3FG8A

Crystal structure of pas domain of rha05790
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
GRENLYFQGGLGFMALDEDLRIIYVNSGCLRHVRRSRDELLGRVVTEVLPETQGSYFDALCRKVLATGREQQTRVDSLYSPGMTIEVTAAADSGALVVHFRDVTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of PAS domain of RHA05790
rcsb
source organism Rhodococcus sp. rha1
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein RHA05790
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fg8A00
4I3JA 1OTDA 2V0UA 3MJQA 2VV7A 3A0RA 2WKQA 2PD7A 3NOPC 4I39A 3K3CA 1S1YA 3NOTC 4KUKA 3LIAA 5HWWA 3E4QA 2J80A 4DJ2A 1OT6A 3MR0A 2BASA 2INWA 3LIDA 4JGQA 2KDKA 3E4OA 4HHDA 1UWPX 4L9EA 1KOUA 2V1BA 5HDCA 4E04A 2WKRA 3H82A 5TBMA 4H6JA 2QWSA 1S4SA 3B33A 4NXGA 4HI4A 1DP6A 4R70A 3FG8A 1TS6A 3ULFA 4EEUA 4HJ4A 1P97A 4GS9B 1LSWA 4HJ6A 4YWZA 1ODVA 2PD8A 1XFQA 3MXQA 4HH2A 4NXEA 3CWFA 2YKFA 2VEAA 1LT0A 1S4RA 1S67L 3F1NB 4R38A 3MFXA 1DP9A 1F9IA 2QJ5A 3F1NA 1S1ZA 3T50A 5DJUA 1GSWA 3IS2B 2WKPA 2D02A 1T1AA 5IU1A 2HV1A 4WLAA 1LSXA 3BWLA 4GS9A 4I5SA 4KUOA 5DKLA 4L9FA 4M4XA 4DJ3A 3IBRA 1OJGA 4JGRA 3H7WA 5AVFA 1T19A 3CLOA 1D7EA 4HJ3A 5HDSA 1EW0A 5KIZA 3UE6A 3UB9A 1OTEA 3LI8A 3VE3A 2PYPA 3HJIA 4KQDA 5HD3A 4L9GA 3C2WA 1OT9A 1T1BA 2VLGA 1N9OA 4HNBA 4LRZE 3D72A 3F1OB 1T18A 1V9ZA 3BY9A 5HD5A 3G6OA 3KX0X 2D01A 4GHIA 4EXOA 4EQ1A 2GJ3A 3GECA 3LI9A 1DRMA 4WUJA 5HWTA 2PR6A 5J3WA 2ZOIA 1OJ5A 1LL8A 2QKPA 2R78A 3NHQA 3OLOA 1MZUA 2V0WA 4I3IA 3A0SA 5G4YA 3UB6A 1P0ZA 2L0WA 3MQOA 4EETB 1TS7A 1XJ2A 2V9AA 4JGOA 3CAXA 3GDIA 4MN6A 2EA9A 3A0VA 2VV8A 2PYRA 2QHKA 3LIBA 4GCZA 2PDRA 5F6AA 5EFWA 3NOUC 4HIAA 4EEPA 4WL9A 1LSVA 1GSVA 1BYWA 1TS8A 4I38A 2W0NA 3P7NA 4B9OA 4I3AA 3LIEA 5G4ZA 3UMEA 1JNUA 1VB6A 1D06A 2Z6CA 4GHIB 2ZBBA 5AVEA 5TBMB 1UWNX 3H7WB 2OWJA 5DKKA 4BBUA 1TS0A 2A24A 2H28A 2JHEA 4LRXC 2B02A 2KX6A 2OWHA 3K3DA 4RQ9A 3PHYA 1X0OA 3MQQA 4R3AA 4HY8A 4XT2A 4H6JB 4HP4A 4HP9A 2YKHA 4JGPA 3LUQA 3VE4A 4BBVA 3PYPA 1XJ3A 4PKYA 3SW1A 3RH8B 4NXBA 2L1MA 5J7EA 1N9NA 1Y28A 1T1CA 3NJAA 5F69A 5HSQA 3C8CA 3F1PB 4XT2B 3IS2A 4EERA 4HH3A 2K7SA 2PR5A 4K08A 3RTYA 5HZHA 3F1PA 2OOLA 1OTAA 2Z6DA 4F3LB 1OTIA 4WN5A 1N9LA 2I9VA 2A24B 2W27A 3LIFA 1F98A 1GSXA 1OTBA 1XFNA 2JN7A 3E4PA 5HDDA 3ZQ5A 2ZOHA 2V1AA 3UB8A 4HOIA 4LRYC 4NXFA 3UMDA 4LLOB 4EESA 1NWZA 5HWVA 1WA9A 4BBTA 3HJKA 2L4RA 2VV6A 3H82B 5DJTA 1G28A 1S66L 1V9YA 2PHYA 2M1CA 2CMNA 3FC7A 3LYXA 4GW9A 4PKYG 4R6LA 5I5LA 1UGUA 4WF0A 3BY8A 3H9WA 5F5YA 2QJ7A 1XJ6A 4F3LA 3VOLA 3F1OA 3EWKA 5F68A 4EW7A 5A8BA 1XJ4A 3EEHA 5J4EA 3ICYA 5IS1A 4MN5A 4LPZA 1DP8A 3LICA 2P7JA 4HQAA 3UB7A
chains in the Genus database with same CATH superfamily
4GDBA 4HEFA 3VSKA 1KE0A 1BLHA 4L9EA 5FA7A 1LL5A 1JWZA 3VOYA 2PU2A 1DJBA 4O8GA 3L9KA 4MBFA 3GV9A 1MWSA 3IWQA 4X55A 1CEGA 2ZC4B 4PMAA 2ZL1B 1FR6A 1PW1A 1K56A 4X1MA 3R7WA 4CLCA 2Y2KA 2O99A 4ZAMA 1RGYA 4BQMA 3EQVA 4O01A 1N9OA 2QZ6A 2DNSA 2ZQ9A 2ZOIA 4OONA 3OLOA 2V0WA 3ZDJA 4EETB 3ITBA 3E98A 2C6WB 3A0VA 1K38A 2EFXA 3LIBA 3N8SA 4GCZA 1IYOA 3FWLA 4DDYA 2W0NA 1AXBA 1D06A 5EM0A 3M6HA 2VK3A 1J9MA 4RA7A 5TGFA 4YNRA 2J3TD 3IBJA 3LUQA 3TSGA 4OPZA 4EBLA 2XLNA 4XT2B 4K08A 2Z6DA 3IXBA 4EQIA 4CPKA 5DVAA 5L10A 3E4PA 3ZQ5A 2XD1A 2ZOHA 3UPNA 5HWVA 4LLOB 3RXWA 3V3RA 2L4RA 1RCJA 1BLCA 1S66L 3LYXA 3VP4A 1E3UD 4C6YA 5FDHA 5DF8A 3QP1A 4HBTA 2WKIA 3S4XA 3P98A 1O07A 1Q2QA 4LCLA 2INWA 2KDKA 4QPRA 3IX4A 4HESA 4OQIA 1XP4A 3UNWA 4KZ7A 1LHYA 4WELA 3IQAA 4HJ4A 3NBLA 1MWTA 2A3UA 2ZM8A 3B3XA 3DTKA 1T1AA 4N92A 5KIZA 4JXWA 4BLMA 4B93A 5CGSA 3EEAA 1OT9A 4KZBA 1D1JA 3IH9A 3F1OB 2ZD8A 4EXOA 1Q2PA 4R1GA 3HLFA 4S2JA 2GZAA 1XJ2A 4MN6A 3GR2A 2JKTI 2HDRA 5G4ZA 2Z6CA 3SS4A 3DAVA 4BBUA 2H28A 3PAGA 2V20A 4HP4A 3O5YA 3B42A 3NECA 4HBUA 3RH8B 1ES3A 5HL6A 1Y28A 1SZVA 4QY6A 3G32A 3NDEA 2W27A 1XFNA 3CZDA 3G31A 1L0GA 1AWIA 3FC7A 4B9OA 3AGFA 3OPRA 3H9WA 4KZ3A 1KE3A 5J4EA 3QP6A 4MNRA 5HAIA 5F1FA 3VV4A 4PM5A 3FKWA 3EGDC 4DJ2A 2ZC3B 3E4OA 3IXDA 4UA6A 2OLUA 2X02A 1KGGA 2WKHA 2OV5A 2K31A 2WGWA 2BTFP 4KG2A 3T50A 1S1ZA 3T1QB 4U0XA 4I5SA 4X56A 2VGJA 5FQKA 4MN7A 4UQIM 5E43A 2G2WA 4S2LA 4DRTA 2PU4A 3NULA 1CI8A 1ONGA 4LRZE 4Y13A 2QMIA 3V39A 3GSGA 4EBNA 5DTKA 1XGIA 5FQQA 3PXPA 4M3KA 2VJWA 2GNXA 3HBRA 4HIAA 2Y2OA 3T4TA 3BRMA 3HLCA 2JKRI 3L7HA 1IELA 5DKKA 2P9VA 2NUTC 5EUAA 1PNEA 2NUPC 4HY8A 3ZCZA 4E3LA 5J7EA 5HPFA 3IX8A 5CERA 3PBTA 2PR5A 2Y2HA 3Q7VB 3W4OA 1OTBA 2EXAA 2E8IA 4WM9A 3G4PA 2DMWA 1W8YA 2K2NA 2WZZA 1RGZA 2CMNA 1K54C 4WF0A 2WAEA 4LPZA 1HZOA 5BOHA 4DKIA 1Y4OA 1S0WA 5KSCA 4E3NA 3K2NA 3NOPC 1ZTUA 3NOTC 4F94A 4MMNA 3ISGA 1BLSA 1W7FA 3D9YA 3PBSA 4C75A 4E04A 1SKFA 3N8RA 3IF5A 3ULFA 1GHPA 2W1RA 5KMWA 3LEQA 2VEAA 4QWOA 4IVKA 3CG5A 2ZC6B 2HPBA 3ZG0A 4EBPA 2JC7A 2J3WA 1IKIA 5HARA 3T4LA 2B18A 3C2WA 4Z1WA 3KX0X 1GCEA 3DTMA 4EUVA 2PR6A 2DRWA 1OJ5A 3CPTA 2EA9A 3CITA 2PYRA 1CEFA 3RXXA 1TS8A 1XPBA 1JNUA 4IUHA 5AVEA 1LI0A 3HCYA 4ZBEA 1NLYA 2W3GA 4BL3A 2UV0E 2XK1A 5CTNA 1K0KA 2LB5A 3QP4A 4NXBA 5E2FA 5TR7A 5GL9A 2XEPA 3G2YA 4LENA 4LRYC 4ZJ1A 3W4QA 3VP2A 2Q9MA 5EECA 4OQHA 2JE5A 1E4DA 4GW9A 5L2FA 4Y0OA 3SH9A 2XH9A 5FQIA 3BY8A 5CX7A 4WZ5C 5F68A 