3FFUA

Structure of the rna pyrophosphohydrolase bdrpph in complex with gtp and magnesium
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
133
structure length
133
Chain Sequence
GHWIPVVAGFLRKDGKILVGQRPENNSLAGQWEFPGGKIENGETPEEALARELNEELGIEAEVGELKLACTHSYGDVGILILFYEILYWKGEPRAKHHMMLEWIHPEELKHRNIPEANRKILHKIYKALGLEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable pyrophosphohydrolase
publication title Structure and Biological Function of the RNA Pyrophosphohydrolase BdRppH from Bdellovibrio bacteriovorus.
pubmed doi rcsb
source organism Bdellovibrio bacteriovorus
molecule tags Hydrolase
total genus 30
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature ec 3.6.1.-:
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14815 NUDIX_4 NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3ffuA00
3HHJA 2B06A 3DKUA 2RRKA 1X51A 3A6VA 5ISYA 5GHNA 1PUNA 5DD4A 1MP2A 4KYXA 1JRKA 1G0SA 2DUKA 3SMDA 3X0NA 1PPVA 1VIQA 5ANSA 3X0OA 1MK1A 3HYQA 4N1TA 4S2VA 1V8LA 2ICJA 3ID9A 5FSOA 1RRQA 1VHGA 1TUMA 3O69A 4N1UA 1VHZA 2VNQA 1QVJA 1V8WA 3OGAA 3I7VA 4ILQA 2W4EA 1HX3A 1Q54A 3EF5A 2DHOA 1V8UA 4NFWA 1KHZA 3N77A 3N9UA 4V14A 3X0QA 5IW5A 1SJYA 3GG6A 5ANUA 2R5WA 5LPGA 1VCDA 1V8SA 3A6TA 1NFSA 2QJTA 3AC9A 4IJXA 1MR2A 3X0KA 5C7TA 2G74A 3BM4A 3SHDA 2GT2A 1MQWA 1VIUA 4HFQA 3X0LA 2ICKA 2O5FA 3A6SA 4KG4A 5FSNA 1NQYA 3X0IA 5CFJA 3U53A 5BS6A 4MPOA 1VK6A 3F13A 2A8PA 3ACAA 1GA7A 5ANTA 5GHMA 2AZWA 3H95A 4YPRA 2DSCA 1V8MA 3Q91A 4C9WA 2YYHA 1VRLA 5I8UA 2DSDA 2XSQA 1G9QA 2GB5A 4DYWA 4YPHA 3P5TA 3X0MA 3GRNA 3J7Ye 1NQZA 2G73A 3FK9A 1I9AA 2B2KA 3MCFA 4K6EA 2PNYA 3QSJA 1HZTA 2I8UA 1V8YA 1XSAA 1SOIA 1V8RA 3FCMA 3FJYA 3WHWA 3COUA 4ZG0A 3Q4IA 3MDIA 5FSMA 3GWYA 4KTBA 5FSKA 3GZ8A 3DUPA 3G0QA 4JZSA 2A6TA 3P6YA 5CFIA 1X84A 4ICKA 4NFXA 5GHQA 5GHPA 2Q9PA 3BAPA 3GZ6A 2J8QA 1KT9A 2O5WA 2I8TA 3FFUA 1K26A 1SZ3A 3MGMA 1U20A 3SONA 1RRSA 2A8SA 2GT4A 3O6ZA 3Q2SA 4JZTA 1VC8A 2I6KA 4JZVA 2A8RA 4JZUA 2QKMB 5DDGA 2YVPA 5DEQA 1XSCA 3BHOA 5DPKA 3FSPA 3X0PA 1PUSA 2JVBA 