3FFTA

Crystal structure of chey double mutant f14e, e89r complexed with bef3- and mn2+
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDESTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTARAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Matching Biochemical Reaction Kinetics to the Timescales of Life: Structural Determinants That Influence the Autodephosphorylation Rate of Response Regulator Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fftA00
4DADA 2RJNA 1FSPA 2ZWMA 1MAVA 3HEBA 3LUCA 1U04A 4P98A 4EYKA 3HJFA 3A10A 3UKJA 2FMFA 1RPJA 2MYNA 4KPYA 1P6UA 3Q7SA 3KG2A 5EWJA 3JPYA 3OO0A 3UK0A 4E7PA 5IC5A 2R48A 3TMYA 5CNKA 4ZMRA 2H0AA 5KC8A 3DZDA 3KSMA 2ID7A 4Q7EA 3JTEA 2PUAA 1RXIA 4Z4EA 8ABPA 3I42A 4QYMA 3ROFA 3FDFA 4RXMA 5I4CA 2NT4A 1NY5A 3OLVA 1JLKA 2WB4A 4XASA 3SM9A 3GL9A 3N6VA 3N0WA 1ZITA 3GV0A 3HUUA 2FVYA 3MA0A 2FSPA 3LUHA 1NXVA 4JOQA 3BREA 2QU7A 4F12A 3SNKA 1J56A 1GUDA 2VK2A 5FWYA 3URMA 2MYTA 4KFCA 1FQWA 3SQNA 2FQXA 1UDRA 3MMNA 3QK7A 4MS4A 4LE1A 2GWRA 4N0QA 1VLZA 2MSLA 4YP9A 2FW0A 1JFSA 3TB6A 1T34A 3GBPA 5TQ2B 4PZ0A 3C3MA 1ZGGA 4EVRA 4E7OA 1D1QA 4TMYA 5BRAA 1L5ZA 5IEJA 1M2FA 4OLAA 2IPAB 3KYIB 1D5WA 2H3HA 5JNRA 1YTUA 3BILA 1B00A 1M5TA 4ML3A 2R25B 1QMPA 5CNMA 5EWLB 3HVRA 1DCKA 5E3JA 4F11A 3H6HA 1Z15A 4MR7B 1NXTA 2QR3A 4F3TA 2YHBA 4EVSA 3HV2A 1K66A 4PE5B 3SG0A 1QQAA 5TQ0B 5DCLA 3LUDA 1USGA 2JVKA 1CEYA 1JYEA 5TPZD 1JL3A 1PUXA 1SRRA 3JVIA 3QLVC 4JASB 5FBKA 4MQEB 2PMCA 3IPAA 1P8AA 1SXIA 1Y1LA 3RVMA 2CHFA 3EQZA 1CHNA 4KRFA 1C4WA 3DBIA 4F8JA 1QQBA 2NT3A 2QZJA 3DLHA 3F7NA 1GUBA 1BAPA 4ZJPA 4MS3B 3O21A 3A3KA 4FE4A 4XAQA 5EWLA 2WJWA 4RK6A 3RVLA 2GX6A 4Q6BA 3MQ4A 5DKFA 5JS2A 5T7BA 4LX8A 2JK1A 4WXMA 1DC8A 3H5TA 1W25A 5F64A 5KQGA 3DGFC 2M98A 3I09A 3M9XA 5TPWA 3QX8A 4YR7A 2JVIA 3OLWA 1DCMA 3IP6A 5DGCA 3QLVA 5FWXB 3LKBA 1ABFA 4YWHA 1L5YA 4MQEA 4TLMB 3EQ2A 3OLZA 2RDMA 3H1EA 5KC9A 4PYRA 1TMYA 1Z18A 4KK4A 3KS9A 4WWHA 4ZYLA 4W5QA 4EUKA 3QLUC 1TLFA 5B3JC 1W9HA 3JY6A 4G0QA 4IRXA 2PUBA 2W42A 1XHEA 2N9UA 3CRNA 4LRQA 2I6FA 2KYRA 2FLWA 2GI4A 5EWJB 3HZHA 1A2OA 3CNBA 1DJMA 3FFWA 3JS5A 1NXSA 5IUJC 5KWSA 3HUTA 3F73A 1APBA 3LTEA 4L4UA 2V0NA 3FFTA 5HSGA 1ZAYA 2VUIB 2J48A 2P4UA 1U2QA 1JX6A 2AYZA 2IPLA 2L2QA 4IMJB 2O20A 3H1FA 2ZAYA 3E3MA 4UHKA 3VNBA 4EYGA 5ED4A 4RK7A 3M9WA 4WXEA 5FWYB 1ZDMA 4N03A 1NXPA 1OXKB 1LBIA 1XWWA 3RH0A 4RKQA 4LZLA 3EDCA 1XHFA 4JP1A 5FBHA 4RDCA 3RVOA 5IULC 1QP0A 1QPZA 4Z4IA 4MS4B 3LUAA 1Z26A 3N8IA 5EWMA 3N0XA 5TQJA 4JAVC 4Z4FA 3GT7A 2HQBA 4Z4GA 3CLKA 3T38A 2F8TA 2VYCA 2LUOA 1NATA 1F51E 4DN6A 4ETNA 4H60A 3QX9A 1YS7A 1P2FA 3IP7A 3QELB 3HCWA 4RK5A 3EAFA 5BQ3A 3D02A 1QNLA 3B2NA 4XLTA 1VPWA 2MSKA 2PUGA 4MAAA 3I45A 3H5OA 1YK0A 2FQYA 2E4WA 1LJUA 3K9CA 1Z12A 3OM0A 3BRQA 4KV7A 4KZKA 3KJXA 5D2CA 2MYUA 1NXXA 4M88A 4MRMA 5ABPA 1QP4A 3CS3A 3F6CA 3MIZA 2LP4Y 4MR8A 4NV3A 4EYQA 3LUFA 5HQJA 3H1GA 4CBVA 3CG4A 2LIVA 1U0SY 4YLEA 1JDNA 2NUBA 2LPMA 1JDPA 2HQRA 3KLOA 2FEPA 1RZRA 4Z99A 1MIHA 2L19A 4G0YA 1USKA 3CZCA 3QELA 4NQRA 4ZPJA 3RVKA 1DZ3A 4Q6WA 4GPAA 3IP9A 3OO1A 3MYYA 3JPWA 4Y9TA 4FB4A 4TN5A 1ZH2A 5HKOA 1JH9A 4RK1A 3E61A 1BDHA 1EWKA 3C97A 4O5AA 6CHYA 1F4VA 4RK4A 4GNRA 2L17A 3LUGA 5T3YA 3OQNA 2PUCA 4S05A 3CHYA 3EULA 3KKEA 4YCSA 1SXGA 2OQRA 1EHCA 1MB0A 4OATA 5TPWB 1BDJA 3O74A 4MYRA 2JVJA 1BVHA 2L18A 2FEWB 3RVNA 3K4HA 1ZN2A 5JNWA 1JBEA 2BGGA 3O2QB 1PEAA 3CTPA 1NXOA 2ID9A 3GYBA 1C0EA 2AYXA 2Q5CA 4QICA 2IYNA 1Z2DA 3H75A 3LOPA 2TMYA 2PUFA 2IKSA 1JF8A 3M6MD 3KTOA 2DRIA 2QVCA 5BRJA 7ABPA 5IUKC 3H5IA 3Q15C 4QYWA 5CNJA 4NCBA 3HK2A 1DC7A 3MM4A 3NNDA 3C3KA 5C5CA 2FLKA 2PUDA 2PLNA 3N75A 1LBHA 3O75A 2NZVG 1DP4A 1NTRA 3H5WA 2QV0A 4XARA 2A9PA 4RXUA 2IDMA 1EAYA 1HEYA 4PEVA 4Z4CA 4IILA 4RY8A 5BR1A 4IGAA 1URPA 4ETMA 3I5AA 3F6PA 2GKGA 3ILHA 1D1PA 1EWTA 4W5RA 1DRKA 1PHRA 4N47A 4D74A 4KNYA 3G85A 1ZGZA 3OMXA 1LJLA 3T6KA 4F06A 3O2SB 3FMVA 4YS6A 2VUHB 2A9RA 3EODA 3O1JC 4JB2A 4RXTA 1GCGA 4WUTA 1YMUA 4O1HA 5EWMB 1R8JA 3NNNA 3R0JA 2QSJA 1KGSA 3UUGA 3LMKA 2CHEA 2FXIA 1E2BA 3ILYA 2E4UA 2GBPA 4S04A 2QW1A 1AB6A 3CU5A 1DCFA 4Z9AA 1DBWA 4N0PA 4W5TA 3IP5A 1YK1A 1E6KA 1H9CA 3HM9A 1E6MA 1ZVVA 2FEKA 2MSWA 2NZUG 1YS6A 1S8NA 4IF4A 4LDZA 4LE2A 1ZY2A 1Z2EA 1DG9A 4RSMA 3TD9A 3C6QA 4MGEA 3H6GA 4NICA 1AB5A 5DLEA 2B4AA 3QLUA 5B3JA 5JNTA 1Z25A 4KQ9A 3OM1A 4OTZA 4WZZA 2E4YA 2WRZA 2IOYA 3SAJA 5PNTA 3RVSA 3RQIA 2FN9A 4G0ZA 4G0MA 2PUEA 4G86A 4H3KB 2QXYA 4MRMB 1GLGA 4TLLB 5DTEA 3A0RB 3G1WA 1FFWA 1ZHHA 4YGXB 3HDVA 4MR8B 1TJYA 3S99A 3BBLA 1EFAA 3RVQA 1M5UA 4G97A 4WT7A 1VRVA 4KREA 2MYPA 1DBQA 3LKVA 4RS3A 4YO7A 1U8TA 2JB9A 3KCNA 3L49A 3GRCA 3N53A 5JNVA 4LE0A 1QKKA 1Z13A 2R47A 1YIOA 1D4ZA 4RY0A 3OLXA 4MS1B 3CFYA 4P1ZA 2RJOA 3TX6A 1VKRA 3KHTA 5KQPA 4RV5A 2HJ9A 2OENG 4G0XA 3CZ5A 4L85A 2PKXA 3FGZA 2HQOA 3HO1A 4JB0A 5IEBA 5JNSA 1WETA 1Z17A 4XFKA 2B1JA 3Q7TA 1PNTA 2FMKA 1M2EA 1PNRA 3QEMA 1DRJA 1BA2A 4OLBA 4MR9B 1D2AA 2QVGA 4FE7A 2IPMA 3TO5A 4N76A 3HXMA 3Q9SA 4MLDA 3KYJB 3ROTA 4RU1A 3D8UA 4MS1A 5C5EA 3N0RA 3OQOA 2RGYA 4G0OA 3KLNA 3OMWA 3O1IC 1MVOA 1I3CA 3C3WA 1SD5A 3W9SA 1FFSA 1U2PA 2PL1A 