3ZG7B 3SZTA 3FV7A 3SH7A 3ICYA 4MN5A 4ID4A 3O3VA 1KDWA 4I3JA 3A0RA 2M7UA 3ZVWA 4FOFA 1K25A 2G7UA 2ZLYA 5E2EA 3HVFA 4WMCD 3EGXC 2XD5A 3ITAA 5CEBA 4MBKA 1YSQA 1H3QA 4OOLA 5IU1A 3GMWA 2GDNA 5DKLA 3NI9A 1PW8A 3IBRA 2EX6A 2ZQ7A 3CLOA 5HDSA 1XKZA 2Y2IA 4JLFA 3ZFZA 3ZNTA 4KQDA 2ZL1A 3S22A 1XA7A 1GA0A 3NY4A 1OMEA 1N4OA 4EQ1A 4JKTA 3T4QA 1LL8A 4CLCD 5A91A 3GDIA 5F6AA 4P85A 4ARZB 1MKMA 4OQ0A 1YQSA 3PTEA 2IWCA 2ZM0A 2KX6A 3M2JA 2MJ6A 4BWIA 2ZQAA 1VQQA 3JVUA 3T1XA 2HDQA 1TDGA 1EWZA 1KGEA 3IF6A 3IHBA 5FSRA 2A2LA 4E6XA 1HTZA 3GRJA 3UMDA 1PIOA 2PHYA 5HX9A 4GD8A 1UGUA 2HDUA 3BFEA 4K0WA 3N4IA 4XUZA 3A3EA 1PRQA 2VV7A 3UE0A 3MS6A 3MBZA 4G3WA 4IJGA 3T4KA 4DMZA 1TDLA 5EOOA 5HDCA 2ZMFA 1G6OA 4NXGA 4JXVA 2ZC5B 1QMEA 1YT4A 4LV3A 3HUMA 1XFQA 4HH2A 3UB5P 1L2SA 3WRZA 3BLMA 3U4LP 2QYBA 3CJMA 4GS9A 3VP3A 1CK3A 3QNBA 1MKIA 2PBYA 3IWOA 4OPQA 4U3TA 3EOIA 5HAQA 3UPPA 4FSFA 4CQHA 4ME4A 3DTEA 1G68A 2W3DA 3KSHA 1EI5A 3A3JA 2KOIA 3TOIA 2I72A 2R78A 4E3IA 3MSHA 4GB7A 3IWIA 5M19A 4S2IA 4JGOA 3CHWP 1CJFA 2WGVA 4YOFA 4WEJA 2HGVA 3LIEA 2ZBBA 3NCKA 2KLIA 3R7WB 4WBGA 3P01A 3S7OA 3UDXA 2WKEA 4OOYA 4P0MA 1N9NA 3HLEA 1MBLA 1OTIA 1JWPA 5HPIA 3G30A 2XRNA 3NC8A 3JVVA 2XDMA 1NJ4A 3DWKA 3LFVA 4WZ5A 4ETXA 3BQ8A 5FQMA 1V9YA 5KSHA 1KE4A 1H8ZA 4IBRA 5DTTA 3ZG8B 4OP5A 4DXCA 3LICA 2ZQCA 1C3BA 5JYPA 1S1YA 4U0TA 2HJ9C 4KUKA 4OKPA 1SHVA 3A3IA 2X71A 4OPYA 1W63M 3V3SA 1PYYA 5L09A 3VFHA 3B33A 4R3JA 3BM6A 2BG1A 4DE0A 1P9WA 4UHUA 4YWZA 1ODVA 3V50A 1FCMA 3CPTB 2YKFA 1S4RA 4X69A 1L0FA 1M6KA 3UE6A 1YMSA 3BFFA 2H5SA 4R3BA 4LGWA 4GLQA 4E6WA 5FI6A 1K55C 3CUEA 5TJJA 4X68A 3WRTA 2V1ZA 3O86A 5G4YA 3A0SA 4P6ZS 3ZYTA 3FPVA 4WL9A 3BW6A 5JYOA 2VX8A 3PBQA 1VB6A 3BQAA 1ERQA 4LRXC 3U2AA 3E0YA 1WYBA 1K56D 4JPMA 3VSLA 1X0OA 4R3AA 3TW8A 5FAOA 1YLTA 2VKSA 2HJEA 3MKFA 3D3OA 1NRFA 2ZQ8A 5CHJA 2H0TA 3HUOA 4YINA 4X25A 1SCWA 4CLCC 3C8CA 4KZAA 2K7SA 1SDEA 1N9BA 3F1PA 2M7VA 3LY4A 3BFCA 3EQUA 4QJGA 4XXRA 2JN7A 4OPRA 3Q82A 3OCNA 4B88A 2IA2A 3LGOA 5U47A 5A90A 5DJUA 2J8YA 3O87A 2M1CA 4PM9A 5F5YA 5FL3A 1BTLA 1XJ6A 3WS4A 3KSFA 1ACFA 2CC1A 3TG9A 4GZBA 1IYQA 1OTDA 2XFSA 4IEDA 4OQGA 4R0QA 2BLSA 3IH8A 2BASA 3LIDA 3PBNA 5FEGA 4HHDA 1UWPX 2WKRA 1S4SA 2OAQ1 3VP0A 2V8CA 5HFOA 1LLBA 1I2WA 3W8KA 1DP9A 2HP6A 3F1NA 1GSWA 3IS2B 2HV1A 4NKPA 1K57C 2ZMAA 2JKTM 2W3FA 4BD1A 1T19A 3ZHHA 4UQIS 1OTEA 3KSGA 4L9GA 1ESUA 4RYEA 5A93A 1NY0A 5FASA 4OP8A 5FI2A 4KZ5A 5KZHA 1VM1A 1U60A 3HL9A 4O0PA 3PAEA 3N8LA 1E25A 2Y55A 2V9AA 4P87A 4IHQA 3S1YA 5CGWA 1L0EA 2Y2NA 3C4OA 3VFFA 4UA9A 3Q81A 4GNUA 2VGLS 4JXGA 2ZM2A 1GHIA 5FAQA 3A3DA 3N7WA 3PHYA 5HL1A 1RP5A 2ZC7A 5GHZA 2C5WB 3IS2A 3RTYA 4RX2A 1BULA 4FD8A 3QP2A 2R9XA 1NWZA 5FQJA 2P04A 5I94A 2V0UA 5GHYA 3W2ZA 2Y79A 3VP1A 2VA0A 4KQOA 3OZHA 4H6JA 5CTMA 2W3HA 5CECA 1ZHHB 3E2KA 4E3OA 4GJ4A 5EOEA 5FDSA 2EX2A 3F1NB 5EM1A 5F83A 4IBXA 4S2PA 4KUOA 4M4XA 1OJGA 5M18A 4KG6A 4Y0UA 4NK3A 1ONHA 4MCWA 5D3OA 4FH2A 3N6IA 2W1TB 3GECA 5J3WA 3VOZA 3LR4A 3LO7A 1A0KA 5GHXA 5EFWA 1NXYA 1W79A 4GHIB 5GLAA 1UWNX 2J9PA 2DCFA 3H7WB 5DTSA 4Y3IA 2A24A 1NZOA 5TFQA 3T4OA 1IOUA 2Z2MB 2YKHA 3Q1FA 3WS1A 4DE2A 4PM8A 2B5RA 2OAP1 2ZJ9A 4LCMA 3OOVA 3MF0A 3MMHA 2I9VA 2XQZA 2O9BA 3LIFA 3C38A 1LL9A 3MZFA 5CEDA 3OBFA 2XFTA 4UA7A 1TEMA 5M1AA 4Y15A 3OC2A 4Y5FA 2PT7A 4QHCA 3G35A 1KVLA 3C30A 1DP8A 1BUEA 2P7JA 3K3CA 5FI7A 2B95A 3JPUA 2RCXA 1OT6A 4DF6A 3T4JA 3LR3A 4YFMA 2V1BA 3HLDA 4HI4A 1DP6A 2OLVA 4GS9B 1LSWA 4HJ6A 4ARZA 1MC0A 4Y7PA 4NXEA 4S2MA 4II7A 4JF4A 3HUNA 1XX2A 4L9FA 2WGIA 3UE1A 4P6BA 2PYPA 4O7DA 4A5RA 4N9LA 3W4PA 3BY9A 1XXMA 4E3KA 3T1SA 3OPLA 1TVFA 1NZUA 1MZUA 1KGFA 3SH8A 4OOMA 2L0WA 1FSYA 3UB6A 1ERMA 2VV8A 4NETA 1XA1A 4K0XA 1TS0A 3QNCA 3CUEC 3B47A 4DXBA 5AQ9A 3DWZA 1ES4A 1K6RA 1NYMA 3SS5A 2V2FF 3BECA 1WE4A 4KZ4A 4F3LB 3E2LA 3A3FA 4EWFA 2A24B 5HW3A 1ZG6A 4FUWA 4NXFA 3HJKA 2HDSA 5FATA 2FZ0A 2Y4AA 1VHMA 2RL3A 2VZWA 3NDGA 1EROA 4BMWA 2EXBA 1I5QA 1YM1A 3OCLA 1K6SA 2JKGA 3O88A 3BFGA 1F5MA 3C4PA 3LCEA 4DE1A 5CGXA 2OSUA 3Q7ZA 3LR5A 4CLCB 2Q9NA 2D02A 1YLYA 4QD4A 1EW0A 4Q0HA 3UB9A 1QMFA 1P9RA 3VE3A 3UO9A 4MBHA 3HLBA 2IWBA 1T1BA 5IT5A 4KQQA 1DJAA 5FEFA 2GJ3A 4IUKA 3T4SA 3KYZA 3OPPA 1KVMA 1FIKA 4OLDA 3GTCA 4Q0IA 4P6ZM 5EVEA 1BSGA 1J3WA 3NIAA 3FKVA 3UN7A 1ZC2A 2OWJA 3T12B 2JHEA 3IF6C 3K3DA 4RQ9A 3MQQA 3BJNA 4KG5A 4XT2A 2HP9A 4HP9A 3MXSA 2WGWB 3WS5A 2L1MA 3Q7VA 5EPHA 1K4FA 2PRFA 4EERA 1STZA 2XA7M 2OOLA 4PHTA 4KZ6A 5L07A 3TJZC 5GLDA 3PBRA 3CI6A 1IFQA 4NEED 3AGDA 4C3QA 1IEMA 2V8FA 5IS1A 1O7EA 4JF5A 4FCFA 4OVDA 5FAPA 3MJQA 2UWXA 2Y2QA 3LIAA 4KZ8A 4LV0A 2Y2JA 3HREA 4JGQA 3C7VA 3D4FA 3HLWA 2QWSA 3MKEA 4Z9QA 4EEUA 1CI9A 1P97A 3MXQA 4R38A 1LT0A 2QJ5A 3H7WA 3RFBA 2ZMVA 4X6TA 5DFXA 1FILA 3IXGA 4CJNA 2WK0A 3LI8A 4BL2A 3HJIA 1K54A 4Y17A 3S7NA 1FOFA 4S2NA 5CHMA 3TE8A 2EFUA 3NHQA 4Q8IA 1P0ZA 1TS7A 2XROA 3SOIA 5GLBA 2JBFA 3UMEA 1VEUA 4QU3A 4S2OA 1Y54A 1WYCA 4PM7A 3VE4A 5CHUA 2ZQDA 4WYYA 1HD8A 3C5AA 5HSQA 1BZAA 1DY6A 2Y2MA 2Z2LB 1CF0A 2FFYA 1LI9A 2LB9A 2P9VB 5EE8A 1CQAA 4KENB 4KZ9A 5EVIA 1W8QA 4GKUA 1G28A 2J7VA 3IX3A 1YKDA 4GN2A 5EVIB 2QJ7A 1G6AA 2HZ5A 4EW7A 2JKFA 