3FGVA

Crystal structure of a putative antibiotic biosynthesis monooxygenase (spo2313) from silicibacter pomeroyi dss-3 at 1.30 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
MREVVIVKSTPQRGKFNAFAELVGKLVSETRDFPGCLGAYLMLAPERNEQVVMHIWETPDALEAYLTWRADRGDFLEINEYLEVEQDFKTYQLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein with ferredoxin-like fold
publication title Crystal structure of protein of unknown function with ferredoxin-like fold (YP_167536.1) from SILICIBACTER POMEROYI DSS-3 at 1.30 A resolution
rcsb
source organism Silicibacter pomeroyi dss-3
molecule tags Oxidoreductase
total genus 26
structure length 94
sequence length 94
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fgvA00
1MWYA 3FMBA 5A6PA 1FE4A 1URRA 2AP6A 1X7VA 1YJUA 3IWXA 2RMLA 1Y9OA 2HLUA 2K2PA 2RILA 4NL5A 1P8GA 2BJDA 4Y2KA 3WDOA 1FEEA 4Q2MA 1AFJA 2VV5A 5F0UA 2KT3A 1VQSA 2Q3PA 2K7JA 3HHLD 2XMWA 4YDXA 1S6OA 2OKQA 1FESA 1RJJA 1Y3JA 1FVQA 4FNIA 3MCSA 5B0FA 4DPOA 2BJEA 5T7LA 3KKFA 1IUJA 5B08A 3BR8A 1FD8A 3HHLC 2KKHA 3I9ZA 1JK9B 2HQIA 1N5TA 2W4CA 3MZIA 2ROPA 3IWLA 5B0AA 3CJKB 2OMOA 3HF5A 4EFAC 1AFIA 2OFGX 1OPZA 2K1RB 1GXTA 5B0GA 1CC7A 4OJ1A 1TZ0A 2QIFA 1N5VA 2OFHX 2GV1A 1TUVA 2FB0A 3TRGA 4YEAA 3QGPA 2HFOA 4ZOSA 5B09A 1TL5A 2G9OA 3LGNA 4OJ3A 2PGCA 1Q8LA 2N7YA 5F0WA 3F44A 1Y3KA 3KG1A 4Y2MA 3TOQA 1AW0A 2KT2A 2ZDOA 2ASYA 2IYGA 2ROGA 5B0EA 2XMMA 1Q4RA 2FHMA 2GGPA 5B0BA 5B0CA 4A46A 3K7RA 3TNVA 5K9FA 3HFKA 1OSDA 3HX9A 4DN9A 3HHLA 2HLTA 2JDJA 2HFNA 3UDCA 5B0DA 1GXUA 5A6WA 1CPZA 3BM7A 1OQ6A 1TR0A 4Q2LA 2VH7A 3GZ7A 1QUPA 1KVIA 1LQ9A 2RSQA 4F67A 2K1RA 2LQBA 3DXSX 4OJGA 1WD6A 4A47A 1Q8BA 3E8OA 1SB6A 2N4DA 2XMKA 2RU9A 4A48A 2IFXA 1P6TA 4ZA1A 2OP5A 2KYZA 1YJRA 2GA7A 4FNHA 4NPOA 1APSA 1VQYA 2OAUA 1TL4A 3KNGA 3BDEA 1U7LA 2LDIA 1YRXA 3QMQA 2L3MA 2OD4A 3BGUA 4HI1A 5KAKA 4QOTA 3FRYA 2XMJA 2ACYA 2QLWA 4HI2A 1R6YA 5IXUA 1X8DA 2XMVA 3LGMA 3CJKA 1N5SA 2BUNA 2N4CA 2QLXA 3LO3A 2FIUA 1JWWA 1K0VA 3T9NA 3KG0A 4HL9A 2FTRA 2BBEA 3BN7A 4HH0A 1Y0HA 1V3ZA 2GFFA 2W4DA 1YJTA 3VTIA 4OJHA 1Q53A 2ZDPA 1FE0A 2LXFA 1ULRA 1X0PA 2LQ9A 4OIXA 2IYIA 2AJ1A 1YG0A 4HH1A 4A4JA 3DCAA 1OQ3A 2OD6A 2W4PA 2XMUA 1S6UA 2QYCA 4Y2IA 4DL0C 1SQEA 2EW9A 2GGPB 1KQKA 1FVSA 1SI9A 2XMTA 3BB5A 1XBWA 2CRLA 2GO8A 2HIQA 1MWZA 4U9RA 3HHLB 5T7LB 1CC8A 2AJ0A 1N5QA 3FGVA 2GCFA 3HDSA 1W2IA 2ROEA 1YJVA 2AW0A 1KVJA 2K7KA 3BF4A 2BYCA 2PD1A
chains in the Genus database with same CATH superfamily
2J9DA 3TO8A 4I6AA 4ZK7M 2IVFB 3PACA 3H90A 1X4HA 3W64A 4C0HA 4UTGA 3PW2A 3O2IA 2GIRA 2I0XA 5B0GA 2UXBJ 4F4XA 4M5HA 5LMUF 4C3KA 5JUMA 2HMIB 2KVIA 3QPIA 2YQ3A 2DRBA 5J2MA 3HFKA 2YPYA 3C3LA 5A2QU 3DKDA 4O23A 2V8PA 5GVQA 2XMAA 5GADU 3CPWR 2E9TA 1LXJA 2RQCA 1LWEB 5G0RA 1LW0A 5K20B 5AXNA 1UCNA 5D4PA 3BV8A 5DLFA 3F41A 5L1IA 2FIUA 1RHKB 4I4BA 3DC2A 2BBEA 3DLEB 3S7RA 1VIOA 4RBUA 2M52A 1RGVA 1BQMA 4PWUA 5D15A 3SSSA 3C46A 1FWLA 3NGTA 1C1CB 1HARA 1SPBP 4DL7A 4HTIA 2M7SA 5FDLB 3M1VA 4YMEA 2AJ4A 2QEXS 3NOGA 3QIDA 4ZVRB 1Y4ZB 1N33J 1NKCA 3C6TB 4WKYA 3MAAB 2UXCJ 1L3KA 4ECZA 2IHR1 4M5GA 2GIFA 3MM6B 4NYPA 2FJWA 1VQNS 2HNDA 4CO3A 2CA9A 1Q1KA 4H4KA 2HVEA 1EETA 4N8OA 4CLLA 3MM7A 2O5DA 1RU1A 4DV2F 2OPQB 2YNGB 