACGA 2XB6C 5DUWA 5JZGB 5A3NA 4B3TO 2F23A 4HVQA 1LULA 3I3BA 2ZMNA 1Y9MA 4P14A 1QH7A 3CJIB 3OFNG 1JJOA 3B3QE 2PAMA 4CYDA 4BHPA 2YGMA 4Q4Y2 3CDZB 4CCNA 4EYUA 3VLBB 4DYLA 2DMXA 2YXLA 1JZ4A 4A7ZA 2ZEYA 2R073 3HT1A 4XHBA 3N2KA 1GSLA 3BIEA 2D6KA 4EFEA 5CU1A 1AYN1 1GZWA 3AL6A 4AHYA 4Q4W2 2ZEXA 5APAA 4NHMA 4B1LA 2F4PA 4WFEA 1NTKH 2LGWA 4KXRA 4A6SA 4MXWB 3AZWA 4HXCA 1VQ9V 1OA4A 1HB1A 2DU0A 4F7ZA 3FHIB 2IC1A 1RUE3 2VZ3A 1AR5A 1SPPA 2ZA9A 3E1F1 1ACCA 3VBHB 4QXBA 1TEIA 4N8MA 1PX3A 3MAQA 3J4UH 5E8AA 3CCMV 3BCWA 1F31A 5JAXA 1I08A 3WLUA 5FMOS 3J7MA 1W9FA 4KNCA 5LBFA 2CE4A 1S0EA 1NCRC 1R1A3 1MG1A 3AG4C 4DV4O 3POFA 1ENRA 2P37A 2XBO1 3B40A 3LFIA 5BZBA 2G4IA 2YS8A 3WCRA 1NR1A 5FWEA 1W8FA 1JZ6A 4AE2A 2TUNA 1W03A 2RDSA 5JJEB 4FM1A 2QQWA 4K3UA 2A73B 3M2MA 1AYN2 2VVDA 3OE7G 1AUYA 3O12A 5I0TA 4URAA 1EUTA 4QX5A 2QE3A 1LNQA 2VL4A 4YVWB 3AEIA 1O3RA 2ZIOA 2MK3A 2LM3A 3GB7C 5EYXA 4AI1A 2KM2A 5FKBA 1I5PA 3AKQA 3PLQA 3KVBA 1WA6X 2DFCA 1HRI3 1OSGA 2Q7GA 3MUY1 2H6BA 1BE3H 2CDOA 4H14A 4XDKA 1H8TA 5IJ0B 2ZABA 4XE9A 1TGOA 4L9BA 1OHFA 5DABA 3JQWA 3IDBB 5FP8A 2QA4V 4AVSA 5BMVB 1RXFA 3W7UA 3HT2A 4FAGA 3O1UA 2UXCO 5C3QA 4XETA 4UUJC 1LHWA 3MIFA 3AK0A 1YI2V 4Q0QA 2XBO2 3WB1A 2QKAA 2XAJA 3C3SA 4WFHA 2D7FA 2ITCC 5T5PA 1R093 2Y60A 2VMFA 1W6QA 1DDLA 4LO6B 4LE4A 3S6PA 3H3ZA 4Q0SA 3ENRA 4BR6A 1VB2A 4XDPA 2JGDA 3NNFA 3ZRXA 2ZE6A 5FP7A 4DR5B 3BU7A 5DN2A 4ASLA 4RFRB 1SF9A 1VF6C 5F39A 1XNAA 3EBRA 3WG7C 4WBNA 4I0AA 2HEWF 4I5SA 4TLGA 4R6ZA 1LHNA 4S2DA 2DUQA 2HEVF 5IWAB 3L9JT 3WXPA 1TMF1 4Y33A 1ZL8B 3NQHA 4OLLA 1EAH3 2R30A 1UZVA 2JD9A 4JAUA 2ZZJA 4AHZA 2W1SA 4HNAB 4CU6A 3JALA 3ZN6B 5B5EZ 2PAEA 3LDDA 2UY8A 2JK5C 3ZRVA 4FT8A 2QQKA 3PVOA 1LUVA 3WB2A 1DU3D 4DR7B 1S1AA 3I2GA 1Z7S1 1P8JA 1U5YA 4CS2A 1CAXB 1L0LH 1W6OA 3IN9A 3O65A 3EB7A 4IE5A 4MTGA 4I9QA 3RFRA 4PQQA 3BEHA 2F1MA 1M06G 5FJHA 1BZWA 4AVTA 1GAXA 4O4HA 3RWKX 2UUAB 1YI7A 2PI4A 5DAXA 4JYAB 1N1VA 2ZEZA 1VALA 3LSDA 5FJKA 4N53C 4A3XA 5JSRA 3ZFEB 3SYOA 2OIGA 4LH7A 