3FGMA

Crystal structure of l44f/c83t/c117v/f132w mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEETLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILWLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fgmA00
1S0LA 1W3GA 2D7IA 3UJ0A 3CRIA 2VUAA 4ZFWB 1HWNB 3VUOA 2HW9A 1XG6A 1EV2A 2WRYA 3BAGA 4XFTA 1NUNA 3FJJA 1MC9A 3VT1A 4KEIA 4XKIA 1ISWA 2X2SA 1HIBA 2Z48A 4AN6A 2GO2A 4I4YA 3OJMA 2R9KB 2FFUA 2QYIB 4F83A 4X38A 1G9DA 4OEFA 5BOWA 2NTDA 3AH4A 4XFUA 2AAIB 4GOVA 5JLVA 2E4MC 6I1BA 2FFVA 1DFQA 4LO7B 4H9WA 3R4UA 2Y9GA 5BQUC 3OJVA 3CA6A 1BARA 2D24A 2P39A 3VT0A 1S0DA 1V6WA 2ET2A 41BIA 3FJ8A 4I1EA 4L4IA 2KI6B 1W3AA 3FUOA 3A23A 4QBCA 4JQ0A 1TWMA 2VLCA 4G9MA 3V0AB 2XOAA 4QC4A 4ZKTB 3FJ9A 1QQKA 1CE7B 4GAIA 3HBWA 4LO1C 1DQGA 1DZDA 1PWAA 2DRZA 1YXWA 3FJCA 1BLDA 1XHBA 1AVXB 3C9ZA 4I2SA 4OEEA 1FN0A 2Z49A 3AJ5A 4G6MA 1YBIA 4OWJA 3IM5A 1JT3A 3CA5A 3POKA 4I4PA 4J23B 1BLAA 4X37A 2HWMA 2Y9XE 2KH2A 3BB2A 4L4HA 4X3AA 4Q9PA 1FGAA 2KKIA 3WMVA 1DZCA 1ISXA 5E24E 4JKXB 2F8XC 5DUYA 1S0FA 3B9UA 4I3NA 3O4CA 3AH2A 1OQLB 4QD2B 5EG6C 4I8MA 4IQPA 1HWMB 3N7KA 5DVHA 1Q1UA 3AKFA 3HSMA 4G1RA 4PC4A 5JMCA 3UDAA 1XZZA 5FZZA 1YF8B 1D0HA 1FWUA 4I4QA 3NJ5A 5BQUA 3BAQA 2VSAA 3OBTA 3PUBA 3KMVA 2VXTI 3PG0A 1IOBA 3NBDA 4LO8B 4GP0A 5GAQA 1ISYA 4I1BA 3BADA 5HPZA 31BIA 1S0CA 4I4UA 5D61A 4KEJA 3FJDA 3VEQA 4OEGA 1V6VA 4DEPA 2KI4A 4ZBVB 3IAGC 4USPA 3AZVA 1WD3A 3V79C 1ABRB 2ESUA 3QYDA 1S0GA 1DQOA 3V0BA 4I0YA 3AH1A 1PUUB 2Y9FA 4DCKC 5EC5A 1DFCA 1AVWB 1HCEA 3ILAA 1AF9A 1T4QA 1V6XA 3IM6A 1ILR1 4Q91A 3RMYA 3VSZA 1JTCA 3BAVA 2ZQNA 4I4VA 3BAOA 4QBVA 4ENDA 1BFFA 3UD8A 4I4RA 3N7LA 4P0LA 2BEBA 2MC2A 3FFZA 5D62A 3CQAA 4FGFA 1RMLA 1AXMA 1RY7A 4IZEA 3O4DA 3BA7A 2ZQOA 1Z2VA 4KC3A 3AZWA 2NM1A 4DENA 4LO2A 3N0KA 4QD2C 3FGMA 3BA5A 4ZLBB 3N7MA 1BFBA 4QKSA 1QQLA 3IIRA 2HZ9A 3EF2A 3RTIB 3RSJA 21BIA 1F31A 2P23A 2RSTA 5I1BA 3T8SA 3O5WB 4D0TA 1JY0A 1ISVA 4ZFYB 1JLYA 4EFPA 4XFSA 3HMYA 3WO4A 3I2XA 3BA4A 3OJ2A 1Q04A 1G82A 4LO3A 2ERMA 4QALA 4A7ZA 4ISQA 4EEEB 1JT7A 1SZ6B 3ZC9A 4KEKA 2NYYA 4FVVA 3BRDA 4D0ZA 2AFGA 4EFQA 2J3PA 3V0AA 3W9TA 2MIBA 3FJEA 3Q7XA 3NBEA 1IILA 4KBBA 3JRRA 3HN1A 1FMZA 4GP3A 4OWLA 4Z8SB 2HWAA 5DZUA 3CU1B 3JUTA 1AFCA 1NZKA 1M16A 4JP0A 4I4XA 3BAUA 4IY9A 2DS0A 2K4AB 1IT0A 1Q03A 3WINA 4IYBA 1HCDA 1K5VA 1RZOB 4IONA 2ZR1B 3RMXA 4IHZA 4I37A 2D22A 4HA2A 5FNXA 1EYLA 4IZXA 1KNMA 3AKGA 4LO2C 2AXMA 4GAFA 2IWTB 1VCLA 3BTAA 3BX1C 4J2SA 2GZBA 1BFGA 5BVPI 3WA1A 1FV3A 5BP5C 4EFRA 3RTJB 3UD7A 3FJIA 3HOMA 1HKNA 3MALA 4ZOTA 2K43A 4WBCA 3MPPG 3NBCA 1QXMA 4LO7C 2VU9A 4G9NA 3FJBA 5F90A 3AJ6A 3OGFA 1BFCA 4JRAA 1JT5A 1FMMS 2X2TA 4A7KA 1ITBA 3IM7A 1SR4A 1AVUA 1P63A 3WMUA 3CRHA 3H6RB 4LO3C 3PHZA 1K5UA 1GGPB 3O4BA 3VSFA 4Z9WB 1W3FA 3E8LC 3OGGA 4P0JA 4G6JA 4QKRA 4H04A 1TOOA 7I1BA 1JT4A 4J2XA 3R4SA 3BRGC 1IRAX 3S8JA 1M2TB 3O4OA 3ZXDA 1YTOA 3VT2A 5B2HA 3SNVA 3BRFA 4R6UB 3FJHA 2DRYA 4D8HA 1HWOB 3LLPA 2RG9B 3WINC 2AQZA 1S0EA 1PZZA 3BAHA 3O44A 5FNWA 2F2FA 1J0SA 3HALA 1R8NA 5BXRA 3PMEA 5F8SA 4IY8A 2VXRA 1EVTA 1IHKA 4OUJA 4I7IA 1N4KA 1XYFA 3F62B 3ZX7A 3I2AA 3AKIA 1JQZA 1DIWA 2Y9WC 4ISRA 1FWVA 3S8KA 1UPSA 4J2YA 3NBNA 5FZUA 1CVSA 4J2KA 1FQ9A 4USOA 3OBRA 4HJJA 3FJFA 4JKQA 3K1XA 3AKHA 5BP5A 4ZGRB 1Z0HA 3UD9A 3A21A 2D7RA 2DREA 2M49A 4LO0A 5BXPA 1AVAC 1SR4C 2D1ZA 4Q9GA 1TTUA 1I1EA 1II4A 2D23A 2FGFA 3F1RA 1A8DA 3O49A 1WBCA 1MD6A 3CA3A 1WD4A 5DSSB 5F8YA 1WBAA 3P53A 5FZYA 1E0OA 2KLLA 4X39A 2QN4A 4P0KA 1G9BA 3O3QA 1L2HA 4OW4A 4A7YA 4CJMA 4TLPA 4GOYA 4I4OA 2BEAA 4QO3A 1S0BA 9ILBA 3CA1A 2YUGA 3FUQA 1TIEA 2VSEA 3P6JA 2F2FC 1G9CA 1JLXA 3Q7WA 2BFHA 3Q7YA 1T9FA 1TWEA 2NZ9A 3TC2A 2K8RA 4JAWA 3WO3A 3VWCA 4ZFUB 3D7WB 2D20A 1ISZA 2L5XA 3CAHA 1Z4SA 5EHAA 3UJ4A 2D43A 3ZXGA 5BXSA 4I4SA 3N7JA 1DLLA 3P6IA 1BASA 4HR6C 3FJAA 2I1BA 2NP0A 3LTQA 1HWPB 1ONKB 1V6UA 2FDBM 5BXTA 4YOLA 3I29B 1FV2A 1EPWA 2LIEA 4LO0C 4F34A 1TFMB 4EKXB 2E4MA 1RG8A 5D63A 2NVHA 2MLLB 1PC8B 3H6SE 1YYNA 4II0A 3CA0A 2Q9XA 2UUSA 3A07A 3QR5A 3V0BB 1IJTA 1PUMB 4OWKA 1R8OA 3ZC8A 1TP0A 2RQ9A 2IHOA 4JPZA 3CRGA 4AN7B 3CA4A 2WBCA 1DJSB 3H6QA 4I6IA 4P6AA 4EB2B 5F8WA 1BA7A 8I1BA 2D44A 3FJKA 4I96A 3WO2A 4LO1A 1G9AA 1I1BA 2LIQA 1IRPA 3O4AA 3H6RA 2Q3NB 4ZA3B 2FO1A 3A22A 5G00A
