3FGMA

Crystal structure of l44f/c83t/c117v/f132w mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQFQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEETLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSVKRGPRTHYGQKAILWLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fgmA00
1AVUA 3AJ5A 3RSJA 3FJDA 1TP0A 3EF2A 3F1RA 1AFCA 5BP5C 2M49A 1TTUA 1D0HA 2GZBA 4I4YA 4II0A 2MLLB 3BRDA 1FWUA 1ONKB 1JQZA 4IZXA 4I4UA 2X2SA 2IHOA 3NJ5A 1F31A 1Z4SA 2D24A 4ZOTA 4GP3A 4ZBVB 3BB2A 4A7KA 1G9DA 3HN1A 4I2SA 3BRGC 3CAHA 4ISRA 1DIWA 3AZVA 5GAQA 4Q9GA 4JQ0A 3A22A 3CA3A 3AH1A 4EKXB 4QBCA 1PUMB 2FFUA 1QXMA 3V0BA 2WRYA 2VU9A 2D20A 5FZUA 5BQUC 1YYNA 1EPWA 3CQAA 4D0TA 3ZX7A 1YXWA 1HWPB 2DS0A 1V6UA 4I7IA 2NZ9A 3O4OA 1BLAA 3O3QA 3OJMA 4I4PA 1YBIA 1CE7B 3FFZA 3VUOA 2Z48A 2Q9XA 3BADA 3BX1C 1RMLA 5F8YA 3VT0A 1IILA 2YUGA 3OJVA 4HA2A 3P6JA 3ZXDA 2FDBM 1Q1UA 4QALA 2BFHA 2Y9WC 3WO4A 1DFQA 1PC8B 2R9KB 1HWNB 5F8SA 4PC4A 1BFCA 2NTDA 1ABRB 3C9ZA 3R4UA 1EVTA 4JRAA 5FNXA 2ZQNA 2WBCA 1YF8B 4GP0A 2K8RA 3JUTA 1V6WA 1RG8A 4G1RA 2AQZA 6I1BA 3OGFA 3UD9A 3HSMA 1FN0A 3NBEA 4QKSA 4ZA3B 3FUQA 3NBNA 1WD4A 3AJ6A 1AVAC 2ZQOA 3ZC9A 1SZ6B 1ISZA 3AKGA 5BP5A 1XZZA 1JT4A 4OUJA 3OBRA 4R6UB 4QO3A 1XYFA 1FQ9A 4J2XA 4Q91A 1JT7A 1FMMS 3O49A 2RG9B 1FGAA 1WBCA 3FUOA 4I8MA 4JAWA 4P0LA 1EYLA 2FGFA 4HR6C 2HW9A 3O4BA 4J2SA 3FJBA 1S0EA 4I4RA 1XHBA 2K43A 2HWMA 2DRZA 1CVSA 3JRRA 5DVHA 3PUBA 1I1EA 2D44A 4G6JA 4LO7C 5B2HA 4WBCA 3FGMA 4IONA 2ESUA 3CA0A 1S0FA 3BAOA 5BQUA 3FJHA 4ZGRB 1FV2A 3VT1A 2QYIB 4G9MA 3HMYA 3IAGC 1BLDA 2UUSA 1S0CA 1G82A 3BRFA 1PWAA 1II4A 3FJIA 4QKRA 3WINC 1I1BA 4J2YA 4ISQA 1W3FA 1XG6A 3H6QA 4P0JA 1DLLA 4XFTA 3O4AA 3W9TA 1M16A 5JMCA 3N0KA 3A07A 3TC2A 1BARA 1FMZA 41BIA 2E4MC 4X37A 2BEAA 1EV2A 1HCDA 1R8OA 2RSTA 3BAGA 1DFCA 3H6RB 2K4AB 4H9WA 1Z2VA 1R8NA 5FZYA 2D7IA 1PZZA 3D7WB 2NP0A 5D61A 3FJ9A 4LO1C 4TLPA 1TIEA 5I1BA 4IQPA 4FGFA 3VT2A 1S0LA 2I1BA 1IJTA 4EB2B 1ITBA 4XFUA 1E0OA 3RTIB 3SNVA 4JPZA 3CRGA 4QD2C 3WO3A 2X2TA 1BFFA 1DQGA 2AFGA 4XFSA 5JLVA 2P39A 2HZ9A 4ZFUB 4QD2B 3R4SA 3KMVA 3CA6A 2D22A 1IRAX 3BA7A 1BA7A 1G9BA 1SR4C 3NBDA 2KLLA 2KH2A 1HKNA 1ISWA 3CA4A 4IZEA 3FJAA 1IOBA 3HBWA 3BAHA 2F8XC 1AXMA 4ZFWB 3S8JA 5EHAA 3UDAA 3VSFA 3K1XA 4OEGA 1BFGA 3PMEA 1RZOB 2ET2A 4GOVA 2VSAA 1K5UA 2KKIA 1Z0HA 2D23A 4OWKA 3RMXA 3RMYA 3CRHA 1JLYA 2D1ZA 1W3GA 4D0ZA 4IY8A 4QBVA 1DZDA 4DENA 4LO3C 4X38A 1BFBA 5EC5A 3WINA 3O44A 1TFMB 2L5XA 4ENDA 3V79C 3CU1B 3BAVA 1V6VA 4GAFA 2E4MA 3N7JA 3H6RA 4L4HA 3FJCA 1G9AA 3CA1A 3OBTA 1JT3A 3O4DA 4AN6A 3BAQA 3I2AA 3OGGA 4LO2A 2VUAA 4I96A 5BXTA 3QYDA 2MC2A 4OWJA 4LO1A 3AKHA 4P0KA 4IHZA 5DSSB 5FZZA 2GO2A 1V6XA 4X39A 1G9CA 2QN4A 3V0BB 1QQKA 2AXMA 1N4KA 3Q7YA 1FV3A 4F34A 3POKA 4GOYA 4IYBA 1J0SA 1HWOB 3MALA 3I2XA 4I4QA 1TWMA 4OEFA 1DJSB 3F62B 4A7YA 3FJKA 3Q7XA 3LLPA 3FJEA 4JKXB 1SR4A 3IM5A 1W3AA 1UPSA 2NM1A 4KBBA 4Q9PA 1ISXA 2Y9XE 2Y9GA 2AAIB 4IY9A 1DZCA 4LO0C 4J23B 1OQLB 5HPZA 5DUYA 3A21A 3N7MA 4I4SA 2LIEA 3E8LC 7I1BA 3FJFA 3NBCA 1WD3A 4LO2C 1RY7A 3BA5A 4HJJA 4DCKC 2FFVA 1HCEA 1NUNA 3PHZA 4I1EA 5F90A 3P6IA 1AVWB 1ILR1 2DRYA 5D62A 4FVVA 3CA5A 1P63A 3ZC8A 4D8HA 4CJMA 4LO3A 3V0AB 2IWTB 4X3AA 5D63A 4I4VA 1QQLA 4Z8SB 1MC9A 3UD7A 4G9NA 2VXTI 31BIA 3WO2A 1MD6A 3N7KA 3T8SA 2ZR1B 1JLXA 5BVPI 3HALA 2XOAA 2VLCA 4JKQA 4AN7B 3O5WB 1Q04A 3UD8A 3FJ8A 1Q03A 2MIBA 1JTCA 3FJJA 4KC3A 3VSZA 5G00A 4I6IA 4H04A 3CRIA 1IHKA 3AKFA 3ZXGA 3IM7A 3AH4A 1HWMB 4JP0A 3A23A 3Q7WA 4J2KA 4YOLA 1T9FA 5DZUA 3I29B 1BASA 3HOMA 4G6MA 4I3NA 4EFPA 3IM6A 1DQOA 2F2FA 4F83A 3BA4A 9ILBA 5F8WA 4GAIA 4I4XA 2KI4A 4ZLBB 1L2HA 1M2TB 1JY0A 3B9UA 2VXRA 3H6SE 4I1BA 4P6AA 1S0GA 3N7LA 3IIRA 3S8KA 2LIQA 4KEIA 3VEQA 2ERMA 3WMUA 4EFQA 4EFRA 4LO0A 5EG6C 4OWLA 1NZKA 1GGPB 1T4QA 1WBAA 1PUUB 4DEPA 2J3PA 4LO8B 5BXRA 4I0YA 4ZKTB 3UJ0A 3V0AA 4Z9WB 5FNWA 1ISVA 3QR5A 2RQ9A 4KEJA 5E24E 2F2FC 3UJ4A 3WMVA 1YTOA 1IRPA 21BIA 1TOOA 3PG0A 1K5VA 3AZWA 3RTJB 1S0DA 5BXSA 3P53A 3O4CA 3AH2A 2DREA 3WA1A 1JT5A 2HWAA 3VWCA 3ILAA 3OJ2A 1AVXB 4QC4A 4L4IA 1ISYA 4USOA 4OW4A 1TWEA 3BAUA 3LTQA 2Q3NB 1A8DA 3BTAA 2D7RA 2Z49A 3MPPG 1VCLA 4OEEA 2BEBA 4I4OA 4KEKA 2NVHA 1IT0A 4LO7B 2VSEA 5BXPA 4XKIA 1AF9A 2Y9FA 2KI6B 2P23A 1HIBA 4EEEB 2FO1A 4ZFYB 8I1BA 2D43A 4A7ZA 1KNMA 4I37A 4USPA 5BOWA 2NYYA 1FWVA 3AKIA 1S0BA