4PDWC 1NKGA 1WBFA 2H94A 2BOCC 2FDFA 3OAAG 3GBFA 4IGGA 3CC4V 1KBHA 3AMPA 3H8XA 1RVF3 5CFCC 2P06A 1POQA 1HIXA 4Y4YA 3SLIA 2BFUS 3PU3A 2DVBA 3U4SA 1J3RA 4P30A 4UAPA 1ZBA3 2WZR1 1S0BA 2Q4SA 2ENRA 1TMF2 4BOWA 4XF4A 2WS93 1V6KA 5EIYB 5FPLA 4YM0A 1RUG1 2W2IA 1OQDA 3EMRA 3Q4HB 3AYEA 5JVDA 3H8RA 5CG9A 3SJCC 3DKQA 3CCSV 5G04L 4LF7B 1YEWA 5KX5A 1Z7S2 4AI8A 5B66Z 2VQEB 3I59B 3HMYA 3FYIB 4EE2A 4HBNA 3Q8CA 3LSQA 4JV4A 1XNTA 4CEWC 3LA3A 4YZ4A 2VMEA 3NXSA 2HWF3 4NKGB 1E5IA 1Z5WA 1GZCA 4JKKA 5LHHA 4FCAA 2O8OA 3MGUA 1UZZA 1PO21 2RDQA 2LFRA 4B1MA 2UWAA 4MV2A 2WT2A 2QQLA 1DGRA 5KA6A 1NX9A 2MEV3 4FXKB 1DTOA 3H8OA 3OR6C 4LO4B 5FZDA 2YUEA 1HV0A 4LIUA 1KFUL 1T6GC 3E97A 3CSXA 2WZR2 5JXHA 1I5YA 1PGL2 3SQOA 2LP7A 2ODMA 2Y6FA 5LGNA 1RUG2 2Z69A 2JE7A 3ABKC 5BNQA 2XAQA 3FUOA 1AR61 2BGPA 2P3KA 1QU7A 3HQXA 5L3DA 4HONA 2WZPP 5ACA2 3U37A 5T50A 1B09A 2IBZH 3EHKA 1POV3 2C0ZA 3WNKA 1PNMA 2IU3A 5CVRA 4TSVA 3BHPA 3WDTA 3E86A 2WN3A 2A7AA 1RMU3 1CGPA 3ZYJB 1ZUQA 1PO22 4XFCA 2EIMC 1JOJA 3LEKA 3KSCA 5F5QA 2PLV3 3AJYA 2HJIA 4X9QA 3DL3A 1NG0A 4H33A 1RM1B 3KM5A 3OTOO 2D44A 4XFHA 3B09A 4QPIB 1UN1A 1RSOA 1YXBA 4DRXA 1K45A 4JX0A 2IJJA 2AH2A 2HWB3 3WQBA 4QX0A 1OCOB 2YPJA 3IIIA 2XL9A 4ES9A 1FYUA 4I01A 2Q4PA 2EIKB 5KAFZ 4K0KO 4CCKA 2QQPA 2VZQA 4MGTA 1XRUA 2MW2B 1OQEA 2UYAA 4ZIBA 5A1AA 4QKNA 3RN4A 3H9VA 1AR62 5EYPB 1K5SA 3F7YC 3DGTA 4YGEA 2ZGKA 3A21A 4WZFA 4JTNA 4QKDA 5A32A 5E79Z 1NCRB 3AFGA 3TEYA 4I3GA 4XIKA 4I0BA 4QXCA 5A2QN 2VPVA 3B01A 2OUHA 3AG4B 1VAVA 1IBMB 4IW3A 4H2AA 4AQTA 2Z5UA 3DPRC 3THTA 3AYAA 2OQ6A 5GW7A 4C91A 2VOWA 3AP7A 4LH6A 1AI4A 5M0TA 4META 4UYBA 1DBNA 2W46A 3TK1A 1HNZB 4BIUA 3RVHA 4KWKA 4AI0A 2FMLA 1DP0A 3SYAA 4GA9A 1ROPA 2VE1A 2PYJA 5B4XA 1WPXA 4JI5B 1H8TC 4DEQA 3E8FA 2ILMA 5K1XA 3TXQA 4EB6B 5FZOB 4D3WA 3SH5A 4FLYA 1ZVFA 1KC8W 3WVJA 1YDXA 2ZEWA 5F5CA 5EJZB 4I2OA 3IAQA 4HVRA 4TQDA 3T3YA 3RMXA 5DECA 1QNYA 1RUH1 2GSMB 3AG7A 3FB5C 2ORXA 3CCLV 1Q8PA 1RJ8A 3MDSA 5J3UA 3WF2A 1WCKA 4KBBA 2X6AA 1XNRO 