4HVYA 5C8LA 1OW2A 3CNGA 3O61A 2PQVA 3EXQA 2FVVA 1V8NA 2YVMA 2O1CA 5ANVA 5FSIA 2DSBA 3EEUA 3X0SA 1PPWA 3ZR0A 3GZ5A 3R03A 1RYAA 1NFZA 3I7UA 1PVFA 1K2EA 3RH7A 1R67A 1V8VA 2FKBA 4C9XA 5HZXA 4S2YA 2KDVA 5ANWA 1X83A 2YVOA 1VC9A 3KVHA 1F3YA 4YOQA 2FMLA 1MQEA 3E57A 1V8IA 1PUQA 5GHIA 3X0RA 1KTGA 1V8TA 1JKNA 5GHOA 2B0VA 1SU2A 3O52A 3F6AA 2VNPA 5C7QA 5GHJA 3X0JA 1Q33A 1Q27A 4S2WA 4KG3A 2CL3A 3L85A 2A8TA 3O8SA 2QJOA 3EESA 5IW4A 5FSLA 3ZR1A 3A6UA 4S2XA 3Q2TA 1IRYA 2YVNA 3Q1PA 2A8QA 2KDWA 1XSBA 1PPXA 5BONA 3MDGA 3I9XA 1MUTA 3Q93A
chains in the Genus database with same CATH superfamily
3HHJA 2B06A 3DKUA 2RRKA 1X51A 3A6VA 5ISYA 5GHNA 1PUNA 5DD4A 1MP2A 4KYXA 1JRKA 1G0SA 2DUKA 3SMDA 3X0NA 1PPVA 1VIQA 5ANSA 3X0OA 1MK1A 3HYQA 4N1TA 4S2VA 1V8LA 2ICJA 3ID9A 5FSOA 1RRQA 1VHGA 1TUMA 3O69A 4N1UA 1VHZA 2VNQA 1QVJA 1V8WA 3OGAA 3I7VA 4ILQA 2W4EA 1HX3A 1Q54A 3EF5A 2DHOA 1V8UA 4NFWA 1KHZA 3N77A 3N9UA 4V14A 3X0QA 5IW5A 1SJYA 3GG6A 5ANUA 2R5WA 5LPGA 1VCDA 1V8SA 3A6TA 1NFSA 2QJTA 3AC9A 4IJXA 1MR2A 3X0KA 5C7TA 2G74A 3BM4A 3SHDA 2GT2A 4J7GA 1MQWA 1VIUA 4HFQA 3X0LA 2ICKA 2O5FA 3A6SA 4KG4A 5FSNA 1NQYA 3X0IA 5CFJA 3U53A 5BS6A 4MPOA 1VK6A 3F13A 2A8PA 3ACAA 1GA7A 5ANTA 5GHMA 2AZWA 3H95A 4YPRA 2DSCA 1V8MA 3Q91A 4C9WA 2YYHA 1VRLA 5I8UA 2DSDA 2XSQA 1G9QA 2GB5A 4DYWA 4YPHA 3P5TA 3X0MA 3GRNA 3J7Ye 1NQZA 2G73A 3FK9A 1I9AA 2B2KA 3MCFA 4K6EA 2PNYA 3QSJA 1HZTA 2CZRA 2I8UA 1V8YA 1XSAA 1SOIA 1V8RA 3FCMA 3FJYA 3WHWA 3COUA 4ZG0A 3Q4IA 3MDIA 5FSMA 3GWYA 4KTBA 5FSKA 3GZ8A 3DUPA 3G0QA 4JZSA 2A6TA 3P6YA 5CFIA 1X84A 4ICKA 4NFXA 5GHQA 5GHPA 2Q9PA 3BAPA 3GZ6A 2J8QA 1KT9A 2O5WA 2I8TA 3FFUA 1K26A 1SZ3A 3MGMA 1U20A 3SONA 1RRSA 2A8SA 2GT4A 3O6ZA 3Q2SA 4JZTA 1VC8A 2I6KA 4JZVA 2A8RA 4JZUA 2QKMB 5DDGA 2YVPA 5DEQA 1XSCA 3BHOA 5DPKA 3FSPA 3X0PA 1PUSA 2JVBA 4HVYA 5C8LA 1OW2A 3CNGA 3O61A 2PQVA 3EXQA 2FVVA 1V8NA 2YVMA 2O1CA 5ANVA 5FSIA 2DSBA 3EEUA 3X0SA 1PPWA 3ZR0A 3GZ5A 3R03A 1RYAA 1NFZA 3I7UA 1PVFA 1K2EA 3RH7A 1R67A 1V8VA 2FKBA 4C9XA 5HZXA 4S2YA 2KDVA 5ANWA 1X83A 2YVOA 1VC9A 