chains in the Genus database with same CATH superfamily
1AVUA 3AJ5A 3RSJA 3FJDA 1TP0A 3EF2A 3F1RA 1AFCA 5BP5C 2M49A 1TTUA 1D0HA 2GZBA 4I4YA 4II0A 2MLLB 3BRDA 1FWUA 1ONKB 1JQZA 4IZXA 4I4UA 2X2SA 2IHOA 3NJ5A 1F31A 1Z4SA 2D24A 4ZOTA 4GP3A 4ZBVB 3BB2A 4A7KA 1G9DA 3HN1A 4I2SA 3BRGC 3CAHA 4ISRA 1DIWA 3AZVA 5GAQA 4Q9GA 4JQ0A 3A22A 3CA3A 3AH1A 4EKXB 4QBCA 1PUMB 2FFUA 1QXMA 3V0BA 2WRYA 2VU9A 2D20A 5FZUA 5BQUC 1YYNA 1EPWA 3CQAA 4D0TA 3ZX7A 1YXWA 1HWPB 2DS0A 1V6UA 4I7IA 2NZ9A 3O4OA 1BLAA 3O3QA 3OJMA 4I4PA 1YBIA 1CE7B 3FFZA 3VUOA 2Z48A 2Q9XA 3BADA 3BX1C 1RMLA 5F8YA 3VT0A 1IILA 2YUGA 3OJVA 4HA2A 3P6JA 3ZXDA 2FDBM 1Q1UA 4QALA 2BFHA 2Y9WC 3WO4A 1DFQA 1PC8B 2R9KB 1HWNB 5F8SA 4PC4A 1BFCA 2NTDA 1ABRB 3C9ZA 3R4UA 1EVTA 4JRAA 5FNXA 2ZQNA 2WBCA 1YF8B 4GP0A 2K8RA 3JUTA 1V6WA 1RG8A 4G1RA 2AQZA 6I1BA 3OGFA 3UD9A 3HSMA 1FN0A 3NBEA 4QKSA 4ZA3B 3FUQA 3NBNA 1WD4A 3AJ6A 1AVAC 2ZQOA 3ZC9A 1SZ6B 1ISZA 3AKGA 5BP5A 1XZZA 1JT4A 4OUJA 3OBRA 4R6UB 4QO3A 1XYFA 1FQ9A 4J2XA 4Q91A 1JT7A 1FMMS 3O49A 2RG9B 1FGAA 1WBCA 3FUOA 4I8MA 4JAWA 4P0LA 1EYLA 2FGFA 4HR6C 2HW9A 3O4BA 4J2SA 3FJBA 1S0EA 4I4RA 1XHBA 2K43A 2HWMA 2DRZA 1CVSA 3JRRA 5DVHA 3PUBA 1I1EA 2D44A 4G6JA 4LO7C 5B2HA 4WBCA 3FGMA 4IONA 2ESUA 3CA0A 1S0FA 3BAOA 5BQUA 3FJHA 4ZGRB 1FV2A 3VT1A 2QYIB 4G9MA 3HMYA 3IAGC 1BLDA 2UUSA 1S0CA 1G82A 3BRFA 1PWAA 1II4A 3FJIA 4QKRA 3WINC 1I1BA 4J2YA 4ISQA 1W3FA 1XG6A 3H6QA 4P0JA 1DLLA 4XFTA 3O4AA 3W9TA 1M16A 5JMCA 3N0KA 3A07A 4H75A 3TC2A 1BARA 1FMZA 41BIA 2E4MC 4X37A 2BEAA 1EV2A 1HCDA 1R8OA 2RSTA 3BAGA 1DFCA 3H6RB 2K4AB 4H9WA 1Z2VA 1R8NA 5FZYA 2D7IA 1PZZA 3D7WB 2NP0A 2NS2A 5D61A 3FJ9A 4LO1C 4TLPA 1TIEA 5I1BA 4IQPA 4FGFA 3VT2A 1S0LA 2I1BA 1IJTA 4EB2B 1ITBA 4XFUA 1E0OA 3RTIB 3SNVA 4JPZA 3CRGA 4QD2C 3WO3A 2X2TA 1BFFA 1DQGA 2AFGA 4XFSA 5JLVA 2P39A 2HZ9A 4ZFUB 4QD2B 3R4SA 3KMVA 3CA6A 2D22A 1IRAX 3BA7A 1BA7A 1G9BA 1SR4C 3NBDA 2KLLA 2KH2A 1HKNA 1ISWA 3CA4A 4IZEA 3FJAA 1IOBA 3HBWA 3BAHA 2F8XC 1AXMA 4ZFWB 3S8JA 5EHAA 3UDAA 3VSFA 3K1XA 4OEGA 1BFGA 3PMEA 1RZOB 2ET2A 4GOVA 2VSAA 1K5UA 2KKIA 1Z0HA 2D23A 4OWKA 3RMXA 3RMYA 3CRHA 1JLYA 2D1ZA 4MZGB 1W3GA 4D0ZA 4IY8A 4QBVA 1DZDA 4DENA 4LO3C 4X38A 1BFBA 5EC5A 3WINA 3O44A 1TFMB 2L5XA 4ENDA 3V79C 3CU1B 3BAVA 1V6VA 4GAFA 2E4MA 3N7JA 3H6RA 4L4HA 3FJCA 1G9AA 3CA1A 3OBTA 1JT3A 3O4DA 4AN6A 3BAQA 3I2AA 3OGGA 4LO2A 2VUAA 4I96A 5BXTA 3QYDA 2MC2A 4OWJA 4LO1A 3AKHA 4P0KA 4IHZA 5DSSB 5FZZA 2GO2A 1V6XA 4X39A 1G9CA 2QN4A 3V0BB 1QQKA 2AXMA 1N4KA 3Q7YA 1FV3A 4MZHA 4F34A 3POKA 4GOYA 4IYBA 1J0SA 1HWOB 3MALA 3I2XA 4I4QA 1TWMA 4OEFA 1DJSB 3F62B 4A7YA 3FJKA 3Q7XA 3LLPA 3FJEA 4JKXB 1SR4A 3IM5A 1W3AA 1UPSA 2NM1A 4KBBA 4Q9PA 1ISXA 2Y9XE 2Y9GA 2AAIB 4IY9A 1DZCA 4LO0C 4J23B 1OQLB 5HPZA 5DUYA 3A21A 3N7MA 4I4SA 2LIEA 3E8LC 7I1BA 3FJFA 3NBCA 1WD3A 4LO2C 1RY7A 3BA5A 4HJJA 4DCKC 2FFVA 1HCEA 1NUNA 3PHZA 4I1EA 5F90A 3P6IA 1AVWB 1ILR1 2DRYA 5D62A 4FVVA 3CA5A 1P63A 3ZC8A 4D8HA 4CJMA 4LO3A 3V0AB 2IWTB 4X3AA 5D63A 4I4VA 1QQLA 4Z8SB 1MC9A 3UD7A 4G9NA 2VXTI 31BIA 3WO2A 1MD6A 3N7KA 3T8SA 2ZR1B 1JLXA 5BVPI 3HALA 2XOAA 2VLCA 4JKQA 4AN7B 3O5WB 1Q04A 3UD8A 3FJ8A 1Q03A 2MIBA 1JTCA 3FJJA 4KC3A 3VSZA 5G00A 4I6IA 4H04A 3CRIA 1IHKA 3AKFA 3ZXGA 3IM7A 3AH4A 1HWMB 4JP0A 3A23A 3Q7WA 4J2KA 4YOLA 1T9FA 5DZUA 3I29B 1BASA 3HOMA 4G6MA 4I3NA 4EFPA 3IM6A 1DQOA 2F2FA 4F83A 3BA4A 9ILBA 5F8WA 4GAIA 4I4XA 2KI4A 4ZLBB 1L2HA 1M2TB 