2F8EX 4YY3F 3C15B 2OEMA 3NGSA 2VFSA 1JXLA 4YR2A 5GAEU 1WWHA 4DHVA 4OLOA 2BUNA 2IJFA 4F4YA 4ANDA 5HQ8A 1YG0A 5HLFB 2HFUA 4OYIA 4C8YA 4J9KA 2VG5A 4ED3A 4ANEA 3GG1A 4CCHA 3M8QA 4J90A 1MN7A 2LCWA 3OHBA 3R7BB 3UDLA 2PE8A 1L3SA 1LV5A 1D0EA 1JIHA 5G4DA 1SVDA 2VPZB 4OI2A 4DPTA 3UN5A 4LFCF 1FNOA 1FXDA 4ZP9A 5HVHA 2FGCA 4PPZA 1ZAXA 4IFYA 2HBRB 4M5KA 4DQPA 4U7UD 4WWSA 3ZNJ1 2OPSA 1FDNA 4FS1A 3BEGB 2DD8S 3HVTB 3M8ZA 3OTCA 2HW3A 3IRXA 3PHEA 3OL9A 3VGSA 1KFDA 1QVGR 5A0YB 3MCNA 1SIZA 1U1LA 2MKSA 4OV6A 1YBTA 4OX9J 2C2ZB 2DY1A 5F3ZA 4J9NA 1W2BR 3RAMA 5BR8F 2JFKA 5KAKA 3IFEA 1TVRB 2MTLA 4DUYJ 4ZHRB 2KH9A 2W01A 5KFEA 4AL5A 4TYBA 3WX8A 1WC0A 4OJHA 5F8GA 3OTOF 2HRYA 2J9CA 1KNZA 2ZBQA 4JI0F 4LF9J 4C4WA 3GYXB 2OPPB 2KJVA 1SC1B 1OJ4A 3FGVA 2MKKA 2B4UA 2F65A 4H4MB 2E5JA 1S1UB 3HULA 3QJJA 3N4WA 3J80Y 4J9SA 3QFWA 4Q8EA 3WDOA 4JI2J 5KOWA 1VQSA 3BGRB 3SXLA 3C14B 4HYKA 1FJGJ 2HZVA 2CQCA 3VAKA 2WAQD 3IR5B 3GIJA 3EM1A 1TUVA 3TRGA 1KQFB 4F02A 3BKUA 3IS9A 1JJHA 2OGUA 2GVDA 4O3QA 2IBOA 4FXDA 3TUZC 1M90T 1GMUA 2Q6BA 2HNYB 2CZ4A 2L41A 5H9FK 4L3KA 4ETXA 4ZVQB 1FRJA 3KHHA 2BANA 1HIYA 4QBUA 2IM2A 4OZ3A 3VAJA 2E44A 2DR5A 1B99A 5C24A 1UP1A 4ES1A 2CDQA 3P45B 2W4DA 4USWA 1ULRA 1PJ5A 1DURA 2GQQA 1QTMA 3MAHA 4RW9A 1SI9A 3AODA 3CCTA 5KG5A 5C5JA 3X3UA 5A6PA 3LOUA 2VJUA 1YJUA 1HHTP 2WONA 1G3OA 5KG7A 4ANCA 1VLYA 4QWAA 2KT3A 4KFBA 2XMWA 3PX6A 4OZLA 3QBCA 3D66A 4DV6J 3TA2A 3TWZA 3NAHA 2BW2A 3BO3A 3M2VB 4KHPF 2AGPA 1RCOB 3EVOA 2YNFB 2M8HA 5B09A 3GFYA 1BUXA 3UO0A 4C2MA 1OQ6A 3CD6S 4UF4A 2DTJA 4WFYA 1JMTA 4CLTA 3P96A 4B3TF 3JSMB 3QJPA 4I69A 4NMXA 1B7YB 1WTBA 5F8LA 2WB1D 1T3NA 1U2FA 2X1AA 5D4OA 2JHEA 4KYZA 3J7A1 3NWRA 2VASA 1ZYQA 5IQ6A 5KTQA 4KO0A 4LR7A 3ZZZA 1GH8A 2ZH4A 3G4SS 2MHNA 1VRTA 3CMQA 3C6UB 3QATA 4EMDA 2NZCA 1URRA 1DRZA 3HVWA 1X7VA 2F5GA 2E7VA 4EI2A 2KI2A 1KHVA 1RI7A 4NLPA 2QA4S 4HDHA 1NRKA 3OSNA 3KLFB 2I2YA 3V5RA 3KKFA 4MYUA 2OMOA 1OPIA 4KTQA 5HJYA 1DTTA 2HEKA 2PGCA 4WFAQ 1H7XA 1UEVA 4CP5A 2CQ4A 5B0CA 4OYPA 2LVWA 3S1TA 4JI5F 4TU7A 2DT9A 1JXEA 4X2BA 4QZVB 4LQ9A 1RP5A 3QT6A 2BOPA 1WC6A 3VZIA 2O67A 1XNQF 5HMXA 3M8SA 3Q8PB 2N4CA 1HI0P 4I64A 6FDRA 3Q8YA 3PG9A 3D0IE 3FZBA 1BLUA 3IG1A 3OUYA 5HK4A 3CJQA 1CS4B 4C98A 3HHLB 1CC8A 4JI6J 4QR2A 3A1YG 2IC3A 1MROB 4X4TA 1FFWB 4IYQA 1Y9OA 2IPOB 2VODA 3VZHA 1Q7LB 3CE8A 3NGRA 1UVLA 3W9HA 1FA0A 5C25B 1JK9B 2LEPA 4TY9A 3TJ9A 4MTPA 5IT4A 3OLAA 4F3OA 1OMSA 1SXLA 1WI8A 4A8XA 2DR9A 4ETZA 2PEHA 3F44A 2CPEA 1NUEA 1NJIT 3G6YA 3AT1B 3R5AA 4OV1A 4DOZA 1TL7A 5CCLA 1RT6B 3K5LA 3E8OA 2XMKA 1RWKB 3HKWA 1LWCA 3DLLQ 2OIHA 2K8GA 4OFZA 3WX4A 2YWWA 2M88A 2XG8A 4LBPA 4JI4J 1K0VA 1KWMA 1HHQA 3I32A 1LKZA 1YJTA 1Q5VA 1PBUA 1U6ZA 3RW7A 4UQGA 1DTQB 2MHEA 2E1CA 4HEA9 3LALA 2ZH1A 1X9SA 2HGMA 3KMSA 5IFMA 3PNIA 3KLIA 1NEEA 2J8AA 3AD9C 2QA4G 2W2MP 1S6QB 2XZDB 1R0AB 2WZ1A 4LRFA 1VQKS 3OBIA 2HVDA 1X9MA 4IOCQ 2V0NA 2VBXA 2QIFA 4OYAA 5ETOA 1RSCA 2XLJA 2YKNA 4GVBB 4ID8A 4C97A 1HD0A 3LANA 3HX9A 3UR0A 2XNQA 5HI7A 2J6UA 4UZCA 1F3VA 1S6PA 1TKTB 3OFGA 4X64F 3Q2TC 2RU9A 3A3PB 1OSCA 3RB3A 4ZP7A 3H5UA 2BJ7A 4QIWD 3BGUA 1RE1B 3TZXA 3MDFA 2GHWA 3TJAA 4TKTA 3N01A 4HH0A 3D6TB 1BQNA 3ELHA 2JEIA 2X1GA 4URSA 3PO5A 2MQMA 1Y7PA 4DR6J 3NCPA 3TA0A 1GTHA 