3KVHA 1F3YA 4J7HA 2FMLA 1MQEA 3E57A 4YOQA 1V8IA 1PUQA 5GHIA 3X0RA 1KTGA 1V8TA 1JKNA 5GHOA 2B0VA 1SU2A 3O52A 3F6AA 2VNPA 5C7QA 5GHJA 3X0JA 1Q33A 1Q27A 4S2WA 4KG3A 2CL3A 3L85A 2A8TA 3O8SA 2QJOA 3EESA 5IW4A 5FSLA 3ZR1A 3A6UA 4S2XA 3Q2TA 1IRYA 2YVNA 3Q1PA 2A8QA 2KDWA 1XSBA 1PPXA 5BONA 3MDGA 3I9XA 1MUTA 3Q93A
chains in the Genus database with same CATH topology
3HHJA 2B06A 3DKUA 2RRKA 1X51A 3A6VA 5ISYA 5GHNA 1PUNA 5DD4A 1MP2A 4KYXA 1JRKA 1G0SA 2DUKA 3SMDA 3X0NA 1PPVA 1VIQA 5ANSA 3X0OA 1MK1A 3HYQA 4N1TA 4S2VA 1V8LA 2ICJA 3ID9A 5FSOA 1RRQA 1VHGA 1TUMA 3O69A 4N1UA 1VHZA 2VNQA 1QVJA 1V8WA 3OGAA 3I7VA 4ILQA 2W4EA 1HX3A 1Q54A 3EF5A 2DHOA 1V8UA 4NFWA 1KHZA 3N77A 3N9UA 4V14A 3X0QA 5IW5A 1SJYA 3GG6A 5ANUA 2R5WA 5LPGA 1VCDA 1V8SA 3A6TA 1NFSA 2QJTA 3AC9A 4IJXA 1MR2A 3X0KA 5C7TA 2G74A 3BM4A 3SHDA 2GT2A 4J7GA 1MQWA 1VIUA 4HFQA 3X0LA 2ICKA 2O5FA 3A6SA 4KG4A 5FSNA 1NQYA 3X0IA 5CFJA 3U53A 5BS6A 4MPOA 1VK6A 3F13A 2A8PA 3ACAA 1GA7A 5ANTA 5GHMA 2AZWA 3H95A 4YPRA 2DSCA 1V8MA 3Q91A 4C9WA 2YYHA 1VRLA 5I8UA 2DSDA 2XSQA 1G9QA 2GB5A 4DYWA 4YPHA 3P5TA 3X0MA 3GRNA 3J7Ye 1NQZA 2G73A 3FK9A 1I9AA 2B2KA 3MCFA 4K6EA 2PNYA 3QSJA 1HZTA 2CZRA 2I8UA 1V8YA 1XSAA 1SOIA 1V8RA 3FCMA 3FJYA 3WHWA 3COUA 4ZG0A 3Q4IA 3MDIA 5FSMA 3GWYA 4KTBA 5FSKA 3GZ8A 3DUPA 3G0QA 4JZSA 2A6TA 3P6YA 5CFIA 1X84A 4ICKA 4NFXA 5GHQA 5GHPA 2Q9PA 3BAPA 3GZ6A 2J8QA 1KT9A 2O5WA 2I8TA 3FFUA 1K26A 1SZ3A 3MGMA 1U20A 3SONA 1RRSA 2A8SA 2GT4A 3O6ZA 3Q2SA 4JZTA 1VC8A 2I6KA 4JZVA 2A8RA 4JZUA 2QKMB 5DDGA 2YVPA 5DEQA 1XSCA 3BHOA 5DPKA 3FSPA 3X0PA 1PUSA 2JVBA 4HVYA 5C8LA 1OW2A 3CNGA 3O61A 2PQVA 3EXQA 2FVVA 1V8NA 2YVMA 2O1CA 5ANVA 5FSIA 2DSBA 3EEUA 3X0SA 1PPWA 3ZR0A 3GZ5A 3R03A 1RYAA 1NFZA 3I7UA 1PVFA 1K2EA 3RH7A 1R67A 1V8VA 2FKBA 4C9XA 5HZXA 4S2YA 2KDVA 5ANWA 1X83A 2YVOA 1VC9A 3KVHA 1F3YA 4J7HA 2FMLA 1MQEA 3E57A 4YOQA 1V8IA 1PUQA 5GHIA 3X0RA 1KTGA 1V8TA 1JKNA 5GHOA 2B0VA 1SU2A 3O52A 3F6AA 2VNPA 5C7QA 5GHJA 3X0JA 1Q33A 1Q27A 4S2WA 4KG3A 2CL3A 3L85A 2A8TA 3O8SA 2QJOA 3EESA 5IW4A 5FSLA 3ZR1A 3A6UA 