1JY0A 3B9UA 2VXRA 3H6SE 4I1BA 4P6AA 1S0GA 3N7LA 3IIRA 3S8KA 2LIQA 4KEIA 3VEQA 2ERMA 3WMUA 4EFQA 4EFRA 4LO0A 5EG6C 4OWLA 1NZKA 1GGPB 1T4QA 1WBAA 1PUUB 4DEPA 2J3PA 4LO8B 5BXRA 4I0YA 4ZKTB 3UJ0A 3V0AA 4Z9WB 5FNWA 1ISVA 3QR5A 2RQ9A 4KEJA 5E24E 2F2FC 3UJ4A 3WMVA 1YTOA 1IRPA 21BIA 1TOOA 3PG0A 1K5VA 3AZWA 3RTJB 1S0DA 5BXSA 3P53A 3O4CA 3AH2A 2DREA 3WA1A 1JT5A 2HWAA 3VWCA 3ILAA 3OJ2A 1AVXB 4QC4A 4L4IA 1ISYA 4USOA 4UY4A 4OW4A 1TWEA 3BAUA 3LTQA 2Q3NB 1A8DA 3BTAA 2D7RA 2Z49A 3MPPG 1VCLA 4OEEA 2BEBA 4I4OA 4KEKA 2NVHA 4MZFB 1IT0A 4LO7B 2VSEA 5BXPA 4XKIA 1AF9A 2Y9FA 2KI6B 2P23A 1HIBA 4EEEB 2FO1A 4ZFYB 8I1BA 2D43A 4A7ZA 1KNMA 4I37A 4USPA 5BOWA 2NYYA 1FWVA 3AKIA 1S0BA
chains in the Genus database with same CATH topology
1AVUA 3AJ5A 3RSJA 3FJDA 1TP0A 3EF2A 3F1RA 1AFCA 5BP5C 2M49A 1TTUA 1D0HA 2GZBA 4I4YA 4II0A 2MLLB 3BRDA 1FWUA 1ONKB 1JQZA 4IZXA 4I4UA 2X2SA 2IHOA 3NJ5A 1F31A 1Z4SA 2D24A 4ZOTA 4GP3A 4ZBVB 3BB2A 4A7KA 1G9DA 3HN1A 4I2SA 3BRGC 3CAHA 4ISRA 1DIWA 3AZVA 5GAQA 4Q9GA 4JQ0A 3A22A 3CA3A 3AH1A 4EKXB 4QBCA 1PUMB 2FFUA 1QXMA 3V0BA 2WRYA 2VU9A 2D20A 5FZUA 5BQUC 1YYNA 1EPWA 3CQAA 4D0TA 3ZX7A 1YXWA 1HWPB 2DS0A 1V6UA 4I7IA 2NZ9A 3O4OA 1BLAA 3O3QA 3OJMA 4I4PA 1YBIA 1CE7B 3FFZA 3VUOA 2Z48A 2Q9XA 3BADA 3BX1C 1RMLA 5F8YA 3VT0A 1IILA 2YUGA 3OJVA 4HA2A 3P6JA 3ZXDA 2FDBM 1Q1UA 4QALA 2BFHA 2Y9WC 3WO4A 1DFQA 1PC8B 2R9KB 1HWNB 5F8SA 4PC4A 1BFCA 2NTDA 1ABRB 3C9ZA 3R4UA 1EVTA 4JRAA 5FNXA 2ZQNA 2WBCA 1YF8B 4GP0A 2K8RA 3JUTA 1V6WA 1RG8A 4G1RA 2AQZA 6I1BA 3OGFA 3UD9A 3HSMA 1FN0A 3NBEA 4QKSA 4ZA3B 3FUQA 3NBNA 1WD4A 3AJ6A 1AVAC 2ZQOA 3ZC9A 1SZ6B 1ISZA 3AKGA 5BP5A 1XZZA 1JT4A 4OUJA 3OBRA 4R6UB 4QO3A 1XYFA 1FQ9A 4J2XA 4Q91A 1JT7A 1FMMS 3O49A 2RG9B 1FGAA 1WBCA 3FUOA 4I8MA 4JAWA 4P0LA 1EYLA 2FGFA 4HR6C 2HW9A 3O4BA 4J2SA 3FJBA 1S0EA 4I4RA 1XHBA 2K43A 2HWMA 2DRZA 1CVSA 3JRRA 5DVHA 3PUBA 1I1EA 2D44A 4G6JA 4LO7C 5B2HA 4WBCA 3FGMA 4IONA 2ESUA 3CA0A 1S0FA 3BAOA 5BQUA 3FJHA 4ZGRB 1FV2A 3VT1A 2QYIB 4G9MA 3HMYA 3IAGC 1BLDA 2UUSA 1S0CA 1G82A 3BRFA 1PWAA 1II4A 3FJIA 4QKRA 3WINC 1I1BA 4J2YA 4ISQA 1W3FA 1XG6A 3H6QA 4P0JA 1DLLA 4XFTA 3O4AA 3W9TA 1M16A 5JMCA 3N0KA 3A07A 4H75A 3TC2A 1BARA 1FMZA 41BIA 2E4MC 4X37A 2BEAA 1EV2A 1HCDA 1R8OA 2RSTA 3BAGA 1DFCA 3H6RB 2K4AB 4H9WA 1Z2VA 1R8NA 5FZYA 2D7IA 1PZZA 3D7WB 2NP0A 2NS2A 5D61A 3FJ9A 4LO1C 4TLPA 1TIEA 5I1BA 4IQPA 4FGFA 3VT2A 1S0LA 2I1BA 1IJTA 4EB2B 1ITBA 4XFUA 1E0OA 3RTIB 3SNVA 4JPZA 3CRGA 4QD2C 3WO3A 2X2TA 1BFFA 1DQGA 2AFGA 4XFSA 5JLVA 2P39A 2HZ9A 4ZFUB 4QD2B 3R4SA 3KMVA 3CA6A 2D22A 1IRAX 3BA7A 1BA7A 1G9BA 1SR4C 3NBDA 2KLLA 2KH2A 1HKNA 1ISWA 3CA4A 4IZEA 3FJAA 1IOBA 3HBWA 3BAHA 2F8XC 1AXMA 4ZFWB 3S8JA 5EHAA 3UDAA 3VSFA 3K1XA 4OEGA 1BFGA 3PMEA 1RZOB 2ET2A 4GOVA 2VSAA 1K5UA 2KKIA 1Z0HA 2D23A 4OWKA 3RMXA 3RMYA 3CRHA 1JLYA 2D1ZA 4MZGB 1W3GA 4D0ZA 4IY8A 4QBVA 1DZDA 4DENA 4LO3C 4X38A 1BFBA 5EC5A 3WINA 3O44A 1TFMB 2L5XA 4ENDA 3V79C 3CU1B 3BAVA 1V6VA 4GAFA 2E4MA 3N7JA 3H6RA 4L4HA 3FJCA 1G9AA 3CA1A 3OBTA 1JT3A 3O4DA 4AN6A 3BAQA 3I2AA 3OGGA 4LO2A 2VUAA 4I96A 5BXTA 3QYDA 2MC2A 4OWJA 4LO1A 3AKHA 4P0KA 4IHZA 5DSSB 5FZZA 2GO2A 1V6XA 4X39A 1G9CA 2QN4A 3V0BB 1QQKA 2AXMA 1N4KA 3Q7YA 1FV3A 4MZHA 4F34A 3POKA 4GOYA 4IYBA 1J0SA 1HWOB 3MALA 3I2XA 4I4QA 1TWMA 4OEFA 1DJSB 3F62B 4A7YA 3FJKA 3Q7XA 3LLPA 3FJEA 4JKXB 1SR4A 3IM5A 1W3AA 1UPSA 2NM1A 4KBBA 4Q9PA 1ISXA 2Y9XE 2Y9GA 2AAIB 4IY9A 1DZCA 4LO0C 4J23B 1OQLB 5HPZA 5DUYA 3A21A 3N7MA 4I4SA 2LIEA 3E8LC 7I1BA 3FJFA 3NBCA 1WD3A 4LO2C 1RY7A 3BA5A 4HJJA 4DCKC 2FFVA 1HCEA 1NUNA 3PHZA 4I1EA 5F90A 3P6IA 1AVWB 1ILR1 2DRYA 5D62A 4FVVA 3CA5A 1P63A 3ZC8A 4D8HA 4CJMA 4LO3A 3V0AB 2IWTB 4X3AA 5D63A 4I4VA 1QQLA 4Z8SB 1MC9A 3UD7A 4G9NA 2VXTI 31BIA 3WO2A 1MD6A 3N7KA 3T8SA 2ZR1B 1JLXA 5BVPI 3HALA 2XOAA 2VLCA 4JKQA 4AN7B 3O5WB 1Q04A 3UD8A 3FJ8A 1Q03A 2MIBA 1JTCA 3FJJA 