2J0QD 3CCUS 3HSDA 4LF2A 2A3JA 3PJXA 2K2PA 3TVZA 4Q2MA 1C0UB 4AXIA 2OHDA 4AT1B 4LF8F 1YHQS 2IRXA 4DV1J 3WC0A 4ZVFA 1CC7A 2IMOA 3THTA 3MAQA 3CC2S 4P6QA 3QIPB 2N7YA 1ZH5A 3GYNA 4ATNA 3KFWX 1JLAA 4JI1J 4YN3B 2PDAA 1REVB 2IDLA 1RK8A 3MTKA 4C3LA 1Q8BA 3DXBA 4I7FB 3UWTA 1N6QB 4DSJA 1QE1A 2I5JB 2VUGA 2A0FB 2A10A 1FKAF 2BKNA 1KC8T 1VBYA 2WB4A 4RW6A 2UVVA 3L3CA 1ICEB 2JRSA 5AXKA 9RUBA 2EXUA 3DMJB 4FYXB 5CA5A 1S1VA 4TQRA 2C2DA 1ZTTA 1UVNA 4F0MA 2XNRA 4DV3F 2YX7A 2EBGA 3PR5B 4K4TA 4Y65A 5D3GA 2Y1RI 2WSFC 1O8BA 2YXLA 4OZ0A 1H98A 3LP1A 3MM9A 5LJ3Y 4DSFA 4GVLA 4E8UA 3J7YU 2UV8G 4B3RF 1MWQA 4ICLB 1VQPS 4DG1B 2PMHA 2V4JB 5F8HA 1RKIA 2ZEJA 1NSAA 3RRKA 2D7SA 1V5IB 3I5BA 1X5TA 4CM0A 3MGJA 3M8PA 4F7VA 3P49B 5KFOA 2OPRA 3ZFVA 4DLEA 4DCPB 3MMAA 4RLEA 2W9BB 4MKBA 3LTOA 2J7KA 4F26A 1H2TZ 3VAHA 1VI7A 2WK4A 3KK1A 3QRQA 3EPGA 3W7BA 3TZZA 3M05A 3SCKE 1RT3A 1N5QA 3M9NB 4RUCA 1TL1B 5K5MA 1K8AT 5H9FJ 4M5DA 3QYYA 3I5CA 3VVUA 3QLHA 3V4IA 3R3TA 2FUG9 4DN0A 1UAWA 4Z7YA 2ZE2B 4ID5B 2R9LA 5FIIA 4J9MA 5KFZA 3KK2B 2W4CA 2FY8A 4CO0A 4OJ1A 1HWLA 4M95A 2YBVA 1TUWA 1IQZA 1EX8A 3SCIE 4L74A 4Y00A 3VCDA 2QV6A 2B9WA 1XR5A 2P9EA 2BQ3A 3M6VA 5CD4H 1YJRA 4B08A 3I31A 4DX5A 2L9NA 1JLCB 4ELTA 4CWBA 1GX6A 2W8LA 3ZO7A 2JNJA 2AGQA 3K89A 4DR3F 3W5YA 1SQFA 4B9VA 2QFIA 2GFFA 3JSYA 2Y8WA 4TY8A 4QPXA 5A8KB 2LQ9A 1J2VA 2QTWA 3QRRA 4PWDB 3JS9A 3IAS9 4E0DA 2MMYA 4ZJLA 1MWZA 3RBEA 3J7AN 1UVMA 3NMAA 1S1XA 1FRKA 4NOHA 2ZNYA 4KSEB 4KGZB 1VRUA 7AT1B 3PR4A 3I0RA 1HWIA 1NO8A 3R5BA 2B7CB 2RS2A 4NEYA 2DVIA 1PBAA 4XIUA 1RT2A 2UXDF 4ZP6A 2DXEA 3HD1A 1VJWA 1TFYA 2ROGA 3K58A 4K59A 1W7WA 2WBMA 3K5OA 2ZD1A 4USVA 3CMAS 5LSOA 3UVJB 3UCUP 4DV2J 1AT1B 4FKXA 1IKYB 3NP5A 3HMJG 4YUDA 3UN3A 1LK5A 1VDHA 4ZLNA 4MYTA 2IRUA 1H7WA 5AXMA 2HWIA 3H5YA 2RHSB 4RX6A 1IBMF 4K5SA 1IKXA 1VC5A 3BSNA 4UY85 3NBPB 3SCLE 4A8KA 2D1CA 3G82B 2D69A 1K1QA 2E1PA 1R8CA 3DRRB 1JLBA 4IG0A 2JFDA 3KUHA 2YWHA 3GU0A 3PRDA 4I2PB 5KFLA 2VDIA 5DDPC 3DGPA 1PO6A 2VFUA 3CJTA 1RHRB 3TOQA 5K8MA 2ZHAA 1J5OA 2ZOMA 2ZZNA 1FFSB 5LL6d 4RNNA 3IN5A 2BRLA 1WD6A 3HLUA 2FZGB 2M8DB 2FJBB 2BA9A 1TL4A 2VIHA 2ZH8A 5BR8J 4DV7F 1HNVB 3THPA 3CJ8A 5FLXY 2KU7A 4DR2J 1S9GA 3MECB 3OTOJ 4JI0J 3KLHA 3MMCB 1NNDA 2AW0A 2IJNA 2ZVSA 3MUMP 3A8KA 4CH1A 5A8WA 3PW7A 2BEFA 5ETTA 3QAUA 3DOKA 2I9SA 3I9V9 1NB2A 1H73A 3SEOA 1Q86T 2V50A 5DQHA 1FWPA 2VA3A 1PAEX 2ZJPQ 5T14A 4XPEA 3R6LB 4EBCA 5F3TA 2G9OA 3KG1A 3H42A 1U1QA 5B0EA 4O3PA 4LF7J 2DH9A 2GQCA 2MDAA 1EP4B 1WDTA 1CPZA 1DHMA 1UETA 2MGZA 3N5BA 5IT0A 3R2CJ 2HBYB 3C16B 4H4OA 3CIMA 2KHCA 4JI8F 2EK1A 3PFEA 2Z58B 3DRSB 4NPOA 4PAAA 3GB0A 3NNAA 1CQMA 3KWMA 2H4WB 1XMOJ 2HSEB 3T9NA 2YNIB 2ZZTA 2DYAA 1F0XA 2GJFA 1UA1A 1FRXA 2B51A 1QAIA 1F3FA 3GILA 4C0OC 5KFIA 4MAKA 5T7LB 3DI6A 3OT9A 4RO0A 4PG6A 3RGIA 2ALYB 3MPWA 4DZDA 3CJ4A 2APOA 2VOOA 3F56A 3N6MA 4IRKA 3I0SA 4KH1B 4B9NA 3FC9A 2AJQA 2DITA 3D3CJ 2MZSA 4PCQA 2CQ2A 4N5SA 4GKKJ 2YH0A 3PW0A 2DGOA 4DL3A 1GXTA 4IH7A 4CLKA 2QA1A 2FB0A 4IRCA 4ALZA 5CD4A 1WHYA 1S4FA 1U49A 4LSLA 1VMBA 2E5LF 2HQCA 3H40A 1XR6A 2E29A 1OSDA 2MY8A 2YKMB 1C4CA 4JP8A 2B0GA 1PYOB 2FJEB 4HHHA 1QUVA 4GO7X 4B3TJ 1K44A 4DUZF 2EFNA 5ADZA 1JNZB 1VQMS 4H54A 2YWKA 4B3OA 2AX0A 4FS2A 2RQ4A 2UVRA 