4S2XA 3Q2TA 1IRYA 2YVNA 3Q1PA 2A8QA 2KDWA 1XSBA 1PPXA 5BONA 3MDGA 3I9XA 1MUTA 3Q93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HHJ A;  2B06 A;  3DKU A;  2RRK A;  1X51 A;  3A6V A;  5ISY A;  5GHN A;  1PUN A;  5DD4 A;  1MP2 A;  4KYX A;  1JRK A;  1G0S A;  2DUK A;  3SMD A;  3X0N A;  1PPV A;  1VIQ A;  5ANS A;  3X0O A;  1MK1 A;  3HYQ A;  4N1T A;  4S2V A;  1V8L A;  2ICJ A;  3ID9 A;  5FSO A;  1RRQ A;  1VHG A;  1TUM A;  3O69 A;  4N1U A;  1VHZ A;  2VNQ A;  1QVJ A;  1V8W A;  3OGA A;  3I7V A;  4ILQ A;  2W4E A;  1HX3 A;  1Q54 A;  3EF5 A;  2DHO A;  1V8U A;  4NFW A;  1KHZ A;  3N77 A;  3N9U A;  4V14 A;  3X0Q A;  5IW5 A;  1SJY A;  3GG6 A;  5ANU A;  2R5W A;  5LPG A;  1VCD A;  1V8S A;  3A6T A;  1NFS A;  2QJT A;  3AC9 A;  4IJX A;  1MR2 A;  3X0K A;  5C7T A;  2G74 A;  3BM4 A;  3SHD A;  2GT2 A;  1MQW A;  1VIU A;  4HFQ A;  3X0L A;  2ICK A;  2O5F A;  3A6S A;  4KG4 A;  5FSN A;  1NQY A;  3X0I A;  5CFJ A;  3U53 A;  5BS6 A;  4MPO A;  1VK6 A;  3F13 A;  2A8P A;  3ACA A;  1GA7 A;  5ANT A;  5GHM A;  2AZW A;  3H95 A;  4YPR A;  2DSC A;  1V8M A;  3Q91 A;  4C9W A;  2YYH A;  1VRL A;  5I8U A;  2DSD A;  2XSQ A;  1G9Q A;  2GB5 A;  4DYW A;  4YPH A;  3P5T A;  3X0M A;  3GRN A;  3J7Y e;  1NQZ A;  2G73 A;  3FK9 A;  1I9A A;  2B2K A;  3MCF A;  4K6E A;  2PNY A;  3QSJ A;  1HZT A;  2I8U A;  1V8Y A;  1XSA A;  1SOI A;  1V8R A;  3FCM A;  3FJY A;  3WHW A;  3COU A;  4ZG0 A;  3Q4I A;  3MDI A;  5FSM A;  3GWY A;  4KTB A;  5FSK A;  3GZ8 A;  3DUP A;  3G0Q A;  4JZS A;  2A6T A;  3P6Y A;  5CFI A;  1X84 A;  4ICK A;  4NFX A;  5GHQ A;  5GHP A;  2Q9P A;  3BAP A;  3GZ6 A;  2J8Q A;  1KT9 A;  2O5W A;  2I8T A;  3FFU A;  1K26 A;  1SZ3 A;  3MGM A;  1U20 A;  3SON A;  1RRS A;  2A8S A;  2GT4 A;  3O6Z A;  3Q2S A;  4JZT A;  1VC8 A;  2I6K A;  4JZV A;  2A8R A;  4JZU A;  2QKM B;  5DDG A;  2YVP A;  5DEQ A;  1XSC A;  3BHO A;  5DPK A;  3FSP A;  3X0P A;  1PUS A;  2JVB A;  4HVY A;  5C8L A;  1OW2 A;  3CNG A;  3O61 A;  2PQV A;  3EXQ A;  2FVV A;  1V8N A;  2YVM A;  2O1C A;  5ANV A;  5FSI A;  