4KC3A 3VSZA 5G00A 4I6IA 4H04A 3CRIA 1IHKA 3AKFA 3ZXGA 3IM7A 3AH4A 1HWMB 4JP0A 3A23A 3Q7WA 4J2KA 4YOLA 1T9FA 5DZUA 3I29B 1BASA 3HOMA 4G6MA 4I3NA 4EFPA 3IM6A 1DQOA 2F2FA 4F83A 3BA4A 9ILBA 5F8WA 4GAIA 4I4XA 2KI4A 4ZLBB 1L2HA 1M2TB 1JY0A 3B9UA 2VXRA 3H6SE 4I1BA 4P6AA 1S0GA 3N7LA 3IIRA 3S8KA 2LIQA 4KEIA 3VEQA 2ERMA 3WMUA 4EFQA 4EFRA 4LO0A 5EG6C 4OWLA 1NZKA 1GGPB 1T4QA 1WBAA 1PUUB 4DEPA 2J3PA 4LO8B 5BXRA 4I0YA 4ZKTB 3UJ0A 3V0AA 4Z9WB 5FNWA 1ISVA 3QR5A 2RQ9A 4KEJA 5E24E 2F2FC 3UJ4A 3WMVA 1YTOA 1IRPA 21BIA 1TOOA 3PG0A 1K5VA 3AZWA 3RTJB 1S0DA 5BXSA 3P53A 3O4CA 3AH2A 2DREA 3WA1A 1JT5A 2HWAA 3VWCA 3ILAA 3OJ2A 1AVXB 4QC4A 4L4IA 1ISYA 4USOA 4UY4A 4OW4A 1TWEA 3BAUA 3LTQA 2Q3NB 1A8DA 3BTAA 2D7RA 2Z49A 3MPPG 1VCLA 4OEEA 2BEBA 4I4OA 4KEKA 2NVHA 4MZFB 1IT0A 4LO7B 2VSEA 5BXPA 4XKIA 1AF9A 2Y9FA 2KI6B 2P23A 1HIBA 4EEEB 2FO1A 4ZFYB 8I1BA 2D43A 4A7ZA 1KNMA 4I37A 4USPA 5BOWA 2NYYA 1FWVA 3AKIA 1S0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVU A;  3AJ5 A;  3RSJ A;  3FJD A;  1TP0 A;  3EF2 A;  3F1R A;  1AFC A;  5BP5 C;  2M49 A;  1TTU A;  1D0H A;  2GZB A;  4I4Y A;  4II0 A;  2MLL B;  3BRD A;  1FWU A;  1ONK B;  1JQZ A;  4IZX A;  4I4U A;  2X2S A;  2IHO A;  3NJ5 A;  1F31 A;  1Z4S A;  2D24 A;  4ZOT A;  4GP3 A;  4ZBV B;  3BB2 A;  4A7K A;  1G9D A;  3HN1 A;  4I2S A;  3BRG C;  3CAH A;  4ISR A;  1DIW A;  3AZV A;  5GAQ A;  4Q9G A;  4JQ0 A;  3A22 A;  3CA3 A;  3AH1 A;  4EKX B;  4QBC A;  1PUM B;  2FFU A;  1QXM A;  3V0B A;  2WRY A;  2VU9 A;  2D20 A;  5FZU A;  5BQU C;  1YYN A;  1EPW A;  3CQA A;  4D0T A;  3ZX7 A;  1YXW A;  1HWP B;  2DS0 A;  1V6U A;  4I7I A;  2NZ9 A;  3O4O A;  1BLA A;  3O3Q A;  3OJM A;  4I4P A;  1YBI A;  1CE7 B;  3FFZ A;  3VUO A;  2Z48 A;  2Q9X A;  3BAD A;  3BX1 C;  1RML A;  5F8Y A;  3VT0 A;  1IIL A;  2YUG A;  3OJV A;  4HA2 A;  3P6J A;  3ZXD A;  2FDB M;  1Q1U A;  4QAL A;  2BFH A;  2Y9W C;  3WO4 A;  1DFQ A;  1PC8 B;  2R9K B;  1HWN B;  5F8S A;  4PC4 A;  1BFC A;  2NTD A;  1ABR B;  3C9Z A;  3R4U A;  1EVT A;  4JRA A;  5FNX A;  2ZQN A;  2WBC A;  1YF8 B;  4GP0 A;  2K8R A;  3JUT A;  1V6W A;  1RG8 A;  4G1R A;  2AQZ A;  6I1B A;  3OGF A;  3UD9 A;  3HSM A;  1FN0 A;  3NBE A;  4QKS A;  4ZA3 B;  3FUQ A;  3NBN A;  1WD4 A;  3AJ6 A;  1AVA C;  2ZQO A;  3ZC9 A;  1SZ6 B;  1ISZ A;  3AKG A;  5BP5 A;  1XZZ A;  1JT4 A;  4OUJ A;  3OBR A;  4R6U B;  4QO3 A;  1XYF A;  1FQ9 A;  4J2X A;  4Q91 A;  1JT7 A;  1FMM S;  3O49 A;  2RG9 B;  1FGA A;  1WBC A;  3FUO A;  4I8M A;  4JAW A;  4P0L A;  1EYL A;  2FGF A;  4HR6 C;  2HW9 A;  3O4B A;  4J2S A;  3FJB A;  1S0E A;  4I4R A;  1XHB A;  2K43 A;  2HWM A;  2DRZ A;  1CVS A;  3JRR A;  5DVH A;  3PUB A;  1I1E A;  2D44 A;  4G6J A;  4LO7 C;  5B2H A;  4WBC A;  3FGM A;  4ION A;  2ESU A;  3CA0 A;  1S0F A;  3BAO A;  5BQU A;  3FJH A;  4ZGR B;  1FV2 A;  3VT1 A;  2QYI B;  4G9M A;  3HMY A;  3IAG C;  1BLD A;  2UUS A;  1S0C A;  1G82 A;  3BRF A;  1PWA A;  1II4 A;  3FJI A;  4QKR A;  3WIN C;  1I1B A;  4J2Y A;  4ISQ A;  1W3F A;  1XG6 A;  3H6Q A;  4P0J A;  1DLL A;  4XFT A;  3O4A A;  3W9T A;  1M16 A;  5JMC A;  3N0K A;  3A07 A;  3TC2 A;  1BAR A;  1FMZ A;  41BI A;  2E4M C;  4X37 A;  2BEA A;  1EV2 A;  1HCD A;  1R8O A;  2RST A;  3BAG A;  1DFC A;  3H6R B;  2K4A B;  4H9W A;  1Z2V A;  1R8N A;  5FZY A;  2D7I A;  1PZZ A;  3D7W B;  2NP0 A;  5D61 A;  3FJ9 A;  4LO1 C;  4TLP A;  1TIE A;  5I1B A;  4IQP A;  4FGF A;  3VT2 A;  1S0L A;  2I1B A;  1IJT A;  4EB2 B;  1ITB A;  4XFU A;  1E0O A;  3RTI B;  3SNV A;  4JPZ A;  3CRG A;  4QD2 C;  3WO3 A;  2X2T A;  1BFF A;  1DQG A;  2AFG A;  4XFS A;  5JLV A;  2P39 A;  2HZ9 A;  4ZFU B;  4QD2 B;  3R4S A;  3KMV A;  3CA6 A;  2D22 A;  1IRA X;  3BA7 A;  1BA7 A;  1G9B A;  1SR4 C;  3NBD A;  2KLL A;  2KH2 A;  1HKN A;  1ISW A;  3CA4 A;  4IZE A;  3FJA A;  1IOB A;  3HBW A;  3BAH A;  2F8X C;  1AXM