1PO13 5DZFA 1H6YA 1D4M3 1CAWA 5FUNA 2XKPA 1AL23 3D3QA 4P9OA 1W05A 1W2NA 5FZ8A 2WO1A 4AWDA 4JCKA 1D2QA 4BDVB 3OMIB 1JPXA 2PZSA 3VQVA 4LCUC 4WFGA 3K4DA 3HEIA 2DYCA 4JPRA 2JWPA 1QQP3 1XNQO 1GU3A 1WB7A 4GH4A 4FBFA 3HKDB 1ZREA 2V09A 2JIJA 1OLMA 1ENVA 3GWKC 2LO1A 2BTQB 4NIHA 1AP6A 1D0HA 3CRCA 5C5UA 1Q6HA 4PIYA 1NE6A 5HBAA 1OF4A 1XI1A 3OSDA 5IUQA 3AG2C 2W0FC 1RUH2 1FXVA 3OD4A 2CAUA 2Y64A 2IJKA 4OGQB 3UGHA 1N1SA 3WD5A 3GBWA 2VZUA 2Y69C 1V55C 1EPWA 2VOTA 3ASNC 4LHLA 1G9DA 4NE9A 5L3CA 4JGYA 4YJ2A 1JN2P 2WNVB 5GLVA 5FPBA 1EM1A 1FS0G 4N7IA 1QVGU 4CUCA 1G86A 5IFTA 2JG9A 5C3OA 5KR7A 5JSOA 5CB4B 3I2OA 5C8CC 3E2EA 2R6QA 3WG2A 1SA0B 1JFFA 2DW4A 3ZMTA 3PVNA 1QJZA 2HBUA 2D43A 5EC2C 1DLLA 4NJ4A 3CO2A 1ZYBA 3QF7A 3VQWA 4M3CB 1VARA 1RTVA 4BA6A 2Q1FA 3ZX7A 5J96B 1OFNA 4ZZ5A 1DFQA 1VP7A 3SDLA 1H2MA 4M4PA 1QJU1 1JHNA 2BQPA 5GLTA 1PKXA 3R4UA 4IEXA 2A9HA 5FZHA 4K6BA 1YQ2A 1KITA 4DV2B 1OMIA 1D2DA 1RUC1 2E31A 4Q26A 5HCFA 3DGEA 1NU1H 1GN6A 1QJEA 4G28B 4RR3B 3GVMA 3POBA 3AXEA 4IUGA 4GKYA 3B2EE 4E2GA 1QR9A 3AZVA 1W06A 5FIXA 3M4FA 2XDVA 3H1LH 1HNXO 5LBEA 4DR2O 4KI5M 5FPXA 1WUVA 3ZIWA 3F2ZA 1RUOA 2VO5A 4CH4A 2W1WA 4DV7O 5F5IA 5D8AB 4QGPA 4UF0A 2YEVA 2WLIA 2GSYA 4EN0A 3B4SA 3ABUA 4MYEA 4QU1A 2ZINA 5F37A 1REDA 4HMZA 4XFIA 2ZDIA 4JTAB 2OZJA 1FFTB 1F5JA 3CCUV 2BVVA 3O14A 4CXYA 2AEZA 3IMMA 1X4TA 1I5ZA 5K0UC 5F7UA 3P5BA 5CFDC 1QJU2 3M3QA 1T2XA 1K5QA 1AP5A 4LF8B 1K3EA 3LEMA 5J9PC 4QX8A 4AOCA 5J09A 2Q68A 1WLCA 1AR73 3H0OA 1NA1A 2ITDC 2YY1A 5FDBA 5GALA 5CMUA 4BK4A 3QO7A 1RUC2 3UKTA 1X8MA 2W68A 1KS4A 2HBTA 3JASA 1COV3 4LITA 2JDHA 1JUHA 1PGW1 3VDAA 4U7NA 3ZSKA 2CK3G 4MGSA 5H9CA 2OWOA 4JAVA 4YIPA 2E5LB 4ITCA 3N2KB 3ZSEA 4NR1A 2ADQB 1YFXA 1GZWB 1TVKA 4LBKA 3K9SA 4F6EA 2A79B 3VBOC 4MO3M 1CX4A 1Y66A 5AC93 4C8DA 1V6IA 5KHJA 3NJVA 4XILA 1SPPB 3V65A 1UIKA 3VBUA 2XH6A 3E83A 2XVGA 2UWCA 5FZAA 1GO3F 2BRTA 3T08A 3QOPA 4CCDA 4LPLA 1UXZA 4LBQA 3WG3A 4QT6A 5K8SA 4MUVA 3H1YA 1QBZA 1G4YB 5IWFA 4D69A 3LSEA 2F93B 1BYHA 