3FFWA

Crystal structure of chey triple mutant f14q, n59k, e89y complexed with bef3- and mn2+
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDQSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWKMPNMDGLELLKTIRADGAMSALPVLMVTAYAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chemotaxis protein cheY
publication title Matching Biochemical Reaction Kinetics to the Timescales of Life: Structural Determinants That Influence the Autodephosphorylation Rate of Response Regulator Proteins.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Signaling protein
total genus 44
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ffwA00
1EAYA 1ZHHA 2PLNA 3HDVA 3OO0A 3G1WA 1FQWA 1MAVA 4RV5A 2NZUG 4XFKA 1DBQA 1W25A 4H3KB 3M9XA 2VUIB 4WT7A 4KVFA 2L17A 1Z18A 5TPWA 2PE5A 2WJWA 4NCAA 4ETIA 3FGZA 5KWSA 1Z17A 1P2FA 4XARA 3RVKA 3LUCA 4JP1A 1MVOA 3FFTA 2WJAA 3K9CA 3T8YA 2PUEA 5C5EA 5KC9A 2RGYA 2L2QA 4YP9A 1TVMA 4Z4FA 1LJUA 1NY5A 2N9UA 4NV3A 3H6HA 4S05A 2A9RA 5IBQA 3M9WA 2IPNA 1BDIA 3P9YA 4IGAA 2L19A 4RXUA 3DZDA 3DLHA 4N76A 1JFVA 1M5UA 3IP9A 3NNDA 1YK1A 4G0MA 4Q6WA 4D74A 1TM2A 4RY0A 3Q15C 2MSLA 1D5WA 4H3HB 3FMVA 3HK2A 3RVNA 4XLTA 1P6UA 1JH9A 1QO0D 2L18A 2TMYA 3Q9SA 4MQFB 5EWLB 1GUDA 3IP5A 4YGXB 5KQPA 3O2QB 1YS6A 3ROFA 3GL9A 3N75A 3O75A 4RK5A 1PUXA 3GBPA 3E61A 4G0YA 1QQBA 3MF4A 4Y9TA 3OM0A 2QSJA 2R4QA 4HNRA 4RSMA 3RVJA 3QLTA 3C3WA 3HVRA 3I45A 2WB4A 3KCNA 4RKRA 2LP4Y 1S8NA 1Z2DA 3OLYA 3OMWA 3O1JC 4W5NA 2GKGA 4MS1B 4E7PA 4GNRA 2QV0A 3QEMA 3EQZA 2A9OA 3HUTA 4RZSA 3SM9A 3JVIA 5ED4A 4XAQA 3A0UA 4LRQA 5ABPA 1GCGA 4JOQA 1ABFA 1ZGZA 4N0PA 1M2FA 5CNIA 2GX6A 3A0RB 2PUAA 4Z99A 3DGFC 3HXMA 5FWYB 3LOPA 4EGSA 4KRFA 2FTKE 4N41A 1FFWA 4WXEA 3O2JA 4LE0A 1GLGA 3CLKA 4KFCA 1NATA 1SRRA 3G85A 3D02A 3O21A 1AB5A 3DBIA 3H5WA 4MQFA 2PUCA 3CFYA 1BDJA 5E3JA 5JS1A 1ZY2A 4Z9BA 5F64A 1YTUA 3OLVA 5JNRA 5JNSA 1RXIA 2YHBA 3EDCA 1DCFA 4DADA 4E7OA 4DQDA 3RH0A 3VNAA 4DN6A 1ZVVA 1XHEA 4H60A 3HV2A 1L5YA 3FFWA 4Q6BA 4EUKA 1BDHA 4MR9B 4MS1A 1PNTA 2H0AA 4PZ0A 3KKEA 1QKKA 2AYXA 5PNTA 4G0QA 3UK0A 1FFSA 1VLZA 2PJUA 3LUAA 4LDZA 4EVQA 5IEBA 2FN8A 1GUBA 5IUKC 2QR3A 2QZJA 4MAAA 4B09A 5FWYA 3TB6A 6ABPA 1U2PA 5JNWA 3OLZA 3GRCA 1RPJA 5IC5A 3H6GA 1LK0A 2JK1A 2E4VA 4JAVC 3CHYA 3SNKA 4D6YA 3T6KA 2DRIA 1C4WA 3JTEA 1UDRA 4MLCA 4MRMB 3F7NA 1K66A 4NCBA 3H5LA 3JVDA 4F12A 1USGA 2P4UA 1BAPA 3EGCA 3LUKA 4KK4A 4F11A 1JDPA 4JASB 3LUJA 4LE2A 4TLLB 5IUNC 2JVKA 1A0OA 1M5TA 9ABPA 3HZHA 1OXBB 2V0NA 2IYNA 4F8JA 4Z4EA 4RU1A 3E3MA 3Q7RA 3TO5A 4ZJPA 3RVSA 3KYJB 3OLXA 5IUJC 1Z16A 3Q41A 2B4AA 4Z9AA 4EYKA 8ABPA 5T7BA 4MR9A 3HO1A 1W9HA 2J48A 2MYUA 2R48A 2E4YA 2I6FA 3KLNA 3H1EA 2FXIA 4IMJB 3H75A 2CHFA 5T3YA 4EYOA 5DLEA 1DC7A 3TMYA 3NHMA 1ZGGA 3HEBA 3KG2A 1NXTA 3CG4A 3MA0A 1ZDMA 1QO0A 3NHZA 4KMRA 4P1ZA 3CS3A 1E6MA 1J56A 1U04A 2JVIA 3C3MA 3KYIB 3IP6A 3JPYA 3HUUA 4JB0A 2ID9A 2Q5CA 1YMVA 4O5AA 1SXHA 4WWHA 2BGGA 2E4XA 1I3CA 1SXIA 4ETMA 3QK7A 1TLFA 4G0ZA 4N03A 4RY9A 2M1ZA 2VUHB 3MM4A 3RVQA 1E6KA 3JS5A 1YIOA 3A3KA 4FB4A 3F73A 2QXYA 5KQLA 2QVCA 3CU5A 2XDYA 2YHAA 4PE5B 4Z4IA 4G0XA 4RKQA 1CYEA 1TJYA 5FBKA 2JRLA 3O2SB 2RJOA 3O1HB 5BRJA 4QYMA 3CTPA 1NXWA 1YVUA 3N0WA 4EVRA 5BRAA 2F8SA 1E2BA 1USIA 5CNKA 2VK2A 2O20A 3OMXA 3EJWA 4YS6A 2OENG 5HKOA 1L5ZA 3KLOA 4M88A 4W5OA 5I4CA 3RVRA 1JHZA 5KI6A 5HSGA 1CHNA 4F3TA 1DJMA 4RWEA 4WXMA 3CZ5A 2LUOA 4OG2A 5EWJB 1H9CA 1MIHA 2VYCA 2R47A 5CNMA 1VKRA 3EULA 4FE7A 1AB6A 3QX9A 4HNQA 3CRNA 3RVMA 5D2CA 2JBAB 3MMNA 4YRZA 4NQRA 1LBIA 2FSPA 2PMCA 3LMKA 1DRJA 4ML3A 3N53A 3HS3A 1ZH2A 1D4ZA 2NZVG 3FDFA 2B1JA 4MLDA 4HNSA 1USKA 2ZWMA 2HQBA 4KQCA 1ZAYA 5EWLA 3JY6A 3QX8A 2WY2D 4ZPJA 2FLWA 3H5OA 1SXGA 1Z12A 2E4ZA 1JYEA 5JNVA 1IIBA 4RK1A 4P98A 4L85A 3A10A 2LPMA 1YMUA 3L49A 4MYRA 4OLAA 3F6PA 3K4HA 3GBVA 1FSPA 4G86A 3KHTA 4LDAA 4QPJC 5DTEA 6CHYA 3UUGA 1Z25A 1MB0A 1DBWA 3NNSA 3L6UA 3OQOA 2F8TA 3Q7TA 4FE4A 3DGEC 3LTEA 1JYFA 3LUDA 4QICA 3BREA 1LJLA 2A9PA 4OBBA 5EWMB 1P6QA 3GT7A 4UHJA 5HM6A 3ROTA 3I09A 1GCAA 3GWGA 4F06A 1RXEA 5GOTA 3N0RA 1U0SY 2JBAA 2E4UA 3HCWA 3CKMA 4EYQA 1FFGA 5TQ0B 2JB9A 1A04A 2RDMA 3QLUC 4RXMA 1QP7A 2GWRA 1DP4A 4YCSA 1NXXA 5JNTA 2PKXA 2HQOA 4PYRA 2W42A 2FKAA 1Z15A 1DZ3A 2GI4A 3QLUA 2FMIA 2X7XA 5BQ3A 2MSWA 2NT3A 4RS3A 4N0QA 4MS3B 3LKVA 5B3JC 2OQRA 5TPWB 4CBVA 3SG0A 4KV7A 4S04A 1NXVA 3VNBA 3O74A 2HSGA 4LZLA 4TLMB 3R0JA 3H5IA 3QLVC 2FEWB 2HPHA 3T38A 2ZAYA 3S99A 3M6MD 4WZZA 1BA2A 1DRKA 1BVHA 5EWMA 3NBMA 1R8JA 3O1IC 5TQ2B 1RZRD 4Z4GA 4LX8A 4W5TA 3ILYA 1VRVA 3OQNA 1RNLA 1PEAA 3EQ2A 3LUGA 1D1PA 2R25B 4EVSA 1ZN2A 1U8TA 1EFAA 2MYTA 2P9HA 5IEJA 1Z26A 4MPTA 1JFTA 3CG0A 4MR7B 2PUFA 5TQJA 2PUBA 3KJXA 1DC8A 1A2OA 3BRQA 4MRMA 5CHYA 5KQGA 3OQMA 4NICA 3C3KA 3IPCA 2H3HA 2PUGA 4JA2A 2FMHA 1CEYA 1ISRA 1DCMA 2FN9A 1NTRA 4O1HA 5DKFA 2RJNA 4RK0A 2PL9A 1ZH4A 4IRXA 1XWWA 1JL3A 3N6VA 1PHRA 3MQ4A 4MQEB 2E4WA 4HYEA 4MS3A 5KC8A 3GV0A 2WWVD 2JCGA 2MYNA 2FEPA 3IPAA 1E6LA 4ZMSA 1F4VA 1NXPA 3I5AA 1K68A 4KPYA 1SD5A 3QEMB 3DLBA 3H5TA 2FMFA 4MS4B 5TQ2A 3UKJA 3LUHA 1D1QA 2NUBA 2GBPA 4MR8B 5DGCA 2WMYA 1DBPA 3RVLA 4YV7A 3NNNA 3KTOA 2WRZA 1ZESA 3Q7SA 