A;  4ZFW B;  3S8J A;  5EHA A;  3UDA A;  3VSF A;  3K1X A;  4OEG A;  1BFG A;  3PME A;  1RZO B;  2ET2 A;  4GOV A;  2VSA A;  1K5U A;  2KKI A;  1Z0H A;  2D23 A;  4OWK A;  3RMX A;  3RMY A;  3CRH A;  1JLY A;  2D1Z A;  1W3G A;  4D0Z A;  4IY8 A;  4QBV A;  1DZD A;  4DEN A;  4LO3 C;  4X38 A;  1BFB A;  5EC5 A;  3WIN A;  3O44 A;  1TFM B;  2L5X A;  4END A;  3V79 C;  3CU1 B;  3BAV A;  1V6V A;  4GAF A;  2E4M A;  3N7J A;  3H6R A;  4L4H A;  3FJC A;  1G9A A;  3CA1 A;  3OBT A;  1JT3 A;  3O4D A;  4AN6 A;  3BAQ A;  3I2A A;  3OGG A;  4LO2 A;  2VUA A;  4I96 A;  5BXT A;  3QYD A;  2MC2 A;  4OWJ A;  4LO1 A;  3AKH A;  4P0K A;  4IHZ A;  5DSS B;  5FZZ A;  2GO2 A;  1V6X A;  4X39 A;  1G9C A;  2QN4 A;  3V0B B;  1QQK A;  2AXM A;  1N4K A;  3Q7Y A;  1FV3 A;  4F34 A;  3POK A;  4GOY A;  4IYB A;  1J0S A;  1HWO B;  3MAL A;  3I2X A;  4I4Q A;  1TWM A;  4OEF A;  1DJS B;  3F62 B;  4A7Y A;  3FJK A;  3Q7X A;  3LLP A;  3FJE A;  4JKX B;  1SR4 A;  3IM5 A;  1W3A A;  1UPS A;  2NM1 A;  4KBB A;  4Q9P A;  1ISX A;  2Y9X E;  2Y9G A;  2AAI B;  4IY9 A;  1DZC A;  4LO0 C;  4J23 B;  1OQL B;  5HPZ A;  5DUY A;  3A21 A;  3N7M A;  4I4S A;  2LIE A;  3E8L C;  7I1B A;  3FJF A;  3NBC A;  1WD3 A;  4LO2 C;  1RY7 A;  3BA5 A;  4HJJ A;  4DCK C;  2FFV A;  1HCE A;  1NUN A;  3PHZ A;  4I1E A;  5F90 A;  3P6I A;  1AVW B;  1ILR 1;  2DRY A;  5D62 A;  4FVV A;  3CA5 A;  1P63 A;  3ZC8 A;  4D8H A;  4CJM A;  4LO3 A;  3V0A B;  2IWT B;  4X3A A;  5D63 A;  4I4V A;  1QQL A;  4Z8S B;  1MC9 A;  3UD7 A;  4G9N A;  2VXT I;  31BI A;  3WO2 A;  1MD6 A;  3N7K A;  3T8S A;  2ZR1 B;  1JLX A;  5BVP I;  3HAL A;  2XOA A;  2VLC A;  4JKQ A;  4AN7 B;  3O5W B;  1Q04 A;  3UD8 A;  3FJ8 A;  1Q03 A;  2MIB A;  1JTC A;  3FJJ A;  4KC3 A;  3VSZ A;  5G00 A;  4I6I A;  4H04 A;  3CRI A;  1IHK A;  3AKF A;  3ZXG A;  3IM7 A;  3AH4 A;  1HWM B;  4JP0 A;  3A23 A;  3Q7W A;  4J2K A;  4YOL A;  1T9F A;  5DZU A;  3I29 B;  1BAS A;  3HOM A;  4G6M A;  4I3N A;  4EFP A;  3IM6 A;  1DQO A;  2F2F A;  4F83 A;  3BA4 A;  9ILB A;  5F8W A;  4GAI A;  4I4X A;  2KI4 A;  4ZLB B;  1L2H A;  1M2T B;  1JY0 A;  3B9U A;  2VXR A;  3H6S E;  4I1B A;  4P6A A;  1S0G A;  3N7L A;  3IIR A;  3S8K A;  2LIQ A;  4KEI A;  3VEQ A;  2ERM A;  3WMU A;  4EFQ A;  4EFR A;  4LO0 A;  5EG6 C;  4OWL A;  1NZK A;  1GGP B;  1T4Q A;  1WBA A;  1PUU B;  4DEP A;  2J3P A;  4LO8 B;  5BXR A;  4I0Y A;  4ZKT B;  3UJ0 A;  3V0A A;  4Z9W B;  5FNW A;  1ISV A;  3QR5 A;  2RQ9 A;  4KEJ A;  5E24 E;  2F2F C;  3UJ4 A;  3WMV A;  1YTO A;  1IRP A;  21BI A;  1TOO A;  3PG0 A;  1K5V A;  3AZW A;  3RTJ B;  1S0D A;  5BXS A;  3P53 A;  3O4C A;  3AH2 A;  2DRE A;  3WA1 A;  1JT5 A;  2HWA A;  3VWC A;  3ILA A;  3OJ2 A;  1AVX B;  4QC4 A;  4L4I A;  1ISY A;  4USO A;  4OW4 A;  1TWE A;  3BAU A;  3LTQ A;  2Q3N B;  1A8D A;  3BTA A;  2D7R A;  2Z49 A;  3MPP G;  1VCL A;  4OEE A;  2BEB A;  4I4O A;  4KEK A;  2NVH A;  1IT0 A;  4LO7 B;  2VSE A;  5BXP A;  4XKI A;  1AF9 A;  2Y9F A;  2KI6 B;  2P23 A;  1HIB A;  4EEE B;  2FO1 A;  4ZFY B;  8I1B A;  2D43 A;  4A7Z A;  1KNM A;  4I37 A;  4USP A;  5BOW A;  2NYY A;  1FWV A;  3AKI A;  1S0B A; 
#chains in the Genus database with same CATH topology
 1AVU A;  3AJ5 A;  3RSJ A;  3FJD A;  1TP0 A;  3EF2 A;  3F1R A;  1AFC A;  5BP5 C;  2M49 A;  1TTU A;  1D0H A;  2GZB A;  4I4Y A;  4II0 A;  2MLL B;  3BRD A;  1FWU A;  1ONK B;  1JQZ A;  4IZX A;  4I4U A;  2X2S A;  2IHO A;  3NJ5 A;  1F31 A;  1Z4S A;  2D24 A;  4ZOT A;  4GP3 A;  4ZBV B;  3BB2 A;  4A7K A;  1G9D A;  3HN1 A;  4I2S A;  3BRG C;  3CAH A;  4ISR A;  1DIW A;  3AZV A;  5GAQ A;  4Q9G A;  4JQ0 A;  3A22 A;  3CA3 A;  3AH1 A;  4EKX B;  4QBC A;  1PUM B;  2FFU A;  1QXM A;  3V0B A;  2WRY A;  2VU9 A;  2D20 A;  5FZU A;  5BQU C;  1YYN A;  1EPW A;  3CQA A;  4D0T A;  3ZX7 A;  1YXW A;  1HWP B;  2DS0 A;  1V6U A;  4I7I A;  2NZ9 A;  