3FG8A

Crystal structure of pas domain of rha05790
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
GRENLYFQGGLGFMALDEDLRIIYVNSGCLRHVRRSRDELLGRVVTEVLPETQGSYFDALCRKVLATGREQQTRVDSLYSPGMTIEVTAAADSGALVVHFRDVTAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords uncharacterized protein RHA05790
publication title Crystal structure of PAS domain of RHA05790
rcsb
source organism Rhodococcus sp. rha1
molecule tags Structural genomics, unknown function
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3fg8A00
5TBMB 4R6LA 4JGPA 2PDRA 2KX6A 2V0WA 5J4EA 4WLAA 3UB9A 3F1OB 4JGOA 2PR6A 3F1PA 2W0NA 3NOPC 3UE6A 3EEHA 2KDKA 2OWJA 4WUJA 1GSWA 1OTDA 2PD8A 3LIFA 3KX0X 2PR5A 5F69A 2QKPA 2QWSA 5F68A 2VV6A 4LRZE 4KUKA 3UB8A 2ZOHA 4LLOB 4M4XA 3H82B 5J7EA 2V1BA 1BYWA 1UGUA 1S66L 4JGQA 2ZBBA 1T1CA 3HJKA 1S4SA 2H28A 4B9OA 2PD7A 4KQDA 3MQOA 3MXQA 4R3AA 4EESA 1OTAA 5HWWA 4LPZA 1TS7A 1UWPX 3LIDA 3F1OA 4HY8A 3H7WB 3CAXA 3E4OA 4HH2A 1LSVA 4K08A 2W27A 1LT0A 2WKPA 1NWZA 1UWNX 1G28A 4LRXC 2QJ7A 3F1NA 5J3WA 1JNUA 2YKHA 5HDSA 3P7NA 3ZQ5A 4WF0A 2WKRA 2VV8A 4NXGA 3H82A 1P0ZA 2PHYA 4R38A 4I5SA 4EEPA 3SW1A 1TS6A 4HP9A 2YKFA 3BY9A 3A0VA 5HD3A 3C8CA 3G6OA 5HZHA 3NHQA 4XT2B 2JHEA 3NOTC 1GSXA 3H7WA 1DP8A 1XJ2A 4HJ6A 4DJ3A 1OJGA 4HH3A 3LIBA 4WN5A 4EXOA 2A24B 1OT9A 5HSQA 4HNBA 1EW0A 3CWFA 1XJ3A 3GDIA 1S1ZA 4PKYG 1OTEA 2J80A 1N9NA 5EFWA 3K3DA 5IU1A 1S67L 2GJ3A 4GCZA 3LIEA 1V9ZA 1P97A 2QHKA 2HV1A 3MQQA 1LL8A 1XJ4A 3K3CA 5HWTA 1OJ5A 2L4RA 1V9YA 4GS9A 4HIAA 2V0UA 3UB7A 4YWZA 2I9VA 5TBMA 3UMEA 2V1AA 1S1YA 4NXBA 5DKLA 5HDDA 4I3IA 3RTYA 1VB6A 3A0RA 1LSXA 3BWLA 5HWVA 2INWA 1N9OA 4HHDA 3MFXA 3LYXA 1OTBA 1WA9A 3GECA 5A8BA 4F3LB 4BBUA 2L1MA 5DJTA 2R78A 3FG8A 4DJ2A 5DJUA 4LRYC 1XJ6A 3F1PB 2CMNA 3C2WA 2OWHA 4R70A 2PYRA 4I3AA 3EWKA 2B02A 4JGRA 1T19A 4HP4A 1T1BA 1F98A 4BBTA 4BBVA 2EA9A 3LICA 4I38A 4H6JB 3NOUC 4EW7A 5F5YA 3VE3A 4HJ3A 3HJIA 5DKKA 1Y28A 4PKYA 1DP6A 2D01A 3UMDA 4L9GA 4WL9A 2PYPA 1D7EA 3PHYA 3VE4A 1T1AA 4RQ9A 3NJAA 3OLOA 1GSVA 4HOIA 5KIZA 3LI9A 3IBRA 3T50A 5AVEA 4I3JA 3F1NB 1S4RA 4HQAA 4XT2A 4MN5A 4EERA 3PYPA 4HI4A 2Z6CA 3FC7A 5AVFA 1ODVA 3LIAA 3E4QA 2D02A 2A24A 4EETB 1MZUA 4H6JA 5IS1A 1DP9A 2VEAA 2VV7A 4GHIB 2ZOIA 3IS2B 5HD5A 4HJ4A 2VLGA 3LI8A 4I39A 5G4ZA 1X0OA 1KOUA 3MR0A 5HDCA 3MJQA 3E4PA 2WKQA 2BASA 1OT6A 2JN7A 4EQ1A 3VOLA 1TS0A 2V9AA 3A0SA 1T18A 1D06A 3BY8A 2QJ5A 1F9IA 1XFQA 3ICYA 2P7JA 4MN6A 3RH8B 3ULFA 2K7SA 5G4YA 4GHIA 2OOLA 3UB6A 3IS2A 1LSWA 2L0WA 5F6AA 3D72A 2Z6DA 4E04A 4L9FA 1N9LA 2M1CA 4EEUA 4NXFA 4GS9B 1TS8A 3LUQA 4L9EA 4NXEA 1XFNA 4KUOA 3H9WA 4F3LA 1OTIA 3CLOA 3B33A 1DRMA 4GW9A 5I5LA
chains in the Genus database with same CATH superfamily
4B93A 5TBMB 3FV7A 2HF6A 4JXVA 2KX6A 3MKFA 5CERA 3UB9A 1J9MA 4JGOA 3VSKA 4LGWA 3MMHA 4KZ8A 3F1PA 3ZCZA 4RYEA 3C5AA 4CLCD 3EGDC 3WS1A 5CRFA 1WYBA 5TGFA 4C6YA 2DMWA 2H10A 1IYOA 1KGGA 2QKPA 2H0YA 4WMCA 1YPRA 3G4PA 4PM8A 1ZTUA 5CHJA 2VV6A 4LRZE 3QP1A 2ZOHA 1TDGA 3DWZA 3H82B 1FCNA 4GLQA 1YAXA 3IT9A 1K57C 4X53A 1S66L 1HVBA 2K2NA 2H28A 3UE1A 3HUOA 1PWDA 3O88A 2PD7A 4UQIM 4MBFA 4OPRA 3TG9A 2JE5A 4LFUA 3GTCA 4R3AA 5FQMA 4LPZA 1TS7A 1UWPX 3LIDA 3OOVA 2EX9A 2JKFA 5LBRA 4HH2A 1LSVA 2W27A 2JKGA 4PAUA 2XFSA 3NULA 2WKPA 2NUTC 1UWNX 2QJ7A 2J8YA 1WYCA 3DTIA 2C6WB 4ZBEA 3T4JA 1W79A 2WKRA 2VV8A 1P0ZA 1PW1A 2R9WA 3BQAA 5BOHA 5M18A 1IYPA 3NC8A 1FIKA 1YMSA 2XQZA 1IKIA 3BRMA 1NJ4A 3QP8A 4HP9A 5TJJA 1XP4A 4E3MA 3BY9A 1CEGA 2VJWA 1K4FA 4CJNA 4KZBA 4K0XA 2HZ5A 3C8CA 1GCEA 3NHQA 3RFBA 5C5KA 4XT2B 3T1QB 4UA9A 3N8SA 2FFYA 5EM1A 4EUZA 2W3EA 3BQ8A 4HH3A 4A5RA 1EW0A 1MXOA 1HTZA 2IWBA 1M40A 4EBNA 3WRZA 5HAPA 2H0TA 1PZPA 2Q9MA 2BLSA 5EFWA 3QNCA 3UB5P 3K3DA 1NLYA 4EV4A 4B88A 3LIEA 2G2WA 3UE0A 2GZAA 5AQ7A 5FQIA 2ACGA 2HV1A 3E0YA 3B3XA 3KO6A 4GKUA 3K3CA 3BLMA 1W8QA 1YKDA 2VKSA 1IFQA 1W5DA 3WWXA 1V9YA 4MNRA 2WAEA 3BFEA 4JLFA 4OQHA 2M7VA 2XSSA 3S7OA 3GR2A 4YWZA 1DJCA 4N1XA 3M6HA 1GHIA 4P6BA 3FWLA 4GDBA 2J9OA 4RX3A 4B4ZA 2HJ9C 2Y2IA 4BENA 2INWA 3LYXA 1KGEA 3T4KA 2ZM2A 3UE3A 2LB9A 3QHYA 5J8XA 1W63M 2L1MA 2CC1A 2R78A 3HLEA 4MLLA 2ZC3B 4E3NA 2XA7M 3PR6A 5DJUA 1TD5A 4LRYC 2EXBA 3IX8A 1CI8A 5TR7A 3BW6A 2OLVA 2X01A 2J3TC 3S7NA 2EWWA 4Y2FA 4OPZA 3PXPA 3V5MA 3C7VA 3OPRA 4KG6A 4BBVA 4ARZB 3FYZA 3LR0A 2EA9A 1BLSA 4ZRRA 2WGIA 3HLFA 4OOYA 4UA6A 2WKHA 3IF6A 3HJIA 4HBTA 4B4XA 2WGWA 2B18A 3TOIA 5DKKA 3CHWP 5EVIC 3S1YA 1ERQA 2HDSA 2D01A 3UMDA 1LI9A 2PYPA 1MWRA 3LO7A 5G18A 4Y0UA 1XX2A 5FATA 1K55C 4E3JA 1AXBA 1SDNA 2R9XA 3VE4A 5GHZA 5CGWA 1FR6A 2W3GA 4JF6A 1TVFA 1GSVA 4DE2A 3IBJA 5KIZA 4E6WA 4R1GA 2W3HA 5GLCA 5AVEA 1PW8A 4BJPA 1YM1A 1VETA 4S2MA 2LB5A 4UQIS 3PYPA 1GA0A 2Y2LA 3N8RA 2HP9A 4LV3A 1KDWA 3IX4A 2D02A 3MS6A 1SKOA 2A24A 3BFGA 1MZUA 5E43A 2QYBA 3JVVA 1DP9A 5IS1A 3FKVA 2VEAA 2VV7A 4ZTKA 5A91A 4O8GA 3R7WB 2VLGA 5AJGA 1KOUA 2JKRM 2Y2NA 3MJQA 3E4PA 5JYOA 2WKQA 3C4OA 4ZJ3A 3ITBA 2Y79A 2KOIA 4KZ3A 2ZC7A 1K56A 4E3LA 4BL2A 4IVIA 1H3QA 3B42A 3T4SA 1GHPA 4GD8A 1BT5A 5DVAA 1K54A 3BY8A 4HBUA 2QJ5A 5HW3A 2W1TA 3GSGA 1ES2A 3W4PA 1NYMA 4R4SA 3G30A 4OP5A 3GVBA 1F2KA 1XA7A 4MN6A 