2FMHA 4D6XA 1EWVA 2PE5A 4LDAA 2WY2D 4RK0A 3L6UA 1ZH4A 3QEKA 3VNAA 1ABEA 3OQMA 1BDIA 3H5VA 4RY9A 5IUNC 3HS3A 1IIBA 1YMVA 5KQMA 1GCAA 3EGCA 3A0UA 3NHZA 2PL9A 4MR9A 4EVQA 1ISSA 1RXEA 4MLCA 4N41A 2XDYA 3JVDA 3IDOA 2FQWA 1QP7A 2A9QA 3Q41A 1RNLA 5CNIA 2IPNA 4Z0NA 5GQSA 1USIA 5KQLA 1P6QA 3T8YA 3CG0A 4QPJC 2PAFA 3RVRA 1FFGA 4DQDA 2JRLA 3EJWA 1SXHA 1JWLA 4KQCA 5KI6A 5HM6A 1YVUA 1QO0D 2WWVD 2M1ZA 4EY3A 2CD7A 2FKAA 5TQ2A 3MF4A 1LK0A 1E6LA 1TM2A 5IBQA 5TPZA 1MB3A 3NHMA 6ABPA 2HPHA 2JBAB 3FFXA 4YRZA 1CYEA 1NXWA 2PJUA 3Q7RA 3HDGA 4EYOA 1QO0A 4OG2A 3NBMA 3LUJA 4IMIB 2JCGA 4JA2A 4RZSA 1PEYA 4HYEA 4MR7A 3T95A 2CWDA 3H5LA 3HSYA 5TQ0A 1TVMA 2E4ZA 4OBBA 4HNSA 4Z9BA 3LFTA 3O2JA 4ZMSA 1JFTA 3QLTA 4UHJA 3CKMA 5TE9A 2LBPA 1OXBB 1A04A 1A0OA 4KVFA 4MQFB 3GA5A 1Z16A 4G0PA 1KMIY 2WJAA 4MPTA 3RVJA 1JHZA 4B09A 4ETIA 2P9HA 4D6YA 2E4XA 2F8SA 2WMYA 2JBAA 4XXHA 4MS3A 2A9OA 9ABPA 2YHAA 3LUKA 4RKRA 3GWGA 3OLYA 5GOTA 3IPCA 1DBPA 4HNRA 2FN8A 2E4VA 2FTKE 3O1HB 4KK3A 3NNSA 3SY8A 4Z4HA 4KMRA 4H3HB 4W5OA 4PICA 5JNUA 5CHYA 1KRWA 1KRXA 1JFVA 1ZESA 3P9YA 1RZRD 3BRSA 3GBVA 5FWXA 3QEMB 4RWEA 4MQFA 3RVPA 5JS1A 4W5NA 3DGEC 3DLBA 4HNQA 5IX8A 4NCAA 1ISRA 2X7XA 4O1IA 2FMIA 4YV7A 2R4QA 2HSGA 1K68A 4EGSA 1JYFA
chains in the Genus database with same CATH superfamily
4LJ8A 4XSHA 4P3NA 1FSPA 3FI0A 3GI1A 1IWBB 1OC4A 1BXZA 1N92A 2ZSAA 4OK6A 3EBLA 3UMJA 4D81A 4EB6A 2VJLA 4PSVA 2Y99A 3NS7A 2UZ0A 2HBYA 3L1HA 5ALPA 3R3SA 4ZMRA 3DL0A 3LM8A 4FXPA 4GP7A 4Z4EA 2J3HA 2FP3A 1FX0B 1P6XA 2HO4A 3RAPR 3B8EA 3ROFA 5AVRA 1YV9A 4GRAA 1FFXA 3S28A 1ZKDA 1DJPA 2WG0A 2KQUA 3DLTA 3NTXA 1SC6A 1QIHA 1ZMRA 3MA0A 3P9IA 4M6WA 2F62A 1AUOA 3PEWA 2QAIA 3ZBTA 2FRDA 2X2OA 4ZOLF 2QU7A 1O9GA 5HEKA 1PJSA 1EPUA 3S8MA 3JZIA 2P0EA 2TMKA 3ICOA 4KKXB 4AO7A 1EGMB 3RR2A 3JQ6A 1WBBA 3CNEA 3IRUA 1RADA 4HDRA 1X7YB 1ZQ1A 3OHPA 4YRTA 3WSTA 5KNDA 3M0EA 1M75A 2O8DA 5A3JA 2EZ8A 4MCIA 4X3CA 2X5OA 5E9JA 1RBZA 2Q4EA 1T34A 3GBPA 2P35A 5TB5A 2C88A 2OCIA 1GXSB 2Q5HA 4BFWA 1W85A 3AR8A 1U28A 2QROA 1YD7A 2RH4A 2XMRA 4D80A 2J7KA 1KFBB 2PK3A 1N3LA 2OMEA 5EC8A 2FRVA 3RU9A 1J0EA 1JXAA 2DUNA 3R5HA 1EVJA 1RWWA 3UNXA 2O19A 1U1EA 1XRNA 4ZU6X 2F3QA 1RPAA 2X77A 3IUBA 4X1IA 1RE1A 4CT0A 1ORWA 3PQEA 1L7EA 4E3ZA 2G8LA 1KU0A 4EVSA 1K66A 4O4JB 3OF3A 2QTZA 3VPGA 1TC2A 1RCFA 1F20A 3K2BA 3SSNA 1YMQA 1JQ3A 1U0GA 1CULC 3I8XA 1DDGA 1GPNA 4YRJA 4AD8A 3RWBA 2D0OB 2G40A 1LK5A 4WRRA 3I2FA 1PW7A 2EKLA 4IOJA 5G4KA 3W78A 4B6EA 4BPRA 4G0NA 1BMTA 1Y4SA 4OXYA 3OOWA 4U2KA 1L6IA 3L7KA 3CCFA 4E5VA 1A2QA 1WEHA 3HEMA 2IYUA 3OPQA 3ICPA 1TF7A 2WJWA 3UK1A 2BBOA 2YR0A 1SBHA 1U99A 2CLEB 4MLPA 5KPDA 1CHDA 4X7MA 5FT9A 1PZEA 1KJ8A 4LPSA 1A95A 4P3YA 2DKOA 3Q8XB 1AGXA 2GMWA 3LVFO 4QOIA 1KYYA 1P73A 5K0BA 4FKBA 2E37A 2QLTA 3EXEA 4GQAA 3T0IA 5HTOA 5FTKA 4DV1B 2ZJFA 2CCKA 3FY4A 1EDEA 3JX9A 4FJ1A 2YWHA 4J3NA 3BB3A 4CQLA 5L3SB 3UQYS 4H7IA 1RWPA 1NJSA 1XTSA 1AC5A 3W4KA 3JZFA 4IRXA 2A5DA 3G2IA 1B2LA 3WLMA 3G02A 1IONA 1KC1A 3FIUA 4PC6A 5E1MA 3ZXIA 3SFTA 2HSDA 4ZVLA 1YL6A 5F9FA 3KLPX 4IY1A 1T2NA 3DJFA 4F96A 1DWOA 2FQQA 3KOYA 3GLGA 3CNBA 2ZATA 4R71A 1SEVA 3QV2A 1PL8A 2ZLBA 3F73A 1U9YA 5U9CA 2UZ4A 3HRIA 4TKLA 4IHAA 4MWTA 1PGPA 2C99A 2BEJA 3ZHVA 3ZD7A 4FX2A 1D3AA 4JC0A 4PLYA 4BJHB 2CY0A 2J48A 2C61A 3FTFA 1ORDA 4NXNB 1XEXB 1PSWA 4UCXA 1T43A 4NEGA 3EQ8A 3W6NA 4E5NA 1G18A 2I54A 1GUAA 2O20A 2IS6A 2BZ1A 2PUHA 3H1FA 2UYOA 4UHKA 3ZD9A 3ZLTA 1L7MA 3L8GA 2C95A 1PGJA 4NH4A 5FWYB 1M1NB 2Y77A 2A3NA 3SM3A 2WMNB 1NXPA 1FW6A 3NWBA 2ONJA 3RYCA 2QRVA 5AVZA 3G2LA 4IIJB 1R5OA 4WSOA 4BB9A 3A9RA 2J3LA 4Z4IA 1MLDA 4QD3A 10MHA 3WHIA 4GHWA 1Z26A 3N8IA 2ZJ5A 4JAVC 5IJZA 1ZXXA 1LPMA 2X4GA 3NC1C 5E1BA 1WF3A 4N5NA 2HIGA 4EG3A 3TNJA 1CR2A 2I66A 2IF0A 2R11A 2GPYA 3BM5A 3EA5A 3HE3A 3EZFA 4KQXA 3S7ZA 4GMKA 4BEBA 4H60A 1FS4A 1THZA 2H4WA 2LWIA 4LHXA 3U3MA 4BNZA 4F8EA 4N18A 3AC0A 1GA6A 5CLIA 4ALLA 3FYHA 3KJEA 1WUYA 4Y2XA 1XQWA 2VZLA 5BNWA 5BR8B 2ZJ6A 3CLTD 3BCRA 2NTEA 2BEWA 3T4EA 2H2FA 4EAAA 1NVEA 1QZUA 1XK6A 3LC0A 1W1UA 4BQEA 4YLYA 2JASA 2MYUA 1HETA 1GN9A 2NVUB 1L5SA 4EZBA 1BXGA 3A9WA 4M54A 4TZKA 5K7SA 1KYXA 1LLUA 5I9MA 2QG4A 5AVXA 1U7UA 3BDAA 2H1VA 3U9TA 4JBIA 1EFUA 4AG5A 3TDNA 3HADA 3QA3E 3FUCA 5C81A 3F7MA 4ALKA 4CLDA 4F9TA 1E2PA 1CB7A 1QYIA 5FIUA 4D9GA 2FX5A 4JJGA 1AGYA 3E22B 3N87A 3ND8A 3PTZA 3V8VA 3WQSB 1HE8B 5AK6A 4KAJA 1L2TA 2J9XB 2VKQA 4EI8A 1E0KA 1UWLA 2VNKA 4YBZA 4R6XA 3NAZA 5CT6A 2EF0A 5CD9A 3CZQA 3NT5A 4TMKA 3SQOA 3ADDA 4B47A 1CEQA 3DXYA 1E5DA 2DCMA 1TF2A 2OQRA 2QU8A 4H7DA 1K3UB 4A0FA 1PFWA 3H86A 3NATA 1C3OA 4UHHA 4RGYA 4Z1OA 1YA8A 3BXOA 2CNOA 3DT8A 1KO8A 3IFSA 4HLNA 4NYJR 4A1FA 4BJ5A 3O2QB 5GOTA 2JLUA 2BM8A 2IYNA 3ACCA 1NNI1 3DE3X 2QB5A 4GKJB 4G0WA 2QUAA 3GRYA 1W5SA 4RL4A 4A9AA 3IIMA 1BHJA 3V42A 3ADOA 1QGAA 4ZQHA 1M2NA 1GKUB 3HHPA 5HXAA 3MM4A 4B8YA 4HGRA 4E2FA 5KSPA 1G4AE 1YB7A 3K05A 4MMYB 4G5YA 1C8LA 1D8AA 1WEKA 3ZQ4A 4LUCA 1WXWA 2D7DA 3T7SA 2WZCA 5FNVF 4LC0A 1G8YA 4B80A 3FF4A 2JFYA 4RH1A 4HUQB 3QYPA 1FNCA 1G38A 3DSRA 3X1MA 3L4EA 4L8LA 3LK7A 4JODA 4L0MA 5IDYA 1S2GA 4DDWA 1IMOA 1DZIA 4FBGA 3KSAC 1L3BA 1Y3DE 2MDTA 