3RB4A 3U1MA 3HZEA 2KXHA 5J2PB 3OPKA 2OTLS 1S6UA 3HHKA 4WIIA 3DDKA 4JI3F 5L9XA 3DM2B 3M6UA 1S7HA 2XHWA 1TL3B 4WE1B 4DN9A 4FDFA 5J1PA 5DDRC 5SUHA 4WPAA 1FK9B 3JAMU 3NNCA 1FESA 1S9EA 3P5TL 1Z2LA 4DFJA 2Y1LB 3DLGA 2C1EB 4BWJA 2ALZA 3CDUA 3ADAC 4PR6A 4LBHA 3FCWA 1NJXA 4A46A 5K9FA 1P9QC 1U0HB 2H5EA 4LSZB 4O3OA 3JSBA 3DDNA 4RW4B 4EGLA 3RBXA 1QAJA 2B6AB 1UVIA 4C11B 1PG5B 4DX8H 3KNGA 1E6VB 3MEEA 4F4KA 3R6GB 2GNKA 5BJRA 2DB1A 1KEKA 2AQ4A 2HKEA 1XNQJ 1D8YA 2H65B 4D3HA 3GSIA 4OLPA 4RW8B 2DO0A 2F63A 2HURA 2DH8A 1VS3A 3MR5A 3CB4A 3PHTA 1R6VA 1M0SA 4ZVPB 2AX1A 3EZ5A 4ZPCA 1VQ8S 3RRGA 2HLUA 2FC9A 1GEHA 4MK8A 4YDXA 3OR1A 3GIIA 5KOXA 4EWTA 3KDOA 2FHJD 1HBOA 5HP1B 4FF1A 3SFUA 4Z7CA 4A8WA 1QY7A 3PY8A 2WOMB 1JX4A 1RAEB 1RLCL 3AA8A 1QD1A 1AZSB 4OYWA 4YHHF 1HBUA 2QL7B 5L39A 1NCLA 1RBLA 1ZM3A 2G2YA 3DYAA 1HMVA 4M5IA 1I94F 3CCSS 5HMYA 4KB7A 4RBVA 5KT2A 4K50A 4IR9A 3HZGA 1ZZNA 1G4CA 2FLLA 1UWBB 3PW4A 2W9CB 3T5KA 2DRAA 2Y8YA 5EN1A 1P9YA 1QVFR 2XO7A 3D0GE 3FSXA 2ZOFA 4D3GA 1D1UA 1VK8A 4YB1P 2UXBF 1FX4A 3EX7B 5CZVA 2WBRA 2Q66A 1QAXA 3QJLA 2V2KA 3FMBA 4DL6A 3H59A 2VBZA 3CJ3A 3DHXA 3GFHA 3NMRA 4CLSA 4GKJJ 3VGUA 2K3KA 1RTIA 2VG7A 4O4RA 2KL8A 2V2VA 2DO4A 5K14A 5KFTA 3HHLC 1RTJA 3BYPA 1NDCA 1IR2A 1TV6A 1UZDA 2YQ1A 3BO4A 3TX8A 4C8OA 3A8JA 1X4FA 3TNVA 4ZN3A 3MHYA 5B7WA 4KKOA 4PUOA 2ASJA 2H5IB 3SV4A 2CIMA 3D68A 3GIMA 1SC6A 4Q0BA 5CYJA 4ILRA 4I2QA 3H2VE 5DM7Q 2ACYA 5FD1A 4ZPWR 3MEGB 4M5LA 2PI4A 4W4MA 2D3UA 2CPJA 1OY8A 3IR7B 2LYVA 3M8WA 3SQGA 2XYPB 2DHHA 4KGMA 2D3O1 3CTRA 1K0TA 1R0BG 2MPUA 2OMLA 2AV5A 3VHQA 1KRPA 1OIAA 4NL5A 1M1KT 4N7TA 1ACMB 5E3AA 1N36J 2CNNB 1FT8A 5J2MB 4JYAF 3UE2A 1SKUB 1CJUB 4CYUB 5F41A 2BQUA 1JLQA 1WF2A 1RT1A 5MLCV 2OO4A 1U25A 4Y2CA 1LW0B 2DNLA 5THWA 4FZVA 4ZN1A 1RT5A 3SV3A 1WC1A 4G65A 2R4FA 3AY0A 1BQMB 1HI8A 4CTAA 3BDEA 3ZZOA 3W2VB 3ZZPA 1A9NB 3MR3A 4ES2A 2LXUA 4WJBA 4XO0A 2KRBA 2VG6A 1LFPA 2KT5A 1DY3A 4LIRA 2KFZA 3SIPB 3ISND 3M1VB 5L1KA 4OX8A 2UU9J 2OJ3A 2W9AA 1DQ9A 2G1DA 4S0MA 1RB0A 2LLZA 4FN5A 2GW8A 2MZJA 3KHRA 4CNYA 4DUTA 3AAWB 4NA2A 4DV5F 4CZCA 4J9RA 1IUJA 2YWFA 3MM7B 2X7IA 4NCBA 2RRBA 4OX9F 3TZWA 3PJWA 3MEDA 2LMIA 1O0PA 3V81A 4B3RJ 1KP6A 4R5PA 4DUYF 3LAMA 1RYSA 3PCOB 3LPEA 1RDRA 1VCTA 1W25A 4YR0A 4NLRA 2HS3A 2FD2A 4NASA 2FVCA 1NLKL 4LF9F 3BJYA 5J2QB 1F9FA 4DR4J 3ENQA 1U7LA 2EK6A 2UV8A 2OSQA 3S8SA 2AEMA 1RU2A 1WNEA 3BREA 4JI2F 2DPIA 5HVFA 2QO3A 1OQ3A 1FJGF 1HQ2A 3ILIA 4QWBA 2KJWA 3M6XA 4DDFA 3K2YA 3DNCA 4IFYB 1WUUA 4UY8T 3M32B 3M2UA 2IJRA 1N56A 2OPSB 4QQBA 3IRXB 1LW2A 5K8OA 2BJEA 2ZHBA 4KHRA 2HS0A 1C0TA 1NHVA 5HVGA 3UI3A 2MKJA 2GV1A 3OVSA 3FZ2A 5E3PA 5HAOA 1HWJA 1X4AA 2HLTA 4F04B 1RAJA 2BX6A 3MFIA 4QIEA 3NS7B 2MYFA 1BD6A 4FVMA 3FK4A 1NPRA 1OYEA 2BDPA 2D3OR 1WEYA 2YNHB 4QWDA 5KT5A 5ETKA 3OHAA 1RAOA 3SBMA 5KFMA 2F3JA 4WYLA 2CZVC 2JJ4D 1WELA 1V3ZA 2A18A 4DR3J 5C2GA 2IA0A 2ERRA 1RQ0A 4YB7A 2HIQA 4KGKA 2A1BA 3J80U 4TNOA 2OPQA 2R7XA 2VB6A 4NWBA 3IS9B 3G6XA 3HM9A 1SJFA 1KQGB 3T19A 5I3UB 2GVDB 2YKOA 1GK8A 3D1OA 4LRCA 1M5VC 2CVEA 2VICA 4EEYA 2CPZA 2QFJA 1KHWA 2BANB 5KFXA 4UOCA 4NYZA 5ETLA 4CM2A 1NAQA 5DETA 4IFVA 3EGZA 4MIBA 3U1LA 1I5OB 2RS8A 2UVUA 1GNKA 3BSAA 4ECRA 2W24A 2LDYA 3WC2A 4RW9B 1LXNA 2EC2A 