3IXDA 4JF5A 1ONGA 5A90A 5CECA 3BEBA 1CEFA 4DDYA 1PZOA 2Y2JA 2OOLA 3AGDA 3IS2A 4KG2A 1PWGA 5F6AA 2GDNA 4IBXA 1STZA 1FCOA 4EEUA 3IHBA 5KMWA 5GLAA 1F5MA 1BUEA 1XFNA 4KUOA 1LI0A 1YLTA 4GW9A 3UDFA 4YFMA 4JGPA 2IWCA 3JYIA 4MN7A 5J4EA 1NRFA 3F1OB 2PR6A 2V2FF 3CG5A 3S7QA 1FILA 2W0NA 4MDZA 3OCLA 5U47A 3IH9A 2OWJA 4WUJA 4QWOA 1PI5A 2PRFA 5FAOA 2PD8A 3LIFA 3KX0X 5F69A 4BL3A 4X25A 3C30A 4DE3A 3D9YA 2EX8A 2QWSA 3P98A 2K31A 3VSLA 4M4XA 4IHQA 5AQ9A 3V3SA 4QPRA 5HX9A 4AFIA 1VQQA 1YSPA 3MZDA 1BYWA 2WGVA 3L7HA 4OVDA 1XGJA 1I2SA 5KZHA 1T1CA 2BTFP 1S4SA 1YMXA 1XXMA 3NECA 1SHVA 1ZC2A 3D3OA 4Q0JA 4DN0A 4RVAA 3SH7A 5HWWA 2V8CA 4LCLA 3ITAA 3HUMA 4KZ7A 1ALQA 4HEFA 3EGXC 5FI7A 1KDSA 1SCWA 3VFFA 2PAVP 5FAPA 2JCHA 3SS3A 3EEAA 4RX2A 4KZ9A 3F1NA 2VX8A 4YINA 5CEDA 5FI6A 1E3UD 5HDSA 2XDMA 3ZQ5A 1HLUP 5HAIA 3T1SA 4WF0A 4BMWA 3MBZA 3H82A 3N8LA 4DMZA 1FSYA 2FFFB 4P6ZM 4I5SA 5F82A 1QMEA 3OBFA 2JKTI 3PAEA 3W4QA 3R4KA 3EQVA 1KE4A 3A0VA 1ES3A 3CPTB 2VZWA 2ZQ8A 2JHEA 4WBGA 1GSXA 2WZXA 1DJBA 1DP8A 1H8ZA 1XJ2A 4DJ3A 1OJGA 3UO9A 4Q8IA 5E2FA 4OOMA 3B47A 3LIBA 1K0KA 4KQOA 3E2LA 3DTMA 1ZHHB 1KVLA 1OT9A 5HSQA 4S2KA 1MY8A 3LR4A 5DTSA 3T4OA 3HLWA 3OC2A 1Z09A 4QU3A 5EOOA 5DF8A 5IU1A 4OOLA 1PRQA 5EPHA 4Y3IA 3MQQA 1L0FA 3HREA 2P9VB 1QMFA 4QD4A 1OJ5A 2UWXA 4IUKA 2B95A 2WADA 1G68A 4HIAA 1A0KA 4N9LA 3U4LP 2H5SA 3ISGA 2I9VA 4ETXA 3G32A 1OPXA 1S1YA 4JXSA 4NXBA 2J9PA 3C4PA 5HDDA 3D4FA 1VB6A 5E2GA 1LSXA 3NY4A 3BJNA 5EVIB 5HWVA 5DTTA 1N9OA 2XK1A 4HHDA 2OLUA 2DRWA 2XH9A 3TRCA 4DDSA 3KSGA 3KYQA 3PBQA 2Y2HA 5A8BA 5AQAA 2ZMAA 3HLCA 4E6XA 2XRNA 2PBYA 3FPVA 4S2IA 1FCMA 4Q0HA 3HLDA 4MBHA 3KSFA 2DNSA 4FD8A 3F1PB 3WS0A 1JVJA 1PIOA 3ZGAB 2P74A 2B02A 4K0WA 3LCEA 1K54C 1O7EA 2Q9NA 2HDQA 2A49A 3T12B 1T1BA 1ZG6A 1F98A 5DTKA 4I38A 4H6JB 5FI2A 3MFDA 4UHUA 3A3EA 5F5YA 3LR3A 5EVEA 1HD8A 3N6IA 3SZTA 4BD0A 4P85A 3C7UA 3WS2A 3P01A 4L9GA 3ZDJA 1D7EA 4LV1A 4H8RA 1TDLA 3Q7VA 3IH8A 1LL9A 3ZYTA 4ESPA 3NJAA 4U0XA 5EM0A 3LI9A 5EVLA 1S4RA 4FSFA 1ZG4A 4CLCE 5CHMA 4MN5A 5F83A 1N4OA 3WS4A 5DF7A 4EERA 3LEZA 3ZVTA 1H8YA 4ARZA 3LIAA 1I2WA 3W4OA 4QJGA 3V50A 4RA7A 2ZOIA 1IEMA 5HD5A 4HJ4A 3LI8A 4I39A 4DXCA 3CITA 2G2UA 4BWIA 3OPPA 1JTDA 4EQ1A 1NYYA 4GZBA 2OV5A 3VOLA 1Y4OA 1YT4A 3A0SA 3E2KA 3NDGA 1T18A 4P6ZS 2Y2KA 3M2KA 3BYDA 3ICYA 4LV0A 1ES4A 3RXWA 3UDIA 5GL9A 5EE8A 1JWZA 4UAAA 2P04A 1LLBA 1MKIA 2HJEA 3RH8B 3T1XA 2ZQDA 4UA7A 4L0LA 4ZAMA 4EBPA 1RP5A 5G4YA 1IYQA 4CLCA 2HGVA 1ACFA 3ZG7B 2O9CA 3L9KA 2QMIA 4GNUA 3HVFA 4E04A 4ZJ1A 1MWUA 2M1CA 1D1JA 4Y0OA 2J3TD 1Q2PA 4BQMA 4L9EA 3ZHHA 4IJGA 1BSGA 3H9WA 4F3LA 1OTIA 4O01A 1MKMA 2I72A 1YLWA 1EROA 3Q07A 5GLDA 4FCFA 3EQUA 2V0WA 2ZC6B 4WELA 4EU0A 1YLJA 4KZ5A 5A92A 1YQSA 1WE4A 2W1RA 3FPWA 3UE6A 3MZFA 4OPQA 4YOFA 4N9KA 2ZJ9A 4JKTA 1GSWA 5JYPA 5EVID 2EWVA 5F1FA 2ZL1A 2Y4AA 4D60A 3PBTA 4DXBA 2XEPA 5J7EA 3MZEA 2V1BA 1W7FA 4BD1A 5GLBA 4GJ4A 4JGQA 2ZBBA 3ZG9B 1L3LA 3JVUA 4FH4A 4B9OA 5L10A 2HDUA 2Y8HA 1SZVA 3MXQA 4EESA 2QZ6A 1I5QA 3LGOA 5L07A 1ESIA 1S0WA 3F1OA 3HL9A 2VGLM 3H7WB 3CAXA 3E4OA 3UY6A 1ZKJA 1LT0A 3NCKA 4GDNA 2RL3A 4WMCD 3QP6A 3MQ0A 5F1GA 5CTNA 4LRXC 1G28A 5GHYA 5CEBA 3EOIA 5J3WA 2YKHA 4GD6A 3Q81A 4Y17A 2O9BA 2PHYA 1K4EA 4R38A 2BG1A 5GHXA 4BLMA 4OP8A 3UPPA 1TS6A 3BFDA 1NRJA 2J7VA 3O86A 5FA7A 4U3TA 1GHMA 3HLBA 3G6OA 4S2JA 3T1RA 4ZDXA 4Y13A 5HZHA 2HPBA 1E25A 1YLYA 2AVXA 1VETB 5HFOA 4XUZA 4FTXA 4R23A 4E3OA 2E8JA 3E98A 4DE0A 3QP2A 2Z2LB 4WN5A 2Y59A 1DJAA 4EXOA 1SKOB 2A24B 2WUQA 3VP2A 1N9BA 3CWFA 4FH2A 5KSHA 1CQAA 1PYYA 1XJ3A 4WYYA 3Q82A 3GDIA 2JBFA 4OQ0A 4FUWA 1VEUB 3OPHA 4OONA 1S1ZA 3IQAA 3NIAA 3DW0A 4X69A 4Y5FA 3CZDA 3G35A 5FL3A 1OTEA 1CI9A 4OH0A 1BTLA 2GX5A 5M1AA 5A93A 4GCZA 1V9ZA 2DCFA 4QB8A 2EXAA 2A3UA 1LL8A 1DY6A 4MEZA 1TF1A 2A2LA 2W1TB 4LV2A 4GS9A 2V0UA 5E2HA 3M6BA 4XXRA 5TBMA 3HLGA 3VP1A 5CGSA 4EWFA 5DF9A 5DKLA 1JTGA 2Y2GA 4NKPA 5FDSA 4I3IA 4E3IA 2ZLYA 3RTYA 3KSHA 1CK3A 3TSGA 2NUPC 1ERMA 3BWLA 3LFVA 2PU2A 4QHCA 3MFXA 3G2ZA 3DBAA 2ZM8A 4KQQA 4X1LA 3GECA 4OLGA 1BLCA 4GB7A 2O99A 5DJTA 3GMWA 3FG8A 2ZMVA 1JWPA 2P9VA 4R0QA 1NZOA 1K25A 5HPIA 1HZOA 4QY5A 2Y2OA 2CMNA 3C2WA 3G2YA 1K6SA 2OWHA 4R70A 1LL5A 3NBLA 4JGRA 4PPRA 5CX7A 1T19A 1Z6FA 3K2NA 1KE0A 1OMEA 3VOZA 5EVIA 3U2AA 3A3FA 3ZNTA 3LY3A 4FOFA 4WM9A 1K55A 3SS5A 4EW7A 4CLCC 3VE3A 3DTKA 4II7A 4R3BA 4N92A 4DE1A 3GV9A 1MWTA 1Y28A 1TEMA 4PKYA 1G6AA 4MBKA 4O7DA 2FZ0A 3IHAA 3KYZA 3VV4A 4C3QA 1DP6A 1PI4A 4WL9A 3ZFZA 1G5UA 3QP4A 1MPLA 5FQ9A 3PHYA 1M6KA 1K6RA 4F94A 4UEYA 3JPUA 3IF6C 5I94A 4RQ9A 3OLOA 1P9RA 1L0DA 2ZQ9A 1C3BA 3HBRA 3IBRA 1P9WA 2O9AA 3F1NB 1NLZA 2HP5A 1RGZA 4XT2A 2VA0A 3ZVWA 3PTEA 5AQBA 2WAFA 4NK3A 3MSHA 4JBFA 2Z6CA 4LENA 5AVFA 1ESUA 5DFXA 3ZG5A 4EQIA 2X71A 3IXBA 3N4IA 2V1ZA 4EETB 4H6JA 5FAQA 4GHIB 2VGLS 1RGYA 1XGIA 5G4ZA 1X0OA 4X55A 3MR0A 3SH9A 3PBOA 5HDCA 5MC7A 1BULA 2JC7A 4G3VA 3OPLA 1K38A 2BASA 1IELA 1OT6A 2B5RA 2JN7A 3VMAA 1TS0A 4K91A 3S7PA 1L2SA 4G3KA 5HARA 1D06A 2XGNA 2P7JA 1PNEA 1ES5A 1L0GA 3ULFA 2V20A 2Z2MB 2K7SA 1MC0A 5FSRA 1YSQA 4P87A 5EOEA 3T4TA 3UB6A 3LY4A 1LSWA 5HL1A 3LEQA 2L0WA 2M7UA 3PAGA 4EUVA 3T4LA 1K56D 