3FG6A

Structure of the c-terminus of adseverin
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
320
structure length
296
Chain Sequence
GKVEIWRVENNGRIQVDQNSYGEFYGGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPVHLLSLFKDKPLIIYPTRLFQVRRNLASITRIVEVDVDANSLNSNDVFVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQTSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESLKSAKMYLTPIVIIKQGHEPPTFTGWFLGWDSSKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the C-terminus of adseverin reveals the actin-binding interface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin-binding protein
molecule keywords Adseverin
total genus 86
structure length 296
sequence length 320
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2008-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00626 Gelsolin Gelsolin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3fg6A03
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3fg6A02
3.40.20.10 Alpha Beta 3-Layer(aba) Sandwich Severin Severin 3fg6A01
5KYWB 5KYUB 3EGDB 1CNUA 1M4JA 5FAEA 4CBWG 3EFOA 3A5LS 1WNJA 1SVQA 1F7SA 3TU5B 5FAFA 2LLFA 3CI5G 1M2VA 3Q2BA 4Z94G 1C0FS 1VKKA 1Q8GA 2I2QA 5KYWA 3EGXB 3A5OS 3FFKA 2FF3A 2MOTA 1H1VG 2FGHA 1Q8XA 5IVUA 3CJCG 3FFNA 1EQYS 3EG9B 2XF1A 3EFOB 1ESVS 4KEEA 1NM1G 1T3XA 1YAGG 2FH1A 4JD2H 2NUTB 2VIKA 2KVKA 1D4XG 1RGIG 1P8XA 5KYXA 1UDMA 1JHWA 2D8BA 5KYYB 5L6WC 1QPVA 3A5NS 3EGDA 5KYNA 1SVRA 3EH1A 1PD0A 1DEJS 1AK6A 2QTVA 3EGXA 1WFSA 2LXXA 2W0IA 3FG7A 5A1MA 1NMDG 2MP4A 1D0NA 4KEFA 1KCQA 2NUPA 1J72A 1NPHA 2FH2A 4S10C 3L50A 4BEX1 4CBXG 1T3YA 4PKHB 1YVNG 2VILA 1PD1A 3CJBG 1T2LA 3FG6A 2MV2A 1C0GS 1SVYA 1AHQA 1V6FA 1T44G 2HD7A 1AK7A 4PKIG 3CIPG 4PKGG 1PCXA 1COFA 2L72A 2FH3A 2FF6G 3EG9A 5KYXB 1X67A 5HVKB 3EH2A 5HVKD 1HQZ1 1NLVG 1P8ZG 2NUTA 3A5MS 1VFQA 4KEDA 5KYUA 1CFYA 2LJ8A 2FH4A 5KYYA 5DD2A 3DAWB 2VACA 4LIZA 1TVJA 1MDUA 1WM4A 1M2OA 1M2VB 1TMWA 2NUPB 4CBUG 2XFAA
chains in the Genus database with same CATH superfamily
5KYWB 5KYUB 3EGDB 3DA7A 1CNUA 1M4JA 5FAEA 4CBWG 3EFOA 3A5LS 1WNJA 1SVQA 1F7SA 3TU5B 5FAFA 2LLFA 3CI5G 1M2VA 3Q2BA 4Z94G 1C0FS 1VKKA 1Q8GA 2I2QA 5KYWA 3EGXB 3A5OS 3FFKA 2FF3A 2MOTA 1H1VG 2FGHA 1Q8XA 5IVUA 3CJCG 3FFNA 1EQYS 3EG9B 2XF1A 3EFOB 1ESVS 4KEEA 1NM1G 1T3XA 1YAGG 2FH1A 4JD2H 2NUTB 2VIKA 2KVKA 1D4XG 1RGIG 1P8XA 5KYXA 1UDMA 1JHWA 2D8BA 5KYYB 5L6WC 1QPVA 3A5NS 3EGDA 5KYNA 1SVRA 3EH1A 1PD0A 1DEJS 1AK6A 2QTVA 3EGXA 1WFSA 2LXXA 2W0IA 3FG7A 5A1MA 1NMDG 2MP4A 1D0NA 4KEFA 1KCQA 2NUPA 1J72A 1NPHA 2FH2A 4S10C 3L50A 4BEX1 4CBXG 1T3YA 4PKHB 1YVNG 2VILA 1PD1A 3CJBG 1T2LA 3FG6A 2MV2A 1C0GS 1SVYA 1AHQA 1V6FA 1T44G 2HD7A 1AK7A 4PKIG 3CIPG 4PKGG 1PCXA 1COFA 2L72A 2FH3A 2FF6G 3EG9A 5KYXB 1X67A 5HVKB 3EH2A 5HVKD 1HQZ1 1NLVG 1P8ZG 2NUTA 3A5MS 1VFQA 4KEDA 5KYUA 1CFYA 2LJ8A 2FH4A 5KYYA 5DD2A 3DAWB 2VACA 4LIZA 1TVJA 1MDUA 1WM4A 1M2OA 1M2VB 1TMWA 2NUPB 4CBUG 2XFAA