4F4ZA 1Y0HA 3HK2A 4IG3A 1UVJA 2IYIA 2DIVA 3CIZA 4KFBB 5E2QA 5JXSA 2GO8A 4EUVA 5A0YA 3CCVS 1U02A 1NM2A 3H7HB 1IBCB 1R7IA 1HQEA 4DBQA 2KM8B 2ASLA 1ZM4A 5KFRA 3D6HB 2FVPA 4BWMA 1VK3A 1T8EA 4KHMA 1F2GA 2LQ5A 2Z4PA 2IM0A 1TL5A 2DIUA 3VAGA 4K7QA 5E3CA 3HFZB 4LUBA 2P9GA 2CNLB 2OPPA 1HFEL 2ZOGA 1V3SA 3NCQA 2FLNA 2WCXA 4H4MA 4ZCMA 2CXEA 1S1UA 5E41A 2HYIB 4I56A 4KO0B 1RCXB 5DJBA 4JI6F 4OHWA 2XB2D 5BYSA 2B9YA 2YKAA 3MM8A 1B0VA 3N79A 4R8UA 4OYZA 2J0XA 1VRTB 4LF6J 1Q79A 2YX1A 1XMQF 2DNQA 1NJWA 1X5PA 2XULA 1X0PA 1NK8A 5KFSA 4PWWA 1H72C 1X9WA 3ILOA 3O8WA 1S1TA 2V68A 1DQ8A 3OL6A 1TU0B 4RUAA 4OZ5A 5JJBA 1FE4A 2LQ8A 4AD6A 4C0BA 1DTTB 2B9EA 1UJ5A 4PYDA 1RJJA 4IKAA 5J1EA 2CQGA 2M5YA 4FYWB 5ETNA 3R5JB 4USUA 2CFXA 4B17A 1C4AA 4RL1A 3D6FB 1VQ5S 2MQ8A 8RUCA 2ZH6A 2AYGA 3EDRB 1WKLA 4WIQA 5ETQA 1LWXA 2DR7A 4ZPTR 4P2SA 1NBEB 5CCMA 5AJ3J 1YRUA 3IG1B 3OUYB 2XGQA 4FF4A 4DX6A 3CSKA 1F6TA 3JYTA 1N8RT 1TKZB 1RT4A 3FUYA 5D0EA 2RVJA 3LUYA 4CO2A 4DV4J 4PEOA 4DCOB 2YNFA 2CQIA 4K0KJ 5EWGA 1RISA 2NCKL 3MMBA 2GVZA 2KZMA 2KDOA 2OUGA 3SI8A 5IV3A 2DEJA 3A4TA 4WBFA 2RKIB 1M5KC 2NREA 3DOLA 3V6KA 1U6FA 3D54A 5B08A 3V4MA 2PA8D 4TU9A 4K4VA 3POTA 1TL7B 2RB7A 1N5VA 1MW7A 2NR0A 4UUWA 3LWMA 1DZ5A 1M5OC 3D67A 1LWCB 4ZCIA 4AL7A 3NGUA 5J2NB 4PRFA 4LSNA 3DN9A 2V2QA 3MR7A 4KPCA 2HGNA 2W2QP 1FDDA 4B02A 1XN9A 4I67A 3KHGA 1YTYA 1A7GE 2QLBB 3MURP 3NRBA 1T9XA 4U7CA 2Z57B 3KK3A 2EKNA 3QMQA 2MXYA 1RWOB 2HFSA 5T41A 3EZUA 1CJTA 4YDDB 1UA0A 3ISZA 3LGHA 3KLIB 1FRMA 2FTRA 2XY6A 4B9MA 2JWNA 5DG8A 1T3OA 4EYHB 4TLQA 1SH3A 4JBCA 3G71S 4DV1F 1NZ8A 2R3VA 1U2CA 3ZZ0A 5GADI 1RBOB 1R89A 3GR0A 5ETRA 2BOAA 1RXOB 2BJDA 4JI1F 2DHSA 3ILLA 3D28A 2YKNB 3SCJE 3GE9A 2EBEA 5KG6A 2R8KA 1RAHB 1GT8A 2RDJA 3FRZA 4PZVA 1F5AA 1C2PA 2FLOA 2H54B 1S6PB 2BVZA 4RNOA 3ITHB 1Q81T 2KRRA 1R3NA 2ZDOA 1CS4A 1N48A 3IC1A 2FHMA 1B3TA 3HHLA 4XTTA 2V4RA 4QPTA 3SMZA 1RWXB 1RAIB 3HI9A 3VF0B 3IR6B 2R7SA 1BQNB 1RABB 5IT9Y 4HTJA 5BXIA 2W7OA 3H98A 5DQGA 3B54A 1CJVB 3PJ9A 4NYOA 3ET6B 2HGLA 2PFFB 5A76A 2ZUAA 3MUTP 4RW7B 2XYGB 4OIXA 2IM3A 3NNHA 1RZMA 2B8QA 2CDRB 3GR1A 4ECXA 2F4VF 3D4JA 1JJ4A 1I3OB 4DS4A 1NKBA 1L3VA 1O51A 2PD1A 1RT6A 4MK9A 2HHQA 3Q8QB 1F2HA 3MFHA 2HNZA 2MEWA 3RUBL 1U6BA 5KG1A 2Y0BB 1S1WA 5RUBA 2DH7A 1BGXT 3CCMS 2K06A 3A3OB 4QYRA 2MKIA 2PN6A 5GMKa 3T1YJ 4DR5F 3UN2A 4LIWA 1SH0A 5D78A 3BM7A 3VALA 5L9NA 3UD4P 1QE1B 3R7SB 1HL6A 2RF2B 3HXMA 4CLFA 1YSJA 3L7OA 3UR3C 2NPIA 1S6QA 1EKRA 3R27A 3I4PA 4ZLLA 1YBAA 1N5SA 2HBZB 2R42A 1LOUA 5EDWA 2VFRA 1Q16B 2NQPA 1RWWB 4GVBA 2MKCA 1TAQA 3EZOA 5D3GB 4Q7AA 2XGPA 2AJ0A 2XC9A 2R7TA 3HDSA 1RTDA 1PGZA 1TKTA 4YB5A 2N3LA 4CH7A 2VV5A 3DOMA 2O1PA 2J76E 3VGTA 1XWLA 2P6TA 1BWVA 3L9ZA 1RAAB 1RLDA 2U1AA 3OD2A 3CJKB 3M8PB 1B64A 1N4LA 3GP9A 2OPRB 3EJMA 2VU5A 1S79A 3CF5Q 1DBDA 1FCAA 2NLWA 2H3EB 3MMAB 1NJZA 5KFHA 1U09A 2CQHA 3QQCD 3DLKA 5KFKA 4ED4A 4X62F 5DDQC 4G1IA 1IQTA 3GJTB 1BWEA 5EX3A 5IWAJ 3CJ5A 2ILYA 4RKUC 4FNHA 5E7OB 1SKWA 3H2UB 1RT3B 1HHSA 2Z2MA 1M5HA 3HPOA 4U8VA 2YX4A 1QSLA 3SQOP 4TQSA 2J9EA 4BLGA 1DAXA 3QLHB 3OXLA 3V4IB 3QIPA 3CGIA 1T0TV 4U9RA 2CRLA 3TANA 2B7BB 1E6YB 3MI7X 3R97A 4USHA 1SL1A 1VJQA 3AA9A 4P52A 2CPHA 2J8SA 2JEFA 4LF4J 1Y5NB 1D8ZA 4I7FA 3OTBA 4F0KA 