4OTZA 4EYGA 1KRWA 5HQJA 3OO1A 2IDMA 5C5CA 1QQAA 1HEYA 1ABEA 1M2EA 1P8AA 2QVGA 3H1GA 3I42A 3KSMA 4MR7A 5IX8A 4G0OA 1EWTA 2FLKA 1VPWA 4KREA 3GYBA 2IPLA 4OATA 4G97A 1Z2EA 4QYWA 1DG9A 1JBEA 3FFXA 4XXHA 1QP4A 3C6QA 2ID7A 2IOYA 2LBPA 3D8UA 2HJ9A 4YLEA 4W5RA 3BILA 3URMA 4MQEA 1QMPA 2AYZA 2IPMA 4Z4HA 4RK6A 2PL1A 3JPWA 3SY8A 5FWXB 1KRXA 5BR1A 3RVOA 3IP7A 1F51E 4TN5A 3HDGA 4IMIB 4RK4A 5JS2A 3T95A 3N8IA 3N0XA 4KZKA 3QELB 2FW0A 1C0EA 4MS4A 4UHKA 4RXTA 4GPAA 2JVJA 4O1IA 5CNJA 4YWHA 2CD7A 3QEKA 5TE9A 4D6XA 1MB3A 2FVYA 4MR8A 4N47A 4L4UA 1LBHA 1XHFA 2LIVA 1D2AA 1JX6A 3OM1A 3SAJA 1JWLA 1EWVA 1QPZA 1JDNA 3B2NA 1KMIY 1EHCA 2FMKA 4Q7EA 3SQNA 1T34A 4OLBA 2FQYA 5KQMA 1DCKA 4IILA 1URPA 5EWJA 1NXSA 2FQWA 2KYRA 1KGSA 5TPZA 3KS9A 4LE1A 1Z13A 2IKSA 3BRSA 3HSYA 1PNRA 5JNUA 2CHEA 1OXKB 5FBHA 2HQRA 4RDCA 3MYYA 3ILHA 4WUTA 3C97A 4KNYA 4TMYA 1U2QA 1JLKA 3HJFA 4YR7A 5FWXA 3EAFA 1ZITA 1PEYA 3RVPA 3MIZA 1RZRA 4Z4CA 2M98A 3W9SA 3H5VA 3QELA 4ETNA 2FEKA 3F6CA 4MGEA 5TPZD 3RQIA 4XASA 5DCLA 4W5QA 2PUDA 1QP0A 1TMYA 4ZYLA 3HM9A 3TX6A 3CNBA 1ISSA 4KQ9A 2MYPA 3TD9A 1NXOA 4G0PA 2PAFA 3LFTA 3CZCA 5B3JA 1QNLA 7ABPA 1YS7A 3H1FA 4RK7A 4YO7A 5IULC 3BBLA 1WETA 3QLVA 4RY8A 4Z0NA 4JB2A 4EY3A 4ZMRA 1B00A 3EODA 1JF8A 1APBA 2MSKA 1JFSA 4PEVA 2NT4A 2FQXA 1EWKA 3LKBA 3OLWA 4IF4A 4KK3A 1YK0A 3LUFA 2CWDA 2QU7A 2IPAB 2QW1A 3GA5A 3IDOA 4PICA 5TQ0A 2A9QA 1Y1LA 5GQSA
chains in the Genus database with same CATH superfamily
3HDTA 1EESA 4MUIA 5DI9A 5LJIA 2XWJI 2WM9B 1EVKA 1Q7EA 1T6ZA 2DU8A 2ZYHA 4C2UA 3T3HA 3W8DA 3D3WA 2HR1A 5LP1A 3IHLA 2NYRA 3EXFA 5L45A 1BJRE 2L82A 2ZROA 4WT7A 3M70A 4J4BA 1YA8A 1NF9A 1WG8A 1Z18A 3GFPA 2WAXA 3ZI4A 3WNCA 1QTQA 3B89A 3FJ1A 4DEXA 1YE8A 2C95A 5BSMA 2QLBA 3EJ6A 5J4VA 1DDOA 3A25A 4RVOA 3OICA 2X0FA 3FOEC 1JG7A 1DQPA 4MVJA 4Q05A 5C5EA 2J9RA 4AC9A 2FW6A 2E3JA 4EA7A 5C8XA 4MVJM 5BY2A 5CVEA 1SIOA 1Y9AA 4DUYB 1F5NA 1AQIA 1QRAA 2P78A 5H0IA 3SFTA 1AA6A 2R62A 3D7SA 3DZDA 3O82A 1NVXQ 3Q3EA 4M1TA 3S70A 4GLLA 4YI5A 2HU7A 3BGOS 4YMWA 2JAXA 4BC1A 4L4SA 1EA5A 2WZDA 2FOXA 1U2DC 4R16A 3L0DA 8GPBA 3HWWA 1VJCA 3BCRA 3BCUA 3NUQA 5BWNA 3ORRA 1YA4A 1DMSA 4JELA 3SEAA 1UKCA 4J0JA 4B82A 5HKLA 3ONFA 1V3QE 1C8KA 1T9AA 2CBGA 4GF5A 3OVMA 3WWCA 1KETA 1HZZC 3V8VA 3ZXIA 3A1UA 5ED0A 3OIGA 2NV2B 1V4NA 4QUEA 4RSMA 5AKGA 4LF9B 3ACBA 4D9HA 5LQAA 1FNSA 1SXJD 4NMLA 4EYSA 3TUIC 1VHJA 2BEVA 1U7OA 2O3TA 1P4AA 1MEEA 3DT8A 3RLFA 3LFUA 3DG9A 3HO8A 4BPRA 3LAWA 4LC1A 1SQ5A 2HLNA 4GNRA 1AS3A 1NU8A 2DT5A 3R7LA 2ZK7A 4AIRA 1RRMA 2GM4A 3A0UA 3UWDA 1MPXA 3WYAA 2COKA 1G9SA 2ZRNA 3BQNB 2YWDA 3AR3A 4GM0A 4IQ0A 4EPWA 3G6KA 1TAHA 3ZOZA 5IBRA 1T26A 3DEYX 2XD9A 4N5IX 5A7FA 1JIVA 2VP4A 3LU1A 4H7JA 4E31A 2B2CA 3QNUA 4NBUA 4NPHA 3D5TA 3C74A 2F9MA 2EZUA 3GLSA 1HLPA 2NUTB 3NBQA 3W05A 3IVRA 5KJ1A 2VUTA 4OPMA 4RIHA 4QATA 1JIQA 2C03A 1W5FA 1N57A 3OQMA 3RYCA 3DW1X 1XCGB 1P45A 2JIRA 2VSYA 1WCXA 2HPAA 2YOFA 3I1YA 3KOOA 3EEBA 4R98A 4RD1A 2FP4B 1GPH1 2CKDA 2JAPA 1ZMTA 1SN7A 4F2WA 3ILXA 1IY9A 1J00A 2ORYA 4G1VA 4MVJH 3I0ZA 5KYVA 3V33A 2O8EB 1X1TA 3CGWA 4IW3B 4Z7JA 4LMPA 4EUKA 1BDHA 1JQBA 3M6AA 2FY8A 2H0AA 3HDHA 4MV7A 2ZUTA 1WMAA 1ZRMA 3W3ZB 1SCDA 2R11A 1QTRA 4XM1A 1YBAA 2W90A 4MQ5A 1MAUA 4G0QA 4R8KA 2P0AA 3GY0A 4GOJA 3LWNA 5IF9A 4BU1A 2QL5A 2F1OA 1IOVA 4H0NA 4WZBA 1EVJA 2AOVA 2QAGA 2AOUA 3BF8A 1U4NA 3OTGA 1XTZA 1KS2A 1S9HA 2H1RA 5CAEB 2H9YA 4RAQA 2KWIA 4A6EA 3E9YA 3PDIA 1JEDA 1Q3TA 3NCTA 5F76A 4LTDA 2NADA 4JROA 2JIZD 4O4IA 1CR1A 2WJHA 5KWJA 1ZZEA 2W4MA 4H6VA 5K0FA 3FD8A 5B3AA 3LX5A 1Q17A 1ZJ5A 4LECA 2PR2A 3TM5A 5DGXA 3NAMA 2XW6A 4IVRA 1RQ7A 1RAGA 1RI1A 2V5VA 3IALA 4PLWA 4BP8A 4CHTA 3OLXA 3KQNA 1HGXA 4C5BA 1T8TA 2ZRJA 4GXRA 4MV1A 4EJFA 3TQQA 3V4RA 5DHSA 2PT5A 1OTHA 1W9HA 4XPZA 1AHPA 1PHPA 4MVJP 3QPVA 1QVWA 1I4EB 1VE7A 2CLMB 1KK1A 2EW1A 3H75A 2H1LA 2G5PA 2ROQA 4KGDA 1R5OA 1G6KA 2DTDA 1ZGGA 3HU5A 3ZDQA 4Q7QA 3HKBA 4L73A 1SULA 3GJSA 2OLEA 4P1ZA 3NHZA 4PYIA 1N5OX 3CS3A 2NTJA 4RPCA 3AHGA 5E1MA 3SC2B 3IAS1 4LJYA 2GCIA 2PFSA 1KL7A 4HX5A 3L0ZA 4GMKA 5K0LA 3HGTA 1I4WA 3UMBA 4F5YA 2VYNA 3PQEA 2ID9A 4MA4A 1DINA 2W2LA 1RAEA 1RAFA 3KOZA 1XK6A 4IIFA 2D59A 1JZQA 4KO2S 4YHBA 3UKDA 2XTNA 2ILVA 3QOFA 3ZHQA 2EU8A 1CVLA 5J4KA 4UASA 1CUJA 5I9IA 3GRRA 3TPCA 1SEPA 2QUKA 3PCRB 2P2LA 4OM8A 3JS5A 3RJ9A 4ZHQB 1S2NA 2ZETA 3I1FA 5IFKA 5CLIA 1YRQA 2NVBA 5U9CA 5AM5A 2XDYA 1ZSNA 2JGKA 4B2YA 5IZCA 1HQCA 3LLSA 1GEEA 1SCQA 2XMRA 2TS1A 3JX9A 4DMLA 3AL3A 1FY2A 3EXAA 3S2ZA 1EG7A 2O19A 3OY2A 1MDBA 1OPXA 5HJEA 2GTHA 3GZ4A 1COWD 1W76A 1YVUA 1GZUA 1L1EA 2XYVA 2G9VA 4LZNA 1L9XA 2QEQA 3I2JA 4FMCF 3T15A 1L7BA 2XKBA 3GELA 2PMWB 3AHIA 4HGOA 1U90A 2X42A 4YEDA 3ZGNA 4BQFA 3EEIA 4FKBA 4CDRA 4DZTA 3GLIE 3TX2A 1XXHA 1E5LA 3FSJX 3R0IA 3P0JA 3H5NA 2WF7A 4L2IB 3VHQA 5CYPA 2FX3A 5KI6A 1N78A 2BLNA 1G4AE 1GT6A 4WKBA 4CYMA 1QFMA 2DSNA 2ZIXA 4HJRA 4E70A 2R47A 2D2FA 4BEJA 1F8GA 1N4AA 2BGIA 1PD1A 3CJQA 3N7TA 3GPBA 1WHTA 5CDTA 3HHPA 1L4FA 4HRAA 2O59A 3CV3A 1GUZA 5KJCA 4X97A 2V0CA 4RSHA 3FPAA 4YP1A 1Z4PX 4KE8A 4YMSA 3WI7A 2ZUWA 3OX4A 2BEUB 1U9IA 4YRZA 1X9HA 2PH1A 3K8YA 3W5CA 3EY4A 1JHXA 3LMKA 2JIQA 5ULLA 1IEWA 