3O4O A;  1BLA A;  3O3Q A;  3OJM A;  4I4P A;  1YBI A;  1CE7 B;  3FFZ A;  3VUO A;  2Z48 A;  2Q9X A;  3BAD A;  3BX1 C;  1RML A;  5F8Y A;  3VT0 A;  1IIL A;  2YUG A;  3OJV A;  4HA2 A;  3P6J A;  3ZXD A;  2FDB M;  1Q1U A;  4QAL A;  2BFH A;  2Y9W C;  3WO4 A;  1DFQ A;  1PC8 B;  2R9K B;  1HWN B;  5F8S A;  4PC4 A;  1BFC A;  2NTD A;  1ABR B;  3C9Z A;  3R4U A;  1EVT A;  4JRA A;  5FNX A;  2ZQN A;  2WBC A;  1YF8 B;  4GP0 A;  2K8R A;  3JUT A;  1V6W A;  1RG8 A;  4G1R A;  2AQZ A;  6I1B A;  3OGF A;  3UD9 A;  3HSM A;  1FN0 A;  3NBE A;  4QKS A;  4ZA3 B;  3FUQ A;  3NBN A;  1WD4 A;  3AJ6 A;  1AVA C;  2ZQO A;  3ZC9 A;  1SZ6 B;  1ISZ A;  3AKG A;  5BP5 A;  1XZZ A;  1JT4 A;  4OUJ A;  3OBR A;  4R6U B;  4QO3 A;  1XYF A;  1FQ9 A;  4J2X A;  4Q91 A;  1JT7 A;  1FMM S;  3O49 A;  2RG9 B;  1FGA A;  1WBC A;  3FUO A;  4I8M A;  4JAW A;  4P0L A;  1EYL A;  2FGF A;  4HR6 C;  2HW9 A;  3O4B A;  4J2S A;  3FJB A;  1S0E A;  4I4R A;  1XHB A;  2K43 A;  2HWM A;  2DRZ A;  1CVS A;  3JRR A;  5DVH A;  3PUB A;  1I1E A;  2D44 A;  4G6J A;  4LO7 C;  5B2H A;  4WBC A;  3FGM A;  4ION A;  2ESU A;  3CA0 A;  1S0F A;  3BAO A;  5BQU A;  3FJH A;  4ZGR B;  1FV2 A;  3VT1 A;  2QYI B;  4G9M A;  3HMY A;  3IAG C;  1BLD A;  2UUS A;  1S0C A;  1G82 A;  3BRF A;  1PWA A;  1II4 A;  3FJI A;  4QKR A;  3WIN C;  1I1B A;  4J2Y A;  4ISQ A;  1W3F A;  1XG6 A;  3H6Q A;  4P0J A;  1DLL A;  4XFT A;  3O4A A;  3W9T A;  1M16 A;  5JMC A;  3N0K A;  3A07 A;  4H75 A;  3TC2 A;  1BAR A;  1FMZ A;  41BI A;  2E4M C;  4X37 A;  2BEA A;  1EV2 A;  1HCD A;  1R8O A;  2RST A;  3BAG A;  1DFC A;  3H6R B;  2K4A B;  4H9W A;  1Z2V A;  1R8N A;  5FZY A;  2D7I A;  1PZZ A;  3D7W B;  2NP0 A;  2NS2 A;  5D61 A;  3FJ9 A;  4LO1 C;  4TLP A;  1TIE A;  5I1B A;  4IQP A;  4FGF A;  3VT2 A;  1S0L A;  2I1B A;  1IJT A;  4EB2 B;  1ITB A;  4XFU A;  1E0O A;  3RTI B;  3SNV A;  4JPZ A;  3CRG A;  4QD2 C;  3WO3 A;  2X2T A;  1BFF A;  1DQG A;  2AFG A;  4XFS A;  5JLV A;  2P39 A;  2HZ9 A;  4ZFU B;  4QD2 B;  3R4S A;  3KMV A;  3CA6 A;  2D22 A;  1IRA X;  3BA7 A;  1BA7 A;  1G9B A;  1SR4 C;  3NBD A;  2KLL A;  2KH2 A;  1HKN A;  1ISW A;  3CA4 A;  4IZE A;  3FJA A;  1IOB A;  3HBW A;  3BAH A;  2F8X C;  1AXM A;  4ZFW B;  3S8J A;  5EHA A;  3UDA A;  3VSF A;  3K1X A;  4OEG A;  1BFG A;  3PME A;  1RZO B;  2ET2 A;  4GOV A;  2VSA A;  1K5U A;  2KKI A;  1Z0H A;  2D23 A;  4OWK A;  3RMX A;  3RMY A;  3CRH A;  1JLY A;  2D1Z A;  4MZG B;  1W3G A;  4D0Z A;  4IY8 A;  4QBV A;  1DZD A;  4DEN A;  4LO3 C;  4X38 A;  1BFB A;  5EC5 A;  3WIN A;  3O44 A;  1TFM B;  2L5X A;  4END A;  3V79 C;  3CU1 B;  3BAV A;  1V6V A;  4GAF A;  2E4M A;  3N7J A;  3H6R A;  4L4H A;  3FJC A;  1G9A A;  3CA1 A;  3OBT A;  1JT3 A;  3O4D A;  4AN6 A;  3BAQ A;  3I2A A;  3OGG A;  4LO2 A;  2VUA A;  4I96 A;  5BXT A;  3QYD A;  2MC2 A;  4OWJ A;  4LO1 A;  3AKH A;  4P0K A;  4IHZ A;  5DSS B;  5FZZ A;  2GO2 A;  1V6X A;  4X39 A;  1G9C A;  2QN4 A;  3V0B B;  1QQK A;  2AXM A;  1N4K A;  3Q7Y A;  1FV3 A;  4MZH A;  4F34 A;  3POK A;  4GOY A;  4IYB A;  1J0S A;  1HWO B;  3MAL A;  3I2X A;  4I4Q A;  1TWM A;  4OEF A;  1DJS B;  3F62 B;  4A7Y A;  3FJK A;  3Q7X A;  3LLP A;  3FJE A;  4JKX B;  1SR4 A;  3IM5 A;  1W3A A;  1UPS A;  2NM1 A;  4KBB A;  4Q9P A;  1ISX A;  2Y9X E;  2Y9G A;  2AAI B;  4IY9 A;  1DZC A;  4LO0 C;  4J23 B;  1OQL B;  5HPZ A;  5DUY A;  3A21 A;  3N7M A;  4I4S A;  2LIE A;  3E8L C;  7I1B A;  3FJF A;  3NBC A;  1WD3 A;  4LO2 C;  1RY7 A;  3BA5 A;  4HJJ A;  4DCK C;  2FFV A;  1HCE A;  1NUN A;  3PHZ A;  4I1E A;  5F90 A;  3P6I A;  1AVW B;  1ILR 1;  2DRY A;  5D62 A;  4FVV A;  3CA5 A;  1P63 A;  3ZC8 A;  4D8H A;  4CJM A;  4LO3 A;  3V0A B;  2IWT B;  4X3A A;  5D63 A;  4I4V A;  1QQL A;  4Z8S B;  1MC9 A;  3UD7 A;  4G9N A;  2VXT I;  31BI A;  3WO2 A;  1MD6 A;  3N7K A;  3T8S A;  2ZR1 B;  1JLX A;  5BVP