2Z6DA 3IWQA 1IKGA 1NY0A 1KE3A 1XA1A 1CF0A 2OAP1 1IYSA 3IX3A 5IHVA 4KZ4A 3A3IA 4KZAA 2JKTM 3CMZA 3OCNA 2Y2QA 2GNXA 2W3DA 5I5LA 3S4XA 4R6LA 2VK3A 3CUEA 5FDHA 5M19A 2PDRA 4KENB 2RCXA 4WLAA 5CTMA 3ZG0A 3NDEA 1IOUA 3IWOA 3G34A 3PBRA 3BLSA 3NOPC 2Y2MA 2PT7A 1FSWA 3EEHA 2KDKA 1OTDA 3N7WA 4S2NA 2E8IA 2PR5A 2ZQAA 4DKIA 3QP5A 4OQIA 2JKRI 5F68A 4KUKA 3UB8A 4LLOB 2PBDP 4P0MA 2FH5A 4D2OA 4WEJA 1E3UA 3OZHA 4Q0IA 1UGUA 4S2OA 4R4RA 5FEGA 4HESA 3HJKA 1CJFA 1W63Q 1H8MA 3DTEA 4KQDA 5K5BA 3MQOA 4ME4A 4PMAA 3V39A 1OTAA 3SOIA 3W8KA 1W8YA 4PM5A 2KLIA 4XUXA 5FQKA 5KSCA 4HY8A 4S2LA 3UPNA 5L2FA 4K08A 3FZCA 4WEKA 1PWCA 3UNWA 5CXWA 3VP3A 3TJZC 1NWZA 4OPYA 1BZAA 2ZC4B 1JNUA 2Q0OA 3P7NA 2UV0E 4LCMA 3C38A 3G31A 4MMNA 2PU4A 2XD1A 2ZQCA 1G6OA 4NXGA 1MBLA 3MXSA 3O87A 4EEPA 4WZ5A 3SW1A 2WK0A 3R7WA 4MCWA 4KG5A 3HCYA 2YKFA 4DRTA 3Q7VB 4Z9QA 3BM6A 3UPOA 3CI6A 1VHMA 4S2PA 3W2ZA 5HD3A 3NOTC 1FR1A 3RJUA 4R3JA 3H7WA 3Q7ZA 4HJ6A 2J3WA 3TW8A 3VFHA 4Y0TA 3M2JA 2XF3A 4HNBA 4EBLA 4M3KA 2EFUA 5EV0A 1SDEA 2IA2A 4YNRA 2Y2PA 4ETZA 2ZM0A 4CPKA 1K57A 4PKYG 3GQZA 2J80A 3MXRA 1N9NA 1XKZA 1S67L 2GJ3A 5L09A 2ZQ7A 3NI9A 1VM1A 1P97A 2QHKA 4X1MA 4DF6A 5CHUA 1XJ4A 4Y15A 3AGFA 5HWTA 1E4DA 3KSIA 3ZG8B 2L4RA 3BFCA 1BLPA 3IF5A 5FQQA 2W3FA 2Y91A 1AWIA 3UB7A 5FQJA 4NEED 3MKEA 3UMEA 3GRJA 2V1AA 4X68A 5HL6A 3VP0A 4JXGA 3VOYA 1U60A 3O5YA 5HAQA 5L8MA 3ZNYA 4CLCB 3PBNA 2HDRA 1NZUA 4JF4A 1GA9A 1VEUA 2Y55A 3A0RA 2EX2A 4O0PA 3S22A 2XR0A 1ONHA 1OTBA 1WA9A 3IXHA 3DWKA 1FQGA 3DAVA 4JPMA 3IF6B 4F3LB 4BBUA 2O0YA 2WGWB 4X6TA 4ZJ2A 4DJ2A 2OAQ1 1Q2QA 4E3KA 4NETA 1EI5A 1EWZA 3UN7A 5IT5A 1XJ6A 4PHTA 2IWDA 5HPFA 4C75A 5EUAA 3V67A 2PYRA 4I3AA 3EWKA 2X02A 4Y7PA 1RCJA 2ZL1B 2WKIA 4NG2A 4HP4A 2G7UA 1YLZA 4BBTA 5CGXA 3LICA 4KZ6A 3A3JA 5EECA 3KYEA 1J3WA 4JXWA 3SS4A 3NOUC 3RXXA 1H0MA 4HJ3A 3QNBA 3CJMA 4IVKA 3WS5A 2WKEA 1S6RA 4PM6A 2P08A 5DFYA 1T1AA 5FEFA 4HOIA 3VP4A 4KQRA 3T50A 2C5WB 3IXGA 5D3OA 4Z1WA 4I3JA 3CUEC 3CPTA 4HQAA 4QY6A 1MWSA 4X56A 3HUNA 3O3VA 3IWIA 4HI4A 2ZD8A 1BLHA 3FC7A 5FASA 1ODVA 1LHYA 1SKFA 3E4QA 3FKWA 3TE8A 4ID4A 4OQGA 4S2NC 2WZZA 2VGKA 1XPBA 3IS2B 4OLDA 2OSUA 4OKPA 2XROA 2XD5A 2XLNA 3BECA 3A3DA 4IEDA 2EFXA 4GN2A 4G3WA 3MF0A 2V9AA 3V3RA 1KGFA 1YLPA 3T4QA 2XFTA 2XA7S 4PM9A 1F9IA 1XFQA 1H5XA 2WYXA 4GOGA 4N1HA 3WRTA 3P09A 1NXYA 1KVMA 1L0EA 2EX6A 1Y54A 1FOFA 2ZC5B 1JWVA 3PBSA 2VGJA 4GHIA 5TFQA 3BFFA 5E2EA 2V8FA 3LR5A 2MJ6A 3UDXA 2HP6A 4WZ4A 4IBRA 1O07A 3D72A 2QPNA 4L9FA 4PM7A 1N9LA 4U0TA 4CQHA 3SH8A 3I7JA 4NXFA 4GS9B 2ZMFA 1TS8A 3LUQA 4WZ5C 4NXEA 3Q1FA 4IUHA 1PFLA 3CLOA 3B33A 1DRMA 3AGEA
chains in the Genus database with same CATH topology
4B93A 5TBMB 4R6LA 3CUEA 2HF6A 4JGPA 2PDRA 2KX6A 4MN7A 3EQUA 2V0WA 5J4EA 4WLAA 3UB9A 4WELA 3F1OB 4JGOA 4EU0A 2PR6A 3MMHA 1IOUA 3F1PA 3PBRA 3S7QA 4MDZA 2W0NA 3FPWA 2W1RA 3NOPC 3OCLA 3UE6A 3EGDC 2PT7A 4CLCD 3EEHA 2KDKA 2OWJA 4YOFA 4WUJA 1GSWA 1OTDA 2PD8A 3LIFA 2DMWA 2EWVA 3KX0X 2PR5A 5F69A 3C30A 2QKPA 2QWSA 2JKRI 1ZTUA 2K31A 5F68A 2VV6A 4LRZE 3PBTA 4KUKA 2ZOHA 4LLOB 4IHQA 4M4XA 3UB8A 3H82B 2FH5A 4QPRA 4WEJA 4GLQA 5J7EA 2V1BA 4AFIA 1YAXA 1YSPA 4Q0IA 1BYWA 1UGUA 1S66L 4GJ4A 4JGQA 2ZBBA 1T1CA 3HJKA 1S4SA 2K2NA 3JVUA 2H28A 4B9OA 1W63Q 1H8MA 2PD7A 3D3OA 4UQIM 4KQDA 4Q0JA 5K5BA 3MQOA 4DN0A 2Y8HA 3MXQA 4ME4A 4R3AA 4EESA 1OTAA 5HWWA 4LPZA 1TS7A 1UWPX 2KLIA 3LIDA 3OOVA 3F1OA 2VGLM 4HY8A 3EGXC 3H7WB 3CAXA 3E4OA 4HH2A 5LBRA 1LSVA 4K08A 2W27A 1LT0A 4WEKA 4PAUA 3TJZC 2WKPA 3MQ0A 1NWZA 2NUTC 3EEAA 1UWNX 1G28A 4LRXC 2QJ7A 3F1NA 2VX8A 3EOIA 5J3WA 1JNUA 2YKHA 5HDSA 3P7NA 3C38A 3T4JA 3ZQ5A 4MMNA 4WF0A 2WKRA 4BMWA 2VV8A 1G6OA 4NXGA 3H82A 4DMZA 1P0ZA 2O9BA 2PHYA 3BQAA 4P6ZM 4R38A 4I5SA 3OBFA 4EEPA 2JKTI 3SW1A 1TS6A 3R7WA 3R4KA 4MCWA 4HP9A 5TJJA 3HCYA 1NRJA 2YKFA 3BY9A 3EQVA 3CI6A 1VHMA 2VJWA 3A0VA 3W2ZA 5HD3A 3C8CA 3G6OA 5HZHA 2VZWA 3NHQA 3RFBA 5C5KA 4XT2B 2JHEA 3NOTC 1GSXA 3H7WA 1DP8A 1XJ2A 4HJ6A 4DJ3A 1OJGA 2W3EA 3BQ8A 4HH3A 4OOMA 3B47A 2J3WA 3E98A 3TW8A 3LIBA 4KQOA 4WN5A 4EXOA 1ZHHB 2A24B 1OT9A 5HSQA 4HNBA 1EW0A 3CWFA 3LR4A 5KSHA 1XJ3A 3GDIA 2IA2A 4YNRA 4ETZA 1S1ZA 3T4OA 3OC2A 4PKYG 4Y5FA 5FL3A 1OTEA 2J80A 1N9NA 5EFWA 3K3DA 5IU1A 1S67L 1NLYA 4OOLA 2GX5A 2GJ3A 4GCZA 3LIEA 1V9ZA 2GZAA 4Y3IA 1P97A 2QHKA 2HV1A 3MQQA 3E0YA 1LL8A 3KO6A 1XJ4A 3K3CA 5HWTA 1YKDA 1OJ5A 2VKSA 1IFQA 1TF1A 4IUKA 2A2LA 2W1TB 3KSIA 2L4RA 1V9YA 4GS9A 4HIAA 2V0UA 2W3FA 3UB7A 2M7VA 2XSSA 3S7OA 4YWZA 2I9VA 5TBMA 4NEED 4ETXA 3UMEA 1OPXA 2V1AA 5HL6A 1S1YA 3O5YA 4NXBA 5DF9A 5DKLA 2HJ9C 5L8MA 4CLCB 4NKPA 5HDDA 3PBNA 4I3IA 3RTYA 3KSHA 1VB6A 3A0RA 2NUPC 1LSXA 3BJNA 3BWLA 4O0PA 5HWVA 3LFVA 2INWA 1N9OA 4HHDA 3MFXA 3LYXA 1OTBA 1WA9A 3T4KA 3TRCA 3UE3A 3DBAA 3KSGA 2LB9A 3GECA 3KYQA 3PBQA 5A8BA 1W63M 4BBUA 4F3LB 2O0YA 2L1MA 2O99A 2XRNA 5DJTA 2R78A 2OAQ1 2ZMVA 3FG8A 3FPVA 4DJ2A 2XA7M 3PR6A 4Q0HA 5DJUA 5HPIA 3KSFA 1TD5A 4LRYC 5IT5A 1XJ6A 3F1PB 4PHTA 2CMNA 5HPFA 3C2WA 3BW6A 2OWHA 3V67A 2J3TC 4R70A 3S7NA 2PYRA 4I3AA 3EWKA 2EWWA 4Y2FA 2B02A 4JGRA 5CX7A 1T19A 3PXPA 3K2NA 4HP4A 2G7UA 1T1BA 1F98A 4BBTA 4BBVA 4ARZB 3LR0A 2EA9A 4ZRRA 3LICA 