3MCSA 4Y2AA 4ED8A 2X3DA 3W5ZA 1WG4A 3ZXWA 2RDIA 5KFPA 4JYAJ 2Z0GA 4QCLA 3CCLS 3V2UC 3GCXP 3BR9A 2E5IA 5AT1B 4IOAQ 3CJ2A 1WDDA 5F8JA 2HHHF 2MSTA 2FPHX 2HFNA 4PQUA 4USTA 1ZETA 3D3BJ 1ZAVA 4EO6A 4M1KA 5L1LA 1WG1A 1JB0C 2CPIA 4HT5A 2HFVA 1RTHB 2E1MC 2GA7A 2RQKA 4UOGA 3THVA 2CJKA 1YITS 4OHXA 1CLFA 2AYBA 1S1XB 5JVHQ 2QC3A 3RAQA 2HHTA 3PRBA 1NHKL 2RH3A 4ICLA 2W4PA 3I0RB 2V4JA 5IOLA 7FDRA 3FVYA 4DSIA 1NDPA 4G1PA 4F2SA 1EZZB 2ILZA 1T9UA 2AU0A 3EMTA 4JB8B 2VQFF 1CVJA 2CYYA 3IWXA 4OYMA 3BPDA 3PRVA 3AJ2A 1JQGA 3ONQA 2Q6CA 3GTYX 3QZ7A 4M5MA 5DDOC 3Q22A 1S4EA 4E98A 4DV5J 3FQKA 3IXQA 1IVZA 1JLGA 3CUNA 3EXCX 2NSCA 1SH2A 4Y2MA 4U67Q 4Q8FA 4FXWA 3FKBA 1TFWA 2XY5A 4WCEQ 3GV8B 2HAIA 4DR2F 4F67A 3W66A 3ILJA 4W92B 1IKWA 4A47A 1T03A 3T41A 3JQKA 3IRWP 3WQPA 4J9OA 4ID5A 1IKXB 4U95A 3OFEA 1XR7A 4EO8A 4CQ1A 4OZJA 2L9WA 3KUGA 3OQ2A 4HI2A 3TVKA 1HBMA 2QLXA 3KG0A 3PYDA 4IG0B 5LSLA 1WHWA 1PYTA 1OYDA 4OI6A 5A8RA 2KFYA 1YX2A 2QMXA 2DGVA 3U1NA 2ROEA 1WC4A 3LP2B 3KJVA 1TK5A 2A6OA 2D74B 4LF7F 2VC0A 3IM8A 1J5OB 3W8PA 3BR8A 5D0GA 5HJXA 5M2PA 2ROPA 4ELVA 4PABA 2OI2A 5GAHU 5A8KA 2KVQE 1FO1A 4ZCKA 5HBMA 5M2UA 4PWDA 4ECVA 4B3SF 5B0BA 1S9FA 2QSFA 2HIYA 4AFFA 1XMOF 2LA4A 4RUHA 3G6ES 1UMJA 2FVSA 3LP0B 2K1RA 1MN9A 3IWNC 2W1BA 2DRDA 1ZPVA 3MCMA 1YLXA 5KFBA 4CDIA 2HHPA 2HZCA 1N5YB 3WZ0A 1LEOA 3KLHB 4GO5X 1NDLA 4MJKA 4K4XA 4HLBA 3BN7A 4OI0A 2ZH5A 2VONA 5A8WB 2JEJA 4IH6A 4GKKF 3DOKB 2JH3A 1FHTA 4O4GA 1N0VC 1T9YA 1OY6A 2WSCC 2OH2A 2ACMA 4ECQA 2IVYA 3N5FA 3M8YA 2VBWA 4LFBJ 2NXUA 5CXTA 4KRWA 1BY9A 4J7CA 2MKYA 5D0HA 2MGZB 1SL2A 4X4PA 2QRRA 1Y00A 2B4PA 2HWTA 4H4OB 3NS5A 4DR7F 2QE5A 3I82A 4UZBA 4DS5A 2YWEA 2VPYB 3NBPA 1MMDA 3D5MA 2CJBA 3TEHB 2CJQA 3N9UC 4F36A 3DRRA 5E3RA 4TLRA 2Y1JA 5KT3A 2ZM6F 2G13A 3ZZUA 4KPYA 3PIPQ 3EXYA 1YI2S 3I0SB 2ZDPA 3FBCA 4A8OA 3GJSB 3OVBA 3U02A 1NXIA 4OMFG 4ECTA 3PYFA 4CLYA 1UWAA 4QU7A 3ULHA 4JI7F 2VF3A 2QMUB 4ZVUB 2R2TA 4K4YA 1KD1T 3OL7A 1CJKB 2H4YB 4DPOA 4KC5A 5LT5A 1S48A 4FBUA 2AYMA 1EARA 1M1GA 4DZ6A 2N7CA 5I3QA 2E66A 2BQRA 1B4SA 5KT4A 2AGOA 4OYXA 3TJ8A 4X4UA 5B0DA 1WF0A 2ZHOA 4DQIA 2B43A 5I42B 2ZWPA 1SB6A 2GMLA 4Y6IA 2KYZA 3JQMA 1JJCB 1C1BA 1JKHB 1F9HA 5KFWA 2XMJA 4ZPAA 4OI4A 6FD1A 1HQUA 4NXMJ 1B0PA 3I96A 2V8VA 3G96A 4RU2A 4CO4A 2DGTA 1XMQJ 4DPUA 1S10A 3KJFB 2JVRA 4Y2IA 1KN6A 1T02A 1KQKA 1HA1A 1XBWA 3MR2A 1V6HA 5K8PA 1EP4A 4DJBA 2C3OA 2I6WA 3DLGB 4R0EA 2PI5A 2GJ2A 2I38A 2JVOA 2RNEA 2FZCB 1UJ4A 1WKJA 4BBYA 2CUYA 1NK0A 1B7FA 2P5VA 5CYMA 2ZC3A 4X4OA 4C7QA 3PDNA 4NLYA 5KG2A 1SQGA 2Y3YA 2CQDA 4QWEA 1VC6A 4RWWA 2HQIA 5B0AA 2R2SA 1X4CA 3ENWA 2OFGX 3BQ1A 5F9NA 1HNXJ 3FQLA 2YNIA 2QX0A 2KM8C 3RBDA 3LF0A 1Q8LA 1KKHA 2DGXA 4XDDA 3M2RB 3MEEB 3IBFB 4B9TA 1KONA 2C2KB 3MMJA 1IBLJ 3NL0A 3B78A 4LR8A 1DQAA 4X4QA 1NSKL 2QYGA 2L3MA 4O44A 2QA2A 4GKJF 1U1RA 2DHGA 3R7NB 5U47A 3C8YA 2CQ3A 2PFDA 1IR0A 5E3QA 3DCAA 2MLYA 4P9SA 3ENAA 2WVEA 2AMCB 3LW5C 2CQPA 1HBOB 2EFVA 2ZH7A 2OELA 3QRPA 1MMNA 1YJWS 4PG7A 3TAPA 3HT3A 2EFQA 3LQVA 6AT1B 3VAFA 4XAKA 2M3DA 3QO9A 1HBNA 2IRYA 3I6PA 4DX7A 3M8RA 1SJQA 4DPXA 2CADA 3DGVA 5EWEA 5J2PA 4ZVGA 3DYAB 3UQSA 2JX2A 1HMVB 4DFPA 4KGVB 1GMWA 2HHVA 2XBPA 4WTYA 3JAMY 3DM2A 1TR0A 4KAIA 1QM9A 2UP1A 1LK7A 4WE1A 