5IK2D 4NYMR 4PPGA 1A4XA 4PIVA 4AICA 4GL2A 3ZNPA 2J5BA 3HFGA 3VHLB 1ACMA 4DPLA 4YMGA 3DQZA 4W8GA 5BPFA 3R7FA 2ZTSA 3QBVA 3WK6A 4YIHA 4GKKB 4KNYA 1Z2NX 4ND5A 3QFRA 4EHNA 5JRZA 2JIBA 2QM3A 3K73O 1RQ2A 5FD8A 2NZ2A 5L4NA 4M53A 5T4HA 1ZCJA 4BWGA 4PYKA 1GZDA 3L7BA 3WDSA 5CITA 1UBUS 4IZOA 4DC9A 1U2RA 2IHTA 3O1JC 1UFQA 3N1UA 5FI3A 3WGMA 5JI2E 1RQRA 4XVQA 5BT8A 3EC1A 1TA4A 1JR3E 4MV6A 1H2YA 1K5PA 2PKRA 4AMZA 2GBPA 4S1WA 4TMZA 4N7JA 2WFMA 3DPUA 4IZIA 1KPIA 1L5NA 4F71A 4GIBA 1BD3A 2CGEA 4KDEA 5AVQA 4GM1A 5HQ3B 1MT0A 5F33A 4V0NA 2GK6A 3ZIUA 4CMGA 4LDZA 2Y1OA 3V8MA 3VKFA 5T4EA 5DFAA 3QWIA 2GCOB 3KPWA 4DUGD 1PX2A 5JCPA 1NUQA 4CCAA 4M0UA 4Y67A 3GFQA 4D9HA 2AR7A 4YALA 3RSGA 4N9WA 4NJEA 1GARA 3L40A 3OFND 3WZMA 1YO6A 3HA2A 4RC9A 1GDTA 3KQKA 1P9RA 1Y7HA 2PKCA 1YBMA 2FFJA 4XJTA 4DUGA 4DV3B 3PC8A 3EXIA 2GPTA 4Q7MB 1NMXA 1W4ZA 2ZYWX 3OFNA 2QX9A 4G97A 2XTAA 3MGGA 2MYPA 3LKVA 2C9DA 4YT5A 5LXTB 1QVRA 2FX3A 2H07A 3KCNA 4N48A 2ECOA 4D9IA 3RD5A 1QKKA 2D4AA 4NEQA 5B6IA 1YCFA 4E2WA 5ITWA 5IU6A 4DAEA 5IJWA 2NU9B 2HJ9A 3RC7A 3WY9A 1YHZA 4KLAA 1B7GO 3IHTA 2IIQA 2ZTUA 3MFYA 1KH3A 4NE2A 1CZOA 4QX6A 3STXA 4TMVA 4J7AA 1NWHA 1XQXA 4IV8A 1K8RA 1LVHA 2B8WA 2VXCA 1YUBA 2X0NA 3KXLA 3LQQA 4D57A 3UJCA 3ELBA 3WL5A 2JI4A 1QAQA 3L07A 1LTQA 2I4MA 2YYYA 3M4ZA 1O58A 1O5OA 2IXAA 2X2EA 5KYUA 5T6BA 2XNDD 5FFNA 4F5EA 1SD2A 3CNOA 4X9XA 2C0QA 5BUZA 2XSZD 3T9CA 2YV2A 2W2KA 4OLBA 1U7ZA 4M9SA 1BH2A 4LHSA 1NLFA 4XEHA 4Y1FA 3OKAA 2JZNA 1RWMA 5LB2A 4W1SA 4MRAA 1E6WA 1XAIA 1M8GA 2XNDA 3RUIA 3KYJB 3H1PA 1B2RA 2JLXA 4XWWA 1XTIA 3RTCA 1N6HA 3SKXA 3CRVA 4Y6PA 2JFPA 3OP4A 1UUFA 1XA4A 4WKGA 3SXPA 3N0RA 3HL0A 4K46A 3CZPA 4G65A 2ODAA 3JQBA 3KPJA 3P2KA 3G68A 4MRPA 1Q44A 1TW2A 1U5AA 4GI2A 3UMSA 4DDUA 1JNYA 3FVVA 1Z5OA 4RZ3A 3NANA 4MQBA 1S1MA 1BCSB 2R4UA 2X2FA 4JZYA 4QUIA 5FI1B 4LBVA 3C74A 2BRUA 4KXUA 1LW7A 1CF4A 3OIYA 2C42A 3DTVB 1RHRA 4DSNA 2K2WA 3ZGLA 1CUBA 2KJQA 3UT6A 1VL6A 4EJ0A 1PP4A 3PEEA 3JQQA 5KAPA 3LC2O 3PV0A 5ALUA 4OHKA 1IIRA 3A0UA 2WDPA 1SPBS 4GWGA 2NACA 2JS7A 4Q48A 1QRAA 2W98A 3BFJA 1VTKA 2W22A 3N74A 1KAGA 3BH7A 1Z82A 1YACA 1YQWA 1TYEB 5FKJA 2FF7A 4U9IS 3L8YA 1SNYA 2ZM6B 3FNHA 1XF1A 5A6SA 5GQSA 2Y9MB 4DAOA 2VF2A 4ZMBA 1QWSA 2X13A 4YK7A 3B5IA 4NFHA 1L4HA 4PYLA 4R31A 4WCFB 4D4JA 1B8PA 3GLTA 4DQDA 1OX6A 4ZODA 5GZ3A 3DEJA 3KVNA 4ND7A 2ZIXB 4H4EA 1BMQA 2HDNB 4NU6A 1YZGA 2PVPA 4XQCA 5I4KA 1W29A 1XROA 2FB9A 1QO0D 2WWVD 2FKAA 3R5SA 4H17A 3AL2A 1SULA 2GPNA 2W2PA 3PTLA 4DKXA 1RPTA 1SRQA 4ZDWA 3X1DA 4NK4A 1KBQA 1F2UA 4AK9A 3UJ8A 2HF8A 3LRPA 1SZJG 1RYEA 1QGOA 4EYOA 1L5MA 5DX0A 1QO0A 3CVWA 5ICFA 2O3SA 5KU7A 3AVUA 3G2NA 4GBGA 1LI7A 3ZU4A 5EXTA 2C8LA 1HFJA 1P4HA 2Q0QA 4OYHA 3UHPA 1GGHA 1MW9X 3ZXXA 4NECA 2P4HX 1U7PA 1WCXA 5AK5A 4EPWA 1EFHA 1CJTC 1WXGA 4C4AA 3X1XA 4XWGA 1AKYA 3EXFA 1H69A 4RA6A 4ITUA 1CUDA 1U0LA 2WAYA 2LBPA 3Q4GA 1KFEB 1J99A 2H48A 3WFJA 5B3AA 1ACJA 4IOLA 1RYYA 4ZAGA 5JBNA 3ABOB 2RI0A 3DHVA 1N57A 3EC7A 1JEYA 1JHZA 4HQNA 3S7TA 1GTRA 4V0MA 1GU1A 4QT4A 3KM0A 2QI9C 4HEA6 2JGNA 3CH4B 5LIPA 4JHXA 5FBZA 1ZP6A 1D0VA 1KQGA 2F1HA 3OSUA 2VHVA 4JLOA 4UE3S 3OLYA 2ZJBA 4Y2UA 2W00A 5K3CA 6REQB 1ZIDA 3A1TA 4EHIA 1B73A 1TVCA 4MV7A 2IU3A 4KK3A 3SY8A 4OHRA 2I2CA 3VR5H 3ZE0B 1HLPA 3NEPX 2PRIA 1FUEA 4H3HB 2Z9CA 4LHZA 2QNRA 4I50B 3VR6A 5AJWA 5D51S 4L5IA 1LNSA 4I5GA 2Q99A 3OU7A 1LTHR 2RB4A 1N5DA 2HHJA 2PGAA 1YZVA 4NJOA 4MV3A 2YV4A 2C8KA 3A11A 4OHVA 1JSLA 1IOLA 4P4SA 4XW2A 5D00A 4AJLA 1MFPA 3GRFA 1OV6A 3NOQA 1T1RA 2FXVA 4GP6A 3SYMA 4BFUA 1ILWA 1V43A 1EJBA 5K5EA 2NSHA 5ALIA 4OHZA 1G2QA 4ZC8A 4B4DA 3UAVA 3S8EA 2PZKA 4K6KA 2PUVA 1LEHA 3WWOA 2KW5A 1Z4MA 2QL9A 1EFRD 4BY9E 3N8DA 1P72A 3FXAA 4KJZA 2BP7A 4QECA 3P4UA 3IKMB 1FYDA 2HO5A 3OAAA 2AEEA 2WLTA 4L8VA 5CNKA 1GAEO 2G70A 3JTEA 1JJFA 3R3ZA 1EFRA 4R69A 1I6WA 3E03A 4ZJZA 1N5LA 1VMAA 2Z56A 4BVKA 3FDFA 1JN0A 1L5KA 2BJVA 3L4KA 1CNMA 1NVWQ 1C4XA 1VL8A 1CCWA 1QF9A 1U28C 2PSEA 2WB4A 3AYXB 3GL9A 3UJ6A 2UVPB 2A4MA 2HJHA 2Y76A 2YHIA 3QMPA 1Q1QA 4J90A 4L08A 2JFFA 4WMLA 2NN3C 3BREA 1N0WA 3NGMA 3TBFA 3BK7A 1RYFA 1XQ1A 4OXRA 3QOYA 5KWIA 1J56A 2B4TO 1XZFA 2IEZA 2PR7A 3AWDA 4GBED 3RTDA 4CFYA 1V2HE 1QS0B 3TEJA 1V45E 2CXOA 3R76A 1LQUA 1IJEA 3HU3A 3QVWA 3ZWOA 4B2LA 2RB5A 3CF4A 2FW6A 1T9CA 2L69A 2WINI 3FYUB 4G5SA 5TEVA 5MN6A 3RFUA 3AFGA 3O83A 3ILVA 4EA6A 2VZ9A 4YJ3F 2ONZA 4WAUA 5TQ2B 1XEWY 4YRDA 2XT0A 3E0QA 5HX7A 1MAHA 2PZBA 3L0OA 1NA5A 4AN1A 3PTAA 2FHSA 2HU7A 4JWKA 4LPKA 2GK3A 5JSFA 4GGMX 2W93A 1X39A 4JJKA 3RS0A 1P91A 3EZ9A 2H65A 4H0NA 4FNAA 4YCBA 1EMDA 2XYRA 2RAVA 3EBPA 4E5YA 1QQAA 2BMWA 1QFSA 5K8TA 1Z4JA 3I1IA 3WB0A 4CLRB 3Q7EA 3V2HA 1R4NA 1MORA 2EQBA 1PL6A 2GKSA 3FOBA 2JVKA 3AUAA 4QA9A 3J81k 4DR3B 4WY2A 2RGNA 1Q11A 3EVDA 1CVLA 1NGSA 3OZIA 4XQEA 4IIHA 3T7KA 4MQEB 3CO0S 3HCRA 4QREA 4AJOA 3M33A 5AUOB 1I7SB 1BRMA 3MTEA 3NYWA 2C2GA 3SC2A 2BEVB 2WTEA 1N6PA 4DQVA 3DBIA 1CVRA 2QJFA 4B7UA 4B74A 2EEPA 4FN5A 5KNDH 4QLOA 4AJEA 2CSXA 3EPHA 1BVUA 1KORA 1QAMA 2QT1A 3SDZA 1MTOA 5EWLA 1G9XA 4HUTA 1EG7A 2ZOSA 4DMCA 2CKMA 1H1LA 3N2KB 1N77A 1E61A 1WSDA 4Q6BA 1VPLA 4PNEA 1SU8A 1G19A 4L9RA 2PYDA 3MUNA 