3U2AA 4I38A 4H6JB 4FOFA 3NOUC 4EW7A 5F5YA 4CLCC 3VE3A 3LR3A 4HJ3A 4II7A 3HJIA 2B18A 5DKKA 1Y28A 4PKYA 3VV4A 2FZ0A 3KYZA 1DP6A 2D01A 3UMDA 3P01A 4L9GA 4WL9A 2P08A 2PYPA 5DFYA 1D7EA 3PHYA 4UEYA 3VE4A 1T1AA 3ZYTA 2W3GA 4RQ9A 3NJAA 3OLOA 1GSVA 1P9RA 3IBJA 4HOIA 5KIZA 3LI9A 3IBRA 1P9WA 2W3HA 3T50A 4Z1WA 5AVEA 4I3JA 3CUEC 2O9AA 3F1NB 1NLZA 1S4RA 4HQAA 4BJPA 4FSFA 4XT2A 2VA0A 4CLCE 4MN5A 2LB5A 4EERA 4UQIS 3PYPA 4HI4A 2Z6CA 3FC7A 5AVFA 1ODVA 5DFXA 4ARZA 3LIAA 3E4QA 2D02A 2A24A 4EETB 1MZUA 2QYBA 4H6JA 3JVVA 1DP9A 3TE8A 5IS1A 2VEAA 2VV7A 4GHIB 2VGLS 2ZOIA 4O8GA 3IS2B 5HD5A 4HJ4A 3R7WB 2VLGA 3LI8A 4I39A 5G4ZA 5AJGA 2XROA 1X0OA 3CITA 1KOUA 2JKRM 3MR0A 4BWIA 3PBOA 5HDCA 5MC7A 3MJQA 4G3VA 3E4PA 2WKQA 2BASA 2Y79A 1OT6A 2KOIA 2JN7A 4EQ1A 4G3WA 1TS0A 3VOLA 1H3QA 3MF0A 2V9AA 3B42A 3T4SA 3S7PA 3A0SA 4G3KA 3T4QA 1T18A 1D06A 2XA7S 3BY8A 4P6ZS 2QJ5A 1F9IA 1XFQA 2W1TA 3ICYA 2P7JA 4MN6A 2P04A 2HJEA 3RH8B 3PBSA 3ULFA 2K7SA 4L0LA 5G4YA 1MC0A 1YSQA 4GHIA 4CLCA 2HGVA 2OOLA 3T4TA 3UB6A 3IS2A 3LR5A 1LSWA 2MJ6A 2O9CA 2L0WA 2M7UA 5F6AA 4EUVA 3T4LA 3D72A 2Z6DA 4E04A 4L9FA 1N9LA 2M1CA 1STZA 4EEUA 2J3TD 4CQHA 2OAP1 4NXFA 4GS9B 2ZMFA 1TS8A 3LUQA 4L9EA 4NXEA 1F5MA 1XFNA 4KUOA 2JKTM 4IJGA 3H9WA 4F3LA 1OTIA 4IUHA 3OCNA 4O01A 1MKMA 3CLOA 3B33A 2GNXA 1DRMA 4GW9A 2W3DA 5I5LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TBM B;  4R6L A;  4JGP A;  2PDR A;  2KX6 A;  2V0W A;  5J4E A;  4WLA A;  3UB9 A;  3F1O B;  4JGO A;  2PR6 A;  3F1P A;  2W0N A;  3NOP C;  3UE6 A;  3EEH A;  2KDK A;  2OWJ A;  4WUJ A;  1GSW A;  1OTD A;  2PD8 A;  3LIF A;  3KX0 X;  2PR5 A;  5F69 A;  2QKP A;  2QWS A;  5F68 A;  2VV6 A;  4LRZ E;  4KUK A;  3UB8 A;  2ZOH A;  4LLO B;  4M4X A;  3H82 B;  5J7E A;  2V1B A;  1BYW A;  1UGU A;  1S66 L;  4JGQ A;  2ZBB A;  1T1C A;  3HJK A;  1S4S A;  2H28 A;  4B9O A;  2PD7 A;  4KQD A;  3MQO A;  3MXQ A;  4R3A A;  4EES A;  1OTA A;  5HWW A;  4LPZ A;  1TS7 A;  1UWP X;  3LID A;  3F1O A;  4HY8 A;  3H7W B;  3CAX A;  3E4O A;  4HH2 A;  1LSV A;  4K08 A;  2W27 A;  1LT0 A;  2WKP A;  1NWZ A;  1UWN X;  1G28 A;  4LRX C;  2QJ7 A;  3F1N A;  5J3W A;  1JNU A;  2YKH A;  5HDS A;  3P7N A;  3ZQ5 A;  4WF0 A;  2WKR A;  2VV8 A;  4NXG A;  3H82 A;  1P0Z A;  2PHY A;  4R38 A;  4I5S A;  4EEP A;  3SW1 A;  1TS6 A;  4HP9 A;  2YKF A;  3BY9 A;  3A0V A;  5HD3 A;  3C8C A;  3G6O A;  5HZH A;  3NHQ A;  4XT2 B;  2JHE A;  3NOT C;  1GSX A;  3H7W A;  1DP8 A;  1XJ2 A;  4HJ6 A;  4DJ3 A;  1OJG A;  4HH3 A;  3LIB A;  4WN5 A;  4EXO A;  2A24 B;  1OT9 A;  5HSQ A;  4HNB A;  1EW0 A;  3CWF A;  1XJ3 A;  3GDI A;  1S1Z A;  4PKY G;  1OTE A;  2J80 A;  1N9N A;  5EFW A;  3K3D A;  5IU1 A;  1S67 L;  2GJ3 A;  4GCZ A;  3LIE A;  1V9Z A;  1P97 A;  2QHK A;  2HV1 A;  3MQQ A;  1LL8 A;  1XJ4 A;  3K3C A;  5HWT A;  1OJ5 A;  2L4R A;  1V9Y A;  4GS9 A;  4HIA A;  2V0U A;  3UB7 A;  4YWZ A;  2I9V A;  5TBM A;  3UME A;  2V1A A;  1S1Y A;  4NXB A;  5DKL A;  5HDD A;  4I3I A;  3RTY A;  1VB6 A;  3A0R A;  1LSX A;  3BWL A;  5HWV A;  2INW A;  1N9O A;  4HHD A;  3MFX A;  3LYX A;  1OTB A;  1WA9 A;  3GEC A;  5A8B A;  4F3L B;  4BBU A;  2L1M A;  5DJT A;  2R78 A;  3FG8 A;  4DJ2 A;  5DJU A;  4LRY C;  1XJ6 A;  3F1P B;  2CMN A;  3C2W A;  2OWH A;  4R70 A;  2PYR A;  4I3A A;  3EWK A;  2B02 A;  4JGR A;  1T19 A;  4HP4 A;  1T1B A;  1F98 A;  4BBT A;  4BBV A;  2EA9 A;  3LIC A;  4I38 A;  4H6J B;  3NOU C;  4EW7 A;  5F5Y A;  3VE3 A;  4HJ3 A;  3HJI A;  5DKK A;  1Y28 A;  4PKY A;  1DP6 A;  2D01 A;  3UMD A;  4L9G A;  4WL9 A;  2PYP A;  1D7E A;  3PHY A;  3VE4 A;  1T1A A;  4RQ9 A;  3NJA A;  3OLO A;  1GSV A;  4HOI A;  5KIZ A;  3LI9 A;  3IBR A;  3T50 A;  5AVE A;  4I3J A;  3F1N B;  1S4R A;  4HQA A;  4XT2 A;  4MN5 A;  4EER A;  3PYP A;  4HI4 A;  2Z6C A;  3FC7 A;  5AVF A;  1ODV A;  3LIA A;  3E4Q A;  2D02 A;  2A24 A;  4EET B;  1MZU A;  4H6J A;  5IS1 A;  1DP9 A;  2VEA A;  2VV7 A;  4GHI B;  2ZOI A;  3IS2 B;  5HD5 A;  4HJ4 A;  2VLG A;  3LI8 A;  4I39 A;  5G4Z A;  1X0O A;  1KOU A;  3MR0 A;  5HDC A;  3MJQ A;  3E4P A;  2WKQ A;  2BAS A;  1OT6 A;  2JN7 A;  4EQ1 A;  3VOL A;  1TS0 A;  2V9A A;  3A0S A;  1T18 A;  1D06 A;  3BY8 A;  2QJ5 A;  1F9I A;  1XFQ A;  3ICY A;  2P7J A;  4MN6 A;  3RH8 B;  3ULF A;  2K7S A;  5G4Y A;  4GHI A;  2OOL A;  3UB6 A;  3IS2 A;  1LSW A;  2L0W A;  5F6A A;  3D72 A;  2Z6D A;  4E04 A;  4L9F A;  1N9L A;  2M1C A;  4EEU A;  4NXF A;  4GS9 B;  1TS8 A;  3LUQ A;  4L9E A;  4NXE A;  1XFN A;  4KUO A;  3H9W A;  4F3L A;  1OTI A;  3CLO A;  3B33 A;  1DRM A;  4GW9 A;  5I5L A; 
#chains in the Genus database with same CATH topology