chains in the Genus database with same CATH topology
5KYWB 5KYUB 3EGDB 3DA7A 1CNUA 1M4JA 5FAEA 4CBWG 3EFOA 3A5LS 1WNJA 1SVQA 1F7SA 3TU5B 5FAFA 2LLFA 3CI5G 1M2VA 3Q2BA 4Z94G 1C0FS 1VKKA 1Q8GA 2I2QA 5KYWA 3EGXB 3A5OS 3FFKA 2FF3A 2MOTA 1H1VG 2FGHA 1Q8XA 5IVUA 3CJCG 3FFNA 1EQYS 3EG9B 2XF1A 3EFOB 1ESVS 4KEEA 1NM1G 1T3XA 1YAGG 2FH1A 4JD2H 2NUTB 2VIKA 2KVKA 1D4XG 1RGIG 1P8XA 5KYXA 1UDMA 1JHWA 2D8BA 5KYYB 5L6WC 1QPVA 3A5NS 3EGDA 5KYNA 1SVRA 3EH1A 1PD0A 1DEJS 1AK6A 2QTVA 3EGXA 1WFSA 2LXXA 2W0IA 3FG7A 5A1MA 1NMDG 2MP4A 1D0NA 4KEFA 1KCQA 2NUPA 1J72A 1NPHA 2FH2A 4S10C 3L50A 4BEX1 4CBXG 1T3YA 4PKHB 1YVNG 2VILA 1PD1A 3CJBG 1T2LA 3FG6A 2MV2A 1C0GS 1SVYA 1AHQA 1V6FA 1T44G 2HD7A 1AK7A 4PKIG 3CIPG 4PKGG 1PCXA 1COFA 2L72A 2FH3A 2FF6G 3EG9A 5KYXB 1X67A 5HVKB 3EH2A 5HVKD 1HQZ1 1NLVG 1P8ZG 2NUTA 3A5MS 1VFQA 4KEDA 5KYUA 1CFYA 2LJ8A 2FH4A 5KYYA 5DD2A 3DAWB 2VACA 4LIZA 1TVJA 1MDUA 1WM4A 1M2OA 1M2VB 1TMWA 2NUPB 4CBUG 2XFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KYW B;  5KYU B;  3EGD B;  1CNU A;  1M4J A;  5FAE A;  4CBW G;  3EFO A;  3A5L S;  1WNJ A;  1SVQ A;  1F7S A;  3TU5 B;  5FAF A;  2LLF A;  3CI5 G;  1M2V A;  3Q2B A;  4Z94 G;  1C0F S;  1VKK A;  1Q8G A;  2I2Q A;  5KYW A;  3EGX B;  3A5O S;  3FFK A;  2FF3 A;  2MOT A;  1H1V G;  2FGH A;  1Q8X A;  5IVU A;  3CJC G;  3FFN A;  1EQY S;  3EG9 B;  2XF1 A;  3EFO B;  1ESV S;  4KEE A;  1NM1 G;  1T3X A;  1YAG G;  2FH1 A;  4JD2 H;  2NUT B;  2VIK A;  2KVK A;  1D4X G;  1RGI G;  1P8X A;  5KYX A;  1UDM A;  1JHW A;  2D8B A;  5KYY B;  5L6W C;  1QPV A;  3A5N S;  3EGD A;  5KYN A;  1SVR A;  3EH1 A;  1PD0 A;  1DEJ S;  1AK6 A;  2QTV A;  3EGX A;  1WFS A;  2LXX A;  2W0I A;  3FG7 A;  5A1M A;  1NMD G;  2MP4 A;  1D0N A;  4KEF A;  1KCQ A;  2NUP A;  1J72 A;  1NPH A;  2FH2 A;  4S10 C;  3L50 A;  4BEX 1;  4CBX G;  1T3Y A;  4PKH B;  1YVN G;  2VIL A;  1PD1 A;  3CJB G;  1T2L A;  3FG6 A;  2MV2 A;  1C0G S;  1SVY A;  1AHQ A;  1V6F A;  1T44 G;  2HD7 A;  1AK7 A;  4PKI G;  3CIP G;  4PKG G;  1PCX A;  1COF A;  2L72 A;  2FH3 A;  2FF6 G;  3EG9 A;  5KYX B;  1X67 A;  5HVK B;  3EH2 A;  5HVK D;  1HQZ 1;  1NLV G;  1P8Z G;  2NUT A;  3A5M S;  1VFQ A;  4KED A;  5KYU A;  1CFY A;  2LJ8 A;  2FH4 A;  5KYY A;  5DD2 A;  3DAW B;  2VAC A;  4LIZ A;  1TVJ A;  1MDU A;  1WM4 A;  1M2O A;  1M2V B;  1TMW A;  2NUP B;  4CBU G;  2XFA A; 
#chains in the Genus database with same CATH topology