3CWJA 1TK8A 3BGFA 1N52B 2WTFA 3EYZA 4CLWA 1AYEA 3CNQP 4DI6A 2YPZA 1PAUB 3HKZD 1PJ7A 4WU2A 4QOTA 3FRYA 3BBFA 3RYLA 2HRUA 3IBCB 4OI1A 2EFPA 4ERDA 4LVOP 5DG9A 1N36F 2FJXA 4J5OA 1RTIB 2VG7B 4DF8A 2FQQB 4JUZA 5K14B 3R5CA 1ZTWA 2NYIA 2DCLA 1IWGA 3PM9A 3W60A 2FVQA 1U0HA 2IIHA 1RTJB 1RKJA 2XYHB 4RW4A 1AXQA 1TV6B 2BRKA 4FPIA 3C19A 2B6AA 4C11A 2Y1IA 3TX0A 1GTEA 4WZQA 1FVQA 5HROA 2VHGA 2GS8A 1SV5A 3AOAA 5DQIA 4B9LA 2B9XA 2HHSA 4KKOB 1S49A 4PUOB 4ZCLA 4F4AA 1QTNB 2O66A 3HHDA 1S12A 3F0NA 4O0IA 3HJVA 3VAMA 2MZTA 4Q0BB 2ADBA 1U4BA 2W2NP 4I2QB 1RYRA 3G86A 3P4UB 3V6DA 4EYIB 3GIRA 1VIXA 3SDEA 4Z2XA 4MMOA 4XPCA 2UU9F 1Q8IA 2MZQA 1FWKA 2OAUA 1HPZB 2GIQA 2RJZA 3RBZA 2QT7A 3L95X 4AE5A 3T3FA 4DL4A 3P5BP 3BPSP 5HP1A 3DLJA 3HFVA 1KVKA 2MSSA 5DZ6A 4B3MJ 4EZ9A 2QJ3A 1JLFA 1JLEA 2ABYA 2HZAA 2F4VJ 1KVJA 1HYSB 2VKRA 3D0HE 1JLQB 3GV7B 2D41A 1RT1B 3J81U 3IP0A 4ZJOA 3UD5A 3ZTRA 2NZ4A 1Y3JA 2LP4A 3CCES 2X3GA 3FCHA 3PZPA 5LMNF 2PMZD 1UWBA 1V5VA 2AEJA 3AB4B 1RT5B 2W9CA 4DR4F 3TAMA 1WHXA 2O01C 4N47A 3QT8A 2GMJA 4QYZJ 3O6QA 4KY3A 1IKVA 5E33A 4Q43A 4DR5J 1M1HA 1RHMB 3QWUA 3B4DA 4C48A 3TI0A 5I4MA 1KLMA 2Y9HA 2RUSA 4FKYA 1HNIB 1NKEA 1F1BB 1YDLA 1T9VA 5D4LA 1XK8A 4RNMA 1KQSR 4GRSA 1JWWA 3QFHA 3QT5A 3LPYA 1V9OA 5HN0A 3W61A 3GPAA 1HNZJ 1U8SA 4ED2A 2U2FA 2UUBF 4YQWA 1TKXA 2HBQB 4CT8A 3IGNA 4F4WA 3MEDB 3CD7A 3IBWA 2W7AA 1RHJB 2GMHA 4TU8A 2Z30B 1P8GA 3V81B 3Q2SC 4YS2A 2HAFA 4AUKA 4V19J 1KTVA 2B4OA 2GC8A 2XS2A 4DU8A 4PYAA 2J7WA 1CEZA 2BJ1A 4LR9A 1PC5A 3DLHA 4K4WA 1S97A 2MQLA 3H25A 1JNRB 4ER8A 2M70A 2ASYA 2ZVIA 2OSRA 1J5EJ 3KLGA 3PVXA 1KTQA 1QUPA 3MF5A 2V9WA 4X62J 1IXKA 3H2LA 1IR1A 3FFIA 4ECSA 3CMES 3FCVA 2C2RA 2OD4A 4AXJA 5C42B 4IUFA 2HQDA 3CCRS 1CJUA 4QR0A 4CYUA 4NLDA 3CCJS 4O0NA 1S99A 3M2UB 2ZJRQ 4HACA 2D9PA 2A2DA 3QGGA 5MAOA 3KDNA 3MPYA 5ETPA 1G1XA 1A0OB 1MNEA 1K1SA 1LW2B 1SUQA 1T9TA 3CULA 2Z2LA 1OS5A 3AQPA 2E5HA 1C0TB 3TW0A 1HW8A 1GXLA 3W5XA 1XTZA 2RILA 3FBFA 2WVBA 1AFJA 3UD3P 3VV2B 1AA1B 3LAKA 4N77A 3MPVA 1U1NA 3PYEA 3W2VA 5HQLA 1IBKJ 1G7CB 2KKHA 1NJYA 1IWAA 2DNMA 4ZJQA 3HJFA 3K17A 3NAIA 2ZJQQ 5L1JA 4EU0A 5F9LA 2HHHJ 3T5JA 3FDSA 3KUEA 1S7IA 5H1SV 4NZ7A 3FJ2A 2LKZA 5F8NA 3AFGA 1P1LA 4I68A 1UFLA 2DPJA 3HCXA 1N34J 2CJYB 2HQGA 3KXDA 1IJFB 2BJ8A 1EAYC 2GGPB 2AT1B 4RNFA 1B70B 5D8HB 3KLEA 2DXDA 3QT7A 4ED1A 4K4UA 1SJ1A 3MM5A 3QZ8A 5GAGI 2VQFJ 5J2QA 5BYQA 2Q3PA 4IDKA 4F0HA 2MJNA 2JC1A 3WBZA 4AL6A 2C3YA 1FEHA 4BHQA 4NRUA 1NDKA 4IFVB 3BBBA 4DL2A 3CW2C 3LGNA 2B5JB 2J6TA 3PXGa 1H6KX 5D6GA 2WSEC 4LF6F 1DFDA 3UDCA 1D09B 3GZ7A 3ZZTA 1UW9A 4EBDA 1RWPB 4FF3A 3LWLA 4CIOA 3WIVA 3M32A 5HL7Q 2MY7A 4IG3B 5KFNA 2ASDA 4LREA 3QWPA 1FJ7A 1XC9A 5JVGQ 1BE4A 4UOFA 3OR2A 2V4QA 3AXMA 2XMVA 2EFOA 3EDQB 2IAJA 4PKDB 4ZPVR 4HL9A 1HQEB 2CWKA 1D9DA 4IQXA 4HR2A 2E1RA 4C8KA 3EPIA 4YP3A 3U27A 1VLOA 2AP6A 3W65A 2QLFB 3K8VA 1YQHA 3OFFA 2BE2A 1BHNA 2YNHA 3GFZA 1VC0A 3FBEA 4FYYB 1EJ7L 3MZIA 1Q8KA 3DRYA 4FP9A 1RWUA 5AJ3F 1GMWD 4WU3A 1X31C 1MMLA 1NSQA 3EE3A 4NZ6A 2CJ9A 1T05A 3FEXB 3MM8B 3CDWA 1FKPA 4QR1A 4DV4F 4R8UB 2LEBA 4K0KF 4B3SJ 4ZMMA 1TTHB 3X1LB 5CH7B 2AWZA 2EEYA 1P6TA 3FEZA 5E5NA 2R8JA 5I3UA 1S1TB 4OHYA 5DO2A 3HVAA 4A8MP 1QSYA 1T94A 1HKAA 2POKA 1A6LA 3U7JA 4ZIVA 