1ZGAA 4MV0A 4LX8A 3QU2A 3OMLA 1Y3CE 4WXMA 2JBWA 4IGEA 1CP2A 2BHSA 3N2EA 3OKPA 3A6PC 2ZRGA 3T3IA 2PVCA 5HR5A 1K1EA 4UPVA 3J7AC 1AGNA 2Q2QA 4I19A 4R05A 1E89A 3DBRA 3IC5A 2QE6A 4NZNA 5KC9A 1OLUB 3PIIA 3RBAA 3MB8A 5CYGA 2Q0HA 3ED5A 2C2OA 1KF0A 1SB8A 1YB2A 3IQHX 5C46F 3KS9A 2EBFX 3KZVA 5FBVB 1FIUA 4O2AB 1JDTA 1FRQA 2AKYA 4GDFA 1EDDA 4DMGA 2W42A 1F6WA 4YH1A 1A7KA 1FYEA 3F97A 5CCXA 1MC8A 4OV6B 4LRQA 1AS0A 2KYRA 4U5XA 2ZTHA 3FSRA 4HMPA 3UYKA 4RJKA 1NI3A 1CUHA 1E5VA 3VPDA 3FOEC 1ID8A 3EMBA 2BJHA 4OJTA 1WHSA 1X1EA 4B0PA 3ZVMA 1WP4A 2AOTA 3K9WA 1R5JA 1JWBB 4YJ3A 2PD6A 4BMVA 2GETA 2JGFA 3I58A 4DV2B 3WOHA 3N6RA 4LZZA 1J49A 2HRDA 1UOEA 1JKIA 4HSEA 2L2QA 3AFMA 4HYQA 1L7AA 1NG1A 1NMEA 4OM8A 2XV1A 2O8VA 4NQZA 2J6IA 1PLJA 4EYGA 3DTYA 3OE4A 4RMHA 1KQFA 1UBRS 5AI0A 1KJ9A 3FPEA 4XWKA 1EHIA 2E6KA 3SYKA 2PZFA 2A30A 2EIHA 3E1GA 3HKDB 5IULC 2RKOA 2ZUUA 4ISCA 4PVCA 4AJNA 5JWHA 1SAYA 3DYVA 2FNAA 1D8TA 5SYAA 4GZ6A 2Y1GA 4IRUB 1D0SA 3VOSA 4C7JA 3TXAA 3QPBA 3CLKA 5DK4A 3GPCA 3E84A 5I7AA 4PRZA 1VI5A 4ZAZA 2ODPA 3CEJA 1CY0A 1WDWB 2DYKA 3C3BA 3CSDA 1MA0A 1P4JA 3H84A 3LG2A 3PWKA 4MWOA 4R16A 5EVJA 1EGAA 3FPGA 3KDAA 3ZBQA 2O7RA 5KWVA 3K92A 5ARBA 4MUXA 3U37A 2V65A 4NOMA 4YRRA 3NAGA 1DT3A 1OFUA 1P0FA 1RXUA 1SUCA 2I71A 4MAAA 2IEAA 3UGTA 4C0KA 1QRSA 1E96A 4TL8A 2AZMA 2RK3A 2Y67A 1LJUA 2HLDD 1G3UA 2YN4A 3EIUA 4I1UA 4MKXA 4QELA 5ERGB 5M04A 5LD2B 3RANA 2VJPA 2IIVA 3L1JA 4MIEA 2IYQA 4JC8A 4QFCA 3WBBA 4QBIA 3AKEA 3HMQA 4F21A 2COEA 5B1EA 1AUVA 2QNBA 3DT9A 5FLXA 3E9YA 1JHYA 1GCIA 1VL5A 2HLDA 3LUPA 5D84A 5KX5F 4L51A 1NC1A 2JI7A 2NM0A 1SIUA 2GFQA 3U9LA 1ZOOA 2SECE 2WF5A 4YLEA 4FQ5A 5H4HA 3WGIA 2RGEA 2RHTA 1H2EA 4G8BA 3L6BA 2G7ZA 4I1VA 3EVFA 3IVGA 4B5KA 1Z6QA 4HH4A 4S35A 2B83A 1JIXA 3N05A 1Q12A 4O2BF 1KI9A 3JAKB 3DFZA 1CQJB 1XZBA 1SXJD 2QDXA 2C2XA 3DHNA 3I1YA 1C30A 1SA0B 1VCHA 2V8OA 3N86A 3QY9A 4UDOA 4CM4A 2GYYA 2ZRNA 4UZSA 1PV4A 2FETA 1BDHA 3BXPA 2WZQA 2NUPA 2CBZA 1E64A 4NCXA 3ROQA 3IVRA 1E9RA 4NYJQ 1YJAA 3CJRA 4OFBA 4P33A 4CMJA 5JYDA 1CFJA 3H4IA 4M55A 5DN9A 3OZGA 2NIPA 4RW0A 2GA9A 1NBEA 3K5HA 3DBHA 4V2IA 3FWNA 5F7XA 2Q8PA 3GJ5A 1JBEA 1IAVA 1ZSVA 4O63O 4RIEA 5DNAA 1NXOA 1TYBE 2UUOA 4FGZA 1FE8A 2Q5CA 4MK4A 1XOIA 3MJHA 3JVUA 5JDCA 5A05A 5MN4A 4UNQA 3O2NA 4Y6LA 1E3EA 2PS3A 5T4BA 4M38A 4D8UA 3GFTA 1ZRHA 1OLXA 1PSZA 1YFZA 1TTHA 4N40A 1C3LA 1WULS 4ND1A 4EFKA 4ND2A 3B6JA 3H05A 2G3YA 2JFOA 3NCTA 2GN0A 3TQCA 1GU7A 2YUIA 4M89A 5C5CA 3REOA 2C4KA 2CMFA 2PLNA 1RP7A 1PWHA 3MT0A 4K86A 3NIWA 3TNYA 1PR3A 2XPCA 2QP4A 2IKQA 3GUCA 1U5BA 1DTEA 3HDYA 4J29A 5LP6A 5GIPE 2BPOA 2CN1A 3DFUA 1JJVA 2FV8A 2BGUA 2EQ5A 2OE2A 4D9FA 4ZK2A 5K0JA 1QPGA 1G66A 2C20A 3A6ZA 1IE3A 1R6UA 2PGDA 2VP0A 2Y0PA 3F3MA 3I5AA 5JEEA 2O23A 2QLMA 2W83A 5KWJA 2H8GA 1JHXA 3ONFA 1UBKS 4RKYA 1M2WA 1RAIA 3PPXA 4X61A 4ZCPA 5JTUA 3WS7A 4UVIA 2QLLA 3LP5A 5ESWA 1UC9A 2DG2A 3ZNQA 3G85A 1XTVA 4P5PA 5HIJA 2CNLA 3NEJA 5FOVA 4CKEA 1S2DA 5ETJA 3F9CA 3O2SB 4WTOA 1HT0A 5LLDA 1VLJA 1XKTA 2GERA 4H3VA 3EODA 1GTG1 4HGNA 4JB2A 2YC2C 4DJAA 4OSOA 4U7PB 1UEJA 3F8SA 2O2EA 1CY7A 1OYYA 5FHRA 1JLSA 3WR5A 1E7YA 1JEQA 1D4AA 1X7DA 5DF1A 5TSDA 5I7SA 1LPOA 2WABA 2AFHB 2W6ID 4XTRA 4J2TA 5JMPA 1X1DA 2JI8A 4PG8A 1Q17A 5DNEA 4JB3A 1DCFA 1EYZA 3B6KA 1E1MA 3RRFA 3FDZB 3I3SR 2C57A 1YK1A 1E6KA 2VNHA 2FEKA 1JAHA 4O2BA 4HCJA 1R6BX 1QIMA 2I3BA 2ORVA 2MSNA 5L6MB 1DEHA 2HTEA 3RRJA 3STWA 2P75A 4GZ3A 3UK6A 1Q0HA 2B4AA 1C1XA 2VBFA 1MO3A 1CF2O 1P0IA 3AHHA 4LJ5A 4TXHA 2JBHA 5BN4B 6PFKA 4OYRA 4OD0A 2J5XA 2QWXA 2JGMA 5CDTA 1NVVR 1ZD8A 5EIOA 3RQIA 3L0SA 3FRHA 1XCBA 3DLPX 3PXBA 1BD4A 4OKNA 1VOTA 3HNPA 3IOBA 2J0UB 4L4SA 2PMWB 2ATVA 2C00A 5A5FA 2F1JA 2QP3A 4CEHB 1C1HA 1MU0A 5AICA 2WVGA 3CPSA 2JIZD 3PQFA 4LRUA 3DOEA 4MCHA 1O8BA 3A4NA 2CNWD 4E2YA 1WXDA 1Y48E 4Y9SA 5BSUA 1LI5A 2B78A 1JLHA 3KSDO 3PENA 1K4KA 1KGDA 4ZP1A 2ZR8A 5JRDS 3LQYA 2RJOA 3IHLA 1N2CB 3H5AA 3OA2A 4RV5A 2XB8A 1Q3HA 4G0XA 5DNWA 5CA0A 1HPLA 3DAHA 3FGZA 4BZQA 4CTMA 1RJEA 2EFYA 2ZJ1A 4D9CA 2Q4RA 4FGKA 4AXXA 2A7XA 4HDKA 1F0KA 1DEOA 1T4CA 2B1JA 1P0QA 2JLRA 1Z74A 2PRZA 2PZ8A 2Z04A 1DUVG 2OLKA 3VAYA 4OB6A 2D1TA 2HU8A 2JEZA 3LLCA 4I1IA 1Q1NA 1ECLA 2V7QD 3OIUA 4RVGA 4XQ0A 1CUWA 2FEMA 4MICA 3DDHA 3HHEA 3OPNA 2W70A 2WT8A 3CMCO 5F73A 2YZNA 3QVJA 4IXTA 5G0WA 1ND5A 4DIEA 5DWVA 1HT2E 3NTUA 2YWDA 1P9NA 1HY3A 4IG4A 1GTVA 2V7QA 2DTXA 4G01B 2XCUA 4C20A 3HWWA 3E7XA 4RU1A 1U8UA 2FFHA 3INYA 4KIUA 5KQSA 1QH0A 3FNQA 1J21A 1U81A 1ESCA 2OD2A 1MX1A 4RIHA 3LY7A 4UHFA 2XA2A 5C80A 3C3YA 4DRXA 1X8JA 1SD5A 1UM9A 2AR0A 3BFXA 1PNOA 3VTAA 1AV7A 4KR7A 2BF7A 1TCUA 3V4VB 1ADJA 5F3WB 2X14A 4CGZA 2AGVA 1IB6A 1CE8A 1T8RA 1VBMA 3GN1A 1ABEA 3L6RA 1PBTA 3QJGA 2CYAA 4K81B 5DHFA 3C1OA 1H1DA 2Z2JA 5IUNC 5A04A 3DP9A 3USCS 4PZ9A 4BJ3A 2SBTA 5CCDA 1S3IA 1H9AA 4NMXB 3IQZA 3QW4B 3NM4A 3MRTA 4ALNA 3KU4A 1QH8A 2X9GA 5DCYA 4POAA 2N75A 3IBCA 3HRHA 4OXIA 5FXMA 3VJLA 3GBSA 4GVPA 2YY5A 4ZVRA 1N0UA 2PXAA 4ASUA 3KZCA 2ZI4A 3L84A 5CM8B 1FUYB 3N39C 4Q9NA 3J81A 3G17A 2Q5QA 1IL0A 1STOA 2A9KA 2G82A 1FFGA 1ETUA 1N0IA 2R6HA 3AUXA 3CE9A 3RPEA 2BFEA 5HRAA 1SXHA 1JWLA 1D2RA 4X54A 