 4B93 A;  5TBM B;  3FV7 A;  2HF6 A;  4JXV A;  2KX6 A;  3MKF A;  5CER A;  3UB9 A;  1J9M A;  4JGO A;  3VSK A;  4LGW A;  3MMH A;  4KZ8 A;  3F1P A;  3ZCZ A;  4RYE A;  3C5A A;  4CLC D;  3EGD C;  3WS1 A;  5CRF A;  1WYB A;  5TGF A;  4C6Y A;  2DMW A;  2H10 A;  1IYO A;  1KGG A;  2QKP A;  2H0Y A;  4WMC A;  1YPR A;  3G4P A;  4PM8 A;  1ZTU A;  5CHJ A;  2VV6 A;  4LRZ E;  3QP1 A;  2ZOH A;  1TDG A;  3DWZ A;  3H82 B;  1FCN A;  4GLQ A;  1YAX A;  3IT9 A;  1K57 C;  4X53 A;  1S66 L;  1HVB A;  2K2N A;  2H28 A;  3UE1 A;  3HUO A;  1PWD A;  3O88 A;  2PD7 A;  4UQI M;  4MBF A;  4OPR A;  3TG9 A;  2JE5 A;  4LFU A;  3GTC A;  4R3A A;  5FQM A;  4LPZ A;  1TS7 A;  1UWP X;  3LID A;  3OOV A;  2EX9 A;  2JKF A;  5LBR A;  4HH2 A;  1LSV A;  2W27 A;  2JKG A;  4PAU A;  2XFS A;  3NUL A;  2WKP A;  2NUT C;  1UWN X;  2QJ7 A;  2J8Y A;  1WYC A;  3DTI A;  2C6W B;  4ZBE A;  3T4J A;  1W79 A;  2WKR A;  2VV8 A;  1P0Z A;  1PW1 A;  2R9W A;  3BQA A;  5BOH A;  5M18 A;  1IYP A;  3NC8 A;  1FIK A;  1YMS A;  2XQZ A;  1IKI A;  3BRM A;  1NJ4 A;  3QP8 A;  4HP9 A;  5TJJ A;  1XP4 A;  4E3M A;  3BY9 A;  1CEG A;  2VJW A;  1K4F A;  4CJN A;  4KZB A;  4K0X A;  2HZ5 A;  3C8C A;  1GCE A;  3NHQ A;  3RFB A;  5C5K A;  4XT2 B;  3T1Q B;  4UA9 A;  3N8S A;  2FFY A;  5EM1 A;  4EUZ A;  2W3E A;  3BQ8 A;  4HH3 A;  4A5R A;  1EW0 A;  1MXO A;  1HTZ A;  2IWB A;  1M40 A;  4EBN A;  3WRZ A;  5HAP A;  2H0T A;  1PZP A;  2Q9M A;  2BLS A;  5EFW A;  3QNC A;  3UB5 P;  3K3D A;  1NLY A;  4EV4 A;  4B88 A;  3LIE A;  2G2W A;  3UE0 A;  2GZA A;  5AQ7 A;  5FQI A;  2ACG A;  2HV1 A;  3E0Y A;  3B3X A;  3KO6 A;  4GKU A;  3K3C A;  3BLM A;  1W8Q A;  1YKD A;  2VKS A;  1IFQ A;  1W5D A;  3WWX A;  1V9Y A;  4MNR A;  2WAE A;  3BFE A;  4JLF A;  4OQH A;  2M7V A;  2XSS A;  3S7O A;  3GR2 A;  4YWZ A;  1DJC A;  4N1X A;  3M6H A;  1GHI A;  4P6B A;  3FWL A;  4GDB A;  2J9O A;  4RX3 A;  4B4Z A;  2HJ9 C;  2Y2I A;  4BEN A;  2INW A;  3LYX A;  1KGE A;  3T4K A;  2ZM2 A;  3UE3 A;  2LB9 A;  3QHY A;  5J8X A;  1W63 M;  2L1M A;  2CC1 A;  2R78 A;  3HLE A;  4MLL A;  2ZC3 B;  4E3N A;  2XA7 M;  3PR6 A;  5DJU A;  1TD5 A;  4LRY C;  2EXB A;  3IX8 A;  1CI8 A;  5TR7 A;  3BW6 A;  2OLV A;  2X01 A;  2J3T C;  3S7N A;  2EWW A;  4Y2F A;  4OPZ A;  3PXP A;  3V5M A;  3C7V A;  3OPR A;  4KG6 A;  4BBV A;  4ARZ B;  3FYZ A;  3LR0 A;  2EA9 A;  1BLS A;  4ZRR A;  2WGI A;  3HLF A;  4OOY A;  4UA6 A;  2WKH A;  3IF6 A;  3HJI A;  4HBT A;  4B4X A;  2WGW A;  2B18 A;  3TOI A;  5DKK A;  3CHW P;  5EVI C;  3S1Y A;  1ERQ A;  2HDS A;  2D01 A;  3UMD A;  1LI9 A;  2PYP A;  1MWR A;  3LO7 A;  5G18 A;  4Y0U A;  1XX2 A;  5FAT A;  1K55 C;  4E3J A;  1AXB A;  1SDN A;  2R9X A;  3VE4 A;  5GHZ A;  5CGW A;  1FR6 A;  2W3G A;  4JF6 A;  1TVF A;  1GSV A;  4DE2 A;  3IBJ A;  5KIZ A;  4E6W A;  4R1G A;  2W3H A;  5GLC A;  5AVE A;  1PW8 A;  4BJP A;  1YM1 A;  1VET A;  4S2M A;  2LB5 A;  4UQI S;  3PYP A;  1GA0 A;  2Y2L A;  3N8R A;  2HP9 A;  4LV3 A;  1KDW A;  3IX4 A;  2D02 A;  3MS6 A;  1SKO A;  2A24 A;  3BFG A;  1MZU A;  5E43 A;  2QYB A;  3JVV A;  1DP9 A;  5IS1 A;  3FKV A;  2VEA A;  2VV7 A;  4ZTK A;  5A91 A;  4O8G A;  3R7W B;  2VLG A;  5AJG A;  1KOU A;  2JKR M;  2Y2N A;  3MJQ A;  3E4P A;  5JYO A;  2WKQ A;  3C4O A;  4ZJ3 A;  3ITB A;  2Y79 A;  2KOI A;  4KZ3 A;  2ZC7 A;  1K56 A;  4E3L A;  4BL2 A;  4IVI A;  1H3Q A;  3B42 A;  3T4S A;  1GHP A;  4GD8 A;  1BT5 A;  5DVA A;  1K54 A;  3BY8 A;  4HBU A;  2QJ5 A;  5HW3 A;  2W1T A;  3GSG A;  1ES2 A;  3W4P A;  1NYM A;  4R4S A;  3G30 A;  4OP5 A;  3GVB A;  1F2K A;  1XA7 A;  4MN6 A;  3IXD A;  4JF5 A;  1ONG A;  5A90 A;  5CEC A;  3BEB A;  1CEF A;  4DDY A;  1PZO A;  2Y2J A;  2OOL A;  3AGD A;  3IS2 A;  4KG2 A;  1PWG A;  5F6A A;  2GDN A;  4IBX A;  1STZ A;  1FCO A;  4EEU A;  3IHB A;  5KMW A;  5GLA A;  1F5M A;  1BUE A;  1XFN A;  4KUO A;  1LI0 A;  1YLT A;  4GW9 A;  3UDF A;  4YFM A;  4JGP A;  2IWC A;  3JYI A;  4MN7 A;  5J4E A;  1NRF A;  3F1O B;  2PR6 A;  2V2F F;  3CG5 A;  3S7Q A;  1FIL A;  2W0N A;  4MDZ A;  3OCL A;  5U47 A;  3IH9 A;  2OWJ A;  4WUJ A;  4QWO A;  1PI5 A;  2PRF A;  5FAO A;  2PD8 A;  3LIF A;  3KX0 X;  5F69 A;  4BL3 A;  4X25 A;  3C30 A;  4DE3 A;  3D9Y A;  2EX8 A;  2QWS A;  3P98 A;  2K31 A;  3VSL A;  4M4X A;  4IHQ A;  5AQ9 A;  3V3S A;  4QPR A;  5HX9 A;  4AFI A;  1VQQ A;  1YSP A;  3MZD A;  1BYW A;  2WGV A;  3L7H A;  4OVD A;  1XGJ A;  1I2S A;  5KZH A;  1T1C A;  2BTF P;  1S4S A;  1YMX A;  1XXM A;  3NEC A;  1SHV A;  1ZC2 A;  3D3O A;  4Q0J A;  4DN0 A;  4RVA A;  3SH7 A;  5HWW A;  2V8C A;  4LCL A;  3ITA A;  3HUM A;  4KZ7 A;  1ALQ A;  4HEF A;  3EGX C;  5FI7 A;  1KDS A;  1SCW A;  3VFF A;  2PAV P;  5FAP A;  2JCH A;  3SS3 A;  3EEA A;  4RX2 A;  4KZ9 A;  3F1N A;  2VX8 A;  4YIN A;  5CED A;  5FI6 A;  1E3U D;  5HDS A;  2XDM A;  3ZQ5 A;  1HLU P;  5HAI A;  3T1S A;  4WF0 A;  4BMW A;  3MBZ A;  3H82 A;  3N8L A;  4DMZ A;  1FSY A;  2FFF B;  4P6Z M;  4I5S A;  5F82 A;  1QME A;  3OBF A;  2JKT I;  3PAE A;  3W4Q A;  3R4K A;  3EQV A;  1KE4 A;  3A0V A;  1ES3 A;  3CPT B;  2VZW A;  2ZQ8 A;  2JHE A;  4WBG A;  1GSX A;  2WZX A;  1DJB A;  1DP8 A;  1H8Z A;  1XJ2 A;  4DJ3 A;  1OJG A;  3UO9 A;  4Q8I A;  5E2F A;  4OOM A;  3B47 A;  3LIB A;  1K0K A;  4KQO A;  3E2L A;  3DTM A;  1ZHH B;  1KVL A;  1OT9 A;  5HSQ A;  4S2K A;  1MY8 A;  3LR4 A;  5DTS A;  3T4O A;  3HLW A;  3OC2 A;  1Z09 A;  4QU3 A;  5EOO A;  5DF8 A;  5IU1 A;  4OOL A;  1PRQ A;  5EPH A;  4Y3I A;  3MQQ A;  1L0F A;  3HRE A;  2P9V B;  1QMF A;  4QD4 A;  1OJ5 A;  2UWX A;  4IUK A;  2B95 A;  2WAD A;  1G68 A;  4HIA A;  1A0K A;  4N9L A;  3U4L