1W6PB 4P9YA 3K0GA 2Z79A 4IERA 4A41A 5CAZA 2WLLB 5FFOC 4R9AA 1EBOA 3IFXA 1ZRIA 3LDCA 1BS3A 2KD7A 4GUNA 3S7IA 3T0AA 3MICA 4UFJA 5GLZA 3K4AA 2WC2A 1AVMA 2JS3A 3RJ2X 5BNPB 3U1XA 2QWPB 2DVAA 4XFBA 3WNNA 3BTXA 3NVCA 1VQ8V 1MZEA 5BNNA 3EJKA 4YG0A 5A33A 2ETEA 1ASJ3 5FYHA 1Q8VA 3NJYA 1PZ9A 5DQ0A 5C33A 4K9SA 3KGZA 4I30A 2BOIA 4IV1A 2O14A 3T2MA 4IDZA 3I2IA 3CIHA 1VBD1 2VTXJ 1VBA1 3C8XA 1AR81 1H8TB 2CGPA 3FC0A 3F7VC 2WSSG 2ZGQA 2V5YA 2ARAA 1S0FA 4QD2A 1FFXA 2BSKA 3TBDA 1VLNA 1G1XB 2QKSA 4CPBD 4JGZB 1XU2A 1V6NA 2YGLA 5FAXA 1HDKA 4RUFA 4DRVA 2QVSB 5TISZ 4AAPA 1SLIA 2HHHO 3HKBA 1F51A 4R9DA 4TZDA 4ATEA 1LESA 3A2FA 2J1VA 3VD5A 2EXIA 2CWSA 2QWOB 4MT8A 4YJ3B 2RS53 3AJZA 3ZO0B 1U96A 2NN8A 1W3VA 1W6QB 1S0IA 3LF7A 3GF6A 2EBOA 2J1TA 2YI8A 1FMD1 3W58A 1FV3A 1Y7BA 2JGDB 3NV2A 5DZEA 2JJ1G 5F3CA 2EILC 2NPIA 2DBIA 4FQZA 2WA3A 2Q8EA 4BM8A 3T1HO 4WBNB 3I97A 4PA6A 1RUJ2 1ZBA1 3ZN5A 1TG7A 4YW2A 5D5PA 3WDVA 1W04A 3J80N 1X33A 2W94A 3P30A 1VBD2 5JIAA 4YPJA 5HXMA 1VBA2 1E1RG 5LMUO 1PVC3 3KHCA 1AR82 1QLEC 3JALB 1OCZC 2VULA 1BVVA 1TE1B 4H7MA 4WM8A 5JXIA 3TJTA 5FYIA 1RHI1 1QJX2 3J26N 2VZ1A 1W6OB 1O4TA 4KG0A 3MPBA 3G71V 5FY7A 4MH0E 5BY1A 1VJ2A 4JGYC 1G7YA 2J1AA 2WT0A 3AKTA 3I4IA 1H9PA 3GWOA 3UYJA 1S0GA 4JI2O 3THPA 3APOA 1V55B 4O4HB 2W08A 4WM7B 1YHQV 1WW6A 1UPIA 4XOGA 2KG7A 4RQPC 5FO8B 3VZKA 3MF9A 4FFBA 1PNKA 2WLNA 5EBLC 3UGGA 5BNOA 5GONA 1LOGA 3VHNA 1FMD2 2ATKC 1GICA 2V4DA 5C9AC 1V6JA 4CDXA 4GX1A 3OT7A 4HETA 3FZ3A 2MEV1 1WNSA 4RS5C 3WP3A 1R3JC 2ADPA 2QM4A 2YB7A 1XDCA 4FK5C 4BQ5A 5IYYA 3H9AA 5KAIZ 2WAMA 3NKGA 2WFF1 3NNGA 1BBT3 3ZXGA 1VF7A 3IIAA 2HWC3 3OTOB 1PVXA 4BLJA 4QAWA 3FBYA 1UIJA 5JVDB 3CU7A 2DVFA 5FZ3A 5EHDA 2GC2A 1AVBA 3FD9A 1N33B 5CBGA 2W95A 2EIGA 2H6CA 2GALA 1RHI2 2XVKA 4DV3O 3T09A 1GMGA 5C70A 3ZHQA 2NN4A 1SMVA 4YZ5A 3W5NA 3SJBC 4X20B 4R9CA 5T3NA 3JBG3 4MX3A 1R083 2RS11 3WW3A 1J5EB 1LUWA 1RIRA 3AB0A 4UCRA 3OY8A 4IE4A 4BMBA 1DGLA 4I0XA 1FV2A 2VQFO 4O4IB 3VD7A 1ODNA 3MF6A 1UOGA 5L9VA 1SETA 