3FGRA

Two chain form of the 66.3 kda protein at 1.8 angstroem
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
186
structure length
180
Chain Sequence
VSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phospholipase B-like 2 28 kDa form
publication title Initial insight into the function of the lysosomal 66.3 kDa protein from mouse by means of X-ray crystallography
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 63
structure length 180
sequence length 186
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.20 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase; domain 1 3fgrA02
2.10.70.60 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3fgrA01
3FGTA 3FGRA 4BWCA
chains in the Genus database with same CATH superfamily
1GK9A 3KZJA 4AYMA 1LY2A 1E8BA 1H03P 1HFIA 2X2ZA 3GOVA 3T5OA 4K2FA 3NFPI 1OK2A 4WJG2 1OK1A 1OK9A 2EC3A 1OK3A 4BWCA 2LOJA 4E55A 5DN4A 1GKNA 3RJ3D 1OR0A 1VVDA 2Y8TA 1AJNA 2YRAA 1FXHA 1OJWA 2UWNA 1GM7A 4N7EA 2Y8RA 4ZH1D 4HSTA 3ZLDA 3R62A 2WYEA 4JHSA 2XWBF 2EHFA 1GPZA 3ML0A 2CG6A 2KMSA 2KRIA 1FXVA 4AYEA 1HFHA 3ZD1A 4PZ5A 1AJPA 1Z92B 4YFAA 3SRAA 2MCZA 4HSRA 2XQWC 1JVZA 2AE3A 3IX0A 1HCCA 1QGBA 1KECA 1H04P 2O39C 2V8EA 1GKGA 2CG7A 1PNMA 4PELA 2IZ3A 2JGWA 4APLA 1JW0A 3L91A 1QO6A 1PPQA 4B2SA 1AI5A 2RKZA 1SS2A 4YNXA 4A5WB 3FGTA 2WYBA 2CKUA 4LOTA 1K7DA 1RLHA 1SRZA 5JPMG 4B2RA 1TPMA 2ADVA 4WKSA 3SRCA 3SW0X 2XRBA 1G4GA 4PEMA 4C16A 1QUBA 2W80A 2WIIC 4M1JA 1GHQB 1GHDA 2RL0A 3OEDC 4F4OC 4AYDA 1E5GA 1K5SA 2XWJI 4LOSA 4YFBA 2I2LA 3K3WA 1ELVA 3WSXA 2WYDA 5I0QB 1GM8A 2WYCA 1U5MA 2BZMA 2Y8SA 1GK1A 2G7IA 1AI6A 4PO7A 1AI4A 3GXEA 4K2GA 1C1ZA 3IU3I 4K12A 1CKLA 2IZ4A 1AJQA 1PNKA 1AI7A 2A55A 4IGDA 1JX9A 3VWOA 3FGRA 4WKTA 3L94A 1UOTP 3CALA 4CSYA 1CP9A 1MD8A 1E88A 1H2QP 1H2GA 3M7PA 4MUCA 3ZRZA 2RKYA 2QY0A 3NJAA 1Q3XA 2AE4A 4FXGG 3K3TA 3ZLEA 3EJHA 4KKDA 1GM9A 1VVCA 3INBC 1K5QA 4E56A 4DJZA 2RLPA 1H2PP 4WKVA 2YBYA 3F6KA 3KXVA 1FBRA 1MD7A 1KEHA 1FM2A 3WSYA 1OJVA 4AYIA 2MCYA 3CI0J 4WKUA 1GKFA 1O9AA 2RLQA 2ZYCA 1G4FA 5FO8C 1E3AA 2ERJA 4MSLA 3MQLA 3TVJA 1TPNA 2JGXA 1TPGA 5HYPA 4YIZA 5HZPB 5HYUB 3JTQA 1OJYA 2JRAA 3L89M 3O8EB 4E57A 2B5ID 3OXUD 1ZJKA 3S8RA 5DN5A 3OP8A 3JTRA 2XRDA 3ZD2A 4J38B 2AE5A 1PNLA 4YF9A 3SRBA 1NWVA 4ONTD 3ERBA 5HYTB 4BTHA 1GK0A 2W81A
chains in the Genus database with same CATH topology
2X2ZA 3F6KA 3WSXA 2I2LA 3WSYA 2Y8SA 4BWCA 4PO7A 4MSLA 4APLA 2Y8TA 3FGRA 4YIZA 4N7EA 2Y8RA 3FGTA 3ZLDA 3NJAA 3ZLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGT A;  3FGR A;  4BWC A; 
#chains in the Genus database with same CATH topology