4RDHA 4EZIA 1JBKA 1O8CA 4KDEA 4YR9A 5EWLA 3QX8A 4ARVA 3CC8A 5FA5A 2VF4X 3GW8A 2YHSA 3BDIA 1BXRA 1F8UA 1Z12A 3RS3A 2GM9A 1NJ6A 4H6PA 1MCZA 2QSUA 2WT4A 2O8BA 1LC3A 2DKNA 2TMKA 3OZVA 1OAOA 3X1YA 4DZRA 1BOFA 3N39C 3E70C 4B34A 4K86A 4UZEA 4O4LA 5DN6A 1J9EA 2ZI6A 1FTQA 1KBQA 1SVUA 1CJSA 1UMDB 2Y05A 4OK6A 4UJ5A 5DTEA 3UUGA 2BBOA 4GYKA 4EGJA 2A9FA 3EYAA 1MB0A 2V7WA 4CFZA 3GFVA 1R4NB 1ZXXA 3GWZA 3FJOA 1CSEE 4JP2A 3NVAA 2YDXA 1O94D 4J07A 3THOA 1E5XA 1P0CA 2PH3A 3EXHB 1U0SY 1OWNA 1RYEA 5EP2A 4CMAA 1RAIA 4B48A 3A1CA 1PAUA 4R0NA 4NHEA 4JLBA 3MAJA 5JNTA 2Q7OE 5JYEA 2HQOA 5GM2A 3N2YA 3NGLA 5I8ZA 2PLAA 5C35A 1X1DA 1DZ3A 3PTZA 3TQFA 4W5HA 2GPTA 3QLUA 2FMIA 3ND8A 5BQ3A 3OIVA 4JEHA 1BMDA 1VYVA 3IJEB 2A1UB 3LUBA 4ZC8A 4MS3B 5JDIA 3FUUA 1BYUA 2AQKA 2VNSA 4L27A 1XTIA 3WRWA 2VP5A 4I5GA 4WIAA 2RI6A 5C3MA 1Z6PA 2COEA 2DHQA 1ZM4A 4KWIA 3X43A 1P18A 1D2NA 5L53A 2XTMA 4ND1A 3GQBB 3DWGA 1FDTA 1JLHA 4LW8A 9LDTA 5AVZA 2DERA 2QN7A 1R8JA 2NQ2C 1ES9A 4HDMA 3WWOA 5LQNA 1KVSA 3ILYA 1T6BY 3LUGA 3RS0A 5AVTA 5GJBA 4JEIA 5IEJA 1U3CA 5U4XA 4Q3BA 2YC4C 2AZDA 2OMKA 1I7QB 1XIVA 3PBKA 1F0YA 3KK0A 3CLSC 1C81A 2V1UA 5FUXA 3GARA 3PNYA 3T7SA 3S7TA 5BMOA 3P0RA 2QRKA 3G2QA 3V7UA 3T1OA 1QJ4A 4XSHA 5JT1A 2CVOA 1U7DA 3VU3A 1QRRA 2PJRA 4D3SA 2W6JD 3U26A 4O1HA 5KNBA 4H3SA 5DNYB 4RVCA 3AVVA 2JJ2A 2PL9A 1FSSA 4HZGA 4HDKB 4ENQA 2VDKB 3C98A 3N6VA 5AO9A 4HS9A 1WAMA 1T4BA 2ZYRA 2FVXA 3VU9A 3FCCA 3FXAA 2OV6A 3KR0A 4S0ZA 3IQGX 1S8FA 3ZQ4A 4L5AA 3VTKA 1P7YA 1RPZA 1I80A 2REQA 1PSDA 3Q3VA 4ME6A 4U7FA 3NYRA 5BN4B 5CD9A 2ZIFA 4QDUA 2ZWIA 2JEZA 2C9BA 2I6SA 3VV3A 3WGUA 3ADDA 2NXWA 4LJRA 3ENZA 3LP5A 4K6HA 4P83A 5JBIA 4MI6A 3HABA 1D1QA 1GIAA 3ZX5A 2REBA 2CJXA 1A9OA 4CT5A 3CLUD 2I34A 2QGNA 1OX6A 3AVUA 2W6OA 3VC2A 3TZCA 1XWIA 5K0TA 1RACA 1CE8A 1ZC4A 1TYDE 4NPCA 3A2MA 1RWWA 1QZZA 3H1GA 5BWMA 1X38A 4CMKA 1JTEA 3CONA 3A6PC 2PA0A 4GSYA 4WHMA 2OD2A 2I55A 4ARZB 4DCTA 1S2OA 5KTYA 2OOSA 4K05A 5DZSA 1JTFA 1JBEA 4FIZA 4GPD1 1I3MA 3A9UA 3BIOA 3V7FA 1BE6A 5A3JA 5EKUA 1QP4A 3NIGB 1H2FA 5GV8A 3TWOA 4JCOA 4ZV4A 3EPPA 1P5JA 3QFSA 4N6NA 3NXSA 3ESZA 3ZDEA 3FVWA 1JEEA 1QK5A 1J06A 5IAOA 1QIIA 4UE2A 1A3CA 1EK2A 3M9LA 5CTAA 3D7LA 3OE5A 1U8UA 1NZJA 2H63A 3NWBA 4ZJYA 4M9CA 1H6BA 2FPPB 4L3OA 4ZOEA 1RI2A 2QUBA 1FDUA 3N2EA 3RNOA 3FZNA 4B76A 8OHMA 2DX7A 1UC5B 4ESEA 3OOHA 1FP4B 1A97A 4KPUB 4YWJA 1QHEA 3E23A 3JASA 3UYLA 1WOMA 4HGZA 2BJWA 1N6KA 4KV9A 4LF7B 4EMTA 1D2AA 4N6OA 1FEZA 1ONOA 1ZJ6A 1QPZA 4CKCA 3AYZB 5CXQA 4R2LA 4OJKA 2HF2A 3SZOA 1T34A 4X1KA 4GEKA 3DLAA 2CLOB 5EIAA 4AZ0A 1UF9A 1XALA 3UUFA 5KNCA 3HKCB 5KNBH 5GZ6A 1ZR2A 2YYSA 3HCOA 4DIOA 3CO5A 2CXUA 1SWVA 1KEKA 5CFNA 4G41A 2SCUA 1UPBA 3WWPA 3BRSA 5CVJA 4PZPA 5BVGB 2VHEA 1G38A 1E5TA 1HQKA 4JL8A 4MJ3A 4ON9A 3RTEA 5B3KA 1JDSA 4NCNA 4E30A 1MZPA 1AHIA 3RSZA 3V7NA 1OB2A 1AUPA 2B7LA 4X8LA 4DLKA 2VF7A 4LJ7A 4HV4A 4L4ZA 3LQFA 4J0EA 4TL6A 1JLKA 4UPEA 5MFPA 2GZ1A 3OM9A 3KB6A 1LNSA 3MLEA 1ZM9A 2IHBA 3E22A 3E9MA 1EFTA 2ZRPA 3K1ZA 4N5MA 3DSRA 4HAYA 5GPBA 4M9SA 1EFVA 4R9NA 3WP1B 4L4RA 3ZHRA 1E1MA 5CA1B 4XVUA 2W8BB 1YZ3A 1CD5A 2AVNA 1L4BA 2YQ4A 3L4BA 4AMUA 4BUZA 4E5MA 3ZW9A 1QVRA 1CIJA 1R8YA 5KTSA 1JI3A 3ZYZA 3X2FA 3ZXUB 1LTHR 3T9CA 4JYPA 3BN3A 3LFTA 5ALEA 1JXQA 3LHDA 2Z5GA 3OUUA 1S6YA 2DFPA 5JSZA 1RYZA 1Q5PA 1PDWA 3N9IA 4DV4B 4OQNA 1V7CA 3PDCA 1O6GA 1XMSA 3NI2A 4U2BA 5EJ4A 1EFPA 5IULC 3BBLA 4OHRA 4H7KA 4UNQA 1PQ4A 4NU0A 1PFKA 5AK0A 2JCVA 3K6SA 2CL7X 3DTVA 4CPDA 4TXJA 2DQYA 4MO2A 3QV1A 4MKHA 4M6WA 1TIPA 1JLMA 3R3XA 3KQQA 4KU4A 4QYIB 5ECDA 3WLKX 2B6NA 2NU7B 5TQ0A 2IA5A 4TSKA 2QDKA 3IDOA 2DHRA 3G0IA 4EH1A 5CFLA 1N2BA 4INOA 1Z2OX 2IYEA 1RRPA 3I0NA 4AJHA 4YRKA 4CN9A 1M72A 2XA9A 1E1QD 2HQ1A 4MVJE 1CCWA 3K9WA 3S2YA 3GZTB 1KI2A 3VPSA 3VAZA 5TEWA 3M83A 1KJJA 2IU0A 4DDMA 1FA9A 1YZKA 1ZK2A 1O57A 1ICEA 1RRGA 13PKA 3PD7A 2QK4A 2C8JA 2OP1A 3C7KA 2J85A 4I08A 4MYSA 3O31A 1NZFA 1SMKA 4R69A 2W48A 2C3MA 5KNCH 2G9NA 3ZNOA 2IDZA 3BFJA 2AFHB 1A4UA 2EBWA 2SKDA 4A91A 1P2FA 4I1OA 1BFUA 2INGX 2ZANA 3H99A 2F3TA 4KIJA 4R8RA 1AKNA 1IHUA 3B6JA 4LNAA 3KBOA 4CNQA 4PLZA 3FFTA 1H4TA 4N7RA 4G5GA 5SZHB 3WLFA 4UCWA 4DR6B 2AJ8A 4TLDA 4AZTA 2H59A 3E7FA 1OFUX 3IPYA 1DIAA 2XRMA 4HMQA 4LJAA 4QGGA 3WKEA 3DOUA 4YPOA 3U1BA 4LYJA 5DOVA 1Q1BA 1KI7A 1RQNA 3MJ4A 1GGJA 3KJHA 4DQKA 3CWQA 1ISGA 4WOJA 3TIGA 1T2UA 1SK9A 4AG5A 4R1UA 5I5EA 3THSA 2W2KB 5THQA 1Z4KA 3Q3JB 4BWYA 4EW2A 1MW8X 3B3JA 1Y33E 4TMWA 5I7FA 1N8TA 3Q5GA 5DTQA 4ZAYA 3CX4A 4QSHA 3QHQA 3GL9A 3I2IA 4WFIA 4RTNA 4UEKA 1EJ6A 1U2DA 2EW8A 2JIDA 3G2LA 2ZTUA 3KAKA 3D81A 3WJ7A 3ZXXA 3E61A 4KXFB 5C8YB 1SIUA 2QV7A 3AKYA 2X1HA 3NHPA 3R7BA 1SUBA 2F8MA 2JZNA 1JAYA 2WU1A 4F9TA 4BNYA 3NS7A 3FYCA 4TKZA 5JEEA 4FU0A 3HM2A 4L51A 3VKUA 1XZGA 2ZAMA 4AP9A 5LP6F 1HZZA 3FW1A 3UFXB 4BB0A 1A7JA 3UJCA 5DMXA 1VYHA 3P94A 2ANCA 3SM9A 3T7RA 1PQUA 2W37A 4DT1A 2I67A 2VXOA 3RV4A 1B0PA 1Z0DA 4ZOLB 3M1AA 1XVIA 1G9TA 2BIFA 2C0QA 3A0RB 1B6GA 1CEXA 1U1FA 2P2CA 3NC0C 3MIIA 4P7GA 3T1NA 5DGDA 5EPOA 3LC7O 3C48A 1H2AS 3TJRA 4TKLA 4DQVA 4CCSA 1LU9A 3D02A 3KR2A 3ZW8A 1RQLA 1IUOA 4OK3A 4JI7B 4K9SA 1BXGA 2CXPA 1ZUNB 3A1VA 1VCIA 2VHXA 4ZVMA 3STWA 