2PLV1 3IB3A 1OC1A 4FPJA 1M90W 2ZDIC 3H42B 2GMMA 1GANA 1VQNV 3AKRA 2ZE8A 1DQ2A 2WFF2 2R0HA 5E89A 1AR91 2R49A 3VZJA 3I2FA 4YHHB 3PURA 2A0LA 3O1MA 1NA1C 4DOUA 1BQPA 3JD73 3O9OA 2WPDG 1CEZA 4IGOA 3PMSA 3ZHUA 3LB9A 4AEKA 5A6QA 3ZXLA 2EXKA 4L0PA 5CKQA 2B9ZA 1TNRA 1UL9A 4BISA 1Y4MA 3NNJA 2QQIA 3RI9A 4DY5A 3ILFA 5F3IA 2RS12 2JKBA 2GNDA 3T1YB 1RUF1 1PP9H 1BQZA 2BWAA 2NP0A 3MIDA 1UYZA 3ZEDA 1FX5A 2RJZA 5IJRA 1XNRB 4FPEA 3OBAA 2VUAA 2DVGA 2PY5A 1WA4A 1YVWA 1R64A 2ZGMA 1UFIA 2ZGUA 3RSJA 4JYYA 1UY1A 1RSOB 4XDJA 4DRXB 4YRDA 2K1EA 2A6WA 4DV1O 4X62O 3LIHA 1XHZA 4MVSA 1CR7A 1VB4A 4Q5OA 3APQA 1R1ZA 1V0AA 1BCXA 5KLVH 5KXCA 1AR92 2BBAA 3FX7A 3OPTA 2UXDO 2D6LX 3JARA 2LQTA 3ZXDA 3CYOA 4OCTA 1W8HA 4B7KA 4QXHA 1N36B 5J98B 1KDKA 4NIDA 2VWKA 2K9PA 4CDUC 2YBPA 2VTFA 4GX0A 4DW0A 5DUVA 4Z1VA 1QJY3 2CTQA 1SBEA 4QDQA 2WO2A 1QH6A 2CTRA 4I3PA 2RE9A 4NAOA 4YZ3A 4FFIA 2RV9A 1LHVA 4CBCA 1RUF2 1DGWX 1NTMH 1QCEA 3GALA 4BIOA 5HCHA 1OXCA 4AW7A 5EJ3A 1G6NA 2MPFA 3U78A 1J1TA 2QE7G 3ZXJA 4DV6O 4UV9A 3NAPA 3A0BZ 3M1HA 2EZPA 2WRAA 4UFLA 1VF5B 3ZSLA 2PQSA 2K0GA 1QQCA 1IX9A 2EINC 1LHUA 1ND3A 3SPJA 1YIJV 2QNKA 4O9GA 4E2QA 4R4XA 4NAMA 4LQRA 3K57A 1WW5A 3KWVA 3VDDA 4N43A 4E4HA 1HWYA 4J10A 4HPKA 5LGUA 4CUBA 3SPCA 2GC1A 2AGAA 1NJIW 3KCXA 1LECA 3I2HA 2ZCEA 2B4KA 2JDKA 1SFNA 3ZN0A 3ES4A 4QJFB 3RS6A 1YLLA 5GKAC 1CAWB 1DF0A 2V7QG 2LJ2A 4Z92B 3A7QA 4XBLA 1UMHA 3L2YA 4TXWA 3BUCA 1OQ1A 2XJVA 4ZZ8A 2P6JA 1AJOA 2HH9A 5K1PA 2PN5A 5LZ6A 4GB32 4LUMA 4GZ9A 3WG1A 4AVVA 5F9TA 1S2BA 4ZS3A 1HNXB 4DR2B 1BVP1 2RVAA 4WVZA 2OPKA 1F35A 4GH4B 5JOYA 1AF9A 4RSUA 1Q3EA 3TN93 2C1FA 2FDIA 1CXZB 5FY0A 4LFAB 1SFYA 5KXEA 4DV7B 4IV3C 4KHPO 4JI3B 1G9FA 4JV5B 3JCUZ 1G9BA 1I3HA 5JH7B 4WM8C 2UUCB 4AK3A 3SYCA 2IXLA 3OUJA 4MW8A 4X1YA 2CDPA 2W6JG 4HKOA 4OPHA 3JSLA 3T4DA 3AP9A 4X65O 1REFA 4RUEA 2QQUA 4W65A 3B9IA 3PMEA 4XDLA 4LFBO 2DUOA 1ZZ6A 4YJ2B 3RJRA 4WVWA 1XQ8A 1XYOA 1TA8A 2VW2A 2GH8A 3BFRA 4CDXC 4DUXA 2JG9B 3MD0A 1I6XA 3Q8FA 2Q7HA 3HNYM 1S2EA 4WBBA 