chains in the Genus database with same CATH superfamily
1S0LA 1W3GA 2D7IA 3UJ0A 3CRIA 2VUAA 4ZFWB 1HWNB 3VUOA 2HW9A 1XG6A 1EV2A 2WRYA 3BAGA 4XFTA 1NUNA 3FJJA 1MC9A 3VT1A 4KEIA 4XKIA 1ISWA 2X2SA 1HIBA 2Z48A 4AN6A 2GO2A 4I4YA 3OJMA 2R9KB 2FFUA 2QYIB 4F83A 4X38A 1G9DA 4OEFA 5BOWA 2NTDA 3AH4A 4XFUA 2AAIB 4GOVA 5JLVA 2NS2A 2E4MC 6I1BA 2FFVA 1DFQA 4LO7B 4H9WA 3R4UA 2Y9GA 5BQUC 3OJVA 3CA6A 1BARA 2D24A 2P39A 3VT0A 1S0DA 1V6WA 2ET2A 41BIA 3FJ8A 4I1EA 4L4IA 2KI6B 1W3AA 3FUOA 3A23A 4QBCA 4JQ0A 1TWMA 2VLCA 4G9MA 3V0AB 2XOAA 4QC4A 4ZKTB 3FJ9A 1QQKA 1CE7B 4GAIA 3HBWA 4LO1C 1DQGA 1DZDA 1PWAA 2DRZA 1YXWA 3FJCA 1BLDA 1XHBA 1AVXB 3C9ZA 4I2SA 4OEEA 1FN0A 2Z49A 3AJ5A 4G6MA 1YBIA 4OWJA 3IM5A 1JT3A 3CA5A 3POKA 4I4PA 4J23B 1BLAA 4X37A 2HWMA 2Y9XE 2KH2A 3BB2A 4L4HA 4X3AA 4Q9PA 1FGAA 2KKIA 3WMVA 1DZCA 1ISXA 5E24E 4JKXB 2F8XC 5DUYA 1S0FA 3B9UA 4I3NA 3O4CA 3AH2A 1OQLB 4QD2B 5EG6C 4I8MA 4IQPA 1HWMB 3N7KA 5DVHA 1Q1UA 3AKFA 3HSMA 4G1RA 4PC4A 5JMCA 3UDAA 1XZZA 5FZZA 1YF8B 1D0HA 1FWUA 4I4QA 3NJ5A 5BQUA 3BAQA 2VSAA 3OBTA 3PUBA 3KMVA 2VXTI 3PG0A 1IOBA 3NBDA 4LO8B 4GP0A 5GAQA 1ISYA 4I1BA 3BADA 5HPZA 31BIA 1S0CA 4I4UA 5D61A 4KEJA 3FJDA 3VEQA 4OEGA 1V6VA 4DEPA 2KI4A 4ZBVB 3IAGC 4USPA 3AZVA 1WD3A 3V79C 1ABRB 2ESUA 3QYDA 1S0GA 1DQOA 3V0BA 4I0YA 3AH1A 1PUUB 2Y9FA 4DCKC 5EC5A 1DFCA 1AVWB 1HCEA 3ILAA 1AF9A 1T4QA 1V6XA 3IM6A 1ILR1 4Q91A 3RMYA 3VSZA 1JTCA 3BAVA 2ZQNA 4I4VA 3BAOA 4QBVA 4ENDA 1BFFA 3UD8A 4I4RA 3N7LA 4P0LA 2BEBA 2MC2A 3FFZA 5D62A 3CQAA 4FGFA 1RMLA 1AXMA 1RY7A 4IZEA 3O4DA 3BA7A 2ZQOA 1Z2VA 4KC3A 3AZWA 2NM1A 4DENA 4LO2A 3N0KA 4QD2C 3FGMA 3BA5A 4ZLBB 3N7MA 1BFBA 4QKSA 1QQLA 3IIRA 2HZ9A 3EF2A 3RTIB 3RSJA 21BIA 1F31A 2P23A 2RSTA 5I1BA 3T8SA 3O5WB 4D0TA 1JY0A 1ISVA 4ZFYB 1JLYA 4EFPA 4XFSA 3HMYA 3WO4A 3I2XA 3BA4A 3OJ2A 1Q04A 1G82A 4LO3A 2ERMA 4QALA 4A7ZA 4ISQA 4EEEB 1JT7A 1SZ6B 3ZC9A 4KEKA 2NYYA 4FVVA 3BRDA 4D0ZA 2AFGA 4EFQA 2J3PA 3V0AA 3W9TA 2MIBA 3FJEA 3Q7XA 3NBEA 1IILA 4KBBA 3JRRA 3HN1A 1FMZA 4GP3A 4OWLA 4Z8SB 2HWAA 5DZUA 3CU1B 3JUTA 1AFCA 1NZKA 1M16A 4JP0A 4I4XA 3BAUA 4IY9A 2DS0A 2K4AB 1IT0A 1Q03A 3WINA 4IYBA 1HCDA 1K5VA 1RZOB 4IONA 2ZR1B 3RMXA 4IHZA 4I37A 2D22A 4HA2A 5FNXA 1EYLA 4IZXA 1KNMA 3AKGA 4LO2C 2AXMA 4GAFA 2IWTB 1VCLA 3BTAA 3BX1C 4J2SA 2GZBA 1BFGA 5BVPI 3WA1A 1FV3A 5BP5C 4EFRA 3RTJB 3UD7A 3FJIA 3HOMA 1HKNA 3MALA 4ZOTA 2K43A 4WBCA 3MPPG 3NBCA 1QXMA 4LO7C 2VU9A 4G9NA 3FJBA 5F90A 3AJ6A 3OGFA 1BFCA 4JRAA 1JT5A 1FMMS 2X2TA 4A7KA 1ITBA 3IM7A 1SR4A 1AVUA 1P63A 3WMUA 3CRHA 3H6RB 4LO3C 3PHZA 1K5UA 1GGPB 3O4BA 4UY4A 3VSFA 4Z9WB 1W3FA 3E8LC 3OGGA 4P0JA 4G6JA 4QKRA 4H04A 1TOOA 7I1BA 1JT4A 4J2XA 3R4SA 3BRGC 1IRAX 3S8JA 1M2TB 3O4OA 4MZGB 3ZXDA 1YTOA 3VT2A 5B2HA 3SNVA 3BRFA 4R6UB 3FJHA 2DRYA 4D8HA 1HWOB 3LLPA 2RG9B 4H75A 3WINC 2AQZA 1S0EA 1PZZA 3BAHA 3O44A 5FNWA 2F2FA 1J0SA 3HALA 1R8NA 5BXRA 3PMEA 5F8SA 4IY8A 2VXRA 1EVTA 1IHKA 4OUJA 4I7IA 1N4KA 1XYFA 3F62B 3ZX7A 3I2AA 3AKIA 1JQZA 1DIWA 2Y9WC 4ISRA 1FWVA 3S8KA 1UPSA 4J2YA 3NBNA 5FZUA 1CVSA 4J2KA 1FQ9A 4USOA 3OBRA 4HJJA 3FJFA 4JKQA 3K1XA 3AKHA 5BP5A 4ZGRB 1Z0HA 3UD9A 3A21A 2D7RA 2DREA 2M49A 4LO0A 5BXPA 1AVAC 1SR4C 2D1ZA 4Q9GA 1TTUA 1I1EA 1II4A 2D23A 2FGFA 3F1RA 1A8DA 3O49A 1WBCA 1MD6A 3CA3A 1WD4A 5DSSB 5F8YA 1WBAA 3P53A 5FZYA 1E0OA 2KLLA 4X39A 2QN4A 4P0KA 1G9BA 3O3QA 1L2HA 4OW4A 4A7YA 4CJMA 4TLPA 4GOYA 4I4OA 2BEAA 4QO3A 1S0BA 9ILBA 3CA1A 2YUGA 3FUQA 1TIEA 2VSEA 3P6JA 2F2FC 1G9CA 1JLXA 