3FGTA

Two chain form of the 66.3 kda protein from mouse lacking the linker peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
180
structure length
180
Chain Sequence
DPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phospholipase B-like 2 28 kDa form
publication title Initial insight into the function of the lysosomal 66.3 kDa protein from mouse by means of X-ray crystallography
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 63
structure length 180
sequence length 180
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.20 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase; domain 1 3fgtA02
2.10.70.60 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3fgtA01
3FGTA 3FGRA 4BWCA
chains in the Genus database with same CATH superfamily
1GKGA 4WKUA 4YNXA 1PNKA 1JX9A 1QUBA 3T5OA 4F4OC 1FXVA 3L89M 1G4GA 3JTRA 4A5WB 4LOTA 3ZD2A 3ZRZA 2EHFA 1UOTP 2B5ID 2RKZA 2UWNA 3EJHA 3SW0X 1K5QA 2CG7A 4CSYA 3R62A 1GPZA 2WIIC 1GK0A 2ERJA 2Y8RA 4LOSA 4E57A 2IZ4A 2AE5A 3NJAA 5FO8C 5DN5A 4AYIA 3K3WA 1OJYA 4J38B 4JHSA 1JW0A 1SRZA 1FBRA 2EC3A 2MCZA 3FGRA 2YBYA 1PNMA 4PO7A 3IU3I 3SRCA 1GHQB 1HFHA 4FXGG 3SRAA 1G4FA 2RKYA 1CKLA 3L94A 2JRAA 4YFAA 5DN4A 4WKVA 1E8BA 2KRIA 3OXUD 2W80A 2CG6A 2ZYCA 1TPNA 2XRBA 2Y8SA 1C1ZA 2W81A 4HSRA 1OR0A 3WSXA 3ERBA 4B2SA 4KKDA 2IZ3A 4AYMA 1H2GA 3OEDC 4AYEA 1TPMA 3S8RA 3GXEA 2CKUA 5JPMG 1JVZA 4PZ5A 2RL0A 1PNLA 3JTQA 5HYTB 1H2QP 3ZD1A 3ZLDA 2MCYA 3K3TA 2XWBF 3KZJA 4MSLA 3RJ3D 4WKTA 3O8EB 1PPQA 4BWCA 3CALA 1AJQA 2AE3A 4HSTA 4WKSA 1QO6A 2LOJA 2JGXA 4MUCA 1GKNA 4AYDA 2WYDA 1OJWA 1SS2A 2XWJI 2AE4A 4B2RA 1E3AA 1H2PP 1GKFA 1MD8A 1OJVA 1RLHA 4YFBA 1GHDA 4DJZA 1NWVA 1E5GA 4BTHA 3KXVA 2A55A 1K7DA 2JGWA 2XRDA 3CI0J 3SRBA 4N7EA 1HCCA 1LY2A 2XQWC 4IGDA 1KEHA 1GK9A 1AI7A 1AI4A 1H04P 5HYPA 1CP9A 1FXHA 2Y8TA 1FM2A 2I2LA 1VVCA 2YRAA 4PELA 1ELVA 4PEMA 2QY0A 3NFPI 5I0QB 1AI5A 1MD7A 2KMSA 3IX0A 2V8EA 3GOVA 1K5SA 1H03P 1OK2A 4E56A 2WYEA 3ML0A 3TVJA 1OK1A 1QGBA 1AI6A 4E55A 1GK1A 1O9AA 3L91A 3M7PA 1GM8A 1HFIA 1OK3A 3INBC 4C16A 2G7IA 5HZPB 4K2FA 1ZJKA 2O39C 3WSYA 1VVDA 1GM7A 1AJNA 4ZH1D 4YIZA 3MQLA 2RLPA 4ONTD 1GM9A 1E88A 3OP8A 2ADVA 3F6KA 5HYUB 4WJG2 1Q3XA 1Z92B 4K12A 1AJPA 4K2GA 3VWOA 1KECA 3ZLEA 2WYCA 1TPGA 1U5MA 4YF9A 2WYBA 2BZMA 4M1JA 2RLQA 2X2ZA 1OK9A 4APLA 3FGTA
chains in the Genus database with same CATH topology
2Y8SA 3WSXA 4N7EA 3WSYA 3ZLDA 2Y8RA 2Y8TA 4YIZA 2I2LA 3NJAA 4MSLA 3F6KA 4BWCA 3ZLEA 4PO7A 3FGRA 2X2ZA 4APLA 3FGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGT A;  3FGR A;  4BWC A; 