1MWRA 4FTXA 3UDFA 4WEKA 4I39A 1S6RA 3PBOA 4MDZA 2J80A 2O0YA 4E3MA 4B4ZA 1YPRA 4BJPA 4L0LA 3TRCA 4N9KA 3CWFA 5AQBA 1S67L 1LSXA 2Y2GA 5F82A 2JKRM 5CXWA 3BEBA 5AVFA 2R9WA 2J9OA 1PWGA 3WWXA 4PPRA 2P74A 3QP8A 5DF7A 5HD3A 3DW0A 4DN0A 1GHMA 2WUQA 4Y2FA 3ZG9B 3KO6A 4JXSA 1DRMA 4WUJA 5HWTA 4FH4A 1YMXA 4B4XA 3ZGAB 4H8RA 2XGNA 1ESIA 1Z09A 2PBDP 2Y2LA 2WZXA 5E2HA 1MXOA 5TBMB 1FCOA 5EVLA 3FPWA 2OWHA 3S7PA 3R4KA 4H6JB 1FCNA 2QPNA 1T1CA 3T1RA 5HZHA 1VETB 4N1HA 3MXRA 3HLGA 2HP5A 1GSXA 2VGLM 4D60A 3BFDA 3MFDA 3UB8A 4GOGA 1JTGA 1WA9A 4BBTA 1YLZA 2VV6A 4QY5A 2JCHA 4PKYG 4ESPA 2Y59A 3V67A 4F3LA 3VOLA 1ZKJA 1TF1A 4RVAA 4LFUA 3KYEA 2W1TA 1BT5A 2PD7A 1VEUB 4R4RA 1PFLA 4QB8A 5HWWA 3E4QA 1H8YA 3ZG5A 1ES2A 1PI4A 2IWDA 5GLCA 4D2OA 3M2KA 5DF9A 5TBMA 1XGJA 1PI5A 1H5XA 3VMAA 4OH0A 4R70A 2Q0OA 4CLCE 1NRJA 3IT9A 3P09A 5FQ9A 1KDSA 4K91A 2PAVP 2G2UA 3JYIA 3ZNYA 3LY3A 1W63Q 1PWDA 4RX3A 3M6BA 4HNBA 1T18A 1NYYA 5AJGA 4WMCA 3C7UA 4DDSA 4WN5A 4ZDXA 3AGEA 1GA9A 3ZVTA 3MZEA 1G5UA 1BYWA 1GSVA 4I38A 3P7NA 5MC7A 3BYDA 1MY8A 1M40A 5J8XA 4PM6A 3FZCA 2B02A 5AQ7A 4DE3A 3GVBA 5LBRA 3G34A 4PAUA 3PYPA 3KYQA 3NJAA 2H10A 2AVXA 1N9LA 2FH5A 4GDNA 3V5MA 1SKOB 1HLUP 5DJTA 1MWUA 4R6LA 1I2SA 3I7JA 2EWVA 3UY6A 2XSSA 3IF6B 4XUXA 1XJ4A 3OPHA 4HQAA 1E3UA 1IKGA 1JVJA 1JTDA 2P08A 2WKQA 3IHAA 1VETA 3GQZA 2EX9A 1PZOA 1KOUA 2Y8HA 1BLPA 2PD8A 1FSWA 2WAFA 1F9IA 4R4SA 5L8MA 1NLZA 1PZPA 1YLJA 5AQAA 2ACGA 1D7EA 5K5BA 4OLGA 5F1GA 5HAPA 3S7QA 1V9ZA 3G6OA 2D01A 1ZG4A 4N1XA 1TD5A 3LI9A 2O9AA 2QKPA 1MPLA 3MZDA 3MQOA 2EWWA 4EUZA 2XR0A 3CAXA 4UEYA 1H8MA 1JWVA 2XF3A 3NOUC 1LSVA 3BLSA 3DTIA 1SKOA 4I3AA 4KQRA 5EVIC 1L3LA 1YLWA 1OPXA 4JGPA 5A92A 4BBVA 3LR0A 4Y0TA 4ZTKA 2WYXA 4HH3A 1FR1A 5EV0A 1K4EA 3LEZA 4MLLA 4E3JA 2Y2PA 1H0MA 4LV1A 1DJCA 4HOIA 4EESA 3H82B 1YSPA 1K55A 1ES5A 5I5LA 4EEPA 4R23A 3SS3A 3IXHA 3EWKA 5E2GA 2W3EA 3EEHA 4G3VA 3UB7A 4GD6A 4BENA 3MR0A 3KSIA 4JF6A 2A49A 4JBFA 3H82A 4BD0A 1PWCA 1TS6A 3FG8A 5EVID 4ETZA 2E8JA 3UDIA 3CMZA 2VGKA 3MFXA 1W5DA 2WKPA 4WLAA 3BWLA 4DJ3A 4JGRA 3WS0A 4HJ3A 4WZ4A 5IHVA 2EX8A 2VLGA 4LV2A 3D72A 5HD5A 4GHIA 4S2NC 3FYZA 4ZJ3A 1YAXA 2Y91A 5G18A 1L0DA 4MEZA 4I3IA 1Z6FA 4AFIA 1FQGA 4NG2A 2J3TC 2QHKA 2PDRA 5CRFA 1YLPA 1F2KA 1K57A 3QP5A 2X01A 4EV4A 5C5KA 4EU0A 3WS2A 3UE3A 4ZJ2A 3QHYA 4X53A 4UAAA 1XJ3A 4PKYA 3SW1A 5F69A 4S2KA 2H0YA 3F1PB 4Q0JA 1ALQA 1HVBA 2GX5A 1OTAA 3DBAA 1F98A 5HDDA 3RJUA 3G2ZA 3Q07A 2O9CA 2V1AA 1SDNA 1IYSA 4G3KA 3PR6A 2HF6A 3UPOA 4ZRRA 2FFFB 1IYPA 4IVIA 2WADA 3MQ0A 3F1OA 5A8BA 5DFYA 4X1LA 2XA7S
chains in the Genus database with same CATH topology
4I3JA 2V0UA 3W2ZA 3A0RA 2M7UA 4WEKA 4I39A 2Y79A 4FOFA 3PBOA 4MDZA 2J80A 2G7UA 4L9EA 2VA0A 4KQOA 2O0YA 3EGXC 4H6JA 2W3HA 4O8GA 4BJPA 1ZHHB 4GJ4A 4L0LA 3TRCA 3CWFA 1YSQA 3F1NB 1S67L 1H3QA 4OOLA 5IU1A 1LSXA 5DKLA 4KUOA 2JKRM 4M4XA 3IBRA 1OJGA 3R7WA 5AVFA 4CLCA 2O99A 3CLOA 5HDSA 3EQVA 4KQDA 5HD3A 4DN0A 4O01A 4MCWA 1N9OA 4Y2FA 4EQ1A 2W1TB 3KO6A 3GECA 1DRMA 4WUJA 5HWTA 5J3WA 3T4QA 2ZOIA 1LL8A 4CLCD 3LR4A 3OLOA 2V0WA 4EETB 3E98A 3GDIA 5F6AA 3A0VA 3LIBA 4ARZB 4GCZA 5EFWA 1MKMA 2W0NA 1D06A 4GHIB 5TBMB 1UWNX 3H7WB 3FPWA 2A24A 4Y3IA 2KX6A 2OWHA 3T4OA 1IOUA 4YNRA 2J3TD 2MJ6A 4BWIA 3S7PA 3R4KA 4H6JB 2YKHA 3IBJA 3JVUA 3LUQA 1T1CA 2OAP1 4XT2B 5HZHA 4K08A 2Z6DA 3OOVA 3MF0A 3MMHA 2A2LA 2I9VA 2O9BA 3LIFA 1GSXA 2VGLM 3E4PA 3ZQ5A 3C38A 2ZOHA 3UB8A 5HWVA 3UMDA 4LLOB 1WA9A 4BBTA 2L4RA 2VV6A 3OBFA 1S66L 2PHYA 3LYXA 4PKYG 1UGUA 3V67A 3OC2A 4Y5FA 4F3LA 3VOLA 2PT7A 3C30A 1DP8A 1TF1A 2P7JA 2W1TA 2VV7A 2PD7A 3K3CA 4IJGA 4G3WA 3T4KA 4DMZA 5HWWA 3E4QA 1OT6A 3T4JA 2INWA 2KDKA 3LR3A 4QPRA 5HDCA 2V1BA 5DF9A 5TBMA 2ZMFA 1G6OA 4NXGA 4WELA 4HI4A 1DP6A 4R70A 4HJ4A 4GS9B 1LSWA 4HJ6A 4CLCE 4ARZA 1MC0A 1NRJA 1XFQA 4NXEA 4HH2A 4II7A 1T1AA 2QYBA 4GS9A 4L9FA 1W63Q 5KIZA 3EOIA 4FSFA 2PYPA 4B93A 4CQHA 4ME4A 3EEAA 1OT9A 4HNBA 3F1OB 1T18A 3BY9A 2W3DA 3KSHA 4EXOA 2KOIA 5AJGA 2R78A 4WN5A 1MZUA 2GZAA 4OOMA 2L0WA 3UB6A 1XJ2A 4MN6A 4JGOA 2VV8A 1GSVA 1BYWA 4I38A 2JKTI 4WEJA 4YOFA 2HGVA 3P7NA 5MC7A 3LIEA 5G4ZA 2Z6CA 2ZBBA 2KLIA 3R7WB 4BBUA 1TS0A 2H28A 2B02A 3P01A 3S7OA 3CUEC 3B47A 4HP4A 5LBRA 3O5YA 3B42A 4PAUA 3PYPA 3RH8B 3KYQA 1N9NA 5HL6A 1Y28A 3NJAA 4F3LB 1OTIA 5HPIA 1N9LA 2W27A 2A24B 1XFNA 2FH5A 2XRNA 3JVVA 4NXFA 3HJKA 3LFVA 4ETXA 5DJTA 3BQ8A 4B9OA 1V9YA 3FC7A 4R6LA 5KSHA 2FZ0A 3H9WA 2EWVA 2XSSA 1VHMA 1XJ4A 5J4EA 2VZWA 3LICA 4BMWA 4HQAA 3VV4A 2WKQA 2P08A 3OCLA 1S1YA 2HJ9C 4KUKA 3EGDC 4DJ2A 1F5MA 3E4OA 1KOUA 1W63M 2Y8HA 3B33A 1P9WA 4YWZA 1ODVA 2PD8A 2K31A 2YKFA 1S4RA 3LR5A 1F9IA 3T50A 4CLCB 1S1ZA 5L8MA 1NLZA 2D02A 4I5SA 4MN7A 4UQIM 1D7EA 1EW0A 3UE6A 4Q0HA 3UB9A 5K5BA 1P9RA 3VE3A 4GLQA 1T1BA 4LRZE 5IT5A 3S7QA 3CUEA 5TJJA 1V9ZA 3G6OA 2D01A 1TD5A 2GJ3A 3LI9A 4IUKA 3T4SA 3KYZA 2O9AA 2QKPA 3PXPA 5G4YA 3A0SA 4Q0IA 2VJWA 4P6ZM 3MQOA 2GNXA 2EWWA 3CAXA 4UEYA 4P6ZS 1H8MA 3ZYTA 3NOUC 4HIAA 3FPVA 4WL9A 3T4TA 1LSVA 3BW6A 2VX8A 2JKRI 4I3AA 3PBQA 1VB6A 3BQAA 5DKKA 2OWJA 2JHEA 4LRXC 3U2AA 2NUTC 3E0YA 3K3DA 4RQ9A 1X0OA 3MQQA 4R3AA 2NUPC 3BJNA 2VKSA 2HJEA 4HY8A 1OPXA 4XT2A 