3Q7WA 2BFHA 3Q7YA 1T9FA 1TWEA 2NZ9A 3TC2A 2K8RA 4JAWA 3WO3A 3VWCA 4ZFUB 3D7WB 2D20A 1ISZA 2L5XA 4MZFB 3CAHA 1Z4SA 4MZHA 5EHAA 3UJ4A 2D43A 3ZXGA 5BXSA 4I4SA 3N7JA 1DLLA 3P6IA 1BASA 4HR6C 3FJAA 2I1BA 2NP0A 3LTQA 1HWPB 1ONKB 1V6UA 2FDBM 5BXTA 4YOLA 3I29B 1FV2A 1EPWA 2LIEA 4LO0C 4F34A 1TFMB 4EKXB 2E4MA 1RG8A 5D63A 2NVHA 2MLLB 1PC8B 3H6SE 1YYNA 4II0A 3CA0A 2Q9XA 2UUSA 3A07A 3QR5A 3V0BB 1IJTA 1PUMB 4OWKA 1R8OA 3ZC8A 1TP0A 2RQ9A 2IHOA 4JPZA 3CRGA 4AN7B 3CA4A 2WBCA 1DJSB 3H6QA 4I6IA 4P6AA 4EB2B 5F8WA 1BA7A 8I1BA 2D44A 3FJKA 4I96A 3WO2A 4LO1A 1G9AA 1I1BA 2LIQA 1IRPA 3O4AA 3H6RA 2Q3NB 4ZA3B 2FO1A 3A22A 5G00A
chains in the Genus database with same CATH topology
1S0LA 1W3GA 2D7IA 3UJ0A 3CRIA 2VUAA 4ZFWB 1HWNB 3VUOA 2HW9A 1XG6A 1EV2A 2WRYA 3BAGA 4XFTA 1NUNA 3FJJA 1MC9A 3VT1A 4KEIA 4XKIA 1ISWA 2X2SA 1HIBA 2Z48A 4AN6A 2GO2A 4I4YA 3OJMA 2R9KB 2FFUA 2QYIB 4F83A 4X38A 1G9DA 4OEFA 5BOWA 2NTDA 3AH4A 4XFUA 2AAIB 4GOVA 5JLVA 2NS2A 2E4MC 6I1BA 2FFVA 1DFQA 4LO7B 4H9WA 3R4UA 2Y9GA 5BQUC 3OJVA 3CA6A 1BARA 2D24A 2P39A 3VT0A 1S0DA 1V6WA 2ET2A 41BIA 3FJ8A 4I1EA 4L4IA 2KI6B 1W3AA 3FUOA 3A23A 4QBCA 4JQ0A 1TWMA 2VLCA 4G9MA 3V0AB 2XOAA 4QC4A 4ZKTB 3FJ9A 1QQKA 1CE7B 4GAIA 3HBWA 4LO1C 1DQGA 1DZDA 1PWAA 2DRZA 1YXWA 3FJCA 1BLDA 1XHBA 1AVXB 3C9ZA 4I2SA 4OEEA 1FN0A 2Z49A 3AJ5A 4G6MA 1YBIA 4OWJA 3IM5A 1JT3A 3CA5A 3POKA 4I4PA 4J23B 1BLAA 4X37A 2HWMA 2Y9XE 2KH2A 3BB2A 4L4HA 4X3AA 4Q9PA 1FGAA 2KKIA 3WMVA 1DZCA 1ISXA 5E24E 4JKXB 2F8XC 5DUYA 1S0FA 3B9UA 4I3NA 3O4CA 3AH2A 1OQLB 4QD2B 5EG6C 4I8MA 4IQPA 1HWMB 3N7KA 5DVHA 1Q1UA 3AKFA 3HSMA 4G1RA 4PC4A 5JMCA 3UDAA 1XZZA 5FZZA 1YF8B 1D0HA 1FWUA 4I4QA 3NJ5A 5BQUA 3BAQA 2VSAA 3OBTA 3PUBA 3KMVA 2VXTI 3PG0A 1IOBA 3NBDA 4LO8B 4GP0A 5GAQA 1ISYA 4I1BA 3BADA 5HPZA 31BIA 1S0CA 4I4UA 5D61A 4KEJA 3FJDA 3VEQA 4OEGA 1V6VA 4DEPA 2KI4A 4ZBVB 3IAGC 4USPA 3AZVA 1WD3A 3V79C 1ABRB 2ESUA 3QYDA 1S0GA 1DQOA 3V0BA 4I0YA 3AH1A 1PUUB 2Y9FA 4DCKC 5EC5A 1DFCA 1AVWB 1HCEA 3ILAA 1AF9A 1T4QA 1V6XA 3IM6A 1ILR1 4Q91A 3RMYA 3VSZA 1JTCA 3BAVA 2ZQNA 4I4VA 3BAOA 4QBVA 4ENDA 1BFFA 3UD8A 4I4RA 3N7LA 4P0LA 2BEBA 2MC2A 3FFZA 5D62A 3CQAA 4FGFA 1RMLA 1AXMA 1RY7A 4IZEA 3O4DA 3BA7A 2ZQOA 1Z2VA 4KC3A 3AZWA 2NM1A 4DENA 4LO2A 3N0KA 4QD2C 3FGMA 3BA5A 4ZLBB 3N7MA 1BFBA 4QKSA 1QQLA 3IIRA 2HZ9A 3EF2A 3RTIB 3RSJA 21BIA 1F31A 2P23A 2RSTA 5I1BA 3T8SA 3O5WB 4D0TA 1JY0A 1ISVA 4ZFYB 1JLYA 4EFPA 4XFSA 3HMYA 3WO4A 3I2XA 3BA4A 3OJ2A 1Q04A 1G82A 4LO3A 2ERMA 4QALA 4A7ZA 4ISQA 4EEEB 1JT7A 1SZ6B 3ZC9A 4KEKA 2NYYA 4FVVA 3BRDA 4D0ZA 2AFGA 4EFQA 2J3PA 3V0AA 3W9TA 2MIBA 3FJEA 3Q7XA 3NBEA 1IILA 4KBBA 3JRRA 3HN1A 1FMZA 4GP3A 4OWLA 4Z8SB 2HWAA 5DZUA 3CU1B 3JUTA 1AFCA 1NZKA 1M16A 4JP0A 4I4XA 3BAUA 4IY9A 2DS0A 2K4AB 1IT0A 1Q03A 3WINA 4IYBA 1HCDA 1K5VA 1RZOB 4IONA 2ZR1B 3RMXA 4IHZA 4I37A 2D22A 4HA2A 5FNXA 1EYLA 4IZXA 1KNMA 3AKGA 4LO2C 2AXMA 4GAFA 2IWTB 1VCLA 3BTAA 3BX1C 4J2SA 2GZBA 1BFGA 5BVPI 3WA1A 1FV3A 5BP5C 4EFRA 3RTJB 3UD7A 3FJIA 3HOMA 1HKNA 3MALA 4ZOTA 2K43A 4WBCA 3MPPG 3NBCA 1QXMA 4LO7C 2VU9A 4G9NA 3FJBA 5F90A 3AJ6A 3OGFA 1BFCA 4JRAA 1JT5A 1FMMS 2X2TA 4A7KA 1ITBA 3IM7A 1SR4A 1AVUA 1P63A 3WMUA 3CRHA 3H6RB 4LO3C 3PHZA 1K5UA 1GGPB 3O4BA 4UY4A 3VSFA 4Z9WB 1W3FA 3E8LC 3OGGA 4P0JA 4G6JA 4QKRA 4H04A 1TOOA 7I1BA 1JT4A 4J2XA 3R4SA 3BRGC 1IRAX 3S8JA 1M2TB 3O4OA 4MZGB 3ZXDA 1YTOA 3VT2A 5B2HA 3SNVA 3BRFA 4R6UB 3FJHA 2DRYA 4D8HA 1HWOB 3LLPA 2RG9B 4H75A 3WINC 2AQZA 1S0EA 1PZZA 3BAHA 3O44A 5FNWA 2F2FA 1J0SA 3HALA 1R8NA 5BXRA 3PMEA 5F8SA 4IY8A 2VXRA 1EVTA 1IHKA 4OUJA 4I7IA 1N4KA 1XYFA 3F62B 3ZX7A 3I2AA 3AKIA 1JQZA 1DIWA 2Y9WC 4ISRA 1FWVA 3S8KA 1UPSA 4J2YA 3NBNA 5FZUA 1CVSA 4J2KA 1FQ9A 4USOA 3OBRA 4HJJA 3FJFA 4JKQA 3K1XA 3AKHA 5BP5A 4ZGRB 1Z0HA 3UD9A 3A21A 2D7RA 2DREA 2M49A 4LO0A 5BXPA 1AVAC 1SR4C 2D1ZA 4Q9GA 1TTUA 1I1EA 1II4A 2D23A 2FGFA 