3FGTA

Two chain form of the 66.3 kda protein from mouse lacking the linker peptide
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
180
structure length
180
Chain Sequence
DPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phospholipase B-like 2 28 kDa form
publication title Initial insight into the function of the lysosomal 66.3 kDa protein from mouse by means of X-ray crystallography
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 63
structure length 180
sequence length 180
ec nomenclature ec 3.1.1.-:
pdb deposition date 2008-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.20 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase; domain 1 3fgtA02
2.10.70.60 Mainly Beta Ribbon Complement Module; domain 1 Complement Module; domain 1 3fgtA01
3FGTA 3FGRA 4BWCA
chains in the Genus database with same CATH superfamily
2KRIA 3ERBA 4ZH1D 3CI0J 1AJNA 2QY0A 2XWBF 2XRDA 1MD8A 1OK2A 2RKYA 1PNKA 4PELA 2I2LA 2IZ4A 1OK1A 2RKZA 3SRBA 1ELVA 2YBYA 1H04P 3KZJA 4WKVA 2V8EA 3INBC 4MUCA 1AI4A 1GK0A 2WYBA 4E56A 1OJYA 3OXUD 4A5WB 3IX0A 1GM9A 4LOTA 1HCCA 1QUBA 4AYIA 1K5QA 2RLPA 4AYDA 5HZPB 2YRAA 1KECA 4M1JA 3ZRZA 3ZLDA 4WKTA 2CG6A 1CKLA 3OP8A 1GPZA 3JTQA 4HSRA 1U5MA 3CALA 3O8EB 4BTHA 4B2SA 2IZ3A 3T5OA 1AI5A 2EC3A 4K2FA 3KXVA 3ML0A 1TPGA 1K5SA 5DN4A 2WIIC 4YF9A 3S8RA 3ZLEA 1H2GA 3L89M 1FXVA 4IGDA 2XWJI 4YNXA 4CSYA 1SS2A 1Z92B 5FO8C 1CP9A 1UOTP 3SRAA 3FGRA 1HFIA 3L91A 1LY2A 1TPNA 3ZD2A 4JHSA 1QO6A 4APLA 4KKDA 1JX9A 2X2ZA 1GKFA 4ONTD 2Y8SA 1FXHA 1H03P 1VVDA 4YIZA 1GHDA 3FGTA 2WYCA 2W81A 2XRBA 3M7PA 4E57A 1AI6A 2EHFA 3IU3I 1AJPA 2AE3A 4AYMA 1PPQA 2XQWC 2KMSA 1OJWA 4WKSA 1H2QP 2ERJA 2Y8RA 2BZMA 4DJZA 1PNLA 1C1ZA 5I0QB 3MQLA 1OK3A 4PEMA 4MSLA 1NWVA 3F6KA 4B2RA 3VWOA 1G4FA 1SRZA 3WSXA 1K7DA 4YFAA 3OEDC 1JVZA 1FM2A 1GHQB 1HFHA 2MCZA 5HYPA 2W80A 3L94A 2B5ID 1OK9A 4PO7A 3WSYA 5HYUB 2JGWA 1AJQA 1GM7A 4YFBA 4E55A 2WYEA 1Q3XA 2WYDA 3NFPI 3JTRA 2O39C 1KEHA 4WKUA 3RJ3D 5JPMG 2RLQA 4J38B 4K2GA 1G4GA 2A55A 1GM8A 1OJVA 1O9AA 2AE4A 1VVCA 1E3AA 1RLHA 4N7EA 1E8BA 3K3WA 2UWNA 3SRCA 3EJHA 4C16A 4AYEA 2MCYA 3TVJA 2Y8TA 4F4OC 5DN5A 1JW0A 4PZ5A 2CKUA 1ZJKA 4WJG2 1PNMA 3SW0X 1GK9A 1GK1A 4LOSA 1OR0A 1E5GA 1GKNA 1GKGA 3R62A 1FBRA 1MD7A 1E88A 1QGBA 2CG7A 2ZYCA 4FXGG 2LOJA 3ZD1A 2G7IA 2JGXA 3NJAA 2AE5A 1AI7A 3GOVA 2JRAA 4K12A 1TPMA 1H2PP 4HSTA 2RL0A 3K3TA 4BWCA 3GXEA 2ADVA 5HYTB
chains in the Genus database with same CATH topology
4N7EA 2Y8RA 2Y8TA 3ZLEA 2I2LA 4MSLA 3F6KA 3WSXA 3FGRA 4PO7A 3WSYA 4APLA 2X2ZA 3NJAA 3ZLDA 2Y8SA 4YIZA 3FGTA 4BWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGT A;  3FGR A;  4BWC A; 