2DSB A;  3EEU A;  3X0S A;  1PPW A;  3ZR0 A;  3GZ5 A;  3R03 A;  1RYA A;  1NFZ A;  3I7U A;  1PVF A;  1K2E A;  3RH7 A;  1R67 A;  1V8V A;  2FKB A;  4C9X A;  5HZX A;  4S2Y A;  2KDV A;  5ANW A;  1X83 A;  2YVO A;  1VC9 A;  3KVH A;  1F3Y A;  4YOQ A;  2FML A;  1MQE A;  3E57 A;  1V8I A;  1PUQ A;  5GHI A;  3X0R A;  1KTG A;  1V8T A;  1JKN A;  5GHO A;  2B0V A;  1SU2 A;  3O52 A;  3F6A A;  2VNP A;  5C7Q A;  5GHJ A;  3X0J A;  1Q33 A;  1Q27 A;  4S2W A;  4KG3 A;  2CL3 A;  3L85 A;  2A8T A;  3O8S A;  2QJO A;  3EES A;  5IW4 A;  5FSL A;  3ZR1 A;  3A6U A;  4S2X A;  3Q2T A;  1IRY A;  2YVN A;  3Q1P A;  2A8Q A;  2KDW A;  1XSB A;  1PPX A;  5BON A;  3MDG A;  3I9X A;  1MUT A;  3Q93 A; 
#chains in the Genus database with same CATH topology
 3HHJ A;  2B06 A;  3DKU A;  2RRK A;  1X51 A;  3A6V A;  5ISY A;  5GHN A;  1PUN A;  5DD4 A;  1MP2 A;  4KYX A;  1JRK A;  1G0S A;  2DUK A;  3SMD A;  3X0N A;  1PPV A;  1VIQ A;  5ANS A;  3X0O A;  1MK1 A;  3HYQ A;  4N1T A;  4S2V A;  1V8L A;  2ICJ A;  3ID9 A;  5FSO A;  1RRQ A;  1VHG A;  1TUM A;  3O69 A;  4N1U A;  1VHZ A;  2VNQ A;  1QVJ A;  1V8W A;  3OGA A;  3I7V A;  4ILQ A;  2W4E A;  1HX3 A;  1Q54 A;  3EF5 A;  2DHO A;  1V8U A;  4NFW A;  1KHZ A;  3N77 A;  3N9U A;  4V14 A;  3X0Q A;  5IW5 A;  1SJY A;  3GG6 A;  5ANU A;  2R5W A;  5LPG A;  1VCD A;  1V8S A;  3A6T A;  1NFS A;  2QJT A;  3AC9 A;  4IJX A;  1MR2 A;  3X0K A;  5C7T A;  2G74 A;  3BM4 A;  3SHD A;  2GT2 A;  4J7G A;  1MQW A;  1VIU A;  4HFQ A;  3X0L A;  2ICK A;  2O5F A;  3A6S A;  4KG4 A;  5FSN A;  1NQY A;  3X0I A;  5CFJ A;  3U53 A;  5BS6 A;  4MPO A;  1VK6 A;  3F13 A;  2A8P A;  3ACA A;  1GA7 A;  5ANT A;  5GHM A;  2AZW A;  3H95 A;  4YPR A;  2DSC A;  1V8M A;  3Q91 A;  4C9W A;  2YYH A;  1VRL A;  5I8U A;  2DSD A;  2XSQ A;  1G9Q A;  2GB5 A;  4DYW A;  4YPH A;  3P5T A;  3X0M A;  3GRN A;  3J7Y e;  1NQZ A;  2G73 A;  3FK9 A;  1I9A A;  2B2K A;  3MCF A;  4K6E A;  2PNY A;  3QSJ A;  1HZT A;  2CZR A;  2I8U A;  1V8Y A;  1XSA A;  1SOI A;  1V8R A;  3FCM A;  3FJY A;  3WHW A;  3COU A;  