P;  2H5S A;  3ISG A;  2I9V A;  4ETX A;  3G32 A;  1OPX A;  1S1Y A;  4JXS A;  4NXB A;  2J9P A;  3C4P A;  5HDD A;  3D4F A;  1VB6 A;  5E2G A;  1LSX A;  3NY4 A;  3BJN A;  5EVI B;  5HWV A;  5DTT A;  1N9O A;  2XK1 A;  4HHD A;  2OLU A;  2DRW A;  2XH9 A;  3TRC A;  4DDS A;  3KSG A;  3KYQ A;  3PBQ A;  2Y2H A;  5A8B A;  5AQA A;  2ZMA A;  3HLC A;  4E6X A;  2XRN A;  2PBY A;  3FPV A;  4S2I A;  1FCM A;  4Q0H A;  3HLD A;  4MBH A;  3KSF A;  2DNS A;  4FD8 A;  3F1P B;  3WS0 A;  1JVJ A;  1PIO A;  3ZGA B;  2P74 A;  2B02 A;  4K0W A;  3LCE A;  1K54 C;  1O7E A;  2Q9N A;  2HDQ A;  2A49 A;  3T12 B;  1T1B A;  1ZG6 A;  1F98 A;  5DTK A;  4I38 A;  4H6J B;  5FI2 A;  3MFD A;  4UHU A;  3A3E A;  5F5Y A;  3LR3 A;  5EVE A;  1HD8 A;  3N6I A;  3SZT A;  4BD0 A;  4P85 A;  3C7U A;  3WS2 A;  3P01 A;  4L9G A;  3ZDJ A;  1D7E A;  4LV1 A;  4H8R A;  1TDL A;  3Q7V A;  3IH8 A;  1LL9 A;  3ZYT A;  4ESP A;  3NJA A;  4U0X A;  5EM0 A;  3LI9 A;  5EVL A;  1S4R A;  4FSF A;  1ZG4 A;  4CLC E;  5CHM A;  4MN5 A;  5F83 A;  1N4O A;  3WS4 A;  5DF7 A;  4EER A;  3LEZ A;  3ZVT A;  1H8Y A;  4ARZ A;  3LIA A;  1I2W A;  3W4O A;  4QJG A;  3V50 A;  4RA7 A;  2ZOI A;  1IEM A;  5HD5 A;  4HJ4 A;  3LI8 A;  4I39 A;  4DXC A;  3CIT A;  2G2U A;  4BWI A;  3OPP A;  1JTD A;  4EQ1 A;  1NYY A;  4GZB A;  2OV5 A;  3VOL A;  1Y4O A;  1YT4 A;  3A0S A;  3E2K A;  3NDG A;  1T18 A;  4P6Z S;  2Y2K A;  3M2K A;  3BYD A;  3ICY A;  4LV0 A;  1ES4 A;  3RXW A;  3UDI A;  5GL9 A;  5EE8 A;  1JWZ A;  4UAA A;  2P04 A;  1LLB A;  1MKI A;  2HJE A;  3RH8 B;  3T1X A;  2ZQD A;  4UA7 A;  4L0L A;  4ZAM A;  4EBP A;  1RP5 A;  5G4Y A;  1IYQ A;  4CLC A;  2HGV A;  1ACF A;  3ZG7 B;  2O9C A;  3L9K A;  2QMI A;  4GNU A;  3HVF A;  4E04 A;  4ZJ1 A;  1MWU A;  2M1C A;  1D1J A;  4Y0O A;  2J3T D;  1Q2P A;  4BQM A;  4L9E A;  3ZHH A;  4IJG A;  1BSG A;  3H9W A;  4F3L A;  1OTI A;  4O01 A;  1MKM A;  2I72 A;  1YLW A;  1ERO A;  3Q07 A;  5GLD A;  4FCF A;  3EQU A;  2V0W A;  2ZC6 B;  4WEL A;  4EU0 A;  1YLJ A;  4KZ5 A;  5A92 A;  1YQS A;  1WE4 A;  2W1R A;  3FPW A;  3UE6 A;  3MZF A;  4OPQ A;  4YOF A;  4N9K A;  2ZJ9 A;  4JKT A;  1GSW A;  5JYP A;  5EVI D;  2EWV A;  5F1F A;  2ZL1 A;  2Y4A A;  4D60 A;  3PBT A;  4DXB A;  2XEP A;  5J7E A;  3MZE A;  2V1B A;  1W7F A;  4BD1 A;  5GLB A;  4GJ4 A;  4JGQ A;  2ZBB A;  3ZG9 B;  1L3L A;  3JVU A;  4FH4 A;  4B9O A;  5L10 A;  2HDU A;  2Y8H A;  1SZV A;  3MXQ A;  4EES A;  2QZ6 A;  1I5Q A;  3LGO A;  5L07 A;  1ESI A;  1S0W A;  3F1O A;  3HL9 A;  2VGL M;  3H7W B;  3CAX A;  3E4O A;  3UY6 A;  1ZKJ A;  1LT0 A;  3NCK A;  4GDN A;  2RL3 A;  4WMC D;  3QP6 A;  3MQ0 A;  5F1G A;  5CTN A;  4LRX C;  1G28 A;  5GHY A;  5CEB A;  3EOI A;  5J3W A;  2YKH A;  4GD6 A;  3Q81 A;  4Y17 A;  2O9B A;  2PHY A;  1K4E A;  4R38 A;  2BG1 A;  5GHX A;  4BLM A;  4OP8 A;  3UPP A;  1TS6 A;  3BFD A;  1NRJ A;  2J7V A;  3O86 A;  5FA7 A;  4U3T A;  1GHM A;  3HLB A;  3G6O A;  4S2J A;  3T1R A;  4ZDX A;  4Y13 A;  5HZH A;  2HPB A;  1E25 A;  1YLY A;  2AVX A;  1VET B;  5HFO A;  4XUZ A;  4FTX A;  4R23 A;  4E3O A;  2E8J A;  3E98 A;  4DE0 A;  3QP2 A;  2Z2L B;  4WN5 A;  2Y59 A;  1DJA A;  4EXO A;  1SKO B;  2A24 B;  2WUQ A;  3VP2 A;  1N9B A;  3CWF A;  4FH2 A;  5KSH A;  1CQA A;  1PYY A;  1XJ3 A;  4WYY A;  3Q82 A;  3GDI A;  2JBF A;  4OQ0 A;  4FUW A;  1VEU B;  3OPH A;  4OON A;  1S1Z A;  3IQA A;  3NIA A;  3DW0 A;  4X69 A;  4Y5F A;  3CZD A;  3G35 A;  5FL3 A;  1OTE A;  1CI9 A;  4OH0 A;  1BTL A;  2GX5 A;  5M1A A;  5A93 A;  4GCZ A;  1V9Z A;  2DCF A;  4QB8 A;  2EXA A;  2A3U A;  1LL8 A;  1DY6 A;  4MEZ A;  1TF1 A;  2A2L A;  2W1T B;  4LV2 A;  4GS9 A;  2V0U A;  5E2H A;  3M6B A;  4XXR A;  5TBM A;  3HLG A;  3VP1 A;  5CGS A;  4EWF A;  5DF9 A;  5DKL A;  1JTG A;  2Y2G A;  4NKP A;  5FDS A;  4I3I A;  4E3I A;  2ZLY A;  3RTY A;  3KSH A;  1CK3 A;  3TSG A;  2NUP C;  1ERM A;  3BWL A;  3LFV A;  2PU2 A;  4QHC A;  3MFX A;  3G2Z A;  3DBA A;  2ZM8 A;  4KQQ A;  4X1L A;  3GEC A;  4OLG A;  1BLC A;  4GB7 A;  2O99 A;  5DJT A;  3GMW A;  3FG8 A;  2ZMV A;  1JWP A;  2P9V A;  4R0Q A;  1NZO A;  1K25 A;  5HPI A;  1HZO A;  4QY5 A;  2Y2O A;  2CMN A;  3C2W A;  3G2Y A;  1K6S A;  2OWH A;  4R70 A;  1LL5 A;  3NBL A;  4JGR A;  4PPR A;  5CX7 A;  1T19 A;  1Z6F A;  3K2N A;  1KE0 A;  1OME A;  3VOZ A;  5EVI A;  3U2A A;  3A3F A;  3ZNT A;  3LY3 A;  4FOF A;  4WM9 A;  1K55 A;  3SS5 A;  4EW7 A;  4CLC C;  3VE3 A;  3DTK A;  4II7 A;  4R3B A;  4N92 A;  4DE1 A;  3GV9 A;  1MWT A;  1Y28 A;  1TEM A;  4PKY A;  1G6A A;  4MBK A;  4O7D A;  2FZ0 A;  3IHA A;  3KYZ A;  3VV4 A;  4C3Q A;  1DP6 A;  1PI4 A;  4WL9 A;  3ZFZ A;  1G5U A;  3QP4 A;  1MPL A;  5FQ9 A;  3PHY A;  1M6K A;  1K6R A;  4F94 A;  4UEY A;  3JPU A;  3IF6 C;  5I94 A;  4RQ9 A;  3OLO A;  1P9R A;  1L0D A;  2ZQ9 A;  1C3B A;  3HBR A;  3IBR A;  1P9W A;  2O9A A;  3F1N B;  1NLZ A;  2HP5 A;  1RGZ A;  4XT2 A;  2VA0 A;  3ZVW A;  3PTE A;  5AQB A;  2WAF A;  4NK3 A;  3MSH A;  4JBF A;  2Z6C A;  4LEN A;  5AVF A;  1ESU A;  5DFX A;  3ZG5 A;  4EQI A;  2X71 A;  3IXB A;  3N4I A;  2V1Z A;  4EET B;  4H6J A;  5FAQ A;  4GHI B;  