3F1RA 1A8DA 3O49A 1WBCA 1MD6A 3CA3A 1WD4A 5DSSB 5F8YA 1WBAA 3P53A 5FZYA 1E0OA 2KLLA 4X39A 2QN4A 4P0KA 1G9BA 3O3QA 1L2HA 4OW4A 4A7YA 4CJMA 4TLPA 4GOYA 4I4OA 2BEAA 4QO3A 1S0BA 9ILBA 3CA1A 2YUGA 3FUQA 1TIEA 2VSEA 3P6JA 2F2FC 1G9CA 1JLXA 3Q7WA 2BFHA 3Q7YA 1T9FA 1TWEA 2NZ9A 3TC2A 2K8RA 4JAWA 3WO3A 3VWCA 4ZFUB 3D7WB 2D20A 1ISZA 2L5XA 4MZFB 3CAHA 1Z4SA 4MZHA 5EHAA 3UJ4A 2D43A 3ZXGA 5BXSA 4I4SA 3N7JA 1DLLA 3P6IA 1BASA 4HR6C 3FJAA 2I1BA 2NP0A 3LTQA 1HWPB 1ONKB 1V6UA 2FDBM 5BXTA 4YOLA 3I29B 1FV2A 1EPWA 2LIEA 4LO0C 4F34A 1TFMB 4EKXB 2E4MA 1RG8A 5D63A 2NVHA 2MLLB 1PC8B 3H6SE 1YYNA 4II0A 3CA0A 2Q9XA 2UUSA 3A07A 3QR5A 3V0BB 1IJTA 1PUMB 4OWKA 1R8OA 3ZC8A 1TP0A 2RQ9A 2IHOA 4JPZA 3CRGA 4AN7B 3CA4A 2WBCA 1DJSB 3H6QA 4I6IA 4P6AA 4EB2B 5F8WA 1BA7A 8I1BA 2D44A 3FJKA 4I96A 3WO2A 4LO1A 1G9AA 1I1BA 2LIQA 1IRPA 3O4AA 3H6RA 2Q3NB 4ZA3B 2FO1A 3A22A 5G00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0L A;  1W3G A;  2D7I A;  3UJ0 A;  3CRI A;  2VUA A;  4ZFW B;  1HWN B;  3VUO A;  2HW9 A;  1XG6 A;  1EV2 A;  2WRY A;  3BAG A;  4XFT A;  1NUN A;  3FJJ A;  1MC9 A;  3VT1 A;  4KEI A;  4XKI A;  1ISW A;  2X2S A;  1HIB A;  2Z48 A;  4AN6 A;  2GO2 A;  4I4Y A;  3OJM A;  2R9K B;  2FFU A;  2QYI B;  4F83 A;  4X38 A;  1G9D A;  4OEF A;  5BOW A;  2NTD A;  3AH4 A;  4XFU A;  2AAI B;  4GOV A;  5JLV A;  2E4M C;  6I1B A;  2FFV A;  1DFQ A;  4LO7 B;  4H9W A;  3R4U A;  2Y9G A;  5BQU C;  3OJV A;  3CA6 A;  1BAR A;  2D24 A;  2P39 A;  3VT0 A;  1S0D A;  1V6W A;  2ET2 A;  41BI A;  3FJ8 A;  4I1E A;  4L4I A;  2KI6 B;  1W3A A;  3FUO A;  3A23 A;  4QBC A;  4JQ0 A;  1TWM A;  2VLC A;  4G9M A;  3V0A B;  2XOA A;  4QC4 A;  4ZKT B;  3FJ9 A;  1QQK A;  1CE7 B;  4GAI A;  3HBW A;  4LO1 C;  1DQG A;  1DZD A;  1PWA A;  2DRZ A;  1YXW A;  3FJC A;  1BLD A;  1XHB A;  1AVX B;  3C9Z A;  4I2S A;  4OEE A;  1FN0 A;  2Z49 A;  3AJ5 A;  4G6M A;  1YBI A;  4OWJ A;  3IM5 A;  1JT3 A;  3CA5 A;  3POK A;  4I4P A;  4J23 B;  1BLA A;  4X37 A;  2HWM A;  2Y9X E;  2KH2 A;  3BB2 A;  4L4H A;  4X3A A;  4Q9P A;  1FGA A;  2KKI A;  3WMV A;  1DZC A;  1ISX A;  5E24 E;  4JKX B;  2F8X C;  5DUY A;  1S0F A;  3B9U A;  4I3N A;  3O4C A;  3AH2 A;  1OQL B;  4QD2 B;  5EG6 C;  4I8M A;  4IQP A;  1HWM B;  3N7K A;  5DVH A;  1Q1U A;  3AKF A;  3HSM A;  4G1R A;  4PC4 A;  5JMC A;  3UDA A;  1XZZ A;  5FZZ A;  1YF8 B;  1D0H A;  1FWU A;  4I4Q A;  3NJ5 A;  5BQU A;  3BAQ A;  2VSA A;  3OBT A;  3PUB A;  3KMV A;  2VXT I;  3PG0 A;  1IOB A;  3NBD A;  4LO8 B;  4GP0 A;  5GAQ A;  1ISY A;  4I1B A;  3BAD A;  5HPZ A;  31BI A;  1S0C A;  4I4U A;  5D61 A;  4KEJ A;  3FJD A;  3VEQ A;  4OEG A;  1V6V A;  4DEP A;  2KI4 A;  4ZBV B;  3IAG C;  4USP A;  3AZV A;  1WD3 A;  3V79 C;  1ABR B;  2ESU A;  3QYD A;  1S0G A;  1DQO A;  3V0B A;  4I0Y A;  3AH1 A;  1PUU B;  2Y9F A;  4DCK C;  5EC5 A;  1DFC A;  1AVW B;  1HCE A;  3ILA A;  1AF9 A;  1T4Q A;  1V6X A;  3IM6 A;  1ILR 1;  4Q91 A;  3RMY A;  3VSZ A;  1JTC A;  3BAV A;  2ZQN A;  4I4V A;  3BAO A;  4QBV A;  4END A;  1BFF A;  3UD8 A;  4I4R A;  3N7L A;  4P0L A;  2BEB A;  2MC2 A;  3FFZ A;  5D62 A;  3CQA A;  4FGF A;  1RML A;  1AXM A;  1RY7 A;  4IZE A;  3O4D A;  3BA7 A;  2ZQO A;  1Z2V A;  4KC3 A;  3AZW A;  2NM1 A;  4DEN A;  4LO2 A;  3N0K A;  4QD2 C;  3FGM A;  3BA5 A;  4ZLB B;  3N7M A;  1BFB A;  4QKS A;  1QQL A;  3IIR A;  2HZ9 A;  3EF2 A;  3RTI B;  3RSJ A;  21BI A;  1F31 A;  2P23 A;  2RST A;  5I1B A;  3T8S A;  3O5W B;  4D0T A;  1JY0 A;  1ISV A;  4ZFY B;  1JLY A;  4EFP A;  4XFS A;  3HMY A;  3WO4 A;  3I2X A;  3BA4 A;  3OJ2 A;  1Q04 A;  1G82 A;  4LO3 A;  2ERM A;  4QAL A;  4A7Z A;  4ISQ A;  4EEE B;  1JT7 A;  1SZ6 B;  3ZC9 A;  4KEK A;  2NYY A;  4FVV A;  3BRD A;  4D0Z A;  2AFG A;  4EFQ A;  2J3P A;  3V0A A;  3W9T A;  2MIB A;  3FJE A;  3Q7X A;  3NBE A;  1IIL A;  4KBB A;  3JRR A;  3HN1 