2ZJ4A 1ST2A 2EZ4A 4B7XA 1G8JA 1KNXA 4O2LA 1IHOA 4WFIA 5AW8A 4J75A 1TT7A 4KQGA 3O82A 4ZIRA 3U1BA 1SCQA 1AO0A 4MVJA 1VRCA 3Q7RA 2R8YA 3HDGA 1I32A 1V1RA 2P7IA 2WIGA 1OFHA 1CIPA 3OQJA 3PHGA 3Q6MA 3QI7A 1R4AA 1X38A 4EW3A 4B2IA 2JCGA 1OZAA 3SIPA 5H3LA 1CZRA 2D0PB 2X23A 4BQQA 3GLQA 4TQUS 5L3RA 1YJCA 1Y1KE 5P21A 4B83A 3C45A 2HHHB 3GRRA 2E7ZA 4NBUA 5GJBA 1OTXA 4ZMSA 1ZC3A 4RPJA 3FMGA 1A9XB 3ND6A 4RMIA 4GX5A 1T2FA 2P1ZA 3UWMA 1HLFA 2VATA 5DP2A 5HRCA 4JJ6A 1NF8A 5DLDA 1IBLB 3B7PA 2B7LA 1GPLA 3I4CA 4UZEA 1EFDN 4KXQA 5D3MB 3E5RA 4C1NA 3SSAA 1WZCA 1DFHA 1ISHA 1TJ5A 1HFKA 5B12A 4PX3A 5DT9A 4BBPA 1AK1A 5JMTA 2HREA 3L06A 1AE1A 4EEZA 4CF7A 2EYQA 1U98A 3DUFB 2CDBA 3GWGA 5EP2A 3T52A 3U48A 1PJAA 1C1DB 4WV3A 3T34A 2X1HA 1TLLA 3GELA 3O1HB 4FDVA 3WRYA 4FHFA 1RR6A 2VTVA 1QCDA 4PYJA 3C3AA 3EDRA 1JPVA 4EG6A 4EPXA 4YRSA 2R44A 5CHYA 2H2AA 2Q2WA 4IIVA 1CX9B 5IXSA 2R9VA 3O4FA 2VRCD 2WOOA 3G0IA 3PDCA 3VR2D 3ZDXB 1EXVA 3WA6A 5ALGA 5CRIA 5AM1A 3NC4A 3P0FA 1IG3A 2NO9A 3H3FA 3WYEA 2FMIA 1E6UA 3QE9Y 3PKJA 2XBMA 4CF5A 3L8EA 3QTLA 4AM8A 4DDHA 4EGSA 3T3EA 3EASA 4MGIR 3F6EX 2ZWMA 4PC2A 1SUAA 3VR2A 1SCUA 5BSRA 3WL4A 2ZSIA 1ADYA 2YZKA 3M89A 4FI3F 4MWCA 821PA 3ONVA 4HDRB 1W1WA 3H2ZA 3BZBA 5MGBA 2RAFA 3GUZA 2IY9A 3I8OA 5IANA 2BFNA 5A06A 2GT1A 1PEKE 2OAEA 4DCPA 3LT1A 5DT2A 3DZDA 3IAM6 3KSMA 4RFSA 1UEIA 4BUZA 2QAJA 4CMKA 3PXEA 4X90A 5LU8A 1G8KA 2JD2A 3KQMA 1OAOA 4FT4A 1GRQA 5EKSA 3KJFA 1U0OC 3DD1A 3PHBE 1MAWA 3RRMA 4DFDA 4TMXA 4P7FA 2ZYIA 4BOYA 2QTHA 4C2UA 4LTDA 2Z3WA 2ZT7A 4JOQA 4RGQA 2DR2A 4QTZA 1E4YA 4PO1A 3AILA 2FY8A 2VEOA 2WFZA 1J0DA 3VR6H 5KO2A 1U02A 2XZOA 3EGDA 2JHGA 3GEIA 4PX9A 1BX1A 1HSOA 1PT6A 2OLJA 1U6IA 3DWGA 4ZVMA 4MI1A 4EY5A 2B8JA 2B5WA 2EFGA 4HDNB 2RHGB 3T5AA 2HIAA 4KDCA 1UPCA 5EPUA 2JGEA 4ONEA 5FEUA 3U26A 5KNCH 4N8DA 2VJOA 2UXCB 1KDRA 3AZPA 3AT1A 1P0PA 1TU0A 3G5AA 3NHUA 2ACEA 4DWVA 2DETA 1X9IA 1W30A 3NPAA 4BL5A 4E7OA 3B36A 5MFPA 3MD9A 3MT8A 2ZYUX 4XFDA 4ZOBA 4WZAB 2OHXA 4R68A 5JTTA 2O8BA 3FTDA 1FEZA 5AJTA 2VHWA 4CE6A 3A2NA 4XCVA 1QMPA 1UK6A 1W8DA 4DCCA 1ULSA 4CETA 4F11A 1SQ0A 2GN6A 5EJ8A 5L9AA 4M8SA 2WMDA 2WU1A 3CRZA 3JQRA 1FU4A 5LQMA 4YQYA 1XVUA 4R54A 4C2BA 3E48A 2WHRA 2DKFA 4P82A 5IJ0B 3V8NA 3MQ2A 1P1JA 1EFPA 1NONA 3R3UA 4XUEA 3JVIA 2GILA 5FBKA 3EXEB 1Z2OX 2MMGA 2WKWA 1Q1BA 4HDCA 2F64A 4MWBA 3TOVA 1HZZC 1KY3A 1PV1A 1CHNA 2AFHE 3PNOA 1WPRA 4V03A 3A1UA 2JD0A 4E5SA 3NR2A 1E3WB 4M22A 2VJBA 1WIWA 4JL8A 1M7HA 3EXHB 3K6SA 2E1PA 5BMOA 3PHJA 1RYHA 2BBSA 2JFVA 2XZPA 1TYAE 1O95C 3AHCA 4DLYA 3F71A 3QJYA 3WGTA 5DKFA 5F7OA 3UATA 1NUHA 1ZHFA 1NUAA 4RANA 1IEXA 1ILEA 1IXZA 3G5TA 3AEYA 5F64A 5K8UA 1DQYA 1DELA 1K5DA 1M8FA 3IMKA 1YR7A 2QRZA 4TYNA 3VH1A 3HQ4O 3KWJA 3CT6A 4KO2S 1GPWB 1WOMA 1KJWA 1UT8A 1XTTA 1Y3FE 1F60A 2JJQA 5LZ8A 3SICE 1DX4A 3O8LA 3ZDDA 3NO4A 2H06A 3FNRA 3NZEA 5BV0A 2VDUE 1IWPB 5HF6A 2IXEA 3ZGYA 1JKFA 3IQWA 2ZUCA 4ITVA 1EX6A 1GSAA 3BBPA 1YL7A 1QV7A 2GESA 4G0QA 1SZDA 1M34B 4WD3A 3SP1A 4D4LA 1X9HA 2PSDA 5JHHB 2Y0CA 1LPBB 1XX6A 1MOPA 2XMBA 3AFHA 1SH7A 1UEXC 4Y7DA 1N2CE 3UJDA 4JC5A 3BDIA 4R0MA 1V1MA 5FO1A 5BQ5A 6Q21A 4XIIA 4YRIA 3TEFA 3IQXA 3ZDRA 3FNBA 1V8PA 2C1EA 2DHQA 1E63A 5LM3A 4DBVO 2HA5A 2O5VA 2XIQA 5HSGA 1RRVA 2ZYDA 1DBIA 2HI0A 3ZTYA 2HDWA 2C7GA 2PZJA 3IBSA 3PBKA 2I6QA 3ONWA 1VLMA 4MGKR 5DGTA 4OCZA 2WIDA 3TSCA 4UFNA 4MHSA 5GZ1A 4E6EA 1ZCAA 5LBUA 5JAUA 4U2DA 1P4AA 2HMYB 1ODJA 1U1GA 3HN6A 1IPHA 3LO5A 4ENVA 4A6EA 4KRGA 3ZJTA 2YHUA 3UMCA 1A76A 3QVTA 1J5PA 3TLCA 1BFUA 3DDCA 2KS6A 4DIKA 2CT8A 1ZIYA 4JXXA 4DSTA 1D2EA 1Z8HA 3BXXA 3A1FA 3DTNA 2BGIA 1N0HA 4KN8A 2DPGA 3K0KA 4REQA 5KCMA 4UULA 3GRPA 4WEQA 1XMJA 5G0SA 3E18A 4CM7A 1Y7LA 4EIWA 4FSXA 2COUA 2Z9BA 4Q1FA 4LK3A 1PVVA 4CR7A 1E3MA 4NJMB 2J4CA 3BHJA 3ORQA 1SVSA 1BJTA 1QNFA 1T0HB 2ZJYA 4OLFA 4GI3A 3IMFA 5EYPB 3QX9A 4V02A 1YS7A 4EUNA 3H6KA 3UT5B 4RUKA 1UMCA 3GQBA 1U94A 4BNYA 1HRDA 4TT8A 4OHUA 3W4JA 1JBQA 5T57A 4EG8A 3IEMA 3BRWD 4UAGA 5A2GA 1V37A 4OMDA 4OQEA 5JCZA 2DPHA 2XLCA 4UDYX 3F0TA 5I9NA 3Q8MA 4AO8A 2A0XA 4KW7A 1GD1O 5CT4A 3LP6A 3VO2A 3WGOA 2C92A 4IUYA 3HBLA 1AF4A 3T61A 1NXXA 2OO3A 2NUTA 1M6YA 2XF8A 4IVQA 4G5GA 1GNLA 1V8FA 3LPAA 2CDNA 1H8EA 4HEJA 3SZ3A 2GJKA 3P0RA 4QQ8A 1NN3A 5EIWA 2J3EA 4MR8A 3TJRA 1RWXA 3RC9A 5B4VA 3FCCA 1LNQA 1QHYA 3H1GA 1QVVA 2FP4A 1W2HA 2IHZA 2LIVA 1IDN1 1LK7A 5BYKA 1XJ0A 3UPUA 1I6KA 1UFOA 1NR7A 2X8WA 3ER9A 1MZVA 3BE8A 4Q15A 1CNEA 2CFSA 5GV7A 6YASA 1GRCA 3EISA 1D6NA 3TIVA 1Z33A 1PSDA 2EP5A 1C9DB 3A6EA 1ZUWA 3KZOA 5FPKA 5HM8A 2PPLA 1H0RA 5LWQA 1JH9A 1RM4A 2ZUEA 2LKDA 3PR1A 5HMLA 3VHQA 2L17A 2XE8A 2GD2A 5EN4A 1XVIA 5IH7A 1MB0A 2NWQA 2FDCA 4RZUA 1ZR2A 4JMPA 1UKAA 2FWRA 3GLVA 3OTHA 1WD7A 2JVJA 3HUEA 3PPVA 2GZAA 3Q1LA 4QJIA 1CXZA 2OBLA 1NN1A 3CX3A 3ABQB 2XBUA 1Y1PA 3B53X 3LOPA 1LNZA 2CLLB 5AESA 1Z6AA 1VMKA 1SR8A 2QUHA 3M6MD 2GDJA 4FQ7A 1UMBA 5EGSA 3QWBA 3ZBPA 4B4WA 1OH8A 2VRNA 4MKHA 3R7SA 2H1LA 1IK6A 2MSEB 3HN7A 5CEEA 1Z8NA 5JT1A 3D4PA 4XPIA 1LB1B 3ETNA 2Q1TA 3OTIA 3N3AC 5EZ6B 4Y0VA 3M5CA 3LQ2A 3U3JA 3NT4A 3DZKA 3GLHB 3ND9A 4AFNA 1VIMA 1P5ZB 4LYHA 4S2EA 4M49A 1FVXA 1QO9A 1RKQA 5FP0A 3UWKA 