2VGL S;  1RGY A;  1XGI A;  5G4Z A;  1X0O A;  4X55 A;  3MR0 A;  3SH9 A;  3PBO A;  5HDC A;  5MC7 A;  1BUL A;  2JC7 A;  4G3V A;  3OPL A;  1K38 A;  2BAS A;  1IEL A;  1OT6 A;  2B5R A;  2JN7 A;  3VMA A;  1TS0 A;  4K91 A;  3S7P A;  1L2S A;  4G3K A;  5HAR A;  1D06 A;  2XGN A;  2P7J A;  1PNE A;  1ES5 A;  1L0G A;  3ULF A;  2V20 A;  2Z2M B;  2K7S A;  1MC0 A;  5FSR A;  1YSQ A;  4P87 A;  5EOE A;  3T4T A;  3UB6 A;  3LY4 A;  1LSW A;  5HL1 A;  3LEQ A;  2L0W A;  2M7U A;  3PAG A;  4EUV A;  3T4L A;  1K56 D;  2Z6D A;  3IWQ A;  1IKG A;  1NY0 A;  1KE3 A;  1XA1 A;  1CF0 A;  2OAP 1;  1IYS A;  3IX3 A;  5IHV A;  4KZ4 A;  3A3I A;  4KZA A;  2JKT M;  3CMZ A;  3OCN A;  2Y2Q A;  2GNX A;  2W3D A;  5I5L A;  3S4X A;  4R6L A;  2VK3 A;  3CUE A;  5FDH A;  5M19 A;  2PDR A;  4KEN B;  2RCX A;  4WLA A;  5CTM A;  3ZG0 A;  3NDE A;  1IOU A;  3IWO A;  3G34 A;  3PBR A;  3BLS A;  3NOP C;  2Y2M A;  2PT7 A;  1FSW A;  3EEH A;  2KDK A;  1OTD A;  3N7W A;  4S2N A;  2E8I A;  2PR5 A;  2ZQA A;  4DKI A;  3QP5 A;  4OQI A;  2JKR I;  5F68 A;  4KUK A;  3UB8 A;  4LLO B;  2PBD P;  4P0M A;  2FH5 A;  4D2O A;  4WEJ A;  1E3U A;  3OZH A;  4Q0I A;  1UGU A;  4S2O A;  4R4R A;  5FEG A;  4HES A;  3HJK A;  1CJF A;  1W63 Q;  1H8M A;  3DTE A;  4KQD A;  5K5B A;  3MQO A;  4ME4 A;  4PMA A;  3V39 A;  1OTA A;  3SOI A;  3W8K A;  1W8Y A;  4PM5 A;  2KLI A;  4XUX A;  5FQK A;  5KSC A;  4HY8 A;  4S2L A;  3UPN A;  5L2F A;  4K08 A;  3FZC A;  4WEK A;  1PWC A;  3UNW A;  5CXW A;  3VP3 A;  3TJZ C;  1NWZ A;  4OPY A;  1BZA A;  2ZC4 B;  1JNU A;  2Q0O A;  3P7N A;  2UV0 E;  4LCM A;  3C38 A;  3G31 A;  4MMN A;  2PU4 A;  2XD1 A;  2ZQC A;  1G6O A;  4NXG A;  1MBL A;  3MXS A;  3O87 A;  4EEP A;  4WZ5 A;  3SW1 A;  2WK0 A;  3R7W A;  4MCW A;  4KG5 A;  3HCY A;  2YKF A;  4DRT A;  3Q7V B;  4Z9Q A;  3BM6 A;  3UPO A;  3CI6 A;  1VHM A;  4S2P A;  3W2Z A;  5HD3 A;  3NOT C;  1FR1 A;  3RJU A;  4R3J A;  3H7W A;  3Q7Z A;  4HJ6 A;  2J3W A;  3TW8 A;  3VFH A;  4Y0T A;  3M2J A;  2XF3 A;  4HNB A;  4EBL A;  4M3K A;  2EFU A;  5EV0 A;  1SDE A;  2IA2 A;  4YNR A;  2Y2P A;  4ETZ A;  2ZM0 A;  4CPK A;  1K57 A;  4PKY G;  3GQZ A;  2J80 A;  3MXR A;  1N9N A;  1XKZ A;  1S67 L;  2GJ3 A;  5L09 A;  2ZQ7 A;  3NI9 A;  1VM1 A;  1P97 A;  2QHK A;  4X1M A;  4DF6 A;  5CHU A;  1XJ4 A;  4Y15 A;  3AGF A;  5HWT A;  1E4D A;  3KSI A;  3ZG8 B;  2L4R A;  3BFC A;  1BLP A;  3IF5 A;  5FQQ A;  2W3F A;  2Y91 A;  1AWI A;  3UB7 A;  5FQJ A;  4NEE D;  3MKE A;  3UME A;  3GRJ A;  2V1A A;  4X68 A;  5HL6 A;  3VP0 A;  4JXG A;  3VOY A;  1U60 A;  3O5Y A;  5HAQ A;  5L8M A;  3ZNY A;  4CLC B;  3PBN A;  2HDR A;  1NZU A;  4JF4 A;  1GA9 A;  1VEU A;  2Y55 A;  3A0R A;  2EX2 A;  4O0P A;  3S22 A;  2XR0 A;  1ONH A;  1OTB A;  1WA9 A;  3IXH A;  3DWK A;  1FQG A;  3DAV A;  4JPM A;  3IF6 B;  4F3L B;  4BBU A;  2O0Y A;  2WGW B;  4X6T A;  4ZJ2 A;  4DJ2 A;  2OAQ 1;  1Q2Q A;  4E3K A;  4NET A;  1EI5 A;  1EWZ A;  3UN7 A;  5IT5 A;  1XJ6 A;  4PHT A;  2IWD A;  5HPF A;  4C75 A;  5EUA A;  3V67 A;  2PYR A;  4I3A A;  3EWK A;  2X02 A;  4Y7P A;  1RCJ A;  2ZL1 B;  2WKI A;  4NG2 A;  4HP4 A;  2G7U A;  1YLZ A;  4BBT A;  5CGX A;  3LIC A;  4KZ6 A;  3A3J A;  5EEC A;  3KYE A;  1J3W A;  4JXW A;  3SS4 A;  3NOU C;  3RXX A;  1H0M A;  4HJ3 A;  3QNB A;  3CJM A;  4IVK A;  3WS5 A;  2WKE A;  1S6R A;  4PM6 A;  2P08 A;  5DFY A;  1T1A A;  5FEF A;  4HOI A;  3VP4 A;  4KQR A;  3T50 A;  2C5W B;  3IXG A;  5D3O A;  4Z1W A;  4I3J A;  3CUE C;  3CPT A;  4HQA A;  4QY6 A;  1MWS A;  4X56 A;  3HUN A;  3O3V A;  3IWI A;  4HI4 A;  2ZD8 A;  1BLH A;  3FC7 A;  5FAS A;  1ODV A;  1LHY A;  1SKF A;  3E4Q A;  3FKW A;  3TE8 A;  4ID4 A;  4OQG A;  4S2N C;  2WZZ A;  2VGK A;  1XPB A;  3IS2 B;  4OLD A;  2OSU A;  4OKP A;  2XRO A;  2XD5 A;  2XLN A;  3BEC A;  3A3D A;  4IED A;  2EFX A;  4GN2 A;  4G3W A;  3MF0 A;  2V9A A;  3V3R A;  1KGF A;  1YLP A;  3T4Q A;  2XFT A;  2XA7 S;  4PM9 A;  1F9I A;  1XFQ A;  1H5X A;  2WYX A;  4GOG A;  4N1H A;  3WRT A;  3P09 A;  1NXY A;  1KVM A;  1L0E A;  2EX6 A;  1Y54 A;  1FOF A;  2ZC5 B;  1JWV A;  3PBS A;  2VGJ A;  4GHI A;  5TFQ A;  3BFF A;  5E2E A;  2V8F A;  3LR5 A;  2MJ6 A;  3UDX A;  2HP6 A;  4WZ4 A;  4IBR A;  1O07 A;  3D72 A;  2QPN A;  4L9F A;  4PM7 A;  1N9L A;  4U0T A;  4CQH A;  3SH8 A;  3I7J A;  4NXF A;  4GS9 B;  2ZMF A;  1TS8 A;  3LUQ A;  4WZ5 C;  4NXE A;  3Q1F A;  4IUH A;  1PFL A;  3CLO A;  3B33 A;  1DRM A;  3AGE A; 
#chains in the Genus database with same CATH homology