3H8UA 1EN6A 2XOMA 5LA9A 1Y9QA 3LNMB 3SH3A 4JQRA 4A3ZA 3T2PA 4M0HA 5K9YA 5CZKA 4HOOA 4CDQA 1EYBA 1HNWO 5FLIA 2P7TC 1M56B 3ON7A 2YZ4A 3VD9A 1Y3TA 2WINB 4A7KA 1R3IC 3QD6A 4RGGA 3STZC 3HB3B 4N90A 4QHZA 2ZGNA 1AR71 4HYOA 4XC9A 3I2JA 4DR4O 1VQMV 3BVCA 3CE2A 2P5BA 1D4VB 1K33A 3V56A 2G19A 1VAMA 2AENA 2AREA 4YXWG 4XXAA 2FBEA 3S0MA 4KWJA 2XR4A 4OZOA 4LBLA 5JDBA 5FZ9A 3A0RA 2F43G 2LRPA 4Q0UA 3ZR6A 3D6EA 2P3JA 1YJKA 3X29B 5IHRA 4IQPA 4ZS2A 1ZRCA 3Q8AA 3LPFA 4NHLA 3PJQA 2ZM6O 3RDIA 4FZ0A 4JC1A 4DO0A 3RYKA 2TBVA 2QTSA 2EXHA 2YC4A 3IT8A 5IY5B 1BEV2 4CCEA 4OHWA 3VBFC 1LRHA 1YO8A 2DCZA 4Y1VA 4UF0B 2WLIB 1CD3G 2HWD1 1WCDJ 1ND2C 5IJ9A 2KB1A 3U4XA 1KS5A 5EBWC 4LXLA 4WFBV 1AXZA 3B8NA 1R6KA 3CS5A 3QTCA 2DFBA 2UYBA 4I50A 4OUMA 4MVOA 3CMGA 4CU8A 5EK0A 3IPVB 2ZGOA 4K35A 3T4HB 5GLWA 2JDIG 1NA1B 3FFQA 4LF5B 4K7JA 4AQ2A 1SACA 4YM3A 1TUEB 3KQRA 1DGSA 5LMNO 4S2HA 2NMOA 3TOJA 4NXNB 1AJKA 3JASB 1VBE3 4LO7A 1MEC1 1CAVB 1GWKA 4IL7A 2Y26A 1L0NH 1D2SA 5A6XA 4DUYO 1AYM3 1WLDA 2EIEA 1FJGB 5IYBO 4PA9A 5JOZA 3ZXAC 5I8SA 1SQBH 3PU8A 3TEWA 1UPGA 3WQ7A 3BTAA 1OI6A 3MDPA 2FTKA 1WN7A 4NIAA 4LIVA 1D7PM 2HHHB 1NY71 2OTJV 1HP8A 1TVKB 4EN8B 3LA2A 2HWD2 3PTYA 4JI1O 1VMGA 3UO3A 1QMJA 2KQXA 4AFDA 3OEEG 4EZHA 2BERA 4CXWA 5CA1A 1JOBA 3KMHA 2QTWB 5EV7A 4CC6A 4QDSA 3E5UA 3VBUB 3J81N 5FY4A 3U10A 4YG6A 1EPZA 2WUHA 4LBQB 1IBKO 3U07A 1FXKC 3JD1A 2VNVA 4CE8A 5T5LA 1ZAUA 5BR8B 5J36A 3T1HB 4XXPA 4IYIA 4GT1A 2JDAA 4Q1PA 2PTMA 4NTWA 1GQPA 4I0WB 3VDBA 4FMTA 4BMEA 1MEC2 2VQAA 1DQ1A 5E1AC 4BQWA 3AMHA 2W87A 3E6CC 3HQUA 1IQAA 3BKZA 2YV8A 3K3WA 5FXWA 2ZX4A 1NQTA 4FTSA 4FPKA 3N7KA 1TME3 5JR2A 1NY72 2YIAA 3RVZA 2QKDA 1GQHA 5BNNB 2YYOA 1ALYA 2RG4A 4XAAA 3NNMA 5A33B 3OGJA 1F4MA 2UWBA 1H2LA 1EZVH 4WFAV 2QQOA 4NWVA 4IV1B 3CL1A 1MABG 5FMOL 4MG2A 3J7LA 1ZZCA 1XREA 4YFWA 4DR5O 4N43C 4YY3O 4XUPA 3PDQA 2WN2A 5F3GA 5A7OA 1K12A 1Q81W 4HN1A 4DXRA 4MGKE 5LK5A 2PHFA 4R9BA 5GLUA 3M3EA 1FFXB 5KA5A 2I45A 2BSKB 1KB9F 4W6WA 2AC1A 2CTVA 1HQNA 1FPN1 