2EKQA 2H2WA 2P5SA 3KV1A 4BBAA 1N7HA 2C5FA 3M8KA 1S6YA 3U7HB 3ESRA 3ZZUA 1FUIA 1WLSA 3N2GB 1KZ6A 3ILHA 4QUJA 3KK0A 3L18A 3VSBA 2MSCB 3FVTA 4GQBA 4L72A 1XU4A 4A2QA 2OXCA 3D8NA 2PU7A 1NM5A 1G55A 1ZNQO 3HPQA 1BW9B 3A4YA 3BD6A 3EVGA 3G1UA 4I46A 4RJJA 1HOXA 1P7WA 2ZQYA 4U2GA 4YLGA 2XVXA 2OCAA 5DH9A 2TECE 3VNSA 5C1IA 3AG6A 1J7JA 1YZ3A 5EGNA 4OLHA 2NUAA 1C9MA 2ZREA 1L5QA 1OZ0A 1F2DA 3NGLA 2XXBA 3IVAA 4QJ5A 3RFXA 2YWXA 1BKYA 2WA1A 2B8TA 4ERNA 3E5MA 4YCNA 1KKLA 1AHNA 4FEGA 2EX1A 2I3AA 5IT0A 1J0XO 4H18A 3I0ZA 1GCUA 3JR7A 2R2AA 2BYTA 1G21B 1NVVQ 1E6MA 4BFLA 3AI7A 3E9NA 4DR2B 3VRHA 3JASA 4HXEB 2P6RA 4Z53A 3UMFA 1H4QA 3EZGA 2BFFA 3O4VA 3QLUA 1JILA 4KQ9A 4BNWA 3KL4A 3ZZNA 4YXWD 1XB2A 2WRZA 3A9UA 4GX1A 4OI1A 5PNTA 3SAJA 1ZGHA 4BZXA 3EXAA 4FMCF 1I8TA 4GWKA 5A4JA 3N2YA 3ON5A 5IYZB 3BTVA 1DG1G 2PUEA 4MRMB 1E9CA 1RAFA 2OA0A 5DTEA 2QMZA 2ZUTA 1FFWA 4RVHA 3FF1A 4CEIA 1R64A 3ZH2A 1LSUA 3O7WA 5D6OA 3S99A 1SVKA 2W2KB 4LFCB 2OFWA 4TMWA 4RS3A 2JB9A 3KLBA 3L4JA 1XCLA 3QX7A 4HDOB 2Q6KA 1XA3A 4TV8A 5DNYB 2QTNA 3CFYA 2XQIA 4OIMA 5EKUA 2OBFA 4WZAE 1K7EB 1UF9A 2H2DA 2QOEA 4ZDJA 4QXMA 3A9SA 2PXXA 1HDYA 3N7TA 3L05A 4L85A 1Y9DA 3ADPA 1GYQA 4CUKA 1XN1A 4G37A 1XAGA 2GM3A 2H8KA 5EXPA 2R65A 1O94C 5I7OA 3QVXA 2AJBA 2JIRA 4RHUA 2CNDA 4LQDA 2VAWA 2PSSA 2XGJA 3K2QA 5TJHA 1T4DA 1L1QA 2ANCA 3QEMA 2PRJA 1PL7A 3C3JA 4NH0A 3AVYA 1XCGB 1SVLA 3CRRA 2BD0A 1SK9A 1RRMA 3NP9A 2ABWA 4I4NA 3WMWA 1EUQA 1KIAA 3OTGA 4XUGB 3CN9A 5EMJA 5U1PA 5FDFA 3ETJA 1GAQA 2VH1A 5TMBA 4A91A 4BDSA 3QG1A 2ZDHA 1CY8A 5C5EA 3JYHA 4D0LB 3EQ9A 1S7CA 2RGYA 2ODWA 5C2JB 2C0CA 2H9IA 3O1IC 4PHGA 4F3RA 8ATCA 3A31A 3VNUA 3KHKA 1KBZA 4PFSA 4A1OA 3MLBA 2XQVA 4ZT6A 3ZWXA 1QFYA 1K75A 2WAXA 2QL5A 4MROA 3JWHA 4H1WA 1ZIXA 1IBMB 2C9BA 2PFSA 3OQMA 1B74A 3U09A 3FFBA 4KE6A 1SBQA 2OAQ1 2ZULA 3D64A 3LGXA 4GLOA 1JALA 4RY9A 5KTKA 1LRJA 2FG6C 2J46A 4CXMA 2I6UA 5IDXA 3NHZA 4TVOA 4Q00A 4OQQA 3KQVA 3LLMA 4FYVA 3VYTB 1RXEA 1VB3A 2QRPA 3HLYA 4W6ZA 1OIXA 1C9YA 3SFZA 2HA2A 1VDMA 4N6NA 3I01M 1CRQA 3TCNA 3X1ZA 5BSHA 4AZ3B 1C9KA 2OZLA 3HUFA 5FTLA 5I5EA 3D0QA 3OQ1A 3SS7X 2C2HA 1VJ5A 1Y7TA 3WZLA 4UVEA 4OBWA 1M34E 5I7HA 1M2OB 4TPKA 2PUJA 4OLJA 4AJIA 3IAM1 4QPJC 3HU5A 3RT7A 1CDZA 3DP7A 4N01A 4DZTA 1XTJA 2IU4A 5F5LA 3HV0A 1TGYA 2C59A 3EEYA 2PV7A 3WLKX 4ZZIA 5JQWA 1YAJA 1X9GA 4TM8A 1W59A 2PSJA 3RYHA 1DL5A 2H1RA 2RARA 1VBKA 3JRWA 4R7ZA 1PJ8A 5H3CA 1UDWA 4ZCQA 2F3UA 4WXPA 4IEIA 4TM7A 4MDFA 3NHMA 4JI4B 2YJ6A 1NDUA 3WAJA 2JCVA 3EUEA 4BNXA 1NXWA 5A4FS 4IHQA 3DMFA 1GSOA 5H81A 2EP7A 4D9BA 1I30A 3AR4A 3H0EA 3WRXC 2WFAA 4BCDA 3OZXA 2PWAA 2JA1A 1YQGA 4IDBA 1E1LA 3LS2A 4PG5A 4RQUA 1M6WA 2C3PA 3OCVA 2GARA 3WGKA 5TDHA 4AUMA 1BWPA 4C5AA 3AB7A 4C7OB 2YHSA 3P26A 2AG8A 4D9NA 3L6CA 3HK2A 4ZK6A 3BTOA 2ODBA 16PKA 2OCPA 5E1OA 1PGOA 2YVAA 3AVQA 1T5BA 4NESA 3T7AA 4YYEA 2AQKA 1HOTA 1VCMA 1TMOA 4RV4A 4YBRA 2BJWA 2UYYA 4ETIA 1KMHA 1US8A 3K4QA 5CDHA 2KLHA 1DUSA 2V7TA 1V9LA 3HCNA 3QVUA 4GOXA 5AHWA 5J5CA 5JASA 3GD7A 2BDUA 1U0HC 3LCRA 4JSYA 2IY8A 4WLEA 4HZUA 4ZO7A 5DP1A 3ERCA 4HGYA 3ADCA 2OTCA 3LXMA 2I76A 1B0UA 5E2IA 1YVDA 1X80B 2FFAA 1KP2A 5HG0A 3IPCA 1DBPA 1A69A 2FN8A 1ZUNB 1JDBC 2J3KA 1IZZA 4LG1A 2XRFA 3T5MA 1QCCA 4CIAA 5AKZA 4QOJA 2CV0A 2GHQA 3J7TA 4KMRA 4E6PA 4JQCA 3UWOA 3MNFA 1AQLA 4PXAA 4BP3A 1QG6A 4MVJH 5IPFA 4AJ9A 3RTEA 6ADHA 1K7CA 1LDNA 5FWXA 4RVCA 4RTJA 3OFVA 5A6VA 3JRNA 1ZHOA 1YBHA 3R3HA 2P8JA 3OJOA 4XDYA 1KERA 4PIMA 5SY9A 1SWWA 5DX8A 3FHJA 1O5TA 3ANTA 2OG2A 1E2EA 1YR8A 2CCJA 3H7IA 3WC4A 4NL4H 1IZ7A 4CQJA 3MXTA 9LDBA 5HVNA 4I66A 2V3CC 4YP5A 1VG0B 3PF9A 3U7JA 3VPBA 3UQZA 1I0ZA 1M33A 3QFCA 1YKGA 1KDVA 3S27A 3WG9A 1ULTA 2R6R1 1HDOA 2H6EA 3BXHA 2I87A 2OOKA 3OX1A 1JE1A 3RT9A 4D8TA 3UK0A 4AZWA 1Z0FA 1RLTA 4M7RA 1NVUQ 1XPJA 1YTLA 4BGUA 1OWMA 4N7BA 4O4HB 1JQEA 2BDTA 4QL3A 1NMZA 1VGVA 4C01A 2QQFA 4X20B 3BSFA 3I83A 1F1JA 3TKYA 2ZYRA 2NTYC 3L1KA 1DAHA 2QD4A 5FUQA 1K4YA 3G59A 2VHTA 4C6TA 2Q41A 2ZVJA 4KJXA 4N3AA 5CPBA 3MWDA 3U31A 2A2ZA 3SCZA 4FSDA 3ZY5A 3UWPA 4CM3A 3MCAA 4KFCA 4GMHA 1JECA 2KI5A 2IZ6A 3AUKA 3KQHA 5JJIA 1X7ZA 1RZ3A 1PNVA 3MMNA 4KMOA 5CU7A 3W2GA 5B3LA 3LTNC 1PBNA 3U3DA 2BSAA 2CDRA 5IBPA 2XTJA 2ARKA 3WI7A 4JLSA 3OOHA 2GWRA 1FSSA 3PGXA 2PQ0A 4RZ2A 1XBTA 3VZDA 2O2YA 5IX8A 1CQZA 2WG2A 1EHYA 3PGMA 5EJAA 3UT0A 5I51A 3CINA 3NH9A 2DWUA 3EVBA 4BV9A 1ES9A 3IULA 5IG2A 3Q2KA 4IX9A 3GLHE 3BJEA 4GX0A 4EPVA 1KR5A 3PP8A 3QVSA 3SR3A 4TT3D 5CLJA 1O8CA 3M2TA 3W9BA 1PYOA 4ZKDA 4OLAA 1GZUA 1X87A 3PITA 5GY7A 1G63A 1BQ3A 1M5TA 5EWLB 2R25B 4B4OA 5FL7A 1U7DA 2HZ7A 4FI3C 2IDZA 3EVNA 3EWNA 1W4BA 2EWMA 1V4VA 3I9OA 4TT3A 4XD2A 5CX4A 5FI0B 2KMLA 3EGXB 2IQIA 3WOVA 4BVEA 1UDBA 2EAUA 1GILA 4UMEA 2RMKA 5FFFA 5E4JA 5A0VA 4PIPA 2YFKA 1L4EA 1MB9A 5DCLA 1O1YA 1AHPA 3ZE1B 2R0QC 1A50B 1YQXA 2VHUA 5KSZA 3H0CA 1H5UA 1CEYA 3I92A 1XYYA 4U0JA 3AF6A 3M2PA 2PUGA 2ZZNA 2FPIB 1IUPA 1K8YB 3LDAA 1KJJA 1Y3BE 2H9YA 4EG4A 4I2VA 2VT6A 2ZRJA 4DR6B 3AW8A 3GCWA 3RVMA 8ADHA 4EHBA 4TYPA 3D81A 3VKHA 3H2JA 1J7KA 2XCSB 1RLMA 1JT2A 2PX2A 3JZAA 2NT3A 2BGNA 4L6IA 3NJ8A 2WYOA 3UBMA 1QZZA 4ZJPA 4ENQA 3DLHA 1AK9A 1G21E 