3TW8A 3D3OA 4HP9A 4JGPA 4BBVA 3LR0A 2L1MA 5J7EA 5HPFA 4CLCC 3C8CA 4EERA 3PBTA 1STZA 2K7SA 2PR5A 4HH3A 2XA7M 3F1PA 2OOLA 2M7VA 4PHTA 3EQUA 3TJZC 1OTBA 2JN7A 3OCNA 3PBRA 3CI6A 1IFQA 4NEED 4HOIA 2IA2A 4EESA 2DMWA 3H82B 1YSPA 2K2NA 5DJUA 5I5LA 2M1CA 2CMNA 4EEPA 5F5YA 4WF0A 5FL3A 1XJ6A 3EWKA 3KSFA 2W3EA 3EEHA 5IS1A 4LPZA 4G3VA 3UB7A 1OTDA 3MJQA 3K2NA 3NOPC 1ZTUA 3NOTC 3LIAA 4MMNA 3MR0A 2BASA 3LIDA 4JGQA 3PBNA 3PBSA 3KSIA 4HHDA 1UWPX 4E04A 2WKRA 3H82A 2QWSA 1S4SA 2OAQ1 4EEUA 3FG8A 1TS6A 3ULFA 4ETZA 2W1RA 1P97A 3MXQA 4R38A 2VEAA 1LT0A 3MFXA 1DP9A 2QJ5A 3F1NA 1GSWA 3IS2B 2WKPA 2HV1A 4NKPA 4WLAA 3BWLA 4DJ3A 2JKTM 2W3FA 4JGRA 3H7WA 3RFBA 1T19A 2ZMVA 5DFXA 4HJ3A 2J3WA 4UQIS 1OTEA 3LI8A 3KSGA 3T4LA 3HJIA 4L9GA 2B18A 3C2WA 4Z1WA 2VLGA 3S7NA 3D72A 5HD5A 3KX0X 4GHIA 3TE8A 4EUVA 1YAXA 2PR6A 1OJ5A 3NHQA 4I3IA 4O0PA 4AFIA 1P0ZA 1TS7A 2V9AA 2EA9A 3CITA 4IHQA 2PYRA 2J3TC 2QHKA 2PDRA 2XROA 1TS8A 3UMEA 1JNUA 4IUHA 5AVEA 2VGLS 3HCYA 5C5KA 4EU0A 1NLYA 2W3GA 3UE3A 3PHYA 3VE4A 1XJ3A 4PKYA 3SW1A 2LB5A 4NXBA 5F69A 5HSQA 3F1PB 4Q0JA 3IS2A 3RTYA 2GX5A 1OTAA 3DBAA 2LB9A 1F98A 5HDDA 2O9CA 2V1AA 4LRYC 1NWZA 4G3KA 3PR6A 2HF6A 1G28A 4GW9A 4ZRRA 1YKDA 2P04A 3BY8A 5CX7A 2QJ7A 3MQ0A 3F1OA 5F68A 4EW7A 5A8BA 5DFYA 3ICYA 4MN5A 2XA7S
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I3J A;  1OTD A;  2V0U A;  3MJQ A;  2VV7 A;  3A0R A;  2WKQ A;  2PD7 A;  3NOP C;  4I39 A;  3K3C A;  1S1Y A;  3NOT C;  4KUK A;  3LIA A;  5HWW A;  3E4Q A;  2J80 A;  4DJ2 A;  1OT6 A;  3MR0 A;  2BAS A;  2INW A;  3LID A;  4JGQ A;  2KDK A;  3E4O A;  4HHD A;  1UWP X;  4L9E A;  1KOU A;  2V1B A;  5HDC A;  4E04 A;  2WKR A;  3H82 A;  5TBM A;  4H6J A;  2QWS A;  1S4S A;  3B33 A;  4NXG A;  4HI4 A;  1DP6 A;  4R70 A;  3FG8 A;  1TS6 A;  3ULF A;  4EEU A;  4HJ4 A;  1P97 A;  4GS9 B;  1LSW A;  4HJ6 A;  4YWZ A;  1ODV A;  2PD8 A;  1XFQ A;  3MXQ A;  4HH2 A;  4NXE A;  3CWF A;  2YKF A;  2VEA A;  1LT0 A;  1S4R A;  1S67 L;  3F1N B;  4R38 A;  3MFX A;  1DP9 A;  1F9I A;  2QJ5 A;  3F1N A;  1S1Z A;  3T50 A;  5DJU A;  1GSW A;  3IS2 B;  2WKP A;  2D02 A;  1T1A A;  5IU1 A;  2HV1 A;  4WLA A;  1LSX A;  3BWL A;  4GS9 A;  4I5S A;  4KUO A;  5DKL A;  4L9F A;  4M4X A;  4DJ3 A;  3IBR A;  1OJG A;  4JGR A;  3H7W A;  5AVF A;  1T19 A;  3CLO A;  1D7E A;  4HJ3 A;  5HDS A;  1EW0 A;  5KIZ A;  3UE6 A;  3UB9 A;  1OTE A;  3LI8 A;  3VE3 A;  2PYP A;  3HJI A;  4KQD A;  5HD3 A;  4L9G A;  3C2W A;  1OT9 A;  1T1B A;  2VLG A;  1N9O A;  4HNB A;  4LRZ E;  3D72 A;  3F1O B;  1T18 A;  1V9Z A;  3BY9 A;  5HD5 A;  3G6O A;  3KX0 X;  2D01 A;  4GHI A;  4EXO A;  4EQ1 A;  2GJ3 A;  3GEC A;  3LI9 A;  1DRM A;  4WUJ A;  5HWT A;  2PR6 A;  5J3W A;  2ZOI A;  1OJ5 A;  1LL8 A;  2QKP A;  2R78 A;  3NHQ A;  3OLO A;  1MZU A;  2V0W A;  4I3I A;  3A0S A;  5G4Y A;  3UB6 A;  1P0Z A;  2L0W A;  3MQO A;  4EET B;  1TS7 A;  1XJ2 A;  2V9A A;  4JGO A;  3CAX A;  3GDI A;  4MN6 A;  2EA9 A;  3A0V A;  2VV8 A;  2PYR A;  2QHK A;  3LIB A;  4GCZ A;  2PDR A;  5F6A A;  5EFW A;  3NOU C;  4HIA A;  4EEP A;  4WL9 A;  1LSV A;  1GSV A;  1BYW A;  1TS8 A;  4I38 A;  2W0N A;  3P7N A;  4B9O A;  4I3A A;  3LIE A;  5G4Z A;  3UME A;  1JNU A;  1VB6 A;  1D06 A;  2Z6C A;  4GHI B;  2ZBB A;  5AVE A;  5TBM B;  1UWN X;  3H7W B;  2OWJ A;  5DKK A;  4BBU A;  1TS0 A;  2A24 A;  2H28 A;  2JHE A;  4LRX C;  2B02 A;  2KX6 A;  2OWH A;  3K3D A;  4RQ9 A;  3PHY A;  1X0O A;  3MQQ A;  4R3A A;  4HY8 A;  4XT2 A;  4H6J B;  4HP4 A;  4HP9 A;  2YKH A;  4JGP A;  3LUQ A;  3VE4 A;  4BBV A;  3PYP A;  1XJ3 A;  4PKY A;  3SW1 A;  3RH8 B;  4NXB A;  2L1M A;  5J7E A;  1N9N A;  1Y28 A;  1T1C A;  3NJA A;  5F69 A;  5HSQ A;  3C8C A;  3F1P B;  4XT2 B;  3IS2 A;  4EER A;  4HH3 A;  2K7S A;  2PR5 A;  4K08 A;  3RTY A;  5HZH A;  3F1P A;  2OOL A;  1OTA A;  2Z6D A;  4F3L B;  1OTI A;  4WN5 A;  1N9L A;  2I9V A;  2A24 B;  2W27 A;  3LIF A;  1F98 A;  1GSX A;  1OTB A;  1XFN A;  2JN7 A;  3E4P A;  5HDD A;  3ZQ5 A;  2ZOH A;  2V1A A;  3UB8 A;  4HOI A;  4LRY C;  4NXF A;  3UMD A;  4LLO B;  4EES A;  1NWZ A;  5HWV A;  1WA9 A;  4BBT A;  3HJK A;  2L4R A;  2VV6 A;  3H82 B;  5DJT A;  1G28 A;  1S66 L;  1V9Y A;  2PHY A;  2M1C A;  2CMN A;  3FC7 A;  3LYX A;  4GW9 A;  4PKY G;  4R6L A;  5I5L A;  1UGU A;  4WF0 A;  3BY8 A;  3H9W A;  5F5Y A;  2QJ7 A;  1XJ6 A;  4F3L A;  3VOL A;  3F1O A;  3EWK A;  5F68 A;  4EW7 A;  5A8B A;  1XJ4 A;  3EEH A;  5J4E A;  3ICY A;  5IS1 A;  4MN5 A;  4LPZ A;  1DP8 A;  3LIC A;  2P7J A;  4HQA A;  3UB7 A; 
#chains in the Genus database with same CATH topology