 1GK9 A;  3KZJ A;  4AYM A;  1LY2 A;  1E8B A;  1H03 P;  1HFI A;  2X2Z A;  3GOV A;  3T5O A;  4K2F A;  3NFP I;  1OK2 A;  4WJG 2;  1OK1 A;  1OK9 A;  2EC3 A;  1OK3 A;  4BWC A;  2LOJ A;  4E55 A;  5DN4 A;  1GKN A;  3RJ3 D;  1OR0 A;  1VVD A;  2Y8T A;  1AJN A;  2YRA A;  1FXH A;  1OJW A;  2UWN A;  1GM7 A;  4N7E A;  2Y8R A;  4ZH1 D;  4HST A;  3ZLD A;  3R62 A;  2WYE A;  4JHS A;  2XWB F;  2EHF A;  1GPZ A;  3ML0 A;  2CG6 A;  2KMS A;  2KRI A;  1FXV A;  4AYE A;  1HFH A;  3ZD1 A;  4PZ5 A;  1AJP A;  1Z92 B;  4YFA A;  3SRA A;  2MCZ A;  4HSR A;  2XQW C;  1JVZ A;  2AE3 A;  3IX0 A;  1HCC A;  1QGB A;  1KEC A;  1H04 P;  2O39 C;  2V8E A;  1GKG A;  2CG7 A;  1PNM A;  4PEL A;  2IZ3 A;  2JGW A;  4APL A;  1JW0 A;  3L91 A;  1QO6 A;  1PPQ A;  4B2S A;  1AI5 A;  2RKZ A;  1SS2 A;  4YNX A;  4A5W B;  3FGT A;  2WYB A;  2CKU A;  4LOT A;  1K7D A;  1RLH A;  1SRZ A;  5JPM G;  4B2R A;  1TPM A;  2ADV A;  4WKS A;  3SRC A;  3SW0 X;  2XRB A;  1G4G A;  4PEM A;  4C16 A;  1QUB A;  2W80 A;  2WII C;  4M1J A;  1GHQ B;  1GHD A;  2RL0 A;  3OED C;  4F4O C;  4AYD A;  1E5G A;  1K5S A;  2XWJ I;  4LOS A;  4YFB A;  2I2L A;  3K3W A;  1ELV A;  3WSX A;  2WYD A;  5I0Q B;  1GM8 A;  2WYC A;  1U5M A;  2BZM A;  2Y8S A;  1GK1 A;  2G7I A;  1AI6 A;  4PO7 A;  1AI4 A;  3GXE A;  4K2G A;  1C1Z A;  3IU3 I;  4K12 A;  1CKL A;  2IZ4 A;  1AJQ A;  1PNK A;  1AI7 A;  2A55 A;  4IGD A;  1JX9 A;  3VWO A;  3FGR A;  4WKT A;  3L94 A;  1UOT P;  3CAL A;  4CSY A;  1CP9 A;  1MD8 A;  1E88 A;  1H2Q P;  1H2G A;  3M7P A;  4MUC A;  3ZRZ A;  2RKY A;  2QY0 A;  3NJA A;  1Q3X A;  2AE4 A;  4FXG G;  3K3T A;  3ZLE A;  3EJH A;  4KKD A;  1GM9 A;  1VVC A;  3INB C;  1K5Q A;  4E56 A;  4DJZ A;  2RLP A;  1H2P P;  4WKV A;  2YBY A;  3F6K A;  3KXV A;  1FBR A;  1MD7 A;  1KEH A;  1FM2 A;  3WSY A;  1OJV A;  4AYI A;  2MCY A;  3CI0 J;  4WKU A;  1GKF A;  1O9A A;  2RLQ A;  2ZYC A;  1G4F A;  5FO8 C;  1E3A A;  2ERJ A;  4MSL A;  3MQL A;  3TVJ A;  1TPN A;  2JGX A;  1TPG A;  5HYP A;  4YIZ A;  5HZP B;  5HYU B;  3JTQ A;  1OJY A;  2JRA A;  3L89 M;  3O8E B;  4E57 A;  2B5I D;  3OXU D;  1ZJK A;  3S8R A;  5DN5 A;  3OP8 A;  3JTR A;  2XRD A;  3ZD2 A;  4J38 B;  2AE5 A;  1PNL A;  4YF9 A;  3SRB A;  1NWV A;  4ONT D;  3ERB A;  5HYT B;  4BTH A;  1GK0 A;  2W81 A; 
#chains in the Genus database with same CATH homology
 2X2Z A;  3F6K A;  3WSX A;  2I2L A;  3WSY A;  2Y8S A;  4BWC A;  4PO7 A;  4MSL A;  4APL A;  2Y8T A;  3FGR A;  4YIZ A;  4N7E A;  2Y8R A;  3FGT A;  3ZLD A;  3NJA A;  3ZLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...