2QUIA 5IVPA 1VG9B 1P3Y1 1J8VA 1YE8A 1NAIA 4LNUA 5GONA 4CIYA 1Q84A 4CKCB 1MJFA 1CWUA 2ATEA 3L8CA 2ODQA 3ECCA 3UGKA 3U17A 3GIWA 2GJSA 5JQGB 3X1JA 1EDZA 1P7ZA 1YVRA 1T3GA 1LLFA 2ZTMA 1KMQA 1WHSB 4NYIR 5K0SA 4WJLA 4CR6A 2V5AA 1LU9A 2G7MC 2I6SA 2ZRLA 4QUGA 5I7FA 2V1XA 2H17A 3HC7A 5CLLA 2FN7A 3TXYA 1Q7GA 5HS6A 3FTPA 4BZPA 5IVHA 3EIHA 5JXWA 3H1EA 2XZDA 1CUCA 5AW4A 3GARA 1RJFA 3KEOA 3EX7C 3UYLA 1GZHB 2D1RA 3BHMA 3T99A 1CS0B 2C84A 4V24A 3IOMA 4YAUA 4FMDF 2YV3A 2P3LA 5BW6B 3CLUC 2RGUA 1UWKA 2JANA 1Q91A 4G9EA 4NBVA 4PHTA 3F4BA 3AR2A 3IDFA 4PLHA 2O2SA 1U8AA 1Q74A 1HDIA 3CEPB 3TLGB 2YFHA 3ECSA 1T15A 4I81A 3DONA 3EZLA 2P9GA 2P6OA 1F2VA 2I99A 2J08A 1IM2A 1P9WA 1W7AA 2B37A 3SOPA 4QGBA 3PC3A 1NOJA 4PPNA 1NUPA 1ULUA 5TVGA 3TUJC 4ZV4A 5LL6P 5BNZA 2Y4OA 4H3SA 2FLVA 3SKVA 1FTQA 3MLEA 5K3BA 1LTKA 3RGGA 3RNLA 3ZBUA 1ZA1A 3M9WA 3IESA 4XQGA 1V96A 5L7WA 2CMDA 3ROEA 1ML3A 3B51X 3U49A 3DUWA 4EGAA 1E69A 5JSHA 1JFFA 3DE4X 2CVPA 3QPUA 2KB0A 3UICA 3ZY6A 2C4VA 2RC6A 4G9GA 2P2SA 5CXUA 4RZHA 2H2HA 3ZK8A 3UC5A 1ZCBA 2OV4A 1SD1A 5FORA 5EWMA 3HABA 4LOAA 3FLEA 3GW8A 4HDMB 2PWYA 3MSXA 4RETA 4JC4A 1FC0A 3QI2A 4OQXA 5LA6A 2C1ZA 3UWSA 4B6OA 4DDTA 4BQPA 3EA4A 2P78A 4OF4A 5KYVA 5BMVB 1H5NA 4GXNA 1HT3A 3VJMA 3QV1A 2Y71A 4A8HA 2PJRA 1VMIA 2ZGVA 4RK5A 4LMPA 1LBQA 3W5CA 3EGIA 4XLTA 4G81A 4BNUA 1C30B 2E87A 3A7DA 2R6JA 1E98A 1HLDA 4XEUA 1PLLA 2GF2A 5K3FA 1DINA 5LOVF 1RVDA 4OHOA 4C2TA 1XZPA 2NUPB 3DLAA 3HYSA 5C1PA 1YT5A 3T15A 3D7NA 3C7KA 4K7JA 1CTQA 3LVQE 2PS1A 3WNDA 1SXJB 3S2IA 13PKA 1TA0A 2HGSA 2PKQO 1ECFA 4G4SO 4RMGA 1E0DA 5CLFA 1Y6RA 4M88A 4A6DA 3R75A 4A82A 5KYWA 3UHAA 3KQLA 3T41A 3EF1A 4RF4A 1G5RA 1GVNB 2F1RA 2IUEA 1H2XA 3W90A 1X70A 1FBNA 3HFSA 2CLKB 3ZU6A 5I8WA 1QVWA 5AVUA 1E0AA 2W6JD 4FCTA 3FOWA 3FWPA 2FPRA 3KB8A 5E8JA 1NI4A 4A73A 4TUYB 4AC9A 4OHBA 1SKYB 1JSRA 3HY4A 5AI8A 2ZJ2A 4CF4A 2XNKA 4V0ME 2JI9A 3E7PA 1XWIA 3NUZA 4GPAA 4ZYWA 4EO9A 3Q8LA 2HRBA 4LF9B 1VL1A 1QFJA 1RTKA 4O5AA 4WACA 5GZ6A 2HH9A 4PSDA 2HLHA 2XCQA 4DSOA 3LIIA 3UF0A 4K88A 1NIPA 2UVQA 4XYEA 3SZGA 4ECEA 1UKEA 4F9FA 4YV1A 1H1TA 2AZDA 4H31A 4HWGA 3MGCA 1G8MA 3BXFA 5EIFA 1YAHA 5AXBA 5ADUS 4XIFA 4YGYA 2OGUA 3RVNA 3S2ZA 1GY8A 2GAFA 4U6NA 2X3UA 1MMFB 3TNDA 1DXYA 5JXIA 2CXUA 2O3RA 5FR1A 2QVYX 3R7AA 3DFIA 1VPTA 4DT1A 5ADVA 5TMPA 2B69A 4EL5A 3KUXA 3MFQA 1ESEA 1UXIA 4B6FA 1XK7A 1Y8RB 1JPNA 1T24A 3P20A 5DIFA 1YZNA 4NNOA 4LZNA 2R8ZA 1T8SA 3IUSA 4ND6A 3LD9A 3OFSA 2NV6A 3BWEA 1YDMA 1V25A 1RKVA 4EHKA 2IL1A 2PYZA 3AO0B 4LVUA 4RPKA 3DBLA 3V48A 3VC7A 1LBHA 2F3RA 2VP2A 4OQZA 2BTQB 3TGWA 3FTEA 1V4BA 1J2UA 3EEOA 4MKIA 4DV6B 1Y8AA 1Z4QA 1VHDA 3MTDA 4P3XA 4RX1A 3I9V6 1ZUD1 1G6OA 1VJDA 2VPQA 2ZRFA 5CIYA 2Q27A 2WR8A 1QK5A 2ON6A 4P3KA 1U9JA 4MUFA 1ZS9A 4G8CA 3TQRA 3W0LB 1K7YA 2D8AA 2LR0A 2VUUA 3AETB 4J3JA 2H00A 5AOVA 1Z4OA 4G5QA 5FB3A 2WJ3A 3KYDB 1MQSA 1GTSA 1Y5LA 2HSEA 1UBHS 1WMSA 1MVNA 3BJZA 4JBYA 4YCCA 5LOVA 2JJ8A 1V6CA 2VJDA 2EFCB 3GFGA 1T8WA 4Q3EA 2ZVDA 4Y2YA 1Q1GA 5KVQA 1QHGA 3W8NA 4DW8A 2GO1A 1S1CA 2XMCA 4H2DA 1FFDA 2ZIZA 4MDHA 4R0VA 5CDGA 3CGGA 7MDHA 4N82A 1G7CA 3GLFB 4XJSA 3N70A 3HR8A 3GVPA 3UUGA 4ARUA 3LMKA 4QM6A 4OQMA 2W2VA 1SBCA 4FFBA 5IYZA 2CL6X 5JD4A 4I9UA 3TFQA 4TMFA 1YJBA 1F5NA 1AB6A 1KFCB 4C30A 1DBWA 1E1QD 1YR2A 3TKAA 3IOCA 4CKZA 1SBNE 3KBBA 4XDZA 3A6JA 2FG7C 2WYUA 1W5BA 2GD6A 3ODGA 3A06A 2YXLA 1QH9A 3UOWA 4EGJA 2BCGY 1F3OA 2V6FA 4Q1CA 4ZQCB 1UM8A 3TVTA 5CA0B 2ZIGA 5CMLA 1E1QA 4JBHA 3VQTA 3MS4A 4UCQA 4EA7A 4OBEA 4NZ9A 1WQ3A 1TEZA 2O8EB 2C5AA 3KFXA 2VLIA 4KXWA 4AX4A 1VE9A 1I1OA 2QV7A 3RUDA 3O8DA 5ES3A 3WMRA 4W9NA 4JYCA 2QF7A 3D7MA 3OWXA 2HU2A 1QOQB 3ECAA 1EGQA 1YI8A 5BSMA 3FGNA 4WT7A 1MXFA 4EMTA 2VDMB 1G5PA 3BMCB 2QVXX 4N0DA 2V6JA 4ZAYA 1J1UA 2OHVA 3GRCA 3HSKA 4GAEA 2R47A 4A7PA 3AI2A 3H19A 2YJZA 4LY3A 4UTOA 4CDNA 1OBVA 1FFHA 5ARDA 3DZGA 3C4JA 1XGKA 4YASA 3TNLA 1B26A 4DVGA 5BW8A 1PZFA 3S40A 3QY0A 3JWPA 3BK1A 4DRXB 3VR4A 1QH1A 2HPAA 4ZI7F 2VLBA 1A5BB 3VC2A 8AT1A 3OCXA 2VRWA 5A0FA 1H65A 1XDUA 1BS1A 3HL4A 1CE8B 1JIKA 4MLZA 2VP6A 5DTRA 5SY6A 1YR3A 3T0FA 4UBNA 3NALA 4JV5B 1EESA 2I3DA 2CB9A 3WJ1A 2WW8A 4OUDB 5DGXA 1N9ZA 2WAMA 4RCZA 2QVBA 4UHEA 3QRWA 3B1KA 4Q9LA 3ZIAD 4Y1RB 1HH4A 3G23A 5CB0A 3PUJA 1M6HA 4FE7A 4M46A 4OHXA 3FRJA 1Q3KA 3K09A 2QAGA 4JOCA 1XALA 1NZFA 4JQYA 3G3EA 1SJ9A 3NI2A 4DA6A 3IB3A 5KTMA 2O48X 5DSXA 4RESA 3RI3A 1SELA 1SIBE 2JFBA 3BIWA 3I2YX 2GJ8A 4JITA 5TF0A 5B5SA 3DPIA 3A37A 2M1XA 2WV9A 3U60B 5IT9A 3AVXA 2FPPB 5CX1A 3A26A 3J80A 4LY6A 1A9QA 2FMHA 1ZCFA 3GWZA 3KELA 1NVGA 3ANXA 4RD6A 2WTMA 2FWBA 5AQEA 4KIFA 2BFEB 2R1VB 5LBTA 2Q9CA 1HZJA 4WFJA 4HY3A 2QRGA 4TZTA 3HA5A 4ENUA 4MV4A 4F56A 2PDAA 1DKOA 4MQMA 1L1FA 3OOEA 3OOSA 2ONYA 2AIRA 4QYIA 4HF7A 3W7BA 3QEAZ 3S2GA 1YMVA 4YP6A 3QBEA 3DAYA 4R5HA 4ZFNA 4QBFA 3V1YA 1FNMA 1KK0A 2HJSA 3TPCA 1DEKA 2JL1A 2AR9A 2BKEA 1P77A 2GZRA 4X1YB 5CH5A 1T3LA 1WCIB 1Y33E 2GQ0A 4R2IA 5C5IA 4BE4A 4CKWA 3U7FB 2F8MA 1SHZA 1JA9A 3H8VA 1JG7A 4FHGA 4FYWA 4GUAA 4NMMA 3D8BA 4QPPA 4AS3A 2EFDB 5JJ5A 3IURA 3OCYA 3FLBA 3GR6A 1FLDA 5BXQC 1BDBA 1YRHA 3OLQA 4ZVVA 1KQ3A 1FYXA 1YS9A 3B6MA 1GNQA 4Y2HA 