 5KYW B;  5KYU B;  3EGD B;  3DA7 A;  1CNU A;  1M4J A;  5FAE A;  4CBW G;  3EFO A;  3A5L S;  1WNJ A;  1SVQ A;  1F7S A;  3TU5 B;  5FAF A;  2LLF A;  3CI5 G;  1M2V A;  3Q2B A;  4Z94 G;  1C0F S;  1VKK A;  1Q8G A;  2I2Q A;  5KYW A;  3EGX B;  3A5O S;  3FFK A;  2FF3 A;  2MOT A;  1H1V G;  2FGH A;  1Q8X A;  5IVU A;  3CJC G;  3FFN A;  1EQY S;  3EG9 B;  2XF1 A;  3EFO B;  1ESV S;  4KEE A;  1NM1 G;  1T3X A;  1YAG G;  2FH1 A;  4JD2 H;  2NUT B;  2VIK A;  2KVK A;  1D4X G;  1RGI G;  1P8X A;  5KYX A;  1UDM A;  1JHW A;  2D8B A;  5KYY B;  5L6W C;  1QPV A;  3A5N S;  3EGD A;  5KYN A;  1SVR A;  3EH1 A;  1PD0 A;  1DEJ S;  1AK6 A;  2QTV A;  3EGX A;  1WFS A;  2LXX A;  2W0I A;  3FG7 A;  5A1M A;  1NMD G;  2MP4 A;  1D0N A;  4KEF A;  1KCQ A;  2NUP A;  1J72 A;  1NPH A;  2FH2 A;  4S10 C;  3L50 A;  4BEX 1;  4CBX G;  1T3Y A;  4PKH B;  1YVN G;  2VIL A;  1PD1 A;  3CJB G;  1T2L A;  3FG6 A;  2MV2 A;  1C0G S;  1SVY A;  1AHQ A;  1V6F A;  1T44 G;  2HD7 A;  1AK7 A;  4PKI G;  3CIP G;  4PKG G;  1PCX A;  1COF A;  2L72 A;  2FH3 A;  2FF6 G;  3EG9 A;  5KYX B;  1X67 A;  5HVK B;  3EH2 A;  5HVK D;  1HQZ 1;  1NLV G;  1P8Z G;  2NUT A;  3A5M S;  1VFQ A;  4KED A;  5KYU A;  1CFY A;  2LJ8 A;  2FH4 A;  5KYY A;  5DD2 A;  3DAW B;  2VAC A;  4LIZ A;  1TVJ A;  1MDU A;  1WM4 A;  1M2O A;  1M2V B;  1TMW A;  2NUP B;  4CBU G;  2XFA A; 
#chains in the Genus database with same CATH homology
 5KYW B;  5KYU B;  3EGD B;  3DA7 A;  1CNU A;  1M4J A;  5FAE A;  4CBW G;  3EFO A;  3A5L S;  1WNJ A;  1SVQ A;  1F7S A;  3TU5 B;  5FAF A;  2LLF A;  3CI5 G;  1M2V A;  3Q2B A;  4Z94 G;  1C0F S;  1VKK A;  1Q8G A;  2I2Q A;  5KYW A;  3EGX B;  3A5O S;  3FFK A;  2FF3 A;  2MOT A;  1H1V G;  2FGH A;  1Q8X A;  5IVU A;  3CJC G;  3FFN A;  1EQY S;  3EG9 B;  2XF1 A;  3EFO B;  1ESV S;  4KEE A;  1NM1 G;  1T3X A;  1YAG G;  2FH1 A;  4JD2 H;  2NUT B;  2VIK A;  2KVK A;  1D4X G;  1RGI G;  1P8X A;  5KYX A;  1UDM A;  1JHW A;  2D8B A;  5KYY B;  5L6W C;  1QPV A;  3A5N S;  3EGD A;  5KYN A;  1SVR A;  3EH1 A;  1PD0 A;  1DEJ S;  1AK6 A;  2QTV A;  3EGX A;  1WFS A;  2LXX A;  2W0I A;  3FG7 A;  5A1M A;  1NMD G;  2MP4 A;  1D0N A;  4KEF A;  1KCQ A;  2NUP A;  1J72 A;  1NPH A;  2FH2 A;  4S10 C;  3L50 A;  4BEX 1;  4CBX G;  1T3Y A;  4PKH B;  1YVN G;  2VIL A;  1PD1 A;  3CJB G;  1T2L A;  3FG6 A;  2MV2 A;  1C0G S;  1SVY A;  1AHQ A;  1V6F A;  1T44 G;  2HD7 A;  1AK7 A;  4PKI G;  3CIP G;  4PKG G;  1PCX A;  1COF A;  2L72 A;  2FH3 A;  2FF6 G;  3EG9 A;  5KYX B;  1X67 A;  5HVK B;  3EH2 A;  5HVK D;  1HQZ 1;  1NLV G;  1P8Z G;  2NUT A;  3A5M S;  1VFQ A;  4KED A;  5KYU A;  1CFY A;  2LJ8 A;  2FH4 A;  5KYY A;  5DD2 A;  3DAW B;  2VAC A;  4LIZ A;  1TVJ A;  1MDU A;  1WM4 A;  1M2O A;  1M2V B;  1TMW A;  2NUP B;  4CBU G;  2XFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...