 4GDB A;  4HEF A;  3VSK A;  1KE0 A;  1BLH A;  4L9E A;  5FA7 A;  1LL5 A;  1JWZ A;  3VOY A;  2PU2 A;  1DJB A;  4O8G A;  3L9K A;  4MBF A;  3GV9 A;  1MWS A;  3IWQ A;  4X55 A;  1CEG A;  2ZC4 B;  4PMA A;  2ZL1 B;  1FR6 A;  1PW1 A;  1K56 A;  4X1M A;  3R7W A;  4CLC A;  2Y2K A;  2O99 A;  4ZAM A;  1RGY A;  4BQM A;  3EQV A;  4O01 A;  1N9O A;  2QZ6 A;  2DNS A;  2ZQ9 A;  2ZOI A;  4OON A;  3OLO A;  2V0W A;  3ZDJ A;  4EET B;  3ITB A;  3E98 A;  2C6W B;  3A0V A;  1K38 A;  2EFX A;  3LIB A;  3N8S A;  4GCZ A;  1IYO A;  3FWL A;  4DDY A;  2W0N A;  1AXB A;  1D06 A;  5EM0 A;  3M6H A;  2VK3 A;  1J9M A;  4RA7 A;  5TGF A;  4YNR A;  2J3T D;  3IBJ A;  3LUQ A;  3TSG A;  4OPZ A;  4EBL A;  2XLN A;  4XT2 B;  4K08 A;  2Z6D A;  3IXB A;  4EQI A;  4CPK A;  5DVA A;  5L10 A;  3E4P A;  3ZQ5 A;  2XD1 A;  2ZOH A;  3UPN A;  5HWV A;  4LLO B;  3RXW A;  3V3R A;  2L4R A;  1RCJ A;  1BLC A;  1S66 L;  3LYX A;  3VP4 A;  1E3U D;  4C6Y A;  5FDH A;  5DF8 A;  3QP1 A;  4HBT A;  2WKI A;  3S4X A;  3P98 A;  1O07 A;  1Q2Q A;  4LCL A;  2INW A;  2KDK A;  4QPR A;  3IX4 A;  4HES A;  4OQI A;  1XP4 A;  3UNW A;  4KZ7 A;  1LHY A;  4WEL A;  3IQA A;  4HJ4 A;  3NBL A;  1MWT A;  2A3U A;  2ZM8 A;  3B3X A;  3DTK A;  1T1A A;  4N92 A;  5KIZ A;  4JXW A;  4BLM A;  4B93 A;  5CGS A;  3EEA A;  1OT9 A;  4KZB A;  1D1J A;  3IH9 A;  3F1O B;  2ZD8 A;  4EXO A;  1Q2P A;  4R1G A;  3HLF A;  4S2J A;  2GZA A;  1XJ2 A;  4MN6 A;  3GR2 A;  2JKT I;  2HDR A;  5G4Z A;  2Z6C A;  3SS4 A;  3DAV A;  4BBU A;  2H28 A;  3PAG A;  2V20 A;  4HP4 A;  3O5Y A;  3B42 A;  3NEC A;  4HBU A;  3RH8 B;  1ES3 A;  5HL6 A;  1Y28 A;  1SZV A;  4QY6 A;  3G32 A;  3NDE A;  2W27 A;  1XFN A;  3CZD A;  3G31 A;  1L0G A;  1AWI A;  3FC7 A;  4B9O A;  3AGF A;  3OPR A;  3H9W A;  4KZ3 A;  1KE3 A;  5J4E A;  3QP6 A;  4MNR A;  5HAI A;  5F1F A;  3VV4 A;  4PM5 A;  3FKW A;  3EGD C;  4DJ2 A;  2ZC3 B;  3E4O A;  3IXD A;  4UA6 A;  2OLU A;  2X02 A;  1KGG A;  2WKH A;  2OV5 A;  2K31 A;  2WGW A;  2BTF P;  4KG2 A;  3T50 A;  1S1Z A;  3T1Q B;  4U0X A;  4I5S A;  4X56 A;  2VGJ A;  5FQK A;  4MN7 A;  4UQI M;  5E43 A;  2G2W A;  4S2L A;  4DRT A;  2PU4 A;  3NUL A;  1CI8 A;  1ONG A;  4LRZ E;  4Y13 A;  2QMI A;  3V39 A;  3GSG A;  4EBN A;  5DTK A;  1XGI A;  5FQQ A;  3PXP A;  4M3K A;  2VJW A;  2GNX A;  3HBR A;  4HIA A;  2Y2O A;  3T4T A;  3BRM A;  3HLC A;  2JKR I;  3L7H A;  1IEL A;  5DKK A;  2P9V A;  2NUT C;  5EUA A;  1PNE A;  2NUP C;  4HY8 A;  3ZCZ A;  4E3L A;  5J7E A;  5HPF A;  3IX8 A;  5CER A;  3PBT A;  2PR5 A;  2Y2H A;  3Q7V B;  3W4O A;  1OTB A;  2EXA A;  2E8I A;  4WM9 A;  3G4P A;  2DMW A;  1W8Y A;  2K2N A;  2WZZ A;  1RGZ A;  2CMN A;  1K54 C;  4WF0 A;  2WAE A;  4LPZ A;  1HZO A;  5BOH A;  4DKI A;  1Y4O A;  1S0W A;  5KSC A;  4E3N A;  3K2N A;  3NOP C;  1ZTU A;  3NOT C;  4F94 A;  4MMN A;  3ISG A;  1BLS A;  1W7F A;  3D9Y A;  3PBS A;  4C75 A;  4E04 A;  1SKF A;  3N8R A;  3IF5 A;  3ULF A;  1GHP A;  2W1R A;  5KMW A;  3LEQ A;  2VEA A;  4QWO A;  4IVK A;  3CG5 A;  2ZC6 B;  2HPB A;  3ZG0 A;  4EBP A;  2JC7 A;  2J3W A;  1IKI A;  5HAR A;  3T4L A;  2B18 A;  3C2W A;  4Z1W A;  3KX0 X;  1GCE A;  3DTM A;  4EUV A;  2PR6 A;  2DRW A;  1OJ5 A;  3CPT A;  2EA9 A;  3CIT A;  2PYR A;  1CEF A;  3RXX A;  1TS8 A;  1XPB A;  1JNU A;  4IUH A;  5AVE A;  1LI0 A;  3HCY A;  4ZBE A;  1NLY A;  2W3G A;  4BL3 A;  2UV0 E;  2XK1 A;  5CTN A;  1K0K A;  2LB5 A;  3QP4 A;  4NXB A;  5E2F A;  5TR7 A;  5GL9 A;  2XEP A;  3G2Y A;  4LEN A;  4LRY C;  4ZJ1 A;  3W4Q A;  3VP2 A;  2Q9M A;  5EEC A;  4OQH A;  2JE5 A;  1E4D A;  4GW9 A;  5L2F A;  4Y0O A;  3SH9 A;  2XH9 A;  5FQI A;  3BY8 A;  5CX7 A;  4WZ5 C;  5F68 A;  3ZG7 B;  3SZT A;  3FV7 A;  3SH7 A;  3ICY A;  4MN5 A;  4ID4 A;  3O3V A;  1KDW A;  4I3J A;  3A0R A;  2M7U A;  3ZVW A;  4FOF A;  1K25 A;  2G7U A;  2ZLY A;  5E2E A;  3HVF A;  4WMC D;  3EGX C;  2XD5 A;  3ITA A;  5CEB A;  4MBK A;  1YSQ A;  1H3Q A;  4OOL A;  5IU1 A;  3GMW A;  2GDN A;  5DKL A;  3NI9 A;  1PW8 A;  3IBR A;  2EX6 A;  2ZQ7 A;  3CLO A;  5HDS A;  1XKZ A;  2Y2I A;  4JLF A;  3ZFZ A;  3ZNT A;  4KQD A;  2ZL1 A;  3S22 A;  1XA7 A;  1GA0 A;  3NY4 A;  1OME A;  1N4O A;  4EQ1 A;  4JKT A;  3T4Q A;  1LL8 A;  4CLC D;  5A91 A;  3GDI A;  5F6A A;  4P85 A;  4ARZ B;  1MKM A;  4OQ0 A;  1YQS A;  3PTE A;  2IWC A;  2ZM0 A;  2KX6 A;  3M2J A;  2MJ6 A;  4BWI A;  2ZQA A;  1VQQ A;  3JVU A;  3T1X A;  2HDQ A;  1TDG A;  1EWZ A;  1KGE A;  3IF6 A;  3IHB A;  5FSR A;  2A2L A;  4E6X A;  1HTZ A;  3GRJ A;  3UMD A;  1PIO A;  2PHY A;  5HX9 A;  4GD8 A;  1UGU A;  2HDU A;  3BFE A;  4K0W A;  3N4I A;  4XUZ A;  3A3E A;  1PRQ A;  2VV7 A;  3UE0 A;  3MS6 A;  3MBZ A;  4G3W A;  4IJG A;  3T4K A;  4DMZ A;  1TDL A;  5EOO A;  5HDC A;  2ZMF A;  1G6O A;  4NXG A;  4JXV A;  2ZC5 B;  1QME A;  1YT4 A;  4LV3 A;  3HUM A;  1XFQ A;  4HH2 A;  3UB5 P;  1L2S A;  3WRZ A;  3BLM A;  3U4L P;  2QYB A;  3CJM A;  4GS9 A;  3VP3 A;  1CK3 A;  3QNB A;  1MKI A;  2PBY A;  3IWO A;  4OPQ A;  4U3T A;  3EOI A;  5HAQ A;  3UPP A;  4FSF A;  4CQH A;  4ME4 A;  3DTE A;  1G68 A;  2W3D A;  3KSH A;  1EI5 A;  3A3J A;  2KOI A;  3TOI A;  2I72 A;  2R78 A;  4E3I A;  3MSH A;  4GB7 A;  3IWI A;  5M19 A;  4S2I A;  4JGO A;  3CHW P;  1CJF A;  2WGV A;  4YOF A;  4WEJ A;  2HGV A;  3LIE A;  2ZBB A;  3NCK A;  2KLI A;  3R7W B;  4WBG A;  3P01 A;  3S7O A;  3UDX A;  2WKE A;  4OOY A;  4P0M A;  1N9N A;  3HLE A;  1MBL A;  1OTI A;  1JWP A;  5HPI A;  3G30 A;  2XRN A;  3NC8 A;  3JVV A;  2XDM A;  1NJ4 A;  3DWK A;  3LFV A;  4WZ5 A;  4ETX A;  3BQ8 A;  5FQM A;  1V9Y A;  5KSH A;  1KE4 A;  1H8Z A;  4IBR A;  5DTT A;  3ZG8 B;  4OP5 A;  4DXC