5FY5A 4PV1B 3JUUA 5A70A 1LHOA 1DQ0A 1SQ4A 2DN9A 3GYDA 3HKBB 4EN9B 2RDNA 1K5JA 2FMDA 4CXXA 3L72H 4CSWA 5HV0A 5A7WB 2LUWA 4FPFA 4B4PA 2ZGTA 1AB3A 1H1IA 3HAGA 1RUD2 3LCPA 5AG2A 1H2NA 3I5DA 1AHSA 3ILNA 1RUI3 5LXTA 1LNSA 1K5MC 1CWPA 2HWE1 2EULA 1JX9A 3ZN1A 1D5NA 4LFCB 1AX2A 4U2AA 1HXS3 3HN3A 3I3QA 2BP6A 4A6OA 1NLSA 4JYAO 2QCSB 4B3SO 3AZXA 4D6RA 4NWWA 2X8KA 2VQFB 3HWJA 2H3OA 3A4UA 5C5TA 2ZQMA 2ZOEB 3LSSA 4OI0A 1JS9A 4LWSA 3WU2Z 4JI7B 3RMYA 4OHVA 5LHIA 2OS2A 1UO9A 4GWIA 5FMBA 4PELA 4WM8B 1ZSPA 4LBQD 1XB9A 1J59A 1KJRA 5FOJB 1G9AA 2MHFA 4AR2A 1K7DA 1S0VA 4MGQA 1FPN2 2NYYA 1ZTEA 1NCQA 3CP1A 2ZHMA 5BXZA 4GKKB 4Q4X1 1Y74A 2E6VA 4INDA 5FRAA 1SBDA 4M01A 2VQTA 2H8PC 2A6ZA 3OGSA 3JAWA 2DVDA 2KG7B 3J9SA 1VQOV 1UOJA 1HW7A 4FFBB 1FXZA 1FOD3 4Q0PA 3DC6A 4XACA 5BNOB 4GD4A 2ZKOA 3CBNA 3ZFGA 2VQEO 1MS0A 3LOIA 5EJ1B 4PDMA 1ZNPA 5FZEA 4CDXB 2N7GA 2HWE2 1GOGA 4JHZA 3LNNA 2W39A 4GXLA 1BMFG 4KG8A 1NUKA 4WFFA 4UFIA 4UFHA 3Q9OA 5F2VO 3MW4A 5J2UA 3DUIA 3OF1A 3D0JA 4V1PA 3GCXA 3V64A 3K2OA 2R041 3NJZA 3ZYGA 4H7LA 4ET7A 1S0CA 2IUWA 1Q5OA 4YSFA 4FOYA 3UM7A 3JD71 5L3BA 2BBVA 1VMJA 4ZY9A 4TUYA 4DV1B 4X62B 1MS1A 3H01A 3SGIA 4B7EA 3ZYHA 2VH9A 4OMDA 5FZ6A 3SITA 2GN3A 2UXDB 1KP3A 5A3LA 5IVEA 4FLUA 2K9ZA 3G6EV 2AXTZ 4Q4X2 2IFRA 1SBFA 3I3DA 1S3JA 4O9EA 3OY8B 4DPNA 4I0XB 5IAXA 1NZ6A 1W8UA 1UWWA 3W7TA 1LCLA 2RMU3 3CRAA 5H6RA 2OPWA 5DEDA 3ASOB 3KVAA 4XVHA 2OUJA 1YSCA 4AI2A 4ARXA 2GTAA 1Q82W 1UXXX 3POWA 2R042 3ACHA 1W0OA 1AXKA 4PQ9A 2JVDA 1EN5A 5FYMA 5KMGB 4FLWA 4DV6B 1H4GA 4MSWC 1XE7A 2Q0AA 4QX7A 3APBA 4GALA 3VKNA 3RW0A 4HK9A 1VQ5V 3DKWA 1OCRC 2Z2SB 3OMNB 5F3EA 3ZDVA 2Z0AA 4AGGA 1UZYA 1QJY1 3IBMA 3BPSA 3W7WA 3ZKUA 3AP6A 4W50A 3WNOA 4IEYA 4XFGA 3VZOA 3E22B 2WFPA 1AJQA 4UT5A 4FJCC 1SQFA 1GH6A 3KB5A 3WZ1A 3WW2A 4COYA 1BL8A 3BA9A 1VF6A 1N3PA 2YHJA 4IEOA 3JAKA 2CYFA 2CHHA 2SBAA 3VBRA 1OA3A 1XHXA 4E2SA 5E6HA 2ARHA 4JVAA 2PHTA 3OYWA 2JIZG 3K5NA 2VUJA 1JZ2A 2H0BA 1RPRA 2EIBA 2VBDA 1M5IA 1SC5B 1IBMO 5FV3A 1H6XA 