I;  3HAL A;  2XOA A;  2VLC A;  4JKQ A;  4AN7 B;  3O5W B;  1Q04 A;  3UD8 A;  3FJ8 A;  1Q03 A;  2MIB A;  1JTC A;  3FJJ A;  4KC3 A;  3VSZ A;  5G00 A;  4I6I A;  4H04 A;  3CRI A;  1IHK A;  3AKF A;  3ZXG A;  3IM7 A;  3AH4 A;  1HWM B;  4JP0 A;  3A23 A;  3Q7W A;  4J2K A;  4YOL A;  1T9F A;  5DZU A;  3I29 B;  1BAS A;  3HOM A;  4G6M A;  4I3N A;  4EFP A;  3IM6 A;  1DQO A;  2F2F A;  4F83 A;  3BA4 A;  9ILB A;  5F8W A;  4GAI A;  4I4X A;  2KI4 A;  4ZLB B;  1L2H A;  1M2T B;  1JY0 A;  3B9U A;  2VXR A;  3H6S E;  4I1B A;  4P6A A;  1S0G A;  3N7L A;  3IIR A;  3S8K A;  2LIQ A;  4KEI A;  3VEQ A;  2ERM A;  3WMU A;  4EFQ A;  4EFR A;  4LO0 A;  5EG6 C;  4OWL A;  1NZK A;  1GGP B;  1T4Q A;  1WBA A;  1PUU B;  4DEP A;  2J3P A;  4LO8 B;  5BXR A;  4I0Y A;  4ZKT B;  3UJ0 A;  3V0A A;  4Z9W B;  5FNW A;  1ISV A;  3QR5 A;  2RQ9 A;  4KEJ A;  5E24 E;  2F2F C;  3UJ4 A;  3WMV A;  1YTO A;  1IRP A;  21BI A;  1TOO A;  3PG0 A;  1K5V A;  3AZW A;  3RTJ B;  1S0D A;  5BXS A;  3P53 A;  3O4C A;  3AH2 A;  2DRE A;  3WA1 A;  1JT5 A;  2HWA A;  3VWC A;  3ILA A;  3OJ2 A;  1AVX B;  4QC4 A;  4L4I A;  1ISY A;  4USO A;  4UY4 A;  4OW4 A;  1TWE A;  3BAU A;  3LTQ A;  2Q3N B;  1A8D A;  3BTA A;  2D7R A;  2Z49 A;  3MPP G;  1VCL A;  4OEE A;  2BEB A;  4I4O A;  4KEK A;  2NVH A;  4MZF B;  1IT0 A;  4LO7 B;  2VSE A;  5BXP A;  4XKI A;  1AF9 A;  2Y9F A;  2KI6 B;  2P23 A;  1HIB A;  4EEE B;  2FO1 A;  4ZFY B;  8I1B A;  2D43 A;  4A7Z A;  1KNM A;  4I37 A;  4USP A;  5BOW A;  2NYY A;  1FWV A;  3AKI A;  1S0B A; 
#chains in the Genus database with same CATH homology
 1AVU A;  3AJ5 A;  3RSJ A;  3FJD A;  1TP0 A;  3EF2 A;  3F1R A;  1AFC A;  5BP5 C;  2M49 A;  1TTU A;  1D0H A;  2GZB A;  4I4Y A;  4II0 A;  2MLL B;  3BRD A;  1FWU A;  1ONK B;  1JQZ A;  4IZX A;  4I4U A;  2X2S A;  2IHO A;  3NJ5 A;  1F31 A;  1Z4S A;  2D24 A;  4ZOT A;  4GP3 A;  4ZBV B;  3BB2 A;  4A7K A;  1G9D A;  3HN1 A;  4I2S A;  3BRG C;  3CAH A;  4ISR A;  1DIW A;  3AZV A;  5GAQ A;  4Q9G A;  4JQ0 A;  3A22 A;  3CA3 A;  3AH1 A;  4EKX B;  4QBC A;  1PUM B;  2FFU A;  1QXM A;  3V0B A;  2WRY A;  2VU9 A;  2D20 A;  5FZU A;  5BQU C;  1YYN A;  1EPW A;  3CQA A;  4D0T A;  3ZX7 A;  1YXW A;  1HWP B;  2DS0 A;  1V6U A;  4I7I A;  2NZ9 A;  3O4O A;  1BLA A;  3O3Q A;  3OJM A;  4I4P A;  1YBI A;  1CE7 B;  3FFZ A;  3VUO A;  2Z48 A;  2Q9X A;  3BAD A;  3BX1 C;  1RML A;  5F8Y A;  3VT0 A;  1IIL A;  2YUG A;  3OJV A;  4HA2 A;  3P6J A;  3ZXD A;  2FDB M;  1Q1U A;  4QAL A;  2BFH A;  2Y9W C;  3WO4 A;  1DFQ A;  1PC8 B;  2R9K B;  1HWN B;  5F8S A;  4PC4 A;  1BFC A;  2NTD A;  1ABR B;  3C9Z A;  3R4U A;  1EVT A;  4JRA A;  5FNX A;  2ZQN A;  2WBC A;  1YF8 B;  4GP0 A;  2K8R A;  3JUT A;  1V6W A;  1RG8 A;  4G1R A;  2AQZ A;  6I1B A;  3OGF A;  3UD9 A;  3HSM A;  1FN0 A;  3NBE A;  4QKS A;  4ZA3 B;  3FUQ A;  3NBN A;  1WD4 A;  3AJ6 A;  1AVA C;  2ZQO A;  3ZC9 A;  1SZ6 B;  1ISZ A;  3AKG A;  5BP5 A;  1XZZ A;  1JT4 A;  4OUJ A;  3OBR A;  4R6U B;  4QO3 A;  1XYF A;  1FQ9 A;  4J2X A;  4Q91 A;  1JT7 A;  1FMM S;  3O49 A;  2RG9 B;  1FGA A;  1WBC A;  3FUO A;  4I8M A;  4JAW A;  4P0L A;  1EYL A;  2FGF A;  4HR6 C;  2HW9 A;  3O4B A;  4J2S A;  3FJB A;  1S0E A;  4I4R A;  1XHB A;  2K43 A;  2HWM A;  2DRZ A;  1CVS A;  3JRR A;  5DVH A;  3PUB A;  1I1E A;  2D44 A;  4G6J A;  4LO7 C;  5B2H A;  4WBC A;  3FGM A;  4ION A;  2ESU A;  3CA0 A;  1S0F A;  3BAO A;  5BQU A;  3FJH A;  4ZGR B;  1FV2 A;  3VT1 A;  2QYI B;  4G9M A;  3HMY A;  3IAG C;  1BLD A;  2UUS A;  1S0C A;  1G82 A;  3BRF A;  1PWA A;  1II4 A;  3FJI A;  4QKR A;  3WIN C;  1I1B A;  4J2Y A;  4ISQ A;  1W3F A;  1XG6 A;  3H6Q A;  4P0J A;  1DLL A;  4XFT A;  3O4A A;  3W9T A;  1M16 A;  5JMC A;  3N0K A;  3A07 A;  4H75 A;  3TC2 A;  1BAR A;  1FMZ A;  41BI A;  2E4M C;  4X37 A;  2BEA A;  1EV2 A;  1HCD A;  1R8O A;  2RST A;  3BAG A;  