A;  3LIC A;  2ZQC A;  1C3B A;  5JYP A;  1S1Y A;  4U0T A;  2HJ9 C;  4KUK A;  4OKP A;  1SHV A;  3A3I A;  2X71 A;  4OPY A;  1W63 M;  3V3S A;  1PYY A;  5L09 A;  3VFH A;  3B33 A;  4R3J A;  3BM6 A;  2BG1 A;  4DE0 A;  1P9W A;  4UHU A;  4YWZ A;  1ODV A;  3V50 A;  1FCM A;  3CPT B;  2YKF A;  1S4R A;  4X69 A;  1L0F A;  1M6K A;  3UE6 A;  1YMS A;  3BFF A;  2H5S A;  4R3B A;  4LGW A;  4GLQ A;  4E6W A;  5FI6 A;  1K55 C;  3CUE A;  5TJJ A;  4X68 A;  3WRT A;  2V1Z A;  3O86 A;  5G4Y A;  3A0S A;  4P6Z S;  3ZYT A;  3FPV A;  4WL9 A;  3BW6 A;  5JYO A;  2VX8 A;  3PBQ A;  1VB6 A;  3BQA A;  1ERQ A;  4LRX C;  3U2A A;  3E0Y A;  1WYB A;  1K56 D;  4JPM A;  3VSL A;  1X0O A;  4R3A A;  3TW8 A;  5FAO A;  1YLT A;  2VKS A;  2HJE A;  3MKF A;  3D3O A;  1NRF A;  2ZQ8 A;  5CHJ A;  2H0T A;  3HUO A;  4YIN A;  4X25 A;  1SCW A;  4CLC C;  3C8C A;  4KZA A;  2K7S A;  1SDE A;  1N9B A;  3F1P A;  2M7V A;  3LY4 A;  3BFC A;  3EQU A;  4QJG A;  4XXR A;  2JN7 A;  4OPR A;  3Q82 A;  3OCN A;  4B88 A;  2IA2 A;  3LGO A;  5U47 A;  5A90 A;  5DJU A;  2J8Y A;  3O87 A;  2M1C A;  4PM9 A;  5F5Y A;  5FL3 A;  1BTL A;  1XJ6 A;  3WS4 A;  3KSF A;  1ACF A;  2CC1 A;  3TG9 A;  4GZB A;  1IYQ A;  1OTD A;  2XFS A;  4IED A;  4OQG A;  4R0Q A;  2BLS A;  3IH8 A;  2BAS A;  3LID A;  3PBN A;  5FEG A;  4HHD A;  1UWP X;  2WKR A;  1S4S A;  2OAQ 1;  3VP0 A;  2V8C A;  5HFO A;  1LLB A;  1I2W A;  3W8K A;  1DP9 A;  2HP6 A;  3F1N A;  1GSW A;  3IS2 B;  2HV1 A;  4NKP A;  1K57 C;  2ZMA A;  2JKT M;  2W3F A;  4BD1 A;  1T19 A;  3ZHH A;  4UQI S;  1OTE A;  3KSG A;  4L9G A;  1ESU A;  4RYE A;  5A93 A;  1NY0 A;  5FAS A;  4OP8 A;  5FI2 A;  4KZ5 A;  5KZH A;  1VM1 A;  1U60 A;  3HL9 A;  4O0P A;  3PAE A;  3N8L A;  1E25 A;  2Y55 A;  2V9A A;  4P87 A;  4IHQ A;  3S1Y A;  5CGW A;  1L0E A;  2Y2N A;  3C4O A;  3VFF A;  4UA9 A;  3Q81 A;  4GNU A;  2VGL S;  4JXG A;  2ZM2 A;  1GHI A;  5FAQ A;  3A3D A;  3N7W A;  3PHY A;  5HL1 A;  1RP5 A;  2ZC7 A;  5GHZ A;  2C5W B;  3IS2 A;  3RTY A;  4RX2 A;  1BUL A;  4FD8 A;  3QP2 A;  2R9X A;  1NWZ A;  5FQJ A;  2P04 A;  5I94 A;  2V0U A;  5GHY A;  3W2Z A;  2Y79 A;  3VP1 A;  2VA0 A;  4KQO A;  3OZH A;  4H6J A;  5CTM A;  2W3H A;  5CEC A;  1ZHH B;  3E2K A;  4E3O A;  4GJ4 A;  5EOE A;  5FDS A;  2EX2 A;  3F1N B;  5EM1 A;  5F83 A;  4IBX A;  4S2P A;  4KUO A;  4M4X A;  1OJG A;  5M18 A;  4KG6 A;  4Y0U A;  4NK3 A;  1ONH A;  4MCW A;  5D3O A;  4FH2 A;  3N6I A;  2W1T B;  3GEC A;  5J3W A;  3VOZ A;  3LR4 A;  3LO7 A;  1A0K A;  5GHX A;  5EFW A;  1NXY A;  1W79 A;  4GHI B;  5GLA A;  1UWN X;  2J9P A;  2DCF A;  3H7W B;  5DTS A;  4Y3I A;  2A24 A;  1NZO A;  5TFQ A;  3T4O A;  1IOU A;  2Z2M B;  2YKH A;  3Q1F A;  3WS1 A;  4DE2 A;  4PM8 A;  2B5R A;  2OAP 1;  2ZJ9 A;  4LCM A;  3OOV A;  3MF0 A;  3MMH A;  2I9V A;  2XQZ A;  2O9B A;  3LIF A;  3C38 A;  1LL9 A;  3MZF A;  5CED A;  3OBF A;  2XFT A;  4UA7 A;  1TEM A;  5M1A A;  4Y15 A;  3OC2 A;  4Y5F A;  2PT7 A;  4QHC A;  3G35 A;  1KVL A;  3C30 A;  1DP8 A;  1BUE A;  2P7J A;  3K3C A;  5FI7 A;  2B95 A;  3JPU A;  2RCX A;  1OT6 A;  4DF6 A;  3T4J A;  3LR3 A;  4YFM A;  2V1B A;  3HLD A;  4HI4 A;  1DP6 A;  2OLV A;  4GS9 B;  1LSW A;  4HJ6 A;  4ARZ A;  1MC0 A;  4Y7P A;  4NXE A;  4S2M A;  4II7 A;  4JF4 A;  3HUN A;  1XX2 A;  4L9F A;  2WGI A;  3UE1 A;  4P6B A;  2PYP A;  4O7D A;  4A5R A;  4N9L A;  3W4P A;  3BY9 A;  1XXM A;  4E3K A;  3T1S A;  3OPL A;  1TVF A;  1NZU A;  1MZU A;  1KGF A;  3SH8 A;  4OOM A;  2L0W A;  1FSY A;  3UB6 A;  1ERM A;  2VV8 A;  4NET A;  1XA1 A;  4K0X A;  1TS0 A;  3QNC A;  3CUE C;  3B47 A;  4DXB A;  5AQ9 A;  3DWZ A;  1ES4 A;  1K6R A;  1NYM A;  3SS5 A;  2V2F F;  3BEC A;  1WE4 A;  4KZ4 A;  4F3L B;  3E2L A;  3A3F A;  4EWF A;  2A24 B;  5HW3 A;  1ZG6 A;  4FUW A;  4NXF A;  3HJK A;  2HDS A;  5FAT A;  2FZ0 A;  2Y4A A;  1VHM A;  2RL3 A;  2VZW A;  3NDG A;  1ERO A;  4BMW A;  2EXB A;  1I5Q A;  1YM1 A;  3OCL A;  1K6S A;  2JKG A;  3O88 A;  3BFG A;  1F5M A;  3C4P A;  3LCE A;  4DE1 A;  5CGX A;  2OSU A;  3Q7Z A;  3LR5 A;  4CLC B;  2Q9N A;  2D02 A;  1YLY A;  4QD4 A;  1EW0 A;  4Q0H A;  3UB9 A;  1QMF A;  1P9R A;  3VE3 A;  3UO9 A;  4MBH A;  3HLB A;  2IWB A;  1T1B A;  5IT5 A;  4KQQ A;  1DJA A;  5FEF A;  2GJ3 A;  4IUK A;  3T4S A;  3KYZ A;  3OPP A;  1KVM A;  1FIK A;  4OLD A;  3GTC A;  4Q0I A;  4P6Z M;  5EVE A;  1BSG A;  1J3W A;  3NIA A;  3FKV A;  3UN7 A;  1ZC2 A;  2OWJ A;  3T12 B;  2JHE A;  3IF6 C;  3K3D A;  4RQ9 A;  3MQQ A;  3BJN A;  4KG5 A;  4XT2 A;  2HP9 A;  4HP9 A;  3MXS A;  2WGW B;  3WS5 A;  2L1M A;  3Q7V A;  5EPH A;  1K4F A;  2PRF A;  4EER A;  1STZ A;  2XA7 M;  2OOL A;  4PHT A;  4KZ6 A;  5L07 A;  3TJZ C;  5GLD A;  3PBR A;  3CI6 A;  1IFQ A;  4NEE D;  3AGD A;  4C3Q A;  1IEM A;  2V8F A;  5IS1 A;  1O7E A;  4JF5 A;  4FCF A;  4OVD A;  5FAP A;  3MJQ A;  2UWX A;  2Y2Q A;  3LIA A;  4KZ8 A;  4LV0 A;  2Y2J A;  3HRE A;  4JGQ A;  3C7V A;  3D4F A;  3HLW A;  2QWS A;  3MKE A;  4Z9Q A;  4EEU A;  1CI9 A;  1P97 A;  3MXQ A;  4R38 A;  1LT0 A;  2QJ5 A;  3H7W A;  3RFB A;  2ZMV A;  4X6T A;  5DFX A;  1FIL A;  3IXG A;  4CJN A;  