3CFYA 5EIOA 1XQ6A 3EZ9A 1PWYE 3IXMA 4MHSA 3TF5A 2BFWA 2GERA 4OF4A 2BSXA 3KALA 3QVLA 5T4FA 3T5AA 1OFTA 5AW7A 1T9HA 4QEKA 2PGXA 3EA5A 3D7RA 1ZEMA 2QX4A 3AQ4A 4UFOA 3T1YB 1VE6A 3IV7A 5FBZA 5ITWA 3S8EA 3F6RA 3RBZA 3HBFA 4AJ4A 3P0EA 1G17A 4MS1A 4CQMA 1LPMA 1FX0A 3EASA 3H4TA 4PZ0A 4JBYA 4QUGA 3NGXA 1WABA 2W22A 3KB8A 4PZ9A 3KE9A 3TD6A 1NW8A 1NN1A 5K0JA 1GP2A 1YOVB 4RMGA 4W9NA 1EUDA 1RLOA 1XDDA 4REQB 3EW9A 3FCYA 4D96A 1YHYA 3QKTA 4I3FA 4RABA 4HF7A 5G2OA 5IAAA 1RPJA 4Q4AB 4KODA 1XL0A 3H6GA 5HWSA 1L7EA 4DLTA 2IUSA 2HMTA 1HLGA 2G5CA 4LHXA 4TTIA 4EKYA 1N0UA 3GLUA 2HK9A 2NSYA 3FDIA 3N6RA 4H1HA 2IV7A 3SQWA 1EDOA 2BI4A 4N4AA 4HNAA 3NM4A 1RLMA 3QEBZ 1UC9A 2G1KA 2R6AA 3LBYA 2RHMA 2Z2ZA 4PXAA 5E6UA 4F11A 5IUNC 4U2EA 1UFKA 3K8ZA 3EZYA 2ZSBA 4OGFA 3GLTA 4AS3A 4RU1A 1PNQA 4DC9A 2DFDA 2P7HA 2WKWA 1SXPA 4YONB 3TSOA 3AJEA 1NJ1A 2B4AA 5HE9A 5B1IA 1Z08A 2YFQA 3COPA 2FW9A 1U0TA 1DQRA 3W5SA 1JHDA 5C8ZA 4LNHA 2Y8EA 2OBMA 3L8HA 4F92B 4EJSC 5KCZA 3MWFA 2XNSA 3R3UA 4YA6A 2EWWA 4X71A 1KSGA 4JI5B 2UZ4A 4OQZA 3ZIDA 2HF9A 1J56A 3T5MA 1OR8A 5HZMA 2WJZB 2UZ3A 5DWVA 2P6NA 2VTKA 5CFPA 1EGMB 4FNMA 4MGYR 4KL8S 3HUUA 1TADA 4BQNA 4PONA 4CMEC 4L8FA 3PFHA 3FPLA 3OTOB 4RPIA 2R3SA 3DMHA 2G40A 3T06B 1Z7EA 4OMUA 3MFYA 2F3PA 4JBWA 1JEJA 2V4MA 4BMZA 1XFDA 4XLZA 1NG1A 2VQSA 2WIDA 4PHTA 3HXPA 3PQ4A 1YS9A 4OGLA 3BRWA 3LVRE 4WA7A 1YIOA 4B4KA 1OWMA 3HE3A 2B3TA 1XXHE 1TF5A 1NP6A 4Z8XA 2JFVA 1JFLA 1U5CA 1VPVA 5NLLA 1B3BA 3B3FA 2AQ8A 4R2IA 1KC1A 4Z6KA 2J07A 2H9IA 1G1MA 4ND3A 5HW0A 2VRBA 3IRUA 2Q6LA 1RFLA 2J7PA 4GZLA 3TAXA 4F9GA 5HJ2A 2CLCX 4RKWA 1K8QA 3VR4D 3MGGA 2C5AA 2ZREA 3BK1A 4TRJA 4KGXA 4B17A 2CJWA 1SKUA 5DSTA 1RRFA 3VYRB 2VF2A 4Q4HA 1VL6A 2XVYA 4GR4A 1ESNA 2GT1A 4HUQB 4WXMA 1S4MA 2LUOA 2OYSA 3GBSA 2C2YA 4OQDA 4F2GA 3A2NA 1ACJA 5I9NA 3TRJA 4UULA 2WHYA 1V48A 2GLXA 3FWNA 3BWBA 3E0XA 3U7FB 2HA0A 4JP5A 1ADBA 3FB1A 3KBBA 2JHFA 4J3NA 1ZM3A 3WRYC 1MO5A 1N3LA 2V65A 1GGHA 1ETHA 1R50A 4LJLA 1NM5C 3EUAA 4JH0A 4QRIA 4NAHA 3I01A 2NZVG 1ZD5A 2C04A 3EC7A 4NH4A 1ANKA 4LCEA 4ZOBA 5FNZA 1JN0A 1QWSA 4ZVLA 3W1VA 5KTOA 3ESYA 1ACMA 1WVGA 4Q03A 2QP3A 2FDCA 3Q1KA 1EFKA 1UMCA 1XF9A 3A4IA 1Z07A 1XRPA 2YXPX 5PGMA 3WLLA 1ZD9A 3A10A 3K1JA 2EBUA 3PHJA 3DEFA 1JLRA 1SURA 3GJ6A 1JKMA 4N7MA 1EFLA 3GGOA 1OH7A 1UM8A 3RS7A 3GBVA 5IBCA 1WCYA 4LJ4A 4ZQFA 2CMHA 3VTAA 3E4CA 3OZGA 3WA7A 3PX7A 1GTMA 3G9QA 1RM4A 1VXOA 3WNVA 3AP2A 4OHKA 3L6UA 1MAHA 2XQFA 4H4CA 3UMVA 5KOIA 2C77A 1MR3F 4OAOA 16PKA 4UBOA 3ZC3A 1H2ZA 4JY7A 4A4DA 2ZB8A 3BREA 2LWIA 4K26A 3GT7A 3E9EA 3FF4A 3EOBI 4DM7A 5HM6A 4G0WA 1KH1A 1H23A 1U6JA 1LVHA 4LY9A 4KOEC 3ESRA 4AZSA 3U4HA 2V8BA 1GAXA 3GWGA 3RHSA 2WE8A 3ETJA 2AGVA 2Q5JA 3F4KA 4B9AA 2JEOA 5EL0A 1V37A 4QODA 5ETJA 3SR3A 4EI2A 1PX2A 5E9AA 4M9UA 3UMCA 2W6ZA 5ALYA 5JFOA 3TG8A 3OU2A 4YCSA 2PQ6A 2Y0CA 5F4ZA 3COZA 2WA2A 1HA3A 1QGZA 5HE8A 1SG0A 4TZTA 3SZGA 4XFJA 1JGTA 2G6TA 2QRZA 1E63A 1P5HA 1YZHA 3CCBA 3HI4A 3OZEA 5KAMA 4DJEC 4EBFA 4EG3A 5LLTA 1N2CA 4OV6B 1I7DA 2ZI7A 3EXEB 5ITZA 1EVEA 2IHTA 3SG0A 1NQVA 2GFQA 2YZKA 2I3BA 4UNPA 3RK4A 2O57A 2NUPB 4GGOA 4L76A 1PZXA 1RJFA 3GP3A 3MCVA 3KKKA 4OQPA 3QU9A 1JE0A 3IPLA 1TPZA 4LYAA 1NKVA 5B64A 2OYCA 2Z2JA 3PQ6A 1TAGA 4HSGA 1SJ9A 2XB6A 5D3MB 3EB9A 3MS4A 3OHSX 4QOSA 3OEHD 4J9UE 4LDQA 1BNCA 2W83A 2FFJA 1KJIA 1L7MA 2OV4A 3O93A 3WYEA 4E5UA 5KMGA 3GLGB 1IN8A 4ISCA 1VYTA 4EFMA 2WWIA 5SY4A 1RCTE 1NDUA 3I76A 2HHLA 2P7IA 3BSYA 1EX6A 2HTEA 1KIAA 2AN1A 3F3YA 1E9BA 1X74A 3PRKE 1AIPA 1PL8A 4IHAA 1QU2A 4BBAA 3FOZA 1I94B 3ZHVA 4IOJA 1ATIA 3AVXA 1UAYA 1Z7YA 2ERYA 3KZ1E 3PXGA 2DQSA 5LL6P 3C8DA 4EX6A 3CXUA 3E5RA 1A9QA 1TGVA 4MUEA 1Y8RB 2PWBA 4H1UA 4XQGA 1OLSA 3PQ5A 2E4WA 1VBNA 2F1JA 4M8KA 4IQ4A 521PA 4QVKA 4XGNA 3ZDCA 1YUNA 4WLNA 4BIIA 4Z0TA 3R9XB 4IYRA 5IVIA 4BVAA 4TV8F 1MTOA 1UIRA 3LT4A 1E2FA 4QBHA 3RSLA 1A4IA 4F0JA 1RZUA 3INTA 2FN3A 3GCGA 4MOWA 1II8B 2WF6A 3GFBA 4R8LA 1QC5A 2FMFA 4BLOA 4EHKA 3AEUB 3T9DA 2PDAA 1RYBA 3SDBA 1KPIA 1VA5A 2Y3IA 5EE0A 5B4UA 5LA6B 1P2DA 3VZDA 4K03A 1Z4QA 3PX2A 1BD3A 3S81A 1HH4A 3WAKA 4PSKA 2WM2A 3TIIA 4CKWB 1UPXA 4RZ2A 3JATB 2HMUA 5CJPA 5GONF 4MR7A 2PYZA 4CUZA 5LOVA 1EWTA 1VPWA 2ZRFA 3JALA 4UNIA 1OGIA 3NM6B 2BJVA 2HU5A 4MJLA 5JJLA 2QQFA 1M7GA 2WHEA 3PNSA 4LRSB 1UJBA 2QTBA 1CC1S 1SBNE 2HDNB 3K8QA 2FHPA 1X0XA 3INYA 1WV0A 4N49A 3OESA 3V1MA 3TQHA 1EVLA 1M83A 1WLYA 3NP9A 1GFWA 2AYZA 3Q5EA 4IIHA 4MW2A 3V34A 4OIFA 1KZYC 2BR4A 3FH0A 1RI5A 3AY0A 4GEGA 5JVDA 3N3AC 1AGXA 3PHHA 4PC7A 3ZWNA 4QRDA 5CH8A 1WZCA 3HHEA 4JYMA 4TWRA 5SZJA 2LZ0A 3BE6A 5KTPA 4MS4A 3KZXA 3TTVA 1CQJA 2JVJA 2X3YA 4OP3A 3OOSA 1YDMA 1QS0B 3KOUA 4IS3A 3DQPA 2VHWA 4BLVA 1T3GA 2O2JA 4Q3AA 1X7XA 1ZC3A 2IWHA 4N47A 3SAJA 5C7YA 3EGDA 3OCWA 4MW4A 3CVUA 4QX6A 2H5IA 1V8PA 2EP8A 4QZVA 1YQGA 4Q7EA 4OLBA 2EGUA 2Q07A 3WQHA 1EJ2A 2QR2A 3FX2A 5KQMA 2XAUA 1URPA 2HUPA 1YR2A 3PEYA 5KYYB 2D06A 3WJAA 5ARBA 2HXSA 2G80A 2IKSA 3EA0A 4YAIA 3X1XA 1TZJA 3THXA 2W71A 5ALLA 3AB7A 2A92A 1F7VA 1GILA 1JKXA 3MT7A 3OBBA 4WUTA 1SB9A 1EQUA 2VT2A 3F96A 3H9BA 4JK3A 3E81A 4H1TA 3ST7A 1U2QA 3DHWC 3P9RA 2O3SA 4NOJA 1PFYA 3DV2A 4M1ZA 1E3LA 4WI1A 2XXJA 4X6UA 3T0FA 