3IGAC 2PMWB 4EWDA 1QHTA 1DYKA 1ZBE1 2D5HA 2W1QA 3IDAA 3HJRA 1H4HA 3BTYA 3POIA 2IJHA 4BAYA 2IWGB 4QKBA 2DWDC 3A8TA 1JMKC 3ZHTA 4SLIA 2UU9B 1CX1A 2AZ5A 3B93A 3IDCB 3JARB 2J22A 4K8FA 3FLTA 1HNZO 4E8DA 1P7GA 2NNUA 4LHSA 2GP3A 2RN9A 4XFFA 1YHFA 2Q5ZA 4QU2A 2VUCA 1US2A 1DQ6A 3SHRA 5LP6A 3WUCA 2AHYA 4FLTA 2B9VA 3VKFC 2QR4A 3I3MA 2QFEA 4EWEA 2V4AA 5B3SC 2WNUC 4O4LA 4KUMA 4IESA 3KV5A 4XMAA 5E16A 3ECQA 5GZGA 4UVBA 3VBBA 1PIV3 2A71A 1DQ4A 1CPNA 2ZXWB 1EV11 3DYPA 1WMXA 3CRQA 1O91A 4CUGA 3JAMN 5CFCA 2CSGA 3DV8A 3RQ0A 1J84A 3OUHA 2YPDA 2ZR2A 3USSA 4LNUB 3NAPB 4K8ZA 1ZBE2 2UXBB 2QWRB 5KHKA 1JOYA 2YU1A 2ZGRA 3RYCB 5C3PA 1HRV1 1NBMG 4QQPA 1ND3B 4GZRB 2CNAA 4R4ZA 5C4WC 2X5IA 3OTFA 2PYTA 4LBEC 3W5MA 3CRMA 1PNGA 3VDDB 3VHRA 4CEWA 4N43B 4Y5SA 3L9DA 4HPKB 1HNWB 4P2ZA 3J8F3 4DR6O 2Y38A 4LF4O 1VQPV 4QM8A 2RM21 1QWRA 4W8JA 1XC6A 2AUYA 1SKVA 4X1KA 1AZDA 5E88A 1P4RA 1IGOA 3HKEA 2B5UA 4MVMA 3KHBA 4MVZA 1J83A 3M8LA 4X8NA 1EV12 3N9LA 1F2NA 3AC0A 4Y3OA 2DURA 5F8PA 2HP8A 1UU6A 3K59A 2R9RB 1GN3A 2I07B 1RYYA 1LOBA 1UMIA 2P4KA 1O3SA 1XU1A 3OJBA 4NTXA 5J37A 4RA0A 4IIJA 4CPBA 3ABLB 4AL9A 5FP3A 5DAVA 1VAKA 2ZM6B 5LRRA 3T0DA 5A3PA 2JEUA 2NQYA 1OBNA 1HRV2 5DUXA 2FDGA 3RBZA 3OMAB 1XBFA 4LR3A 3AVRA 5EZWA 1CONA 4OXSA 3S3WA 3OEBA 1QU0A 4AQYB 2PYLA 2IXCA 4ABMA 2YG0A 2NMNA 5A9GA 4ZXKA 2F4LA 3LOBA 1W9SA 2VECA 2WLHA 1NCQC 1VBC1 4CC5A 2RM22 2ZGPA 4QHOA 1JZ5A 1YFYA 3PHMA 4AHCA 5IK4A 4J80A 2E75B 1LOAA 1RPOA 2Q6AA 1AROP 1QF3A 3P3NA 5JCOA 4LTAA 3D82A 1Q8QA 2W5FA 3ZFGC 4DV2O 5A3OA 3VL9A 5IT6A 1UYXA 1WA8A 2C9AA 1OOPB 3TNPB 4ISRA 4UB6Z 5C7GA 2D98A 5LMNB 3VGIA 1W2BU 3LGRA 3KF3A 2RJ2A 2X6CA 4HN0A 1XEQA 2WO7A 2JG8B 2IU0A 2JKXA 5G05L 1YCIA 2JIGA 4FM0A 4DUYB 1HR0B 1GNYA 3C7HA 1NI8A 3HPLC 5JZGA 4CDQB 3K58A 1E5RA 1BHGA 3PN1A 3T1MA 2YIDA 4UW5A 1CZVA 4RGKA 3KD4A 2OKXA 2L35A 2PI5A 1I1EA 4EN7B 4CVUA 4Q4Y3 2GNMA 2B8MA 1VQ4V 4ORFA 2P2KA 3WUDA 5IE9A 4AFMA 4JI1B 3OR7C 4TQFA 2I74A 3N7MA 3A0KA 2CTPA 1LOEA 5ANQA 3FKSG 1C5IA 3RT3C