5E6SB 3TWOA 3LO8A 3LWDA 3QUTA 4LYEA 3V1UA 1KVRA 5ADHA 4JGGA 3AI1A 4KQMA 4MUKA 4KAAA 1Z73A 1GHTA 1P19A 2BEUA 4WUVA 4JEUA 3V7FA 3C5VA 6ABPA 4MUIA 5HFJA 3TM4A 3L92A 2YCLA 2QZ9A 3B70A 5LYJB 3FFXA 3FG9A 4UAVA 3RSCA 1N6RA 4LF7B 3ZI4A 1U2SA 1W0JD 1O95D 4P92A 4W7SA 3ABZA 3DEIA 3FTQA 1CERA 1SU7A 3IR6A 1R37A 2PT7A 1D2NA 3HG7A 4R9NA 3SU8A 2G67A 3T7TA 4AMGA 1M83A 1NBIA 1NSTA 3GNTA 1XZMA 2V4UA 4IGFA 4IWYA 4R8RA 2CVHA 2OQVA 1R50A 4X84A 3VBCA 1Q5PA 1W0JA 3EOAI 2W8BA 1AZWA 3R5KA 2PA3A 1MPXA 1WSAA 2EJTA 3HVKA 4OHPA 3WGZA 1OCEA 4I4TA 3S68A 2Q6LA 1PK8A 2WJZB 3EGEA 2WTXA 2CJPA 4HQ6A 4AIIA 1D4OA 4PNHA 5B58T 2ZS8A 2HA0A 5EE3A 3OZEA 1U8YA 1LX6A 1KMIY 2G4CA 2QL6A 5JLAA 3BKXA 5TRTA 1ABBA 2RI1A 2E4AA 3A4TA 2WDZA 1RXVA 5EE9A 5E2AA 3CUSA 5IMBA 3ZXUB 4EMUA 3ACBA 2F4VB 2JBAA 2OV3A 2P9EA 1O6CA 3D0OA 3LKZA 4S1VA 1SUSA 1G6Q1 2IODA 2GHTA 1L4GA 5EJGA 3VU9A 1PI3A 2QGNA 1JKJA 1ZU4A 3DCJA 4LW8A 5B1HA 4DMRA 2LCFA 1I4TD 4G9BA 3CZ9A 4HQRA 3T1VA 4Z4HA 5MN5A 4RYLA 1F0PA 1KI4A 2WIBA 1SXJE 2EU8A 2QW8A 4YPFA 4EFDA 5IKMA 3P96A 4KOEC 2PGNA 4RTRA 1VA4A 3SC6A 2EW1A 4BFXA 4MB2A 2X1LA 3KOMA 4NPHA 5AJHA 1YSCA 1UWVA 1J0CA 2ZJ8A 4MW2A 4B35A 4EVIA 4M1MA 5CB6A 2G5CA 1P7PA 1XZEA 4FU0A 4P22A 4YJHA 1K68A 2OAP1 4XJXA 1P5RA 5AXDA 2UUAB 4A10A 1SKYE 3OM9A 3BORA 3HEBA 1J1IA 3EGDB 3WTCA 1ZR4A 2XMZA 1CIVA 4DEVA 2HSZA 2FMFA 3O5AA 2V7GA 1P7CA 4RLFA 1DSSG 4TTJA 3P2IA 5FPHA 1CD5A 1IC6A 3OZCA 3VMMA 3K35A 2JFZA 3F98A 3I0MA 3FIJA 3LP8A 2CLIB 2WF9A 2GPJA 3PQCA 2XOKD 4CG0A 2DPMA 4Q7EA 4UJ5A 4UEOA 1RJGA 3I42A 3G79A 3IOYA 3VHXB 2GKOA 5CJ2A 1YFLA 3WNVA 4RXMA 2E82A 2ERCA 1QGZA 2O1SA 2BL4A 2W2OA 3PQ8A 2Q3JA 3HR7A 2A0UA 3B3JA 2XOKA 2ODTX 2OZVA 4MGHA 1GGJA 1CZNA 4UREA 3GRKA 4V0RA 4CM8B 2FEOA 1R8XA 3E1SA 1P1IA 5F4BA 3PQ6A 4UJ3A 3UXHA 3R9XB 4UU1A 3LQKA 2H63A 3CEMA 4B79A 2OORA 3BJRA 3JVDA 1UPAA 1FQWA 1L5FA 4V3BA 1JHAA 1XDDA 4TWJA 3WXBA 1U9IC 2WUGA 4MS4A 4JR0A 3IL2A 4UBJA 1SC9A 2P30A 5BUSA 3K8QA 1X14A 4HWPA 4D8VA 3ISTA 3FZQA 4WN9A 4U63A 5JQGF 2P5YA 4TX1A 1AMNA 4Z2YA 3ROMA 2IGBA 2V5VA 2PMEA 1ENPA 2NXCA 2YW2A 3MWYW 3QHPA 3R9KA 1L5ZA 4AKEA 4LJ9A 1HQCA 3CLRD 3D7RA 2G5PA 4GBJA 1IK4A 1FTNA 3TS1A 3DKRA 3THYA 5EIBC 3HU1A 1P1BA 3KZXA 1HL7A 4FINA 4JY7A 4KIGA 4YONB 5JAQA 4ESOA 5IMSA 1UJMA 4QUEA 1ZMBA 2J3JA 2MSDB 2C9CA 3OT4A 3OZDA 3QQPA 1MIOA 3OESA 3S1AA 3UXYA 2IE0A 1UKCA 5ALJA 4CV2A 5CG2A 2K5UA 4COKA 1SVOA 4MMXB 2YYAA 1WCWA 4CIWA 2Q7DA 1Q0QA 4QUDA 3K16A 3KZKA 4LYFA 2Q7OE 4U7HA 4ZDIA 5HOEA 4X85A 4YMHA 1ZJ4A 1LLCA 2CJYA 1ZOSA 3G2OA 3ZYCA 4EDFA 3GLFE 1CDOA 4G23A 4JBLA 3V4LA 2FPUA 3TQIA 1P75A 3EQZA 2C8VA 3L5OA 4KRFA 2GNPA 3PHIA 3TL3A 4BNFA 2OV1A 3KEFA 3F7NA 3KJQA 4GGPA 3L0PA 3SX4A 3A3KA 3RG8A 2EZUA 1J8DA 3C5WP 1GQ2A 1RBMA 1KZ9A 2AVNA 3C15C 4EM6A 1NDHA 1W0KA 2UDPA 2P2NA 4I55A 2GN2A 1W6RA 3ER8A 3UOGA 5EXXA 2NYUA 2QS9A 1KYQA 2YZGA 3QEOA 2NQ8A 3GCXA 1BEUB 4OK5A 7MHTA 2GR9A 1FS5A 5K0ZA 1J6UA 1NFRA 2AS0A 4JP8A 5CBPB 5TPWA 1LV8A 2C5GA 2OBNA 4UU8A 2W0MA 1SN7A 1Z9BA 2PNJA 4PZEA 1YRQA 5DHAA 3ICQB 4MUNA 2LIPA 4E0BA 5GWXA 1K92A 4FX5A 2RDMA 3Q7IA 1ZRNA 1AZLA 1EA7A 3FNFA 4MA0A 4HYYA 4PYRA 3ZW8A 1Z18A 2X8JA 1Z0DA 3KZMA 1QM5A 1KDZA 4MDEA 5LCXA 3LZCA 3PYMA 4LZWA 3ANLA 1CRLA 1WHTB 5FOWA 3DXFA 1DEAA 4Q3OA 3KVOA 2WF7A 2W6NA 3KT6A 4CMHA 5HKAA 3GA0A 2Y1DA 4MYSA 2XOXA 3V2UA 5FRDA 4QTXA 3TQSA 2Q5EA 1IUOA 4REQB 5JCJA 1R18A 4CFSA 2GF9A 4TL9A 4ZAFA 5CURA 5DASA 4BZWA 4MPDA 4G5FA 4Q3NA 4AUKA 3E2IA 3WKBA 1JS1X 1NBHA 5JC8A 5JO0A 3LTEA 3NQ41 4XFJA 4BVJA 1U1IA 4CU2A 5JY1A 1LV7A 3DE1X 2A1IA 3LIPA 1XD2A 3DAOA 4ID9A 4Q4DA 5E95A 2IRWA 4N9QA 2XCOA 3ZQUA 1CQIB 1IAQA 2QM8A 3D3WB 3VOTA 3MCUA 1N2IA 4OAPA 4DHWA 2BLLA 1QLWA 2O0MA 2WHPA 2ZRPA 3HGMA 5HGXA 1MJHA 3VKGA 2W2NA 1I1NA 4NFSA 3EWAA 4BMOB 2YY7A 3OJCA 4PX5A 2JJ1D 4EKEA 3ZDEA 1RRGA 3BAFA 5DX1A 5J2TB 3M1AA 4JP1A 3E9DA 4MWZA 5IJ9B 1EU1A 1QGED 1ETHA 2Q07A 2VRBA 3GNLA 3NBXX 1IRXA 3G0DA 2QR5A 3K72B 5TQJA 4LVCA 2IUUA 4B1FA 4DA8A 4QKQA 2JJ1A 3BA6A 1SO8A 4H27A 2FP4B 5AOCA 5D5QA 4GOMD 1PDVA 1M2JA 1QHSA 1T1IA 2RH9B 1EM8B 3MW8A 2VC2B 4YVFA 3SZRA 1RQXA 5MDHA 5ED0A 1ZOLA 5IABA 4G36A 1AQIA 2FZ4A 4QUBA 2X8AA 1L1EA 5KYXA 3AHGA 1UZAA 5A9SB 2VJMA 3GMDA 4YUVA 4K40A 1AU9A 4PGHA 4J0IA 5AKEA 5FUYA 3A4VA 3HACA 3H5OA 1IBRA 5DYYA 1TK9A 2XUJA 1O94D 2Y1WA 3PFNA 3PEYA 3GUYA 2QZ4A 4QASA 1Z12A 2DR3A 3BD8A 1KL7A 1MOQA 3OM0A 4IIYA 4ZU1X 3NXSA 3ZKWA 4B87A 2CK3A 4PGMA 4YPOA 5AUPB 4BNHA 3AOGA 2DQSA 1JW9B 2FCRA 1W0CA 3ND7A 1Z4IA 4G56A 5ABPA 3HP7A 1QIIA 3NVAA 4UZFA 3CUUA 2AQ8A 3QJ5A 4EHAA 4EITA 4L5BA 1W9MA 4BLQA 4NDZA 1AJEA 1S9DA 2W6QA 1L5HA 4IYRA 1L7QA 1WXIA 4KQ2A 4UEJA 4L74A 2CMHA 1JDPA 2BTEA 3ASUA 1DMRA 1QBKC 4BC1A 5AJYA 2K87A 4H1HA 2PEYA 2FQ1A 1L1RA 4BV8A 1RT9A 4ZOEA 3G0OA 4ZALA 3IP9A 4IUDS 1SUFA 2EJBA 3I9JA 1XUOA 2PO7A 2Y8EA 5HKOA 2ZWPA 5F2NA 5J5AA 4MJ7A 1CG6A 1JG1A 3DDUA 2IBTA 2PUCA 3BYZA 2GHIA 5JFOA 2ZYHA 5DMXA 3K96A 1GQSA 2EZ9A 2OGWA 1E5XA 5C52B 1R0RE 1BKSB 1R27A 4P81A 1RYMA 4MYRA 4PO9A 4YT8A 3V32A 2GSWA 4LV8B 1J23A 4HB4A 4KQ6A 2R85A 1T26A 4LK2A 3RLFA 3HB0A 2AOUB 1EUDA 1J0BA 1TKRA 3DHEA 3MAJA 3UKDA 1SXQA 5DBHX 5DYWA 4LJ6A 3M6WA 2CJWA <