4ZHSA 2FUKA 3Q7QA 1S8AA 5DWQA 2FWIA 1MHTA 5I3CA 2GKOA 4F3KA 4JLSA 4AY4A 5KSOA 1EZZA 3FRHA 1X7HA 3IEUA 4UXHA 1XEFA 3EIFA 1KO5A 3JV7A 5IARA 2OGWA 3U3XA 4C3OB 1R4ZA 3ZZMA 1DIRA 2ZB2A 2AN9A 3KTAB 1YQXA 3WWYA 1YRYE 3IAS6 3RQIA 1U2GA 3UHFA 4WOKA 2CHVA 5LZ4A 1Z56C 1BMQA 1T3HA 1FXUA 1I0ZA 2DYKA 2JD0A 4W4TA 3T3IA 4FFOA 1DRWA 3X2SA 3TG2A 4I8IA 3ROZA 1WWKA 2IYXA 2P3SA 3DTYA 5I8WA 2QGFA 1NXOA 3GDOA 3C5VA 4DJFC 1FXWA 4MYCA 3P19A 1Z0IA 1BX1A 3RRMA 5F9HA 1QNLA 5EG5A 3PXEA 4LA4A 3OTQA 1HDGO 3DFIA 4BO8A 7YASA 4DA7A 3LGSA 4CKZA 4PU0A 1GQFA 1KBOA 3PFIA 1DOHA 3H84A 5HTKA 5K6RA 1B00A 3W4IA 3O38A 1A88A 2H1WA 2XBUA 3OZBA 4X24A 3TTSA 1SA0A 2NT4A 4JSYA 3PFWO 3IELA 4LRUA 4BATA 2V97A 4PYJA 3KDPA 3Q3HA 1HE4A 4R6WA 3PE4A 4WJLA 1BWPA 2IZZA 1TC1A 2WSSA 1PR4A 5JRZA 1J23A 2HIAA 5ENZA 1NG9A 1M2NA 1LLQA 4BUJA 3HDVA 4F4CA 4QYXA 3TDKA 1EXDA 2PWAA 2I4LA 5F4BA 1PK9A 4Q21A 1W25A 3CR8A 3QENA 5G02A 3ZH2A 4E32A 1L5GB 3JZFA 2VYQA 5DBOA 3WK7A 4TPKA 1E2IA 2IS4A 1XLTC 1R8SA 2AXPA 3QMMA 2WJJA 2OXRA 5J2TB 1JLLB 2J4CA 1M34B 4CU5A 3R3VA 4JP1A 1SXJC 3QPWA 4AMVA 2P9TA 4RX1A 3THYA 1OWLA 1U7ZA 3WGHA 4HVCA 1L5SA 1S0UA 3G49A 3LOUA 3TK1A 3U56A 1OXVA 5KEIA 1R88A 1UPCA 1X8LA 4NV3A 4G1FA 3MJTA 3JZDA 2IPNA 2A9VA 2H4ZA 1EQ2A 2BMJA 4MW1A 5J2UF 2FG7C 2GR9A 1R4MB 1VBFA 3CE6A 4N0MA 3SMQA 2BELA 3TLEA 3WKAA 5FLXA 1IIRA 5BSVA 3E27A 1E3DA 3RVDA 2FI1A 3IHWA 5CB0A 4OH1A 2ZBEA 3FMVA 4TTVA 1KDRA 4ZVTA 1FJHA 5HDQA 2PXXA 4BMDA 5B30A 1QF6A 1Q83A 2L18A 5AVXA 5COAA 5EE5B 1KO4A 2WHQA 3M4XA 1CNFA 3AWIA 2HIHA 1P6XA 4GT1A 4WVLA 1OKKA 1RCUA 5FB3A 1PV1A 5E6RB 3O75A 5REQB 4FGWA 1KYZA 1D2RA 1FMJA 4NYMR 1VB5A 1DKQA 2R5NA 4FYVA 5D1HA 4CT0A 3MF4A 1HM5A 3SLRA 1M1YB 4BO5A 1RI4A 2DGDA 2H31A 3FGNA 4FCVA 4Y1GA 2V0GA 3C3CA 2AW5A 1TVKB 1K9VF 3NPMA 4MWBA 4A2PA 4AXXA 1K63A 3W8EA 4B3FX 3GDWA 1GRQA 1HG1A 1FYXA 4MGKR 5G53C 4DIEA 1S01A 4ZYZA 5IXSA 4W5NA 3L1JA 2R6R1 4H1VA 2M6RA 3O4JA 2O8FB 2C3OA 2XEDA 1KAMA 3RANA 3IVCA 3G3EA 1QZ3A 1GUAA 1NFRA 2QL7A 1WVMA 1NQXA 4KN8A 1J1ZA 3G1UA 4U5QA 4ALLA 4Z99A 2P9YA 3DGFC 2FHSA 2P30A 2GHIA 3HXMA 2P6OA 2JAOA 4O59O 3ZGZA 3ZJTA 2CE2X 1NSTA 2QYOA 3BMOA 4LXUA 3D8BA 3ICQB 1B0UA 5A0VA 1QRDA 1O9GA 5D5QA 1V1MB 2C29D 2X6TA 3ZU2A 4EFDA 5AUQA 2XUPA 3BE8A 4ID3A 3TCXB 3KOXA 3UBMA 4ENWA 3MCAA 4REMA 2YHBA 3A4TA 3M1LA 4J6FA 3FCUB 2BMEA 4DADA 1BCRA 1NW6A 2XYQA 5TB5A 4ESHA 2VAMA 3PRJA 1Q57A 3K30A 4KWEA 4PR0A 3CUKA 2NSHA 4DLZA 1CYDA 4KITB 1ZVVA 2BF7A 4IKEA 3WHPA 4EY5A 2WIJA 1ZU5A 3E8XA 1H2HA 2G71A 3WFIA 3ZWMA 3CLRD 5D7BA 1YBHA 4A0FA 4QELA 3P71T 5TGTA 1LGYA 3G9TA 1T15A 3HMKA 5DX1A 4EP1A 3CW8X 3ER9A 1V7ZA 4IDAA 1DBVO 2G4VA 2GEDA 1DRVA 1XYYA 3HB5X 2H8GA 4IQGA 4B09A 4G5XA 1FTGA 1W0JA 3QTLA 3TB6A 5L3VA 2GJAA 2V7EA 1ZI9A 2QKYA 5JCJD 3PDJA 3O8OA 3JYNA 1JHVA 4U8HA 2II6A 3DULA 5LXTF 4DPKA 3FPHA 4UCXA 4LV5B 4L3WA 3U7QA 2OHVA 3FUVA 3L0IB 4PNPA 3PTAA 4NU8X 5E4JA 3BQMB 4Y6PA 5LMZA 1ND6A 4MEJA 3F7NA 1OZFA 3V5NA 4EIWA 1GQ2A 1VL1A 1OYWA 3MSXA 2IZOA 2ZYWX 4NMHA 4Q3EA 2PGAA 1OLOA 5CDSA 4DIMA 3ASUA 5LCXA 1VE1A 2F62A 2ZBGA 1ESZA 2XWBF 5JJ5A 2PN1A 3LWZA 4ZO6A 5DXFA 1IG3A 3H97A 3OCUA 4ENVA 4U7JA 3RRFA 3UMMA 3USCS 1RWXA 4M8NE 1X7GA 2WW8A 3C5WP 3N8KA 5GJCA 3CVVA 3HU2A 1W75A 3F6YA 4FZ3A 4C0XA 4EA6A 4EYEA 4HWOA 4EKEA 5H02A 5FJIA 4HMPA 3M4ZA 2ZR0A 4N5DA 1TKRA 2EP5A 2WTEA 1L7PA 2QYHA 5EXPA 1X77A 2CFRA 3EIUA 3GIDA 1EP2B 5AVRA 5DLEA 4BFCA 1O4WA 4P31A 5FL3A 4BNVA 4IQFA 1RHKA 1GZ5A 1XELA 2XF8A 4GMFA 2MJLA 3JPYA 4EJSA 3Q5DA 2XNJA 4A7PA 4A23A 2X1LA 3GJ0A 3KXPA 3TR6A 1DU4A 1M0EA 2EAUA 3G23A 2FPRA 2XTZA 3DKPA 1OZAA 3I4FA 3N8DA 4O4JB 4D79A 1PYOA 4CV3A 4BGUA 4O63O 1T1RA 3VO2A 4F21A 1JEYA 3TLXA 3JQ7A 2QPAA 1QB8A 3EVZA 1S2IA 2VUSA 3C8HA 5SV2A 5JYDA 4UMFA 4NEGA 1DDIA 3IUEA 1LNZA 1TK2A 3GPCA 3AUJB 4WEOA 2QXYA 4FB4A 1QR2A 4QPNA 2FZLA 3F8TA 2HZBA 4D7AA 4V3CA 2VKTA 3O2SB 3PFNA 4Z9YA 2QJWA 1G8GA 3ROXA 2YR0A 5JYBA 3CTPA 2BVNA 3L7LA 3AXSA 3FPJA 3OZIA 4P2BA 1BMFA 4BX9A 2MHCA 5BRAA 1F9EA 1M2OA 1ZSVA 2ZJBA 2ZT7A 4WOPA 2NO1A 3KFXA 1CERA 6PFKA 5CIWA 1IBMB 2Y92A 1QFZA 2C8KA 4GI5A 1DEKA 4IOKA 4BN0A 3T3OA 5JE8A 1ZGBA 1ZZGA 1MU0A 2Q2QA 1GT91 4HPWA 4RMHA 4LMBA 3CKKA 5HPYB 1DJMA 5HSGA 4FNOA 4PVCA 1CT9A 4WRRA 2JLCA 4OKIA 3OZFA 2AC2A 1Z22A 2QD1A 1G20E 4BZXA 4FE7A 4BMXA 4OUKX 1TYEB 4IIYA 4NBNA 3EX7C 5DI3A 4A8TA 2FR8C 1RP7A 1PJAA 4M1YA 4WEQA 1NULA 3MWEA 3GCZA 3S5UA 4U39A 3BJEA 1O94C 1LPSA 4R8SA 2OG2A 1OMOA 2HRRA 4IDGA 4PQEA 4RJ2A 1LLUA 1QV7A 1RBZA 4I1YA 4TLAA 4O2BF 4WXYB 4MA5A 4MLDA 1J0DA 3OPNA 1CUXA 1ST2A 3B9BA 4KQCA 3WISA 5KOHA 1G5HA 4KNWA 2NMVA 3AUKA 3BYZA 1NM5A 1O96B 3QF4B 2WY2D 3FWKA 1T2EA 3FA2A 4XZ3A 3FY4A 2BC9A 5FQNA 3WLPA 1KWGA 1EVIA 1JEQA 3ZDYB 3H7AA 4WY5A 1IHOA 3A6DA 5JSKA 4CLRB 2GVDC 4YQYA 3A9CA 4AF8A 3JSXA 4KAXA 3RC8A 1EK6A 5FOQA 1B8UA 5K3AA 5T4BA 4EGFA 3NAQA 4HHEA 4URHA 1PLLA 3IAHA 1TZKA 5AVJA 4BN5A 5BVHA 3RRZA 3UC5A 1P7VA 1A7UA 1R16A 4R9SA 6CHYA 4DIFA 3OQOA 2J31A 2YY5A 4Z51A 4C14A 3W5VA 7GPBA 1P9OA 1O9BA 2C2WA 2VDPB 3AIIA 1TVCA 3KLPX 2WYUA 2Z57A 2A0XA 2QA5A 2NIPA 2IHKA 3E9QA 2IUYA 1ECFA 1K75A 1NUQA 4JUCA 2AZ4A 4F93B 1BGWA 3I8OA 2GN0A 2ZLBA 3DD5A 1OV4A 1T1JA 2RGBA 5GOTA 3UXYA 