A;  1FMZ A;  4GP3 A;  4OWL A;  4Z8S B;  2HWA A;  5DZU A;  3CU1 B;  3JUT A;  1AFC A;  1NZK A;  1M16 A;  4JP0 A;  4I4X A;  3BAU A;  4IY9 A;  2DS0 A;  2K4A B;  1IT0 A;  1Q03 A;  3WIN A;  4IYB A;  1HCD A;  1K5V A;  1RZO B;  4ION A;  2ZR1 B;  3RMX A;  4IHZ A;  4I37 A;  2D22 A;  4HA2 A;  5FNX A;  1EYL A;  4IZX A;  1KNM A;  3AKG A;  4LO2 C;  2AXM A;  4GAF A;  2IWT B;  1VCL A;  3BTA A;  3BX1 C;  4J2S A;  2GZB A;  1BFG A;  5BVP I;  3WA1 A;  1FV3 A;  5BP5 C;  4EFR A;  3RTJ B;  3UD7 A;  3FJI A;  3HOM A;  1HKN A;  3MAL A;  4ZOT A;  2K43 A;  4WBC A;  3MPP G;  3NBC A;  1QXM A;  4LO7 C;  2VU9 A;  4G9N A;  3FJB A;  5F90 A;  3AJ6 A;  3OGF A;  1BFC A;  4JRA A;  1JT5 A;  1FMM S;  2X2T A;  4A7K A;  1ITB A;  3IM7 A;  1SR4 A;  1AVU A;  1P63 A;  3WMU A;  3CRH A;  3H6R B;  4LO3 C;  3PHZ A;  1K5U A;  1GGP B;  3O4B A;  3VSF A;  4Z9W B;  1W3F A;  3E8L C;  3OGG A;  4P0J A;  4G6J A;  4QKR A;  4H04 A;  1TOO A;  7I1B A;  1JT4 A;  4J2X A;  3R4S A;  3BRG C;  1IRA X;  3S8J A;  1M2T B;  3O4O A;  3ZXD A;  1YTO A;  3VT2 A;  5B2H A;  3SNV A;  3BRF A;  4R6U B;  3FJH A;  2DRY A;  4D8H A;  1HWO B;  3LLP A;  2RG9 B;  3WIN C;  2AQZ A;  1S0E A;  1PZZ A;  3BAH A;  3O44 A;  5FNW A;  2F2F A;  1J0S A;  3HAL A;  1R8N A;  5BXR A;  3PME A;  5F8S A;  4IY8 A;  2VXR A;  1EVT A;  1IHK A;  4OUJ A;  4I7I A;  1N4K A;  1XYF A;  3F62 B;  3ZX7 A;  3I2A A;  3AKI A;  1JQZ A;  1DIW A;  2Y9W C;  4ISR A;  1FWV A;  3S8K A;  1UPS A;  4J2Y A;  3NBN A;  5FZU A;  1CVS A;  4J2K A;  1FQ9 A;  4USO A;  3OBR A;  4HJJ A;  3FJF A;  4JKQ A;  3K1X A;  3AKH A;  5BP5 A;  4ZGR B;  1Z0H A;  3UD9 A;  3A21 A;  2D7R A;  2DRE A;  2M49 A;  4LO0 A;  5BXP A;  1AVA C;  1SR4 C;  2D1Z A;  4Q9G A;  1TTU A;  1I1E A;  1II4 A;  2D23 A;  2FGF A;  3F1R A;  1A8D A;  3O49 A;  1WBC A;  1MD6 A;  3CA3 A;  1WD4 A;  5DSS B;  5F8Y A;  1WBA A;  3P53 A;  5FZY A;  1E0O A;  2KLL A;  4X39 A;  2QN4 A;  4P0K A;  1G9B A;  3O3Q A;  1L2H A;  4OW4 A;  4A7Y A;  4CJM A;  4TLP A;  4GOY A;  4I4O A;  2BEA A;  4QO3 A;  1S0B A;  9ILB A;  3CA1 A;  2YUG A;  3FUQ A;  1TIE A;  2VSE A;  3P6J A;  2F2F C;  1G9C A;  1JLX A;  3Q7W A;  2BFH A;  3Q7Y A;  1T9F A;  1TWE A;  2NZ9 A;  3TC2 A;  2K8R A;  4JAW A;  3WO3 A;  3VWC A;  4ZFU B;  3D7W B;  2D20 A;  1ISZ A;  2L5X A;  3CAH A;  1Z4S A;  5EHA A;  3UJ4 A;  2D43 A;  3ZXG A;  5BXS A;  4I4S A;  3N7J A;  1DLL A;  3P6I A;  1BAS A;  4HR6 C;  3FJA A;  2I1B A;  2NP0 A;  3LTQ A;  1HWP B;  1ONK B;  1V6U A;  2FDB M;  5BXT A;  4YOL A;  3I29 B;  1FV2 A;  1EPW A;  2LIE A;  4LO0 C;  4F34 A;  1TFM B;  4EKX B;  2E4M A;  1RG8 A;  5D63 A;  2NVH A;  2MLL B;  1PC8 B;  3H6S E;  1YYN A;  4II0 A;  3CA0 A;  2Q9X A;  2UUS A;  3A07 A;  3QR5 A;  3V0B B;  1IJT A;  1PUM B;  4OWK A;  1R8O A;  3ZC8 A;  1TP0 A;  2RQ9 A;  2IHO A;  4JPZ A;  3CRG A;  4AN7 B;  3CA4 A;  2WBC A;  1DJS B;  3H6Q A;  4I6I A;  4P6A A;  4EB2 B;  5F8W A;  1BA7 A;  8I1B A;  2D44 A;  3FJK A;  4I96 A;  3WO2 A;  4LO1 A;  1G9A A;  1I1B A;  2LIQ A;  1IRP A;  3O4A A;  3H6R A;  2Q3N B;  4ZA3 B;  2FO1 A;  3A22 A;  5G00 A; 
#chains in the Genus database with same CATH topology
 1S0L A;  1W3G A;  2D7I A;  3UJ0 A;  3CRI A;  2VUA A;  4ZFW B;  1HWN B;  3VUO A;  2HW9 A;  1XG6 A;  1EV2 A;  2WRY A;  3BAG A;  4XFT A;  1NUN A;  3FJJ A;  1MC9 A;  3VT1 A;  4KEI A;  4XKI A;  1ISW A;  2X2S A;  1HIB A;  2Z48 A;  4AN6 A;  2GO2 A;  4I4Y A;  3OJM A;  2R9K B;  2FFU A;  2QYI B;  4F83 A;  4X38 A;  1G9D A;  4OEF A;  5BOW A;  2NTD A;  3AH4 A;  4XFU A;  2AAI B;  4GOV A;  5JLV A;  2NS2 A;  2E4M C;  6I1B A;  2FFV A;  1DFQ A;  4LO7 B;  4H9W A;  3R4U A;  2Y9G A;  5BQU C;  3OJV A;  3CA6 A;  1BAR A;  2D24 A;  2P39 A;  3VT0 A;  1S0D A;  1V6W A;  2ET2 A;  41BI A;  3FJ8 A;  4I1E A;  4L4I A;  2KI6 B;  1W3A A;  3FUO A;  3A23 A;  4QBC A;  4JQ0 A;  