2WK0 A;  3LI8 A;  4BL2 A;  3HJI A;  1K54 A;  4Y17 A;  3S7N A;  1FOF A;  4S2N A;  5CHM A;  3TE8 A;  2EFU A;  3NHQ A;  4Q8I A;  1P0Z A;  1TS7 A;  2XRO A;  3SOI A;  5GLB A;  2JBF A;  3UME A;  1VEU A;  4QU3 A;  4S2O A;  1Y54 A;  1WYC A;  4PM7 A;  3VE4 A;  5CHU A;  2ZQD A;  4WYY A;  1HD8 A;  3C5A A;  5HSQ A;  1BZA A;  1DY6 A;  2Y2M A;  2Z2L B;  1CF0 A;  2FFY A;  1LI9 A;  2LB9 A;  2P9V B;  5EE8 A;  1CQA A;  4KEN B;  4KZ9 A;  5EVI A;  1W8Q A;  4GKU A;  1G28 A;  2J7V A;  3IX3 A;  1YKD A;  4GN2 A;  5EVI B;  2QJ7 A;  1G6A A;  2HZ5 A;  4EW7 A;  2JKF A;  1MWR A;  4FTX A;  3UDF A;  4WEK A;  4I39 A;  1S6R A;  3PBO A;  4MDZ A;  2J80 A;  2O0Y A;  4E3M A;  4B4Z A;  1YPR A;  4BJP A;  4L0L A;  3TRC A;  4N9K A;  3CWF A;  5AQB A;  1S67 L;  1LSX A;  2Y2G A;  5F82 A;  2JKR M;  5CXW A;  3BEB A;  5AVF A;  2R9W A;  2J9O A;  1PWG A;  3WWX A;  4PPR A;  2P74 A;  3QP8 A;  5DF7 A;  5HD3 A;  3DW0 A;  4DN0 A;  1GHM A;  2WUQ A;  4Y2F A;  3ZG9 B;  3KO6 A;  4JXS A;  1DRM A;  4WUJ A;  5HWT A;  4FH4 A;  1YMX A;  4B4X A;  3ZGA B;  4H8R A;  2XGN A;  1ESI A;  1Z09 A;  2PBD P;  2Y2L A;  2WZX A;  5E2H A;  1MXO A;  5TBM B;  1FCO A;  5EVL A;  3FPW A;  2OWH A;  3S7P A;  3R4K A;  4H6J B;  1FCN A;  2QPN A;  1T1C A;  3T1R A;  5HZH A;  1VET B;  4N1H A;  3MXR A;  3HLG A;  2HP5 A;  1GSX A;  2VGL M;  4D60 A;  3BFD A;  3MFD A;  3UB8 A;  4GOG A;  1JTG A;  1WA9 A;  4BBT A;  1YLZ A;  2VV6 A;  4QY5 A;  2JCH A;  4PKY G;  4ESP A;  2Y59 A;  3V67 A;  4F3L A;  3VOL A;  1ZKJ A;  1TF1 A;  4RVA A;  4LFU A;  3KYE A;  2W1T A;  1BT5 A;  2PD7 A;  1VEU B;  4R4R A;  1PFL A;  4QB8 A;  5HWW A;  3E4Q A;  1H8Y A;  3ZG5 A;  1ES2 A;  1PI4 A;  2IWD A;  5GLC A;  4D2O A;  3M2K A;  5DF9 A;  5TBM A;  1XGJ A;  1PI5 A;  1H5X A;  3VMA A;  4OH0 A;  4R70 A;  2Q0O A;  4CLC E;  1NRJ A;  3IT9 A;  3P09 A;  5FQ9 A;  1KDS A;  4K91 A;  2PAV P;  2G2U A;  3JYI A;  3ZNY A;  3LY3 A;  1W63 Q;  1PWD A;  4RX3 A;  3M6B A;  4HNB A;  1T18 A;  1NYY A;  5AJG A;  4WMC A;  3C7U A;  4DDS A;  4WN5 A;  4ZDX A;  3AGE A;  1GA9 A;  3ZVT A;  3MZE A;  1G5U A;  1BYW A;  1GSV A;  4I38 A;  3P7N A;  5MC7 A;  3BYD A;  1MY8 A;  1M40 A;  5J8X A;  4PM6 A;  3FZC A;  2B02 A;  5AQ7 A;  4DE3 A;  3GVB A;  5LBR A;  3G34 A;  4PAU A;  3PYP A;  3KYQ A;  3NJA A;  2H10 A;  2AVX A;  1N9L A;  2FH5 A;  4GDN A;  3V5M A;  1SKO B;  1HLU P;  5DJT A;  1MWU A;  4R6L A;  1I2S A;  3I7J A;  2EWV A;  3UY6 A;  2XSS A;  3IF6 B;  4XUX A;  1XJ4 A;  3OPH A;  4HQA A;  1E3U A;  1IKG A;  1JVJ A;  1JTD A;  2P08 A;  2WKQ A;  3IHA A;  1VET A;  3GQZ A;  2EX9 A;  1PZO A;  1KOU A;  2Y8H A;  1BLP A;  2PD8 A;  1FSW A;  2WAF A;  1F9I A;  4R4S A;  5L8M A;  1NLZ A;  1PZP A;  1YLJ A;  5AQA A;  2ACG A;  1D7E A;  5K5B A;  4OLG A;  5F1G A;  5HAP A;  3S7Q A;  1V9Z A;  3G6O A;  2D01 A;  1ZG4 A;  4N1X A;  1TD5 A;  3LI9 A;  2O9A A;  2QKP A;  1MPL A;  3MZD A;  3MQO A;  2EWW A;  4EUZ A;  2XR0 A;  3CAX A;  4UEY A;  1H8M A;  1JWV A;  2XF3 A;  3NOU C;  1LSV A;  3BLS A;  3DTI A;  1SKO A;  4I3A A;  4KQR A;  5EVI C;  1L3L A;  1YLW A;  1OPX A;  4JGP A;  5A92 A;  4BBV A;  3LR0 A;  4Y0T A;  4ZTK A;  2WYX A;  4HH3 A;  1FR1 A;  5EV0 A;  1K4E A;  3LEZ A;  4MLL A;  4E3J A;  2Y2P A;  1H0M A;  4LV1 A;  1DJC A;  4HOI A;  4EES A;  3H82 B;  1YSP A;  1K55 A;  1ES5 A;  5I5L A;  4EEP A;  4R23 A;  3SS3 A;  3IXH A;  3EWK A;  5E2G A;  2W3E A;  3EEH A;  4G3V A;  3UB7 A;  4GD6 A;  4BEN A;  3MR0 A;  3KSI A;  4JF6 A;  2A49 A;  4JBF A;  3H82 A;  4BD0 A;  1PWC A;  1TS6 A;  3FG8 A;  5EVI D;  4ETZ A;  2E8J A;  3UDI A;  3CMZ A;  2VGK A;  3MFX A;  1W5D A;  2WKP A;  4WLA A;  3BWL A;  4DJ3 A;  4JGR A;  3WS0 A;  4HJ3 A;  4WZ4 A;  5IHV A;  2EX8 A;  2VLG A;  4LV2 A;  3D72 A;  5HD5 A;  4GHI A;  4S2N C;  3FYZ A;  4ZJ3 A;  1YAX A;  2Y91 A;  5G18 A;  1L0D A;  4MEZ A;  4I3I A;  1Z6F A;  4AFI A;  1FQG A;  4NG2 A;  2J3T C;  2QHK A;  2PDR A;  5CRF A;  1YLP A;  1F2K A;  1K57 A;  3QP5 A;  2X01 A;  4EV4 A;  5C5K A;  4EU0 A;  3WS2 A;  3UE3 A;  4ZJ2 A;  3QHY A;  4X53 A;  4UAA A;  1XJ3 A;  4PKY A;  3SW1 A;  5F69 A;  4S2K A;  2H0Y A;  3F1P B;  4Q0J A;  1ALQ A;  1HVB A;  2GX5 A;  1OTA A;  3DBA A;  1F98 A;  5HDD A;  3RJU A;  3G2Z A;  3Q07 A;  2O9C A;  2V1A A;  1SDN A;  1IYS A;  4G3K A;  3PR6 A;  2HF6 A;  3UPO A;  4ZRR A;  2FFF B;  1IYP A;  4IVI A;  2WAD A;  3MQ0 A;  3F1O A;  5A8B A;  5DFY A;  4X1L A;  2XA7 S; 
#chains in the Genus database with same CATH homology