4Y7DA 4F06A 1AMUA 1XMXA 2IU4A 1N2CE 2QNRA 4RZQA 2PG3A 5IC4A 1FRZA 3RFVA 1D4FA 1T36A 4EG4A 1YRWA 1J8QA 2BP7B 1CRZA 1GHTA 2P9QA 2ZJ4A 3CNLA 3LX4A 4HFJA 4BC0A 2VQFB 1YZGA 1OFVA 2Q1TA 1VQ1A 2CJFA 4R81A 1SCUB 1C1YA 4NZYA 4ZTZB 2JJQA 7MHTA 4WKPA 4EHNA 1JILA 3BWMA 1TTHA 4YJGA 3OQIB 4MIEA 2C31A 1IK4A 3K0AB 1W5BA 4HXYA 4MZXA 2KQUA 3NW9A 1A7AA 1P5RA 1IFXA 1GL3A 2GMWA 4I6EA 2DKFA 1AUXA 221PA 1E4OA 3A6HA 3OWHA 4PG6A 1C8LA 2NPOA 2WEKA 2OKGA 3GI1A 1LD3A 3KKNA 2R5WA 4KV7A 5BQFA 3G2MA 4UCFA 1Z0SA 3GFGA 4QDXA 2IDJA 1XZ8A 4KH0A 3R41A 4EAQA 5DLYA 2HPHA 1QFXA 1MABB 2VI5A 5AW8A 4URWR 3SJBA 4CM3A 4YJKA 1TO1E 2FFQA 1RZRD 1GRVA 5CA0B 5CFOA 2EZTA 3GUVA 2YMPA 3LC0A 5CURA 3EPHA 3VPFA 1D8AA 1EFAA 4JI8B 4MDYA 4BYGA 1XCOA 3JAMA 2RE8A 1UKEA 3K32A 2Y68A 8LDHA 1VJ5A 3AJ8A 3CLUC 1ORIA 3B1XA 3KZKA 1XT6A 1ZHFA 5ISMA 5EI5A 4OJNA 1EVYA 3SKVA 1ISFA 3DONA 5IS2A 1P1IA 2EQ5A 4KQIA 3LVBA 4QFDA 3E3OA 1QJCA 4ERNA 1JQDA 1UT6A 1ZCJA 4MITA 5ILQA 3S2IA 4NS1A 4JXXA 3GJQA 4ATNA 1NI4A 1IONA 3QJGA 1SELA 2XR1A 5CEJA 4WK0B 4HFNA 4PG8A 1EUZA 1V0JA 2ADFA 2RBGA 5T4EA 1SOUA 2HBRA 2Y0PA 2WIGA 3PC2A 4FBLA 4WL0A 5FPTA 3VAAA 1OU4A 4NZPA 5ELMA 1DC4A 3GFQA 1KERA 1R4AA 3PA6A 3PLRA 1A77A 4FDTA 4LK2A 2YN0A 5ALMA 2O5CA 5DTJA 4GUDA 3GLKA 3V00A 4JQYA 5HXAA 2X2PA 4BQRA 4FSHA 1P81A 4DCJA 2CVQA 1IY2A 2X86A 5BNWA 1H5QA 4GVPA 1MNQA 3TCKA 4LYGA 4DXDA 2D0DA 2ZWOA 5HQJA 4QUAA 2IDMA 5B55A 4FB5A 2JGDA 3AG5A 3VNVA 2ZQZA 2ONYA 3L77A 5YASA 4EJ2A 4CL8A 3GG9A 3GYBA 2IPLA 2P8JA 1PFWA 1ZCFA 3KVOA 5EFZA 4XQEA 4W1PA 2ZQ5A 5F3DA 4G3XA 3G2KA 4YLGA 2YCLA 2CNDA 5CBPB 1A96A 3A4MA 5AK3A 2WZCA 1EXMA 1I0IA 4H31A 4N82A 4YLEA 2XV1A 2YW9A 2FSHA 3DBRB 1RFGE 3PIIA 4MB6A 3VR6A 3WGVA 4EY8A 1TT5B 1Z0KA 4GOMD 4U4AA 3AF5A 4DMKA 1AK2A 2BM1A 2LNDA 1QRSA 4KDFA 3N7AA 5H68A 4OA5A 1CJTC 1OI4A 3P97A 5K1ZA 5KHAA 2H5JA 1Y9ZA 2C20A 4OYRA 2TECE 4C6TB 4RZXA 5CNJA 4EB6A 4UXIA 2GO1A 4BIMA 5C8DA 1CU1A 5E3HA 1GTVA 2FUEA 2FVYA 4JQCA 2OK8A 4TUYB 3TLKA 1B16A 1EWVA 2ODQA 3G2JA 1M73E 2R4TA 1XJ0A 3WQQA 2GBIA 1ZOPA 3L41A 1ZQ1A 2FQYA 1VPLA 4UQPA 4D3ZA 1Z73A 1VL5A 2GBCA 3WK4A 4CHGA 5BUQA 1TQ8A 3KSDO 3DOIA 5ALXA 5HX7A 3V2UA 4AN1A 2EDAA 2QT1A 3CKYA 4DS3A 4DABA 1PNRA 4U2GA 2Q4TA 2QG4A 5TY0A 1RE0A 1TKAA 3MS2A 2C4TA 3NR2A 4B2LA 3HRIA 3PVCA 4NTZA 1RJGA 4DLUA 1A72A 4ZO9A 2GBLC 5EEGA 4RL4A 4QHSA 1JALA 1KZ1A 2J5BA 3H05A 3DMNA 3K20A 3WMFA 3HJFA 3KQPA 2H0RA 1K4KA 3RVPA 2K2WA 2W2QA 5DFAA 2IEDA 4GKBA 1QV6A 4PRYA 3HWRA 4RGYA 3BA1A 3VOAA 5JU6A 2HAEA 4LVCA 3N2NA 4E0BA 4QU0A 3PXXA 2DUUA 3QVKA 2EJCA 4XASA 4A2QA 5JY6A 3KNZA 2WTUA 3LPAA 1SKAA 3HJNA 5E4YA 4CEIA 2BL4A 5IAJA 1KQGA 1TF7A 5K8VA 5L6LB 5EIXA 4KE7A 3TD9A 4DR5B 5DEOA 5GP1A 5B3JA 1L4YA 3GDHA 1YJCA 5DM70 2VPZA 1UBNA 3T4EA 3SFZA 4NECA 4XA8A 3VR6H 1YQ9A 1JHPA 3EDOA 2F59A 4DA8A 3OZTA 4EY3A 4FTWA 3AHHA 4YCCA 2PRJA 2QRVB 1NQUA 4U7GA 4A0SA 5B12A 1ZI6A 3EBPA 3WNDA 5AFSA 3X1JA 4Q1CA 1D6SA 1XV5A 1JBQA 3FNQA 5AOVA 5EXXA 1C3OA 4ER0A 4IHJF 3DO8A 4C29A 3OLCX 2IPAB 3RUEA 2Z95A 2QPLA 5KPJA 1MO4A 1XU4A 2PUJA 6ADHA 2DLNA 4DPLA 3FWYA 3L01A 4P3XA 2WVJA 2IU6A 2ZRCA 4PLCA 3TXXA 2H8KA 4M0MA 2XMDA 2YWRA 3OMLA 3SJAA 4CQJA 10MHA 1L8OA 3FPCA 1CUDA 1JPUA 1XZQA 2VUIB 4RJJA 3W8RA 2F2TA 1BN7A 2O0LA 1U28C 3DS8A 3NDRA 1HNZB 1EB9A 3BL8A 5BW8A 3BM5A 1MDFA 4GOKA 1V3TA 1FBTA 5LDHA 3NTQA 1TU0A 2BEVB 4OBWA 5DP1A 3WLIA 1MRZA 4CF7A 5AVYA 3U3OA 2FSVA 4M9XA 3TSWA 3EOZA 4GC5A 3WO0A 4P54A 3IJPA 1QH1B 1DARA 3O8BA 5KYUB 3ANSA 2XGJA 2L2QA 1GZ4A 2N9UA 5AVWA 1C80A 3E2IA 3ELBA 2HT1A 2HCFA 3DCJA 3GG2A 1RC1A 2ZSIA 4IZHA 4OB8A 4QAQA 5EQFA 3SCZA 3UATA 1KYXA 3QBEA 4YYEA 1XQXA 5JH7F 1GVHA 1B7GO 2ZIWB 2Y1FA 1ZNWA 3PDUA 4B81A 4G09A 5F1KA 2IYTA 2NAFA 4RGVA 4W6ZA 3DB2A 3DZBA 1KVUA 3IILA 3JZAA 3KJGA 3L6OO 4I4TA 2DBRA 1WTCA 3AEYA 1FOEB 1ZN9A 3LVFO 3Q9SA 4MROA 3TGPA 1OA0A 2ZBVA 4M1QA 2Y1XA 3SI7A 4JC8A 4BXOB 3IEPA 1CY7A 2YCBA 1JJIA 5BV0A 1BHSA 1MVLA 4HZUB 4C4OA 3RT1A 4BP1A 1NVAA 4BQOA 2WNSA 3MK31 2C5SA 2JF0A 3O3MB 4HLNA 1JSRA 3PHBE 4K40A 4LBWA 1K6JA 4WSOA 1R0LA 1WP9A 2GN9A 4GBED 1FNNA 3C3WA 4D8YA 1UFRA 1K1EA 1IH8A 5AR1A 5C7LO 3IQIX 5FP0A 1IE3A 1ULHA 2LP4Y 3B1WA 3BQ9A 5C1BA 4B3DA 2EOAA 3IOEA 5KVAA 1KI6A 3UK6A 2B1RA 1QR6A 2OO5C 3DOJA 1ZUIA 2QV0A 3S29A 4UTPA 4MUBA 2VDJA 2E85A 4XAQA 1A9XA 4B6RA 5HKBA 2VXCA 1YSCA 2PRKA 5HS6A 4L22A 1J1UA 2JKZA 3RU3A 3ANTA 2IY9A 4CV0A 4DVJA 4DV0B 3ZXSA 4N0PA 3G8YA 3KWFA 2HA4A 1ULAA 2J7KA 3AVOA 2HV8A 3RO7A 1U1GA 4WZBB 4EGSA 3LOPA 4K6KA 1QPBA 2QAGB 2AOUB 1FFWA 1PKXA 4XGIA 5ADUS 3EPJA 1NUSA 4MV8A 3O21A 3PDIB 2FW1A 4U7HA 5IT0A 5CLFA 2WJ6A 4YI3A 5FHRA 3WC4A 4F8EA 4X1OA 1Y6JA 2OLKA 1NOIA 1XN4A 1SAYA 2JJ1D 2PPVA 3WWDA 3ZU4A 3QVVA 5BWOA 3NVKI 4GDFA 2ZAOA 4CTJA 3CCCA 3EIXA 3K0KA 3HB9A 2DETA 1YTUA 4XYLA 1A2BA 4PSUA 1FLNA 3KUXA 1XCMA 3P2IA 4IR7A 3R7WA 4A10A 3UWPA 3S1SA 1H4QA 4GS5A 3TYXA 2HYDA 4CEHA 1CZOA 4H16A 3FKJA 2J5KA 3VZCA 1MEOA 4EGCB 3WAJA 3Q8LA 2Q8PA 3VNAA 5CLJA 4JJIA 5IH7A 5ELLA 2JIZA 3P2JA 4IIGA 2IS1A 1ZO8A 1EP1B 4JKYA 4ZDIA 3NH6A 3ETNA 1X94A 4GI7A 1GL7A 4KKXB 3IOMA 3VQTA 1CZNA 3I9FA 2P6RA 3DOFA 3RSHA 2AYXA 4JSRA 1ODSA 2H16A 3EDQA 3HB0A 1NNLA 4BBPA 4YDQA 5FFFA 4BE9A 3HKBB 