#chains in the Genus database with same CATH topology
 1GKG A;  4WKU A;  4YNX A;  1PNK A;  1JX9 A;  1QUB A;  3T5O A;  4F4O C;  1FXV A;  3L89 M;  1G4G A;  3JTR A;  4A5W B;  4LOT A;  3ZD2 A;  3ZRZ A;  2EHF A;  1UOT P;  2B5I D;  2RKZ A;  2UWN A;  3EJH A;  3SW0 X;  1K5Q A;  2CG7 A;  4CSY A;  3R62 A;  1GPZ A;  2WII C;  1GK0 A;  2ERJ A;  2Y8R A;  4LOS A;  4E57 A;  2IZ4 A;  2AE5 A;  3NJA A;  5FO8 C;  5DN5 A;  4AYI A;  3K3W A;  1OJY A;  4J38 B;  4JHS A;  1JW0 A;  1SRZ A;  1FBR A;  2EC3 A;  2MCZ A;  3FGR A;  2YBY A;  1PNM A;  4PO7 A;  3IU3 I;  3SRC A;  1GHQ B;  1HFH A;  4FXG G;  3SRA A;  1G4F A;  2RKY A;  1CKL A;  3L94 A;  2JRA A;  4YFA A;  5DN4 A;  4WKV A;  1E8B A;  2KRI A;  3OXU D;  2W80 A;  2CG6 A;  2ZYC A;  1TPN A;  2XRB A;  2Y8S A;  1C1Z A;  2W81 A;  4HSR A;  1OR0 A;  3WSX A;  3ERB A;  4B2S A;  4KKD A;  2IZ3 A;  4AYM A;  1H2G A;  3OED C;  4AYE A;  1TPM A;  3S8R A;  3GXE A;  2CKU A;  5JPM G;  1JVZ A;  4PZ5 A;  2RL0 A;  1PNL A;  3JTQ A;  5HYT B;  1H2Q P;  3ZD1 A;  3ZLD A;  2MCY A;  3K3T A;  2XWB F;  3KZJ A;  4MSL A;  3RJ3 D;  4WKT A;  3O8E B;  1PPQ A;  4BWC A;  3CAL A;  1AJQ A;  2AE3 A;  4HST A;  4WKS A;  1QO6 A;  2LOJ A;  2JGX A;  4MUC A;  1GKN A;  4AYD A;  2WYD A;  1OJW A;  1SS2 A;  2XWJ I;  2AE4 A;  4B2R A;  1E3A A;  1H2P P;  1GKF A;  1MD8 A;  1OJV A;  1RLH A;  4YFB A;  1GHD A;  4DJZ A;  1NWV A;  1E5G A;  4BTH A;  3KXV A;  2A55 A;  1K7D A;  2JGW A;  2XRD A;  3CI0 J;  3SRB A;  4N7E A;  1HCC A;  1LY2 A;  2XQW C;  4IGD A;  1KEH A;  1GK9 A;  1AI7 A;  1AI4 A;  1H04 P;  5HYP A;  1CP9 A;  1FXH A;  2Y8T A;  1FM2 A;  2I2L A;  1VVC A;  2YRA A;  4PEL A;  1ELV A;  4PEM A;  2QY0 A;  3NFP I;  5I0Q B;  1AI5 A;  1MD7 A;  2KMS A;  3IX0 A;  2V8E A;  3GOV A;  1K5S A;  1H03 P;  1OK2 A;  4E56 A;  2WYE A;  3ML0 A;  3TVJ A;  1OK1 A;  1QGB A;  1AI6 A;  4E55 A;  1GK1 A;  1O9A A;  3L91 A;  3M7P A;  1GM8 A;  1HFI A;  1OK3 A;  3INB C;  4C16 A;  2G7I A;  5HZP B;  4K2F A;  1ZJK A;  2O39 C;  3WSY A;  1VVD A;  1GM7 A;  1AJN A;  4ZH1 D;  4YIZ A;  3MQL A;  2RLP A;  4ONT D;  1GM9 A;  1E88 A;  3OP8 A;  2ADV A;  3F6K A;  5HYU B;  4WJG 2;  1Q3X A;  1Z92 B;  4K12 A;  1AJP A;  4K2G A;  3VWO A;  1KEC A;  3ZLE A;  2WYC A;  1TPG A;  1U5M A;  4YF9 A;  2WYB A;  2BZM A;  4M1J A;  2RLQ A;  2X2Z A;  1OK9 A;  4APL A;  3FGT A; 
#chains in the Genus database with same CATH homology
 2Y8S A;  3WSX A;  4N7E A;  3WSY A;  3ZLD A;  2Y8R A;  2Y8T A;  4YIZ A;  2I2L A;  3NJA A;  4MSL A;  3F6K A;  4BWC A;  3ZLE A;  4PO7 A;  3FGR A;  2X2Z A;  4APL A;  3FGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...