 4I3J A;  2V0U A;  3W2Z A;  3A0R A;  2M7U A;  4WEK A;  4I39 A;  2Y79 A;  4FOF A;  3PBO A;  4MDZ A;  2J80 A;  2G7U A;  4L9E A;  2VA0 A;  4KQO A;  2O0Y A;  3EGX C;  4H6J A;  2W3H A;  4O8G A;  4BJP A;  1ZHH B;  4GJ4 A;  4L0L A;  3TRC A;  3CWF A;  1YSQ A;  3F1N B;  1S67 L;  1H3Q A;  4OOL A;  5IU1 A;  1LSX A;  5DKL A;  4KUO A;  2JKR M;  4M4X A;  3IBR A;  1OJG A;  3R7W A;  5AVF A;  4CLC A;  2O99 A;  3CLO A;  5HDS A;  3EQV A;  4KQD A;  5HD3 A;  4DN0 A;  4O01 A;  4MCW A;  1N9O A;  4Y2F A;  4EQ1 A;  2W1T B;  3KO6 A;  3GEC A;  1DRM A;  4WUJ A;  5HWT A;  5J3W A;  3T4Q A;  2ZOI A;  1LL8 A;  4CLC D;  3LR4 A;  3OLO A;  2V0W A;  4EET B;  3E98 A;  3GDI A;  5F6A A;  3A0V A;  3LIB A;  4ARZ B;  4GCZ A;  5EFW A;  1MKM A;  2W0N A;  1D06 A;  4GHI B;  5TBM B;  1UWN X;  3H7W B;  3FPW A;  2A24 A;  4Y3I A;  2KX6 A;  2OWH A;  3T4O A;  1IOU A;  4YNR A;  2J3T D;  2MJ6 A;  4BWI A;  3S7P A;  3R4K A;  4H6J B;  2YKH A;  3IBJ A;  3JVU A;  3LUQ A;  1T1C A;  2OAP 1;  4XT2 B;  5HZH A;  4K08 A;  2Z6D A;  3OOV A;  3MF0 A;  3MMH A;  2A2L A;  2I9V A;  2O9B A;  3LIF A;  1GSX A;  2VGL M;  3E4P A;  3ZQ5 A;  3C38 A;  2ZOH A;  3UB8 A;  5HWV A;  3UMD A;  4LLO B;  1WA9 A;  4BBT A;  2L4R A;  2VV6 A;  3OBF A;  1S66 L;  2PHY A;  3LYX A;  4PKY G;  1UGU A;  3V67 A;  3OC2 A;  4Y5F A;  4F3L A;  3VOL A;  2PT7 A;  3C30 A;  1DP8 A;  1TF1 A;  2P7J A;  2W1T A;  2VV7 A;  2PD7 A;  3K3C A;  4IJG A;  4G3W A;  3T4K A;  4DMZ A;  5HWW A;  3E4Q A;  1OT6 A;  3T4J A;  2INW A;  2KDK A;  3LR3 A;  4QPR A;  5HDC A;  2V1B A;  5DF9 A;  5TBM A;  2ZMF A;  1G6O A;  4NXG A;  4WEL A;  4HI4 A;  1DP6 A;  4R70 A;  4HJ4 A;  4GS9 B;  1LSW A;  4HJ6 A;  4CLC E;  4ARZ A;  1MC0 A;  1NRJ A;  1XFQ A;  4NXE A;  4HH2 A;  4II7 A;  1T1A A;  2QYB A;  4GS9 A;  4L9F A;  1W63 Q;  5KIZ A;  3EOI A;  4FSF A;  2PYP A;  4B93 A;  4CQH A;  4ME4 A;  3EEA A;  1OT9 A;  4HNB A;  3F1O B;  1T18 A;  3BY9 A;  2W3D A;  3KSH A;  4EXO A;  2KOI A;  5AJG A;  2R78 A;  4WN5 A;  1MZU A;  2GZA A;  4OOM A;  2L0W A;  3UB6 A;  1XJ2 A;  4MN6 A;  4JGO A;  2VV8 A;  1GSV A;  1BYW A;  4I38 A;  2JKT I;  4WEJ A;  4YOF A;  2HGV A;  3P7N A;  5MC7 A;  3LIE A;  5G4Z A;  2Z6C A;  2ZBB A;  2KLI A;  3R7W B;  4BBU A;  1TS0 A;  2H28 A;  2B02 A;  3P01 A;  3S7O A;  3CUE C;  3B47 A;  4HP4 A;  5LBR A;  3O5Y A;  3B42 A;  4PAU A;  3PYP A;  3RH8 B;  3KYQ A;  1N9N A;  5HL6 A;  1Y28 A;  3NJA A;  4F3L B;  1OTI A;  5HPI A;  1N9L A;  2W27 A;  2A24 B;  1XFN A;  2FH5 A;  2XRN A;  3JVV A;  4NXF A;  3HJK A;  3LFV A;  4ETX A;  5DJT A;  3BQ8 A;  4B9O A;  1V9Y A;  3FC7 A;  4R6L A;  5KSH A;  2FZ0 A;  3H9W A;  2EWV A;  2XSS A;  1VHM A;  1XJ4 A;  5J4E A;  2VZW A;  3LIC A;  4BMW A;  4HQA A;  3VV4 A;  2WKQ A;  2P08 A;  3OCL A;  1S1Y A;  2HJ9 C;  4KUK A;  3EGD C;  4DJ2 A;  1F5M A;  3E4O A;  1KOU A;  1W63 M;  2Y8H A;  3B33 A;  1P9W A;  4YWZ A;  1ODV A;  2PD8 A;  2K31 A;  2YKF A;  1S4R A;  3LR5 A;  1F9I A;  3T50 A;  4CLC B;  1S1Z A;  5L8M A;  1NLZ A;  2D02 A;  4I5S A;  4MN7 A;  4UQI M;  1D7E A;  1EW0 A;  3UE6 A;  4Q0H A;  3UB9 A;  5K5B A;  1P9R A;  3VE3 A;  4GLQ A;  1T1B A;  4LRZ E;  5IT5 A;  3S7Q A;  3CUE A;  5TJJ A;  1V9Z A;  3G6O A;  2D01 A;  1TD5 A;  2GJ3 A;  3LI9 A;  4IUK A;  3T4S A;  3KYZ A;  2O9A A;  2QKP A;  3PXP A;  5G4Y A;  3A0S A;  4Q0I A;  2VJW A;  4P6Z M;  3MQO A;  2GNX A;  2EWW A;  3CAX A;  4UEY A;  4P6Z S;  1H8M A;  3ZYT A;  3NOU C;  4HIA A;  3FPV A;  4WL9 A;  3T4T A;  1LSV A;  3BW6 A;  2VX8 A;  2JKR I;  4I3A A;  3PBQ A;  1VB6 A;  3BQA A;  5DKK A;  2OWJ A;  2JHE A;  4LRX C;  3U2A A;  2NUT C;  3E0Y A;  3K3D A;  4RQ9 A;  1X0O A;  3MQQ A;  4R3A A;  2NUP C;  3BJN A;  2VKS A;  2HJE A;  4HY8 A;  1OPX A;  4XT2 A;  3TW8 A;  3D3O A;  4HP9 A;  4JGP A;  4BBV A;  3LR0 A;  2L1M A;  5J7E A;  5HPF A;  4CLC C;  3C8C A;  4EER A;  3PBT A;  1STZ A;  2K7S A;  2PR5 A;  4HH3 A;  2XA7 M;  3F1P A;  2OOL A;  2M7V A;  4PHT A;  3EQU A;  3TJZ C;  1OTB A;  2JN7 A;  3OCN A;  3PBR A;  3CI6 A;  1IFQ A;  4NEE D;  4HOI A;  2IA2 A;  4EES A;  2DMW A;  3H82 B;  1YSP A;  2K2N A;  5DJU A;  5I5L A;  2M1C A;  2CMN A;  4EEP A;  5F5Y A;  4WF0 A;  5FL3 A;  1XJ6 A;  3EWK A;  3KSF A;  2W3E A;  3EEH A;  5IS1 A;  4LPZ A;  4G3V A;  3UB7 A;  1OTD A;  3MJQ A;  3K2N A;  3NOP C;  1ZTU A;  3NOT C;  3LIA A;  4MMN A;  3MR0 A;  2BAS A;  3LID A;  4JGQ A;  3PBN A;  3PBS A;  3KSI A;  4HHD A;  1UWP X;  4E04 A;  2WKR A;  3H82 A;  2QWS A;  1S4S A;  2OAQ 1;  4EEU A;  3FG8 A;  1TS6 A;  3ULF A;  4ETZ A;  2W1R A;  1P97 A;  3MXQ A;  4R38 A;  2VEA A;  1LT0 A;  3MFX A;  1DP9 A;  2QJ5 A;  3F1N A;  1GSW A;  3IS2 B;  2WKP A;  2HV1 A;  4NKP A;  4WLA A;  3BWL A;  4DJ3 A;  2JKT M;  2W3F A;  4JGR A;  3H7W A;  3RFB A;  1T19 A;  2ZMV A;  5DFX A;  4HJ3 A;  2J3W A;  4UQI S;  1OTE A;  3LI8 A;  3KSG A;  3T4L A;  3HJI A;  4L9G A;  2B18 A;  3C2W A;  4Z1W A;  2VLG A;  3S7N A;  3D72 A;  5HD5 A;  3KX0 X;  4GHI A;  3TE8 A;  4EUV A;  1YAX A;  2PR6 A;  1OJ5 A;  3NHQ A;  4I3I A;  4O0P A;  4AFI A;  1P0Z A;  1TS7 A;  2V9A A;  2EA9 A;  3CIT A;  4IHQ A;  2PYR A;  2J3T C;  2QHK A;  2PDR A;  2XRO A;  1TS8 A;  3UME A;  1JNU A;  4IUH A;  5AVE A;  2VGL S;  3HCY A;  5C5K A;  4EU0 A;  1NLY A;  2W3G A;  3UE3 A;  3PHY A;  3VE4 A;  1XJ3 A;  4PKY A;  3SW1 A;  2LB5 A;  4NXB A;  5F69 A;  5HSQ A;  3F1P B;  4Q0J A;  3IS2 A;  3RTY A;  2GX5 A;  1OTA A;  3DBA A;  2LB9 A;  1F98 A;  5HDD A;  2O9C A;  2V1A A;  4LRY C;  1NWZ A;  4G3K A;  3PR6 A;  2HF6 A;  1G28 A;  4GW9 A;  4ZRR A;  1YKD A;  2P04 A;  3BY8 A;  5CX7 A;  2QJ7 A;  3MQ0 A;  3F1O A;  5F68 A;  4EW7 A;  5A8B A;  5DFY A;  3ICY A;  4MN5 A;  2XA7 S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...