1TWM A;  2VLC A;  4G9M A;  3V0A B;  2XOA A;  4QC4 A;  4ZKT B;  3FJ9 A;  1QQK A;  1CE7 B;  4GAI A;  3HBW A;  4LO1 C;  1DQG A;  1DZD A;  1PWA A;  2DRZ A;  1YXW A;  3FJC A;  1BLD A;  1XHB A;  1AVX B;  3C9Z A;  4I2S A;  4OEE A;  1FN0 A;  2Z49 A;  3AJ5 A;  4G6M A;  1YBI A;  4OWJ A;  3IM5 A;  1JT3 A;  3CA5 A;  3POK A;  4I4P A;  4J23 B;  1BLA A;  4X37 A;  2HWM A;  2Y9X E;  2KH2 A;  3BB2 A;  4L4H A;  4X3A A;  4Q9P A;  1FGA A;  2KKI A;  3WMV A;  1DZC A;  1ISX A;  5E24 E;  4JKX B;  2F8X C;  5DUY A;  1S0F A;  3B9U A;  4I3N A;  3O4C A;  3AH2 A;  1OQL B;  4QD2 B;  5EG6 C;  4I8M A;  4IQP A;  1HWM B;  3N7K A;  5DVH A;  1Q1U A;  3AKF A;  3HSM A;  4G1R A;  4PC4 A;  5JMC A;  3UDA A;  1XZZ A;  5FZZ A;  1YF8 B;  1D0H A;  1FWU A;  4I4Q A;  3NJ5 A;  5BQU A;  3BAQ A;  2VSA A;  3OBT A;  3PUB A;  3KMV A;  2VXT I;  3PG0 A;  1IOB A;  3NBD A;  4LO8 B;  4GP0 A;  5GAQ A;  1ISY A;  4I1B A;  3BAD A;  5HPZ A;  31BI A;  1S0C A;  4I4U A;  5D61 A;  4KEJ A;  3FJD A;  3VEQ A;  4OEG A;  1V6V A;  4DEP A;  2KI4 A;  4ZBV B;  3IAG C;  4USP A;  3AZV A;  1WD3 A;  3V79 C;  1ABR B;  2ESU A;  3QYD A;  1S0G A;  1DQO A;  3V0B A;  4I0Y A;  3AH1 A;  1PUU B;  2Y9F A;  4DCK C;  5EC5 A;  1DFC A;  1AVW B;  1HCE A;  3ILA A;  1AF9 A;  1T4Q A;  1V6X A;  3IM6 A;  1ILR 1;  4Q91 A;  3RMY A;  3VSZ A;  1JTC A;  3BAV A;  2ZQN A;  4I4V A;  3BAO A;  4QBV A;  4END A;  1BFF A;  3UD8 A;  4I4R A;  3N7L A;  4P0L A;  2BEB A;  2MC2 A;  3FFZ A;  5D62 A;  3CQA A;  4FGF A;  1RML A;  1AXM A;  1RY7 A;  4IZE A;  3O4D A;  3BA7 A;  2ZQO A;  1Z2V A;  4KC3 A;  3AZW A;  2NM1 A;  4DEN A;  4LO2 A;  3N0K A;  4QD2 C;  3FGM A;  3BA5 A;  4ZLB B;  3N7M A;  1BFB A;  4QKS A;  1QQL A;  3IIR A;  2HZ9 A;  3EF2 A;  3RTI B;  3RSJ A;  21BI A;  1F31 A;  2P23 A;  2RST A;  5I1B A;  3T8S A;  3O5W B;  4D0T A;  1JY0 A;  1ISV A;  4ZFY B;  1JLY A;  4EFP A;  4XFS A;  3HMY A;  3WO4 A;  3I2X A;  3BA4 A;  3OJ2 A;  1Q04 A;  1G82 A;  4LO3 A;  2ERM A;  4QAL A;  4A7Z A;  4ISQ A;  4EEE B;  1JT7 A;  1SZ6 B;  3ZC9 A;  4KEK A;  2NYY A;  4FVV A;  3BRD A;  4D0Z A;  2AFG A;  4EFQ A;  2J3P A;  3V0A A;  3W9T A;  2MIB A;  3FJE A;  3Q7X A;  3NBE A;  1IIL A;  4KBB A;  3JRR A;  3HN1 A;  1FMZ A;  4GP3 A;  4OWL A;  4Z8S B;  2HWA A;  5DZU A;  3CU1 B;  3JUT A;  1AFC A;  1NZK A;  1M16 A;  4JP0 A;  4I4X A;  3BAU A;  4IY9 A;  2DS0 A;  2K4A B;  1IT0 A;  1Q03 A;  3WIN A;  4IYB A;  1HCD A;  1K5V A;  1RZO B;  4ION A;  2ZR1 B;  3RMX A;  4IHZ A;  4I37 A;  2D22 A;  4HA2 A;  5FNX A;  1EYL A;  4IZX A;  1KNM A;  3AKG A;  4LO2 C;  2AXM A;  4GAF A;  2IWT B;  1VCL A;  3BTA A;  3BX1 C;  4J2S A;  2GZB A;  1BFG A;  5BVP I;  3WA1 A;  1FV3 A;  5BP5 C;  4EFR A;  3RTJ B;  3UD7 A;  3FJI A;  3HOM A;  1HKN A;  3MAL A;  4ZOT A;  2K43 A;  4WBC A;  3MPP G;  3NBC A;  1QXM A;  4LO7 C;  2VU9 A;  4G9N A;  3FJB A;  5F90 A;  3AJ6 A;  3OGF A;  1BFC A;  4JRA A;  1JT5 A;  1FMM S;  2X2T A;  4A7K A;  1ITB A;  3IM7 A;  1SR4 A;  1AVU A;  1P63 A;  3WMU A;  3CRH A;  3H6R B;  4LO3 C;  3PHZ A;  1K5U A;  1GGP B;  3O4B A;  4UY4 A;  3VSF A;  4Z9W B;  1W3F A;  3E8L C;  3OGG A;  4P0J A;  4G6J A;  4QKR A;  4H04 A;  1TOO A;  7I1B A;  1JT4 A;  4J2X A;  3R4S A;  3BRG C;  1IRA X;  3S8J A;  1M2T B;  3O4O A;  4MZG B;  3ZXD A;  1YTO A;  3VT2 A;  5B2H A;  3SNV A;  3BRF A;  4R6U B;  3FJH A;  2DRY A;  4D8H A;  1HWO B;  3LLP A;  2RG9 B;  4H75 A;  3WIN C;  2AQZ A;  1S0E A;  1PZZ A;  3BAH A;  3O44 A;  5FNW A;  2F2F A;  1J0S A;  3HAL A;  1R8N A;  5BXR A;  3PME A;  5F8S A;  4IY8 A;  2VXR A;  1EVT A;  1IHK A;  4OUJ A;  4I7I A;  1N4K A;  1XYF A;  3F62 B;  3ZX7 A;  3I2A A;  3AKI A;  1JQZ A;  1DIW A;  2Y9W C;  4ISR A;  1FWV A;  3S8K A;  1UPS A;  4J2Y A;  3NBN A;  5FZU A;  1CVS A;  4J2K A;  1FQ9 A;  4USO A;  3OBR A;  4HJJ A;  3FJF A;  4JKQ A;  3K1X A;  3AKH