1Q0RA 1UZMA 5I7EA 3WGTA 2VPXA 3I32A 3SHQA 4HNTA 4M0FA 4JT2A 3EH2A 1YB4A 4QOFA 4DZZA 4XYEA 2QZSA 4X7RA 3O8DA 2YASA 3MJEA 3QUAA 4URYR 5E7JA 5IC5A 4NU5A 4RGBA 3LQKA 1CS0A 1EDEA 3ZHYA 4DBVO 4DEVA 4RTOA 3K70D 1QIKA 2J30A 1NVWQ 1JVNA 4RL6A 1D1SA 3R24A 5HJ5A 4XWOA 3JWIA 1SKQA 1RBYA 3KWJA 2JHCA 2XXBA 2HO4A 3AI1A 4WZAB 3QX7A 1KY5A 1Y5NA 1X8JA 1E4VA 2YVKA 1M5TA 3F6EX 2DBQA 3KHUA 4HN2A 4XYGA 1XO1A 2IYNA 3PGKA 5EIWA 1PG0A 3SXPA 1IQUA 1KVQA 1N1EA 1MT3A 2Z4SA 5KTRA 5WRFA 1KWKA 4ZJPA 2XB8A 2B0CA 3EG5A 4WBNF 5DPMA 5K09A 3A14A 3FHJA 4LF4B 5GTDA 3P4XA 5GAJA 3HYLA 3AR9A 1W34A 1VJTA 3GD5A 5EXSA 2E4YA 1GNTA 2PJZA 3AUXA 1HORA 3BEOA 3KLNA 3QG1A 4RDIA 1N6OA 2E5FA 3C1OA 3Q11A 1PJBA 2BZSA 2IOQA 4BFUA 5HYVA 1FMCA 2RK4A 5CU7A 2RGWA 3DV0B 4DLAA 2PGIA 1OZGA 3DZIA 3P9XA 4KMRA 4O2AA 4EYKA 3CURA 4ZQCB 4QGBA 2GESA 1JQEA 1ZRHA 3ETDA 1U2SA 4JLVA 1T5HX 2QX9A 5KZMB 4HGPA 4FMCB 4KC0A 1COWA 2ZIXB 3IE2A 2X3FA 1GGEA 3ILVA 1AQJA 1CR4A 3EXIB 5AIAA 4X41A 3U7EB 1NSFA 1SXIA 1YZUA 4HP8A 3JVUA 4LG1A 2IWRA 2ZE7A 1Z82A 2ACEA 2VXBA 5BPFA 4IH9A 1K7YA 4N03A 4BNZA 3RCBA 5LKAA 4Q66C 2MINA 4WESA 4ZT5A 1GQQA 3K94A 4M1OA 3RVQA 2IF2A 3EIWA 2XEXA 4B3GA 1XP8A 2C5GA 3A3KA 2HY7A 1XJCA 3ZTYA 5CFZA 3VRHA 2XUHA 4IOLA 1W4RA 2VHZA 3Q0EA 4FFMA 4XW2A 3WDSA 4YMUA 2QRMA 4IGEA 5FBKA 3M6UA 3UAXA 4WACA 1RXCA 2P5UA 4U9IS 5ALTA 5JXHA 3U7HB 2YMMA 3EG9B 4PX9A 3U48A 4D3XA 2OFXA 4DAEA 1FS5A 2C4NA 2B92A 3GPDG 3MHPA 3KT0A 3O4GA 2O8BB 3C7CB 3I6YA 3HJRA 3KM0A 4M8SA 2O20A 4WZ6A 3W9BA 4ZICA 2BGMA 2ECFA 5A7HA 3ONEA 4O4LB 3O84A 4IGFA 2GXUA 4YGYA 5JTUA 3NEJA 3OG9A 4I2NA 2YQZA 3Q4GA 5G0UA 3R0XA 4GPEA 1XU9A 4IGIA 2IUTA 2VJMA 1J24A 1BH6A 2Q21A 4LDJA 4RAOA 1QHXA 1WVIA 3T3EA 3UQZA 4D1YA 1TA4A 1V8ZA 4YP5A 5EA2A 5FD8A 1G98A 4LSGA 2I2CA 3ETEA 3TJMA 4RTKA 4URXR 5U1PA 1NOKA 1S89A 1ULUA 4G5FA 4HNVA 2AEEA 3THRA 5JAHA 4GO1A 2W6MA 2VPPA 3B5EA 4MUGA 2VH5R 3RVMA 1KDYA 2VBCA 4OOEA 1PGOA 1V4BA 3FTDA 2QTZA 4GE3A 1LBIA 2FSPA 2PEZA 1L7AA 2Q1YA 4S24A 3RSSA 2P27A 2WWWA 5CCEA 2B1JA 1BX3A 3LZDA 5DLQC 4PS1A 3VH2A 3A70A 1YJ5A 3WMEA 2IH2A 1NE2A 2P5TB 2FX2A 4US0R 4QUIA 4F3CA 1ENYA 3ED5A 3ZDAA 4J0KA 1Q0ZA 4AULA 1AQUA 3BWCA 1HF3A 2Z5VA 3ETCA 3EEYA 4RK1A 1JR6A 2D4HA 2Q2OA 1H1DA 3GLHA 9ATCA 2XCRB 1JFRA 1MEJA 1XD2A 1Y6GA 4HD8A 4UVHA 3IH5A 1CBUA 4IH1A 3LOQA 2PJDA 3RK1A 2ZUFA 1RWPA 3A7EA 1KK2A 3FJYA 3O5AA 3RFXA 5ICSA 3AGPA 3O26A 1YL6A 1NGSA 4POAA 1UFOA 3TDNA 1JG4A 4HT3B 1U4OA 2YS7A 3HFJA 2KPOA 5ENDA 3DGEC 2YRWA 2Y0DA 4QICA 1XQYA 3I64A 4HDMB 2G7ZA 1H9AA 4HSEA 1X15A 2VL7A 4WE3A 4V0QA 5G0TA 1YQUA 2ZZMA 3I09A 1INLA 1OHHD 4I6GA 4C87A 4R7ZA 3EVGA 4P4SA 2PS0A 1F14A 1I3LA 1AUQA 2RHLA 2WP0A 2BHRA 2ZI5A 4L75A 4XIFA 4AO7A 5C7IO 3WAGA 2PKQP 5CX4A 2JI8A 2AR9A 4J1NA 1NBMA 2P1RA 3IUJA 3TFWA 4CT4B 1ZMRA 1I7SB 3F4BA 3EMVA 3OQBA 1FW8A 2ZT8A 4GLBA 4BMSA 2F64A 2G7MC 4Z7OB 1JXAA 3KUDA 5CFRA 1ESDA 1V5IA 1JJVA 3GDGA 5JQGF 5E0OA 1GCOA 4L5IA 4JJKA 2FGKA 3U7IA 2JFOA 4BVHA 3B70A 1GUYA 4CJXA 2C2GA 5EXEA 1ZJWA 1P1CA 2QVZX 2Q1XA 4KP7A 4JSTA 1R0XA 2RMKA 3DO6A 3KVVA 3UNXA 5CB4A 2OQRA 1A69A 4PGFA 3VR2D 2IJGX 1N6RA 3GJTA 3KKQA 1W44A 2GOYA 2M6SA 2Z1NA 3ONWA 4J0HA 3UN1A 3VAYA 1T91A 2REQB 3A32A 2W6JA 2Z8ZA 4B3MB 3PR2B 1WW3A 1Z6YA 3ZLBA 4BGDA 3GGGA 1IU9A 1MHPA 3NZEA 2RHDA 2XYRA 2DPGA 3O1IC 4MKGA 3NFYA 4BNIA 4W5TA 4JR2A 2CT8A 3ZDDA 4EAAA 1W0CA 3OQNA 1KYTA 4P80A 5C8VA 2J08A 1ZNYA 2EXXA 1YRHA 3EIHA 3OIDA 3WX0A 5IXYA 4H7FA 2XUQA 2LDXA 5AOCA 5I6DA 2EX0A 3X0DA 2AUTA 2AB0A 2F00A 3GGJA 4CIWA 1ZISA 4MRMA 3X1KA 1PZNA 3K15A 4KG7A 1NMZA 3U4IA 2PLRA 3RU2A 4DV6B 1XAHA 4HO1X 3GT3A 3N86A 3OEYA 4G07A 4KVZA 2GEJA 4L8YA 4KXUA 4N54A 2Q2VA 1JL3A 4PAWA 3HJCA 3VR5D 2GN4A 1YFKA 2GLUA 3ZNPA 4YJFB 1XRMA 4RD4A 5JPDA 2QTNA 4IXMA 1WBJB 5D00A 5JCZA 2MTBA 2B69A 4JJFA 1RS0A 1XNJA 2AJDA 1GPNA 2RJ3A 3DLBA 3QTBA 3O6VA 1L4EA 1DAOA 4NNJA 1Z5UA 2BD0A 1FTYA 3RS8A 5TQ2A 3GH3A 3JASB 2GBPA 5LC1A 3UCFA 1Y4ZA 5FBQB 3WBBA 1DBPA 3RJTA 1KO1A 3U80A 4LZJA 1CJMA 2KW5A 4OTZA 4EYGA 5BUZA 4CKCB 5CJ2A 1V1RA 1R00A 4HPJB 3C8ZA 3HEMA 4ALMA 1QQAA 3AB3A 4X1KB 4UEQA 3KETA 1HURA 1K92A 1ODFA 1NMXA 1TQ6A 2V5UA 4M49A 4X90A 3FVVA 1RLJA 4RE6A 2ZYAA 3DBLA 3K5HA 3ZWXA 3FDZB 4CMGA 1VSQA 5LBUA 2G0TA 3NHAA 1QXSA 3EWAA 2V96A 5FPYA 4A6PA 4C3UA 5M7EA 3WGIA 2OLJA 4MV4A 1SG6A 2LBPA 5C5DA 2N42A 4MVJD 2IXBA 4XJXA 4Y6QA 8MHTA 4BX3A 1K5HA 1NJGA 3JXEA 3HU3A 2PL1A 1F06A 3OT5A 3ICOA 4LBYA 5HEKA 1AZSC 4QGHA 1DC5A 3LQ4A 3E22B 3JWGA 5EIFA 3LS2A 2VQ6A 5B58C 2DECA 1U8YA 4TN5A 2O2IA 3SF8B 2X8JA 3FTPA 4C7XA 3E7WA 3NEAA 4RXTA 1R10A 4DSZA 2B0JA 2DY1A 2FPOA 4MR8A 4QSMA 3FDXA 3DDHA 2O3QA 2SKEA 3F7OA 2Z5LA 3C24A 1JWLA 3KT6A 2FMKA 5GZ3A 3K09A 2QB5A 3IKMB 2FFRA 5JOQA 4KAAA 4B2IA 2GJ9A 3GVIA 1NXSA 1P62B 1LW7A 5HIIA 1WQ3A 3V9AA 1SUEA 3OOJA 5JSZB 2FWMX 4D5GA 5AK5A 2R6DA 3O95A 1EFPB 2GDZA 3VISA 5IDWA 1RRKA 1WP4A 3FYUA 2BZGA 2Q2WA 3SVZA 1XEWY 3QKWA 1P5ZB 3CZQA 3MGKA 1A9RA 1OXKB 3H8WA 5DB4A 3K6SB 3MYYA 3Q8WA 1OIXA 3ILHA 4PX5A 3RC9A 4M6WB 3MVEA 3PPIA 4WX2B 4CUKA 2RFLA 3DWEX 3MRXA 1I24A 3QXSA 3GMTA 4KMMA 2JIBA 1SVLA 4RLFA 2ORIA 3W7BA 1XJWA 4II3A 2IZ1A 2GBLA 3NBYC 1GTJ1 3CRZA 3N1UA 1ZN7A 3O4RA 1GU7A 3OETA 