1DFC A;  3H6R B;  2K4A B;  4H9W A;  1Z2V A;  1R8N A;  5FZY A;  2D7I A;  1PZZ A;  3D7W B;  2NP0 A;  2NS2 A;  5D61 A;  3FJ9 A;  4LO1 C;  4TLP A;  1TIE A;  5I1B A;  4IQP A;  4FGF A;  3VT2 A;  1S0L A;  2I1B A;  1IJT A;  4EB2 B;  1ITB A;  4XFU A;  1E0O A;  3RTI B;  3SNV A;  4JPZ A;  3CRG A;  4QD2 C;  3WO3 A;  2X2T A;  1BFF A;  1DQG A;  2AFG A;  4XFS A;  5JLV A;  2P39 A;  2HZ9 A;  4ZFU B;  4QD2 B;  3R4S A;  3KMV A;  3CA6 A;  2D22 A;  1IRA X;  3BA7 A;  1BA7 A;  1G9B A;  1SR4 C;  3NBD A;  2KLL A;  2KH2 A;  1HKN A;  1ISW A;  3CA4 A;  4IZE A;  3FJA A;  1IOB A;  3HBW A;  3BAH A;  2F8X C;  1AXM A;  4ZFW B;  3S8J A;  5EHA A;  3UDA A;  3VSF A;  3K1X A;  4OEG A;  1BFG A;  3PME A;  1RZO B;  2ET2 A;  4GOV A;  2VSA A;  1K5U A;  2KKI A;  1Z0H A;  2D23 A;  4OWK A;  3RMX A;  3RMY A;  3CRH A;  1JLY A;  2D1Z A;  4MZG B;  1W3G A;  4D0Z A;  4IY8 A;  4QBV A;  1DZD A;  4DEN A;  4LO3 C;  4X38 A;  1BFB A;  5EC5 A;  3WIN A;  3O44 A;  1TFM B;  2L5X A;  4END A;  3V79 C;  3CU1 B;  3BAV A;  1V6V A;  4GAF A;  2E4M A;  3N7J A;  3H6R A;  4L4H A;  3FJC A;  1G9A A;  3CA1 A;  3OBT A;  1JT3 A;  3O4D A;  4AN6 A;  3BAQ A;  3I2A A;  3OGG A;  4LO2 A;  2VUA A;  4I96 A;  5BXT A;  3QYD A;  2MC2 A;  4OWJ A;  4LO1 A;  3AKH A;  4P0K A;  4IHZ A;  5DSS B;  5FZZ A;  2GO2 A;  1V6X A;  4X39 A;  1G9C A;  2QN4 A;  3V0B B;  1QQK A;  2AXM A;  1N4K A;  3Q7Y A;  1FV3 A;  4MZH A;  4F34 A;  3POK A;  4GOY A;  4IYB A;  1J0S A;  1HWO B;  3MAL A;  3I2X A;  4I4Q A;  1TWM A;  4OEF A;  1DJS B;  3F62 B;  4A7Y A;  3FJK A;  3Q7X A;  3LLP A;  3FJE A;  4JKX B;  1SR4 A;  3IM5 A;  1W3A A;  1UPS A;  2NM1 A;  4KBB A;  4Q9P A;  1ISX A;  2Y9X E;  2Y9G A;  2AAI B;  4IY9 A;  1DZC A;  4LO0 C;  4J23 B;  1OQL B;  5HPZ A;  5DUY A;  3A21 A;  3N7M A;  4I4S A;  2LIE A;  3E8L C;  7I1B A;  3FJF A;  3NBC A;  1WD3 A;  4LO2 C;  1RY7 A;  3BA5 A;  4HJJ A;  4DCK C;  2FFV A;  1HCE A;  1NUN A;  3PHZ A;  4I1E A;  5F90 A;  3P6I A;  1AVW B;  1ILR 1;  2DRY A;  5D62 A;  4FVV A;  3CA5 A;  1P63 A;  3ZC8 A;  4D8H A;  4CJM A;  4LO3 A;  3V0A B;  2IWT B;  4X3A A;  5D63 A;  4I4V A;  1QQL A;  4Z8S B;  1MC9 A;  3UD7 A;  4G9N A;  2VXT I;  31BI A;  3WO2 A;  1MD6 A;  3N7K A;  3T8S A;  2ZR1 B;  1JLX A;  5BVP I;  3HAL A;  2XOA A;  2VLC A;  4JKQ A;  4AN7 B;  3O5W B;  1Q04 A;  3UD8 A;  3FJ8 A;  1Q03 A;  2MIB A;  1JTC A;  3FJJ A;  4KC3 A;  3VSZ A;  5G00 A;  4I6I A;  4H04 A;  3CRI A;  1IHK A;  3AKF A;  3ZXG A;  3IM7 A;  3AH4 A;  1HWM B;  4JP0 A;  3A23 A;  3Q7W A;  4J2K A;  4YOL A;  1T9F A;  5DZU A;  3I29 B;  1BAS A;  3HOM A;  4G6M A;  4I3N A;  4EFP A;  3IM6 A;  1DQO A;  2F2F A;  4F83 A;  3BA4 A;  9ILB A;  5F8W A;  4GAI A;  4I4X A;  2KI4 A;  4ZLB B;  1L2H A;  1M2T B;  1JY0 A;  3B9U A;  2VXR A;  3H6S E;  4I1B A;  4P6A A;  1S0G A;  3N7L A;  3IIR A;  3S8K A;  2LIQ A;  4KEI A;  3VEQ A;  2ERM A;  3WMU A;  4EFQ A;  4EFR A;  4LO0 A;  5EG6 C;  4OWL A;  1NZK A;  1GGP B;  1T4Q A;  1WBA A;  1PUU B;  4DEP A;  2J3P A;  4LO8 B;  5BXR A;  4I0Y A;  4ZKT B;  3UJ0 A;  3V0A A;  4Z9W B;  5FNW A;  1ISV A;  3QR5 A;  2RQ9 A;  4KEJ A;  5E24 E;  2F2F C;  3UJ4 A;  3WMV A;  1YTO A;  1IRP A;  21BI A;  1TOO A;  3PG0 A;  1K5V A;  3AZW A;  3RTJ B;  1S0D A;  5BXS A;  3P53 A;  3O4C A;  3AH2 A;  2DRE A;  3WA1 A;  1JT5 A;  2HWA A;  3VWC A;  3ILA A;  3OJ2 A;  1AVX B;  4QC4 A;  4L4I A;  1ISY A;  4USO A;  4UY4 A;  4OW4 A;  1TWE A;  3BAU A;  3LTQ A;  2Q3N B;  1A8D A;  3BTA A;  2D7R A;  2Z49 A;  3MPP G;  1VCL A;  4OEE A;  2BEB A;  4I4O A;  4KEK A;  2NVH A;  4MZF B;  1IT0 A;  4LO7 B;  2VSE A;  5BXP A;  4XKI A;  1AF9 A;  2Y9F A;  2KI6 B;  2P23 A;  1HIB A;  4EEE B;  2FO1 A;  4ZFY B;  8I1B A;  2D43 A;  4A7Z A;  1KNM A;  4I37 A;  4USP A;  5BOW A;  2NYY A;  1FWV A;  3AKI A;  1S0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...