A;  5BP5 A;  4ZGR B;  1Z0H A;  3UD9 A;  3A21 A;  2D7R A;  2DRE A;  2M49 A;  4LO0 A;  5BXP A;  1AVA C;  1SR4 C;  2D1Z A;  4Q9G A;  1TTU A;  1I1E A;  1II4 A;  2D23 A;  2FGF A;  3F1R A;  1A8D A;  3O49 A;  1WBC A;  1MD6 A;  3CA3 A;  1WD4 A;  5DSS B;  5F8Y A;  1WBA A;  3P53 A;  5FZY A;  1E0O A;  2KLL A;  4X39 A;  2QN4 A;  4P0K A;  1G9B A;  3O3Q A;  1L2H A;  4OW4 A;  4A7Y A;  4CJM A;  4TLP A;  4GOY A;  4I4O A;  2BEA A;  4QO3 A;  1S0B A;  9ILB A;  3CA1 A;  2YUG A;  3FUQ A;  1TIE A;  2VSE A;  3P6J A;  2F2F C;  1G9C A;  1JLX A;  3Q7W A;  2BFH A;  3Q7Y A;  1T9F A;  1TWE A;  2NZ9 A;  3TC2 A;  2K8R A;  4JAW A;  3WO3 A;  3VWC A;  4ZFU B;  3D7W B;  2D20 A;  1ISZ A;  2L5X A;  4MZF B;  3CAH A;  1Z4S A;  4MZH A;  5EHA A;  3UJ4 A;  2D43 A;  3ZXG A;  5BXS A;  4I4S A;  3N7J A;  1DLL A;  3P6I A;  1BAS A;  4HR6 C;  3FJA A;  2I1B A;  2NP0 A;  3LTQ A;  1HWP B;  1ONK B;  1V6U A;  2FDB M;  5BXT A;  4YOL A;  3I29 B;  1FV2 A;  1EPW A;  2LIE A;  4LO0 C;  4F34 A;  1TFM B;  4EKX B;  2E4M A;  1RG8 A;  5D63 A;  2NVH A;  2MLL B;  1PC8 B;  3H6S E;  1YYN A;  4II0 A;  3CA0 A;  2Q9X A;  2UUS A;  3A07 A;  3QR5 A;  3V0B B;  1IJT A;  1PUM B;  4OWK A;  1R8O A;  3ZC8 A;  1TP0 A;  2RQ9 A;  2IHO A;  4JPZ A;  3CRG A;  4AN7 B;  3CA4 A;  2WBC A;  1DJS B;  3H6Q A;  4I6I A;  4P6A A;  4EB2 B;  5F8W A;  1BA7 A;  8I1B A;  2D44 A;  3FJK A;  4I96 A;  3WO2 A;  4LO1 A;  1G9A A;  1I1B A;  2LIQ A;  1IRP A;  3O4A A;  3H6R A;  2Q3N B;  4ZA3 B;  2FO1 A;  3A22 A;  5G00 A; 
#chains in the Genus database with same CATH homology
 1S0L A;  1W3G A;  2D7I A;  3UJ0 A;  3CRI A;  2VUA A;  4ZFW B;  1HWN B;  3VUO A;  2HW9 A;  1XG6 A;  1EV2 A;  2WRY A;  3BAG A;  4XFT A;  1NUN A;  3FJJ A;  1MC9 A;  3VT1 A;  4KEI A;  4XKI A;  1ISW A;  2X2S A;  1HIB A;  2Z48 A;  4AN6 A;  2GO2 A;  4I4Y A;  3OJM A;  2R9K B;  2FFU A;  2QYI B;  4F83 A;  4X38 A;  1G9D A;  4OEF A;  5BOW A;  2NTD A;  3AH4 A;  4XFU A;  2AAI B;  4GOV A;  5JLV A;  2NS2 A;  2E4M C;  6I1B A;  2FFV A;  1DFQ A;  4LO7 B;  4H9W A;  3R4U A;  2Y9G A;  5BQU C;  3OJV A;  3CA6 A;  1BAR A;  2D24 A;  2P39 A;  3VT0 A;  1S0D A;  1V6W A;  2ET2 A;  41BI A;  3FJ8 A;  4I1E A;  4L4I A;  2KI6 B;  1W3A A;  3FUO A;  3A23 A;  4QBC A;  4JQ0 A;  1TWM A;  2VLC A;  4G9M A;  3V0A B;  2XOA A;  4QC4 A;  4ZKT B;  3FJ9 A;  1QQK A;  1CE7 B;  4GAI A;  3HBW A;  4LO1 C;  1DQG A;  1DZD A;  1PWA A;  2DRZ A;  1YXW A;  3FJC A;  1BLD A;  1XHB A;  1AVX B;  3C9Z A;  4I2S A;  4OEE A;  1FN0 A;  2Z49 A;  3AJ5 A;  4G6M A;  1YBI A;  4OWJ A;  3IM5 A;  1JT3 A;  3CA5 A;  3POK A;  4I4P A;  4J23 B;  1BLA A;  4X37 A;  2HWM A;  2Y9X E;  2KH2 A;  3BB2 A;  4L4H A;  4X3A A;  4Q9P A;  1FGA A;  2KKI A;  3WMV A;  1DZC A;  1ISX A;  5E24 E;  4JKX B;  2F8X C;  5DUY A;  1S0F A;  3B9U A;  4I3N A;  3O4C A;  3AH2 A;  1OQL B;  4QD2 B;  5EG6 C;  4I8M A;  4IQP A;  1HWM B;  3N7K A;  5DVH A;  1Q1U A;  3AKF A;  3HSM A;  4G1R A;  4PC4 A;  5JMC A;  3UDA A;  1XZZ A;  5FZZ A;  1YF8 B;  1D0H A;  1FWU A;  4I4Q A;  3NJ5 A;  5BQU A;  3BAQ A;  2VSA A;  3OBT A;  3PUB A;  3KMV A;  2VXT I;  3PG0 A;  1IOB A;  3NBD A;  4LO8 B;  4GP0 A;  5GAQ A;  1ISY A;  4I1B A;  3BAD A;  5HPZ A;  31BI A;  1S0C A;  4I4U A;  5D61 A;  4KEJ A;  3FJD A;  3VEQ A;  4OEG A;  1V6V A;  4DEP A;  2KI4 A;  4ZBV B;  3IAG C;  4USP A;  3AZV A;  1WD3 A;  3V79 C;  1ABR B;  2ESU A;  3QYD A;  1S0G A;  1DQO A;  3V0B A;  4I0Y A;  3AH1 A;  1PUU B;  2Y9F A;  4DCK C;  5EC5 A;  1DFC A;  1AVW B;  1HCE A;  3ILA A;  1AF9 A;  1T4Q A;  1V6X A;  3IM6 A;  1ILR 1;  4Q91 A;  3RMY A;  3VSZ A;  1JTC A;  3BAV A;  2ZQN A;  4I4V A;  3BAO A;  4QBV A;  4END A;  1BFF A;  3UD8 A;  4I4R A;  3N7L A;  4P0L A;  2BEB A;  2MC2 A;  3FFZ A;  5D62 A;  3CQA A;  4FGF A;  1RML A;  1AXM A;  1RY7 A;  4IZE A;  3O4D A;  3BA7 A;  2ZQO A;  