3QJ5A 4IICA 5EERA 4A8PA 4E3WA 5TT0A 4AQYB 3PLAE 3S27A 1CY6A 4W5QA 1DXHA 1QIFA 3ZW7A 4Y1EA 3LP8A 3VJKA 1LQTA 2BGJA 5E0KB 4EECA 1WM1A 3MCUA 1WF3A 4HH1A 3EE6A 4HDOB 4B84A 4OVKA 1H9BA 1Q1GA 1G1AA 1T13A 5IP5A 1ZK0A 3RREA 2NV0A 1QANA 5C31A 4BX2A 3CNOA 5LDGA 4B4UA 2F55A 5AESA 4D98A 4BVEA 1RU3A 1PV4A 4BNHA 4OMCA 3K92A 3QLVA 4LVUA 4RY8A 3GRVA 3ZK9A 3OJFA 3K1YA 1UBKS 1Z5NA 3EODA 3UMJA 2DR2A 2IEZA 1D2MA 1JF8A 1I1HA 5EQJB 1JT2A 2X77A 2P5YA 4TWBA 1H3NA 1L5RA 3C85A 4G63A 3UWKA 1X7WA 4N8EA 1BQEA 1G5QA 3TSZA 3TTWA 1M2HA 5GINE 5KYWA 3FHCB 4OQYA 1H94A 1MX9A 1NR5A 3HSSA 2WFZA 2VT6A 3O4HA 2QL9A 2P2YA 4IUCS 2DF8A 1J07A 1GKIA 4FZRA 1AKYA 3PEWA 2RGAA 2XXAB 3BSWA 4XB2A 3GGCA 3I34X 4PINA 1T3SA 1SOVA 4YASA 5EJ7A 5CT5A 5I7UA 2NZUG 1CEQA 1L3CA 2Y1KA 4YRPA 1ADJA 3G8BA 4J0DA 2ZE6A 1Z4OA 4JJ8A 2GEKA 4KVFA 2VNHA 4U2FA 4PGHA 1R5NA 3MHTA 3TLGA 1XMJA 2GJ4A 5FPHA 1ZW1A 3K6RA 1C0KA 3KVNA 4K88A 4C0KA 4ZFNA 1ZHOA 3EOAI 3RVKA 2DQKA 3NORA 1E94E 4GE0A 3VMMA 4DJAA 1M6NA 1G8YA 4R68A 2DPMA 3QUBA 4R8MA 5KC9A 4YK7A 4ZA2A 2Q9AA 1I1NA 1NY5A 2NW6A 1V2HE 3TS1A 4L7VA 4C7OA 4BFZA 3WWZA 2A5JA 3F8SA 2J4DA 4N48A 1G63A 2XHEA 1ZD1A 4HAVA 3UHOA 2WOOA 1QGAA 4Q6WA 4BJ1A 3NWJA 3MILA 4MIOA 3B6KA 3D0OA 4W9RA 4YN3A 5CW2A 1OXTA 1Y5RA 4BJ6A 1VI6A 2QR5A 4C0BA 4QBGB 1W5TA 4CIBA 1ZLXA 2I4NA 1XEAA 2IGBA 1GUDA 3PF9A 4MSUA 1Y3CE 2YN2A 2ECQA 3OOWA 4N9QA 4OXQA 2EQBA 1NW5A 1LDEA 3O2QB 1UP7A 2Q3EA 3AJAA 5FLYA 4KAFA 3N75A 4ZP1A 5TXGA 3VPXA 4EJ0A 2VYND 3KWLA 5CT6A 2O4CA 5BNZA 2ZIUB 1QQBA 2W2LD 1FFDA 3F5FA 3QFCA 4TXLA 4PO1A 1JSLA 2H4WA 2DBZA 4CL0A 3RYFA 1B1AA 1LTQA 1UFQA 4KLNA 4B73A 5FUQA 5B6PA 2B5WA 2WAMA 1LBQA 1ZVJA 1VOTA 3AR7A 3STVA 3VDNB 3TFOA 1HETA 1S8NA 3ITNA 1SBZA 3QLJA 4D9IA 4RTJA 4AKIA 4CL2A 1HTWA 3G8CA 4MS1B 2AR7A 3B9PA 1G8KA 4CQMB 1FX0B 1NVDA 4I7EA 4DG5A 3JYOA 1GZDA 1BKDR 3JVIA 4E2ZA 3AESB 3HPRA 4NJEB 4RMJA 3CLRC 5D87A 4EHJA 5ES4B 1ABFA 1C1XA 1ZGZA 2OO5A 3AV3A 4EG6A 4DR1B 2G82A 3LX6A 1ID8A 4KRFA 3VUEA 1A8UA 3UMSA 2I03A 3RBAA 5ESRA 1KXJA 2EJWA 4LE0A 1GLGA 4RIFA 4FXOA 4Q3DA 3G85A 3HBJA 2O0HA 4ZT4A 1XZDA 4DUGD 5K2OA 1C1HA 1JA0A 1E4YA 3EZ2A 4MQFA 1JG1A 1I9GA 5CVUA 4AMBA 3IUSA 2QPOA 3TCNA 4LNUB 5ITVA 3E6AA 3QKSA 4PTYA 4PQFA 4R51A 2QYTA 2V58A 4R1MA 4Z9BA 5DNEA 2R8OA 2WYHA 4HDRA 4RNCA 4BWGA 4BJHB 4YRNA 5JNRA 3KSAC 4FFRA 3G82C 1RW4A 4KQ6A 2H57A 4KYUA 4R1OA 1XD8A 1DCFA 2AD1A 2HMAA 1IJEA 1L4HA 3H2ZA 2JK0A 1RJ9B 3DDCA 3QA3E 4R3WA 4PZAA 2E9SA 4CMHA 1DJQA 4L5BA 2ODBA 2R2AA 4U2DA 4D4KA 4QQRA 1AQNA 4RV4A 1A1VA 3HV2A 1BEUB 2HJRA 2E48A 2VPQA 2YN4A 3OPXA 4NYJR 4Q9JA 1QKKA 5JRDS 3ZWDA 3OKCA 4D8XA 3MMSA 2CEKA 1DJOA 1T4CA 3N05A 4OX9Y 2C2HA 1YULA 2ZSJA 4EVQA 4MEBA 1K97A 5IUKC 4FHFA 3L82B 4NDAA 4Q7MB 5DHRA 5DM4A 5HFJA 5HDBB 3C16C 5FBVB 5JJCA 5CYOA 4HEA1 5FWDA 5FRDA 3RIEA 3M33A 4UBLA 2CJPA 1ONNA 2NG1A 2QMEA 4ZGBA 3UMFA 3DLPX 3PRHA 3L0BA 1ZSYA 5SZIA 1SM4A 4WCDA 3BIFA 3NT2A 1KEUA 3VZQA 3RAPR 4HH0A 1CZHA 4BL5A 1SEVA 3QBDA 4OQMA 4B79A 2I4IA 3OZDA 4IRUB 4AI6A 2LRHA 3G0CA 4XDYA 3CEPB 1MVNA 3RK0A 5EMMA 1AVTA 1A0OA 2FSFA 4RTSA 1NNSA 2QF7A 3BSFA 2HCBA 5TR9A 3MTIA 4DA0A 1E9CA 3ZD7A 1X80A 1GPUA 1Z16A 4S3MA 2EC5A 1UJCA 1Q7TA 4R7GA 4Z9AA 3QVGB 1UBCA 2PXAA 2GAIA 1J90A 3OPQA 2G5TA 2JLAA 3QU7A 5INTA 1GXSA 5EJ9A 2OZEA 2X0EA 5JRJA 2M2IA 3B6IA 4KQ1A 4AWXA 5T3YA 4AJ2A 3LQYA 1IJBA 4PRKA 2NP7A 1QHSA 3PWZA 1EVQA 1SCKA 3N0TA 2CJWB 4AMZA 1GVNB 3NH9A 1GN9A 1YDEA 3GRKA 3LBNA 4TYMA 3TBFA 4C6SA 2NO4A 2Y6VA 4OL9A 5BSTA 4OKSA 1UDBA 4GU5A 3SYMA 5JJKA 3OT1A 3DMGA 3IMFA 4Y1FA 2HSZA 1UWVA 4XQ0A 5D6OA 3IQZA 4ETMA 1XTBA 1SWWA 4JBLA 3U7GA 3VR4A 4AWBA 5IASA 3EZFA 4AO6A 2OK7A 2QGZA 4MV0A 4RC9A 5B5SA 4GIBA 4FDMA 1DBSA 4EG1A 2IIQA 3UGKA 5DCUA 4RDXA 4DR3B 1OLXA 2ONCA 1SC9A 3OOYA 1RMTA 2ZCVA 5H3LA 3W04A 5I7HA 4TS4A 5TS2A 4R2JA 1W8DA 3UJPA 3DAFA 1SBYA 4BNXA 1FQJA 1PFVA 2JGLA 2QSZA 1UMCB 3KYCB 4B7AA 3N2IA 2PIDA 2ODAA 3PKZA 4HJXA 5MF6A 4KO3S 3BL6A 5A0TA 1AZTA 5CNKA 1JU9A 2J3MA 5MN4A 5EOVA 1DLJA 2VSOA 1QH0A 2V54A 4PLTA 4BO9A 1R7RA 4JWTA 5DISB 1UPUA 4NONA 1OI7A 4G56A 3ZJ4A 5I4CA 2DPLA 2B2XA 4N5LA 1BW9A 1JHZA 1CKEA 4WNIA 4ZT2A 4A8JC 3ZWYA 1CUBA 2CLKB 1CHDA 1ZOOA 1M54A 3M0EA 4RLHA 4YT5A 5EWJB 3VKWA 3P9QA 3VYVA 4DBLE 1XTJA 1VKRA 2QW8A 1ZIDA 5EP3A 3U6BA 3ACDA 4PHFA 1FSZA 3TECE 3HXQA 3VYSB 2C9CA 2X6RA 3EFEA 1L2TA 3QF7A 1F7UA 3NG1A 2XOXA 3QXGA 4WDRA 4ZI7A 2FR0A 1MC1A 1D4ZA 1DWQA 1HY3A 2OZLB 4M7OA 2F9FA 3G7NA 1A2QA 1FUKA 2KS6A 4G36A 1UOEA 2QE6A 4PV7A 2O3RA 1FTWA 1F6WA 1K27A 1Z8FA 2GJKA 4LBZA 1NBAA 4JI6B 2UVPA 3I3SR 5JSUA 4YVFA 1N2CB 1KGDA 2DMRA 1VIVA 2QIOA 4HN9A 5DN9A 1M1NB 3RD5A 3P26A 5ITZB 3I9NA 3BE4A 1G21E 3KYDA 2FEAA 3FPFA 5G4KB 3ORYA 4QPJC 1HE2A 1NBME 4ZWNA 1KEWA 3VR4H 2O5RA 4UC0A 4JX9A 3DAOA 2V7PA 4DIUA 2V6BA 3KPVA 3W5BA 2NUAB 3M89A 2O8CA 1NYRA 2OUKA 1PBNA 4YROA 5ALDA 3OJXA 4BCBA 4UHJA 4EI7A 4BV8A 4TVBA 4E1BA 4FN4A 4LDNA 4WFQA 4TM7A 4UEJA 3BD8A 1IM2A 4LYDA 4JKIA 1IB0A 5EMKA 4V38A 5H4GA 3ER6A 1RDFA 3PFCA 4GDMA 4D8TA 5KMGB 1Y81A 4FOOA 5TIIA 1T6NA 4C30A 5EVJA 4ND7A 1BRTA 2CBXA 3KKLA 1EEHA 4PC3A 5JXGA 1ZK3A 3DVAA 4FWIB 4GKVA 1V35A 3TW4A 4R1TA 3DZJA 3REQB 3COJA 2JB9A 3F0TA 1D0VA 4YRSA