 4B93 A;  5TBM B;  4R6L A;  3CUE A;  2HF6 A;  4JGP A;  2PDR A;  2KX6 A;  4MN7 A;  3EQU A;  2V0W A;  5J4E A;  4WLA A;  3UB9 A;  4WEL A;  3F1O B;  4JGO A;  4EU0 A;  2PR6 A;  3MMH A;  1IOU A;  3F1P A;  3PBR A;  3S7Q A;  4MDZ A;  2W0N A;  3FPW A;  2W1R A;  3NOP C;  3OCL A;  3UE6 A;  3EGD C;  2PT7 A;  4CLC D;  3EEH A;  2KDK A;  2OWJ A;  4YOF A;  4WUJ A;  1GSW A;  1OTD A;  2PD8 A;  3LIF A;  2DMW A;  2EWV A;  3KX0 X;  2PR5 A;  5F69 A;  3C30 A;  2QKP A;  2QWS A;  2JKR I;  1ZTU A;  2K31 A;  5F68 A;  2VV6 A;  4LRZ E;  3PBT A;  4KUK A;  2ZOH A;  4LLO B;  4IHQ A;  4M4X A;  3UB8 A;  3H82 B;  2FH5 A;  4QPR A;  4WEJ A;  4GLQ A;  5J7E A;  2V1B A;  4AFI A;  1YAX A;  1YSP A;  4Q0I A;  1BYW A;  1UGU A;  1S66 L;  4GJ4 A;  4JGQ A;  2ZBB A;  1T1C A;  3HJK A;  1S4S A;  2K2N A;  3JVU A;  2H28 A;  4B9O A;  1W63 Q;  1H8M A;  2PD7 A;  3D3O A;  4UQI M;  4KQD A;  4Q0J A;  5K5B A;  3MQO A;  4DN0 A;  2Y8H A;  3MXQ A;  4ME4 A;  4R3A A;  4EES A;  1OTA A;  5HWW A;  4LPZ A;  1TS7 A;  1UWP X;  2KLI A;  3LID A;  3OOV A;  3F1O A;  2VGL M;  4HY8 A;  3EGX C;  3H7W B;  3CAX A;  3E4O A;  4HH2 A;  5LBR A;  1LSV A;  4K08 A;  2W27 A;  1LT0 A;  4WEK A;  4PAU A;  3TJZ C;  2WKP A;  3MQ0 A;  1NWZ A;  2NUT C;  3EEA A;  1UWN X;  1G28 A;  4LRX C;  2QJ7 A;  3F1N A;  2VX8 A;  3EOI A;  5J3W A;  1JNU A;  2YKH A;  5HDS A;  3P7N A;  3C38 A;  3T4J A;  3ZQ5 A;  4MMN A;  4WF0 A;  2WKR A;  4BMW A;  2VV8 A;  1G6O A;  4NXG A;  3H82 A;  4DMZ A;  1P0Z A;  2O9B A;  2PHY A;  3BQA A;  4P6Z M;  4R38 A;  4I5S A;  3OBF A;  4EEP A;  2JKT I;  3SW1 A;  1TS6 A;  3R7W A;  3R4K A;  4MCW A;  4HP9 A;  5TJJ A;  3HCY A;  1NRJ A;  2YKF A;  3BY9 A;  3EQV A;  3CI6 A;  1VHM A;  2VJW A;  3A0V A;  3W2Z A;  5HD3 A;  3C8C A;  3G6O A;  5HZH A;  2VZW A;  3NHQ A;  3RFB A;  5C5K A;  4XT2 B;  2JHE A;  3NOT C;  1GSX A;  3H7W A;  1DP8 A;  1XJ2 A;  4HJ6 A;  4DJ3 A;  1OJG A;  2W3E A;  3BQ8 A;  4HH3 A;  4OOM A;  3B47 A;  2J3W A;  3E98 A;  3TW8 A;  3LIB A;  4KQO A;  4WN5 A;  4EXO A;  1ZHH B;  2A24 B;  1OT9 A;  5HSQ A;  4HNB A;  1EW0 A;  3CWF A;  3LR4 A;  5KSH A;  1XJ3 A;  3GDI A;  2IA2 A;  4YNR A;  4ETZ A;  1S1Z A;  3T4O A;  3OC2 A;  4PKY G;  4Y5F A;  5FL3 A;  1OTE A;  2J80 A;  1N9N A;  5EFW A;  3K3D A;  5IU1 A;  1S67 L;  1NLY A;  4OOL A;  2GX5 A;  2GJ3 A;  4GCZ A;  3LIE A;  1V9Z A;  2GZA A;  4Y3I A;  1P97 A;  2QHK A;  2HV1 A;  3MQQ A;  3E0Y A;  1LL8 A;  3KO6 A;  1XJ4 A;  3K3C A;  5HWT A;  1YKD A;  1OJ5 A;  2VKS A;  1IFQ A;  1TF1 A;  4IUK A;  2A2L A;  2W1T B;  3KSI A;  2L4R A;  1V9Y A;  4GS9 A;  4HIA A;  2V0U A;  2W3F A;  3UB7 A;  2M7V A;  2XSS A;  3S7O A;  4YWZ A;  2I9V A;  5TBM A;  4NEE D;  4ETX A;  3UME A;  1OPX A;  2V1A A;  5HL6 A;  1S1Y A;  3O5Y A;  4NXB A;  5DF9 A;  5DKL A;  2HJ9 C;  5L8M A;  4CLC B;  4NKP A;  5HDD A;  3PBN A;  4I3I A;  3RTY A;  3KSH A;  1VB6 A;  3A0R A;  2NUP C;  1LSX A;  3BJN A;  3BWL A;  4O0P A;  5HWV A;  3LFV A;  2INW A;  1N9O A;  4HHD A;  3MFX A;  3LYX A;  1OTB A;  1WA9 A;  3T4K A;  3TRC A;  3UE3 A;  3DBA A;  3KSG A;  2LB9 A;  3GEC A;  3KYQ A;  3PBQ A;  5A8B A;  1W63 M;  4BBU A;  4F3L B;  2O0Y A;  2L1M A;  2O99 A;  2XRN A;  5DJT A;  2R78 A;  2OAQ 1;  2ZMV A;  3FG8 A;  3FPV A;  4DJ2 A;  2XA7 M;  3PR6 A;  4Q0H A;  5DJU A;  5HPI A;  3KSF A;  1TD5 A;  4LRY C;  5IT5 A;  1XJ6 A;  3F1P B;  4PHT A;  2CMN A;  5HPF A;  3C2W A;  3BW6 A;  2OWH A;  3V67 A;  2J3T C;  4R70 A;  3S7N A;  2PYR A;  4I3A A;  3EWK A;  2EWW A;  4Y2F A;  2B02 A;  4JGR A;  5CX7 A;  1T19 A;  3PXP A;  3K2N A;  4HP4 A;  2G7U A;  1T1B A;  1F98 A;  4BBT A;  4BBV A;  4ARZ B;  3LR0 A;  2EA9 A;  4ZRR A;  3LIC A;  3U2A A;  4I38 A;  4H6J B;  4FOF A;  3NOU C;  4EW7 A;  5F5Y A;  4CLC C;  3VE3 A;  3LR3 A;  4HJ3 A;  4II7 A;  3HJI A;  2B18 A;  5DKK A;  1Y28 A;  4PKY A;  3VV4 A;  2FZ0 A;  3KYZ A;  1DP6 A;  2D01 A;  3UMD A;  3P01 A;  4L9G A;  4WL9 A;  2P08 A;  2PYP A;  5DFY A;  1D7E A;  3PHY A;  4UEY A;  3VE4 A;  1T1A A;  3ZYT A;  2W3G A;  4RQ9 A;  3NJA A;  3OLO A;  1GSV A;  1P9R A;  3IBJ A;  4HOI A;  5KIZ A;  3LI9 A;  3IBR A;  1P9W A;  2W3H A;  3T50 A;  4Z1W A;  5AVE A;  4I3J A;  3CUE C;  2O9A A;  3F1N B;  1NLZ A;  1S4R A;  4HQA A;  4BJP A;  4FSF A;  4XT2 A;  2VA0 A;  4CLC E;  4MN5 A;  2LB5 A;  4EER A;  4UQI S;  3PYP A;  4HI4 A;  2Z6C A;  3FC7 A;  5AVF A;  1ODV A;  5DFX A;  4ARZ A;  3LIA A;  3E4Q A;  2D02 A;  2A24 A;  4EET B;  1MZU A;  2QYB A;  4H6J A;  3JVV A;  1DP9 A;  3TE8 A;  5IS1 A;  2VEA A;  2VV7 A;  4GHI B;  2VGL S;  2ZOI A;  4O8G A;  3IS2 B;  5HD5 A;  4HJ4 A;  3R7W B;  2VLG A;  3LI8 A;  4I39 A;  5G4Z A;  5AJG A;  2XRO A;  1X0O A;  3CIT A;  1KOU A;  2JKR M;  3MR0 A;  4BWI A;  3PBO A;  5HDC A;  5MC7 A;  3MJQ A;  4G3V A;  3E4P A;  2WKQ A;  2BAS A;  2Y79 A;  1OT6 A;  2KOI A;  2JN7 A;  4EQ1 A;  4G3W A;  1TS0 A;  3VOL A;  1H3Q A;  3MF0 A;  2V9A A;  3B42 A;  3T4S A;  3S7P A;  3A0S A;  4G3K A;  3T4Q A;  1T18 A;  1D06 A;  2XA7 S;  3BY8 A;  4P6Z S;  2QJ5 A;  1F9I A;  1XFQ A;  2W1T A;  3ICY A;  2P7J A;  4MN6 A;  2P04 A;  2HJE A;  3RH8 B;  3PBS A;  3ULF A;  2K7S A;  4L0L A;  5G4Y A;  1MC0 A;  1YSQ A;  4GHI A;  4CLC A;  2HGV A;  2OOL A;  3T4T A;  3UB6 A;  3IS2 A;  3LR5 A;  1LSW A;  2MJ6 A;  2O9C A;  2L0W A;  2M7U A;  5F6A A;  4EUV A;  3T4L A;  3D72 A;  2Z6D A;  4E04 A;  4L9F A;  1N9L A;  2M1C A;  1STZ A;  4EEU A;  2J3T D;  4CQH A;  2OAP 1;  4NXF A;  4GS9 B;  2ZMF A;  1TS8 A;  3LUQ A;  4L9E A;  4NXE A;  1F5M A;  1XFN A;  4KUO A;  2JKT M;  4IJG A;  3H9W A;  4F3L A;  1OTI A;  4IUH A;  3OCN A;  4O01 A;  1MKM A;  3CLO A;  3B33 A;  2GNX A;  1DRM A;  4GW9 A;  2W3D A;  5I5L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...