4ZG0 A;  3Q4I A;  3MDI A;  5FSM A;  3GWY A;  4KTB A;  5FSK A;  3GZ8 A;  3DUP A;  3G0Q A;  4JZS A;  2A6T A;  3P6Y A;  5CFI A;  1X84 A;  4ICK A;  4NFX A;  5GHQ A;  5GHP A;  2Q9P A;  3BAP A;  3GZ6 A;  2J8Q A;  1KT9 A;  2O5W A;  2I8T A;  3FFU A;  1K26 A;  1SZ3 A;  3MGM A;  1U20 A;  3SON A;  1RRS A;  2A8S A;  2GT4 A;  3O6Z A;  3Q2S A;  4JZT A;  1VC8 A;  2I6K A;  4JZV A;  2A8R A;  4JZU A;  2QKM B;  5DDG A;  2YVP A;  5DEQ A;  1XSC A;  3BHO A;  5DPK A;  3FSP A;  3X0P A;  1PUS A;  2JVB A;  4HVY A;  5C8L A;  1OW2 A;  3CNG A;  3O61 A;  2PQV A;  3EXQ A;  2FVV A;  1V8N A;  2YVM A;  2O1C A;  5ANV A;  5FSI A;  2DSB A;  3EEU A;  3X0S A;  1PPW A;  3ZR0 A;  3GZ5 A;  3R03 A;  1RYA A;  1NFZ A;  3I7U A;  1PVF A;  1K2E A;  3RH7 A;  1R67 A;  1V8V A;  2FKB A;  4C9X A;  5HZX A;  4S2Y A;  2KDV A;  5ANW A;  1X83 A;  2YVO A;  1VC9 A;  3KVH A;  1F3Y A;  4J7H A;  2FML A;  1MQE A;  3E57 A;  4YOQ A;  1V8I A;  1PUQ A;  5GHI A;  3X0R A;  1KTG A;  1V8T A;  1JKN A;  5GHO A;  2B0V A;  1SU2 A;  3O52 A;  3F6A A;  2VNP A;  5C7Q A;  5GHJ A;  3X0J A;  1Q33 A;  1Q27 A;  4S2W A;  4KG3 A;  2CL3 A;  3L85 A;  2A8T A;  3O8S A;  2QJO A;  3EES A;  5IW4 A;  5FSL A;  3ZR1 A;  3A6U A;  4S2X A;  3Q2T A;  1IRY A;  2YVN A;  3Q1P A;  2A8Q A;  2KDW A;  1XSB A;  1PPX A;  5BON A;  3MDG A;  3I9X A;  1MUT A;  3Q93 A; 
#chains in the Genus database with same CATH homology
 3HHJ A;  2B06 A;  3DKU A;  2RRK A;  1X51 A;  3A6V A;  5ISY A;  5GHN A;  1PUN A;  5DD4 A;  1MP2 A;  4KYX A;  1JRK A;  1G0S A;  2DUK A;  3SMD A;  3X0N A;  1PPV A;  1VIQ A;  5ANS A;  3X0O A;  1MK1 A;  3HYQ A;  4N1T A;  4S2V A;  1V8L A;  2ICJ A;  3ID9 A;  5FSO A;  1RRQ A;  1VHG A;  1TUM A;  3O69 A;  4N1U A;  1VHZ A;  2VNQ A;  1QVJ A;  1V8W A;  3OGA A;  3I7V A;  4ILQ A;  2W4E A;  1HX3 A;  1Q54 A;  3EF5 A;  2DHO A;  1V8U A;  4NFW A;  1KHZ A;  3N77 A;  3N9U A;  4V14 A;  3X0Q A;  5IW5 A;  1SJY A;  3GG6 A;  5ANU A;  2R5W A;  5LPG A;  1VCD A;  1V8S A;  3A6T A;  1NFS A;  2QJT A;  3AC9 A;  4IJX A;  1MR2 A;  3X0K