#chains in the Genus database with same CATH topology
 2KRI A;  3ERB A;  4ZH1 D;  3CI0 J;  1AJN A;  2QY0 A;  2XWB F;  2XRD A;  1MD8 A;  1OK2 A;  2RKY A;  1PNK A;  4PEL A;  2I2L A;  2IZ4 A;  1OK1 A;  2RKZ A;  3SRB A;  1ELV A;  2YBY A;  1H04 P;  3KZJ A;  4WKV A;  2V8E A;  3INB C;  4MUC A;  1AI4 A;  1GK0 A;  2WYB A;  4E56 A;  1OJY A;  3OXU D;  4A5W B;  3IX0 A;  1GM9 A;  4LOT A;  1HCC A;  1QUB A;  4AYI A;  1K5Q A;  2RLP A;  4AYD A;  5HZP B;  2YRA A;  1KEC A;  4M1J A;  3ZRZ A;  3ZLD A;  4WKT A;  2CG6 A;  1CKL A;  3OP8 A;  1GPZ A;  3JTQ A;  4HSR A;  1U5M A;  3CAL A;  3O8E B;  4BTH A;  4B2S A;  2IZ3 A;  3T5O A;  1AI5 A;  2EC3 A;  4K2F A;  3KXV A;  3ML0 A;  1TPG A;  1K5S A;  5DN4 A;  2WII C;  4YF9 A;  3S8R A;  3ZLE A;  1H2G A;  3L89 M;  1FXV A;  4IGD A;  2XWJ I;  4YNX A;  4CSY A;  1SS2 A;  1Z92 B;  5FO8 C;  1CP9 A;  1UOT P;  3SRA A;  3FGR A;  1HFI A;  3L91 A;  1LY2 A;  1TPN A;  3ZD2 A;  4JHS A;  1QO6 A;  4APL A;  4KKD A;  1JX9 A;  2X2Z A;  1GKF A;  4ONT D;  2Y8S A;  1FXH A;  1H03 P;  1VVD A;  4YIZ A;  1GHD A;  3FGT A;  2WYC A;  2W81 A;  2XRB A;  3M7P A;  4E57 A;  1AI6 A;  2EHF A;  3IU3 I;  1AJP A;  2AE3 A;  4AYM A;  1PPQ A;  2XQW C;  2KMS A;  1OJW A;  4WKS A;  1H2Q P;  2ERJ A;  2Y8R A;  2BZM A;  4DJZ A;  1PNL A;  1C1Z A;  5I0Q B;  3MQL A;  1OK3 A;  4PEM A;  4MSL A;  1NWV A;  3F6K A;  4B2R A;  3VWO A;  1G4F A;  1SRZ A;  3WSX A;  1K7D A;  4YFA A;  3OED C;  1JVZ A;  1FM2 A;  1GHQ B;  1HFH A;  2MCZ A;  5HYP A;  2W80 A;  3L94 A;  2B5I D;  1OK9 A;  4PO7 A;  3WSY A;  5HYU B;  2JGW A;  1AJQ A;  1GM7 A;  4YFB A;  4E55 A;  2WYE A;  1Q3X A;  2WYD A;  3NFP I;  3JTR A;  2O39 C;  1KEH A;  4WKU A;  3RJ3 D;  5JPM G;  2RLQ A;  4J38 B;  4K2G A;  1G4G A;  2A55 A;  1GM8 A;  1OJV A;  1O9A A;  2AE4 A;  1VVC A;  1E3A A;  1RLH A;  4N7E A;  1E8B A;  3K3W A;  2UWN A;  3SRC A;  3EJH A;  4C16 A;  4AYE A;  2MCY A;  3TVJ A;  2Y8T A;  4F4O C;  5DN5 A;  1JW0 A;  4PZ5 A;  2CKU A;  1ZJK A;  4WJG 2;  1PNM A;  3SW0 X;  1GK9 A;  1GK1 A;  4LOS A;  1OR0 A;  1E5G A;  1GKN A;  1GKG A;  3R62 A;  1FBR A;  1MD7 A;  1E88 A;  1QGB A;  2CG7 A;  2ZYC A;  4FXG G;  2LOJ A;  3ZD1 A;  2G7I A;  2JGX A;  3NJA A;  2AE5 A;  1AI7 A;  3GOV A;  2JRA A;  4K12 A;  1TPM A;  1H2P P;  4HST A;  2RL0 A;  3K3T A;  4BWC A;  3GXE A;  2ADV A;  5HYT B; 
#chains in the Genus database with same CATH homology
 4N7E A;  2Y8R A;  2Y8T A;  3ZLE A;  2I2L A;  4MSL A;  3F6K A;  3WSX A;  3FGR A;  4PO7 A;  3WSY A;  4APL A;  2X2Z A;  3NJA A;  3ZLD A;  2Y8S A;  4YIZ A;  3FGT A;  4BWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...