1Z2V A;  4KC3 A;  3AZW A;  2NM1 A;  4DEN A;  4LO2 A;  3N0K A;  4QD2 C;  3FGM A;  3BA5 A;  4ZLB B;  3N7M A;  1BFB A;  4QKS A;  1QQL A;  3IIR A;  2HZ9 A;  3EF2 A;  3RTI B;  3RSJ A;  21BI A;  1F31 A;  2P23 A;  2RST A;  5I1B A;  3T8S A;  3O5W B;  4D0T A;  1JY0 A;  1ISV A;  4ZFY B;  1JLY A;  4EFP A;  4XFS A;  3HMY A;  3WO4 A;  3I2X A;  3BA4 A;  3OJ2 A;  1Q04 A;  1G82 A;  4LO3 A;  2ERM A;  4QAL A;  4A7Z A;  4ISQ A;  4EEE B;  1JT7 A;  1SZ6 B;  3ZC9 A;  4KEK A;  2NYY A;  4FVV A;  3BRD A;  4D0Z A;  2AFG A;  4EFQ A;  2J3P A;  3V0A A;  3W9T A;  2MIB A;  3FJE A;  3Q7X A;  3NBE A;  1IIL A;  4KBB A;  3JRR A;  3HN1 A;  1FMZ A;  4GP3 A;  4OWL A;  4Z8S B;  2HWA A;  5DZU A;  3CU1 B;  3JUT A;  1AFC A;  1NZK A;  1M16 A;  4JP0 A;  4I4X A;  3BAU A;  4IY9 A;  2DS0 A;  2K4A B;  1IT0 A;  1Q03 A;  3WIN A;  4IYB A;  1HCD A;  1K5V A;  1RZO B;  4ION A;  2ZR1 B;  3RMX A;  4IHZ A;  4I37 A;  2D22 A;  4HA2 A;  5FNX A;  1EYL A;  4IZX A;  1KNM A;  3AKG A;  4LO2 C;  2AXM A;  4GAF A;  2IWT B;  1VCL A;  3BTA A;  3BX1 C;  4J2S A;  2GZB A;  1BFG A;  5BVP I;  3WA1 A;  1FV3 A;  5BP5 C;  4EFR A;  3RTJ B;  3UD7 A;  3FJI A;  3HOM A;  1HKN A;  3MAL A;  4ZOT A;  2K43 A;  4WBC A;  3MPP G;  3NBC A;  1QXM A;  4LO7 C;  2VU9 A;  4G9N A;  3FJB A;  5F90 A;  3AJ6 A;  3OGF A;  1BFC A;  4JRA A;  1JT5 A;  1FMM S;  2X2T A;  4A7K A;  1ITB A;  3IM7 A;  1SR4 A;  1AVU A;  1P63 A;  3WMU A;  3CRH A;  3H6R B;  4LO3 C;  3PHZ A;  1K5U A;  1GGP B;  3O4B A;  4UY4 A;  3VSF A;  4Z9W B;  1W3F A;  3E8L C;  3OGG A;  4P0J A;  4G6J A;  4QKR A;  4H04 A;  1TOO A;  7I1B A;  1JT4 A;  4J2X A;  3R4S A;  3BRG C;  1IRA X;  3S8J A;  1M2T B;  3O4O A;  4MZG B;  3ZXD A;  1YTO A;  3VT2 A;  5B2H A;  3SNV A;  3BRF A;  4R6U B;  3FJH A;  2DRY A;  4D8H A;  1HWO B;  3LLP A;  2RG9 B;  4H75 A;  3WIN C;  2AQZ A;  1S0E A;  1PZZ A;  3BAH A;  3O44 A;  5FNW A;  2F2F A;  1J0S A;  3HAL A;  1R8N A;  5BXR A;  3PME A;  5F8S A;  4IY8 A;  2VXR A;  1EVT A;  1IHK A;  4OUJ A;  4I7I A;  1N4K A;  1XYF A;  3F62 B;  3ZX7 A;  3I2A A;  3AKI A;  1JQZ A;  1DIW A;  2Y9W C;  4ISR A;  1FWV A;  3S8K A;  1UPS A;  4J2Y A;  3NBN A;  5FZU A;  1CVS A;  4J2K A;  1FQ9 A;  4USO A;  3OBR A;  4HJJ A;  3FJF A;  4JKQ A;  3K1X A;  3AKH A;  5BP5 A;  4ZGR B;  1Z0H A;  3UD9 A;  3A21 A;  2D7R A;  2DRE A;  2M49 A;  4LO0 A;  5BXP A;  1AVA C;  1SR4 C;  2D1Z A;  4Q9G A;  1TTU A;  1I1E A;  1II4 A;  2D23 A;  2FGF A;  3F1R A;  1A8D A;  3O49 A;  1WBC A;  1MD6 A;  3CA3 A;  1WD4 A;  5DSS B;  5F8Y A;  1WBA A;  3P53 A;  5FZY A;  1E0O A;  2KLL A;  4X39 A;  2QN4 A;  4P0K A;  1G9B A;  3O3Q A;  1L2H A;  4OW4 A;  4A7Y A;  4CJM A;  4TLP A;  4GOY A;  4I4O A;  2BEA A;  4QO3 A;  1S0B A;  9ILB A;  3CA1 A;  2YUG A;  3FUQ A;  1TIE A;  2VSE A;  3P6J A;  2F2F C;  1G9C A;  1JLX A;  3Q7W A;  2BFH A;  3Q7Y A;  1T9F A;  1TWE A;  2NZ9 A;  3TC2 A;  2K8R A;  4JAW A;  3WO3 A;  3VWC A;  4ZFU B;  3D7W B;  2D20 A;  1ISZ A;  2L5X A;  4MZF B;  3CAH A;  1Z4S A;  4MZH A;  5EHA A;  3UJ4 A;  2D43 A;  3ZXG A;  5BXS A;  4I4S A;  3N7J A;  1DLL A;  3P6I A;  1BAS A;  4HR6 C;  3FJA A;  2I1B A;  2NP0 A;  3LTQ A;  1HWP B;  1ONK B;  1V6U A;  2FDB M;  5BXT A;  4YOL A;  3I29 B;  1FV2 A;  1EPW A;  2LIE A;  4LO0 C;  4F34 A;  1TFM B;  4EKX B;  2E4M A;  1RG8 A;  5D63 A;  2NVH A;  2MLL B;  1PC8 B;  3H6S E;  1YYN A;  4II0 A;  3CA0 A;  2Q9X A;  2UUS A;  3A07 A;  3QR5 A;  3V0B B;  1IJT A;  1PUM B;  4OWK A;  1R8O A;  3ZC8 A;  1TP0 A;  2RQ9 A;  2IHO A;  4JPZ A;  3CRG A;  4AN7 B;  3CA4 A;  2WBC A;  1DJS B;  3H6Q A;  4I6I A;  4P6A A;  4EB2 B;  5F8W A;  1BA7 A;  8I1B A;  2D44 A;  3FJK A;  4I96 A;  3WO2 A;  4LO1 A;  1G9A A;  1I1B A;  2LIQ A;  1IRP A;  3O4A A;  3H6R A;  2Q3N B;  4ZA3 B;  2FO1 A;  3A22 A;  5G00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...