A;  5C7T A;  2G74 A;  3BM4 A;  3SHD A;  2GT2 A;  4J7G A;  1MQW A;  1VIU A;  4HFQ A;  3X0L A;  2ICK A;  2O5F A;  3A6S A;  4KG4 A;  5FSN A;  1NQY A;  3X0I A;  5CFJ A;  3U53 A;  5BS6 A;  4MPO A;  1VK6 A;  3F13 A;  2A8P A;  3ACA A;  1GA7 A;  5ANT A;  5GHM A;  2AZW A;  3H95 A;  4YPR A;  2DSC A;  1V8M A;  3Q91 A;  4C9W A;  2YYH A;  1VRL A;  5I8U A;  2DSD A;  2XSQ A;  1G9Q A;  2GB5 A;  4DYW A;  4YPH A;  3P5T A;  3X0M A;  3GRN A;  3J7Y e;  1NQZ A;  2G73 A;  3FK9 A;  1I9A A;  2B2K A;  3MCF A;  4K6E A;  2PNY A;  3QSJ A;  1HZT A;  2CZR A;  2I8U A;  1V8Y A;  1XSA A;  1SOI A;  1V8R A;  3FCM A;  3FJY A;  3WHW A;  3COU A;  4ZG0 A;  3Q4I A;  3MDI A;  5FSM A;  3GWY A;  4KTB A;  5FSK A;  3GZ8 A;  3DUP A;  3G0Q A;  4JZS A;  2A6T A;  3P6Y A;  5CFI A;  1X84 A;  4ICK A;  4NFX A;  5GHQ A;  5GHP A;  2Q9P A;  3BAP A;  3GZ6 A;  2J8Q A;  1KT9 A;  2O5W A;  2I8T A;  3FFU A;  1K26 A;  1SZ3 A;  3MGM A;  1U20 A;  3SON A;  1RRS A;  2A8S A;  2GT4 A;  3O6Z A;  3Q2S A;  4JZT A;  1VC8 A;  2I6K A;  4JZV A;  2A8R A;  4JZU A;  2QKM B;  5DDG A;  2YVP A;  5DEQ A;  1XSC A;  3BHO A;  5DPK A;  3FSP A;  3X0P A;  1PUS A;  2JVB A;  4HVY A;  5C8L A;  1OW2 A;  3CNG A;  3O61 A;  2PQV A;  3EXQ A;  2FVV A;  1V8N A;  2YVM A;  2O1C A;  5ANV A;  5FSI A;  2DSB A;  3EEU A;  3X0S A;  1PPW A;  3ZR0 A;  3GZ5 A;  3R03 A;  1RYA A;  1NFZ A;  3I7U A;  1PVF A;  1K2E A;  3RH7 A;  1R67 A;  1V8V A;  2FKB A;  4C9X A;  5HZX A;  4S2Y A;  2KDV A;  5ANW A;  1X83 A;  2YVO A;  1VC9 A;  3KVH A;  1F3Y A;  4J7H A;  2FML A;  1MQE A;  3E57 A;  4YOQ A;  1V8I A;  1PUQ A;  5GHI A;  3X0R A;  1KTG A;  1V8T A;  1JKN A;  5GHO A;  2B0V A;  1SU2 A;  3O52 A;  3F6A A;  2VNP A;  5C7Q A;  5GHJ A;  3X0J A;  1Q33 A;  1Q27 A;  4S2W A;  4KG3 A;  2CL3 A;  3L85 A;  2A8T A;  3O8S A;  2QJO A;  3EES A;  5IW4 A;  5FSL A;  3ZR1 A;  3A6U A;  4S2X A;  3Q2T A;  1IRY A;  2YVN A;  3Q1P A;  2A8Q A;  2KDW A;  1XSB A;  1PPX A;  5BON A;  3MDG A;  3I9X A;  1MUT A;  3Q93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...