3K0JA 2DGQA 1YJ7A 3VTIA 3EWGA 5J1EB 4JV0A 3W2WA 4NLTA 1MWYA 2DBBA 5AE3A 1X5SA 1MSWD 1QAYA 1NZAA 1WEZA 4RJVA 4NLXA 2BM1A 1RT7B 5HATA 4DR1J 3N0VA 4P2FA 4P7VA 2GAGC 2RQMA 3UPFA 1D9AA 2DGWA 2G0IA 1ROFA 4EFAC 4QW8A 1L3UA 3EICA 3RB0A 5KT6A 4DR7J 1UEUA 1LWFA 4LMZA 4RPFA 4NCAA 3JYTB 1RT4B 3VQTA 3B6BA 2KXNB 1NK7A 2KYXA 2FJVA 3HVRA 1HWUA 4KBIA 3BGOP 3F73A 3JTPA 3MMBB 2GVZB 4LJMA 2ZH9A 3L7PA 2ZM6J 4GMKA 5AE1A 1YIJS 3GSDA 4P74A 4K4SA 3SSRA 2KHDA 3DOLB 3ZZYA 5C7PA 2EI5A 2JOQA 4X4VA 2BKPA 2V2ZA 1YBUA 1VHIA 4HVZA 3RTVA 5KFJA 3CEDA 2LECA 3ISNC 3POTB 2DR6A 3E01A 1ZM9A 4M5JA 1FTCA 2FYXA 7FD1A 3G6VA 4JI7J 4LSNB 1NU4A 4XK8C 4A8FA 3QGHA 4G1QA 3R2DJ 4OI3A 1U48A 1AROP 2XSJB 3IGVA 2DNYA 1FDAA 3FEYB 4NI2A 3KHLA 2WW8A 2VPWB 2C22A 4UUXA 1Y3KA 4LT6A 1UL3A 2JSXA 3QNWB 2IYGA 3KK3B 3BN4A 1W26A 3PX4A 3GFXA 5EWFA 4C6AA 1FERA 1Y5LB 1CJTB 1UJ6A 1NSPA 4A48A 1VRQC 4LF5J 4DQRA 4ED5A 1IJEB 2C42A 1YRXA 3DDIA 1KS2A 4KIAA 3UNYA 4ELUA 4DEZA 1D3WA 4FVCA 4C8NA 2DNNA 1RBAA 4MFBA 3G8SA 4DQQA 4O3NA 4NCGA 3BS9A 2RT3A 3DRXA 1FE0A 2CG8A 1X4BA 1MU2A 4USJC 3T1HJ 4KV8A 2YVSA 2D3ZA 1OO0B 3HT0A 1N0UA 2N3OA 4WP9A 3T1YF 4DSEA 5F0UA 4LRDA 2NXNA 2EG2A 1FDBA 2FC8A 4C3MA 4Y28C 5BYRA 2H48B 4EK2A 1TKZA 3I9ZA 3CDEA 3PIOQ 4TVAB 2XM3A 2HFOA 5IQQA 1XEZA 3VWSA 4B9UA 2CKWA 2KT2A 5ETSA 4NE9C 3M7VA 2QN6B 2GJIA 3UNGC 2AIRB 4NMLA 2RKIA 2ZBRA 3TZYA 5IT9U 2DHAA 4KH0B 4KJIA 1FRHA 4IO1A 5GMDA 2V8DA 3NOCA 4CLZA 4DF4A 3FNNA 3A8IA 1FF2A 1VQ4S 1X60A 3SZ2A 2MKHA 5IM0B 1YVFA 1R8AA 3D1HA 5CYQA 1LFWA 5J2NA 1Y11A 3M30A 2HNZB 1BQXA 3KLVA 1S1WB 2CNKB 4WFNQ 2B56A 1VQ7S 4NXNJ 1DLOA 2QLJB 4URQU 5IWAF 4LFAJ 4DV0J 5DGBA 3NEKA 1ZAWA 2LEAA 4J9LA 4WK3A 1WF1A 3IAM9 2KN4A 1FI4A 4NA1A 4OZ1A 3K5NA 3P6YC 2MQPA 3RB6A 2VQEJ 4FBTA 1FKOA 1WOSA 3GJQB 2A2CA 4DSLA 5CAAA 1R43A 2NYHA 1VQ6S 3LGMA 1VGYA 1FX2A 1RTDB 2BABA 4LF4F 1U2RA 3JSRA 3ITHA 1ZA1B 1ZS6A 4TN2A 3DOMB 3CC4S 3HSJA 1PC4A 4X84A 2FHKA 4P71A 1UFKA 3A13A 3KOAA 3KJQB 2EC0A 4LRBA 3EGNA 4DQSA 5KFQA 3DU6A 5HSPA 4X65F 5G0RB 3CT9A 1CJVA 3ET6A 2BACA 3DLKB 3T5HA 3RRHA 1Y10A 2HHXA 3HO1A 5I3PA 2FHOB 2P2CB 2OFHX 3AJDA 3M9OB 4RW7A 4WTOB 3T6JA 2WRMA 4RU9A 1HI1A 3ZTQA 2ZBIA 4MIWA 2JDJA 1NK9A 4MKVA 3DRPA 3US5A 5KG3A 3HHEA 3RR7A 1GMVA 2XLIA 4MKAA 2PC6A 4AQYF 2CQBA 3O44A 1YGYA 1S76D 3G8TA 2CQ1A 1WC5A 4Q45A 1SIWB 2M4MA 2E1AA 3ZTOA 3M6WA 1FNXH 2C2EA 3PTWA 5IZHA 2XS7A 2HNDB 5L8RC 2X1FA 4NEZA 1VBZA 1XNRF 1EETB 1T11A 4G6VB 2H51B 2V67A 4HT7A 2J6SA 1R27B 2RF2A 1VQLS 1CULA 2AJ2A 1PILA 1QJHA 3JB9k 4PQUB 1SJ3P 3G9CA 2YKPA 3IM9A 3SFGA 2RHQB 3UDEA 5LMNJ 3RU0A 4P73A 2VDHA 2VG5B 1UPMB 3M8QB 2XEXA 1YKWA 2XQCA 1FRLA 3SSQA 3RJMB 5A2QY 4X66J 2HMIA 1DARA 2DNOA 3PX0A 4DL5A 1N32F 3EGVA 5LM7E 1FJCA 2FLPA 1RWMB 1K47A 3BBCA 5DRKA 3MOZA 3CJKA 2I1RA 4N8NA 2IMWP 1UKUA 4ILLA 2PT0A 4LF1A 1S0NA 5DS7A 5GMEA 2WVFA 2NSBA 2HHWA 4U96A 3JXOA 1LWEA 1WSVA 1VISA 3MPUB 1Q95G 2BYCA 2UUBJ 3DLEA 4FYDA 1JLGB 1NK6A 1U0SA 3O1LA 1TUGB 2CJAA 3MR6A 4CO5A 2IVMA 3J7Z5 4C8MA 1S6OA 4M5NA 3HSGA 2RD5C 5LJ5Y 3HSZA 1C1CA 2W2OP 1IKWB 3ETOA 1T03B 1VR6A 1EHWA 3QGPA 2ZBCA 2RDDA 1RTZA 1IN0A 1FD2A 5FDLA 3BSCA 4P10A 1Q4RA 1U26A 3D7SB 1E6YA 1WOPA 4GC7A 1HBMB 4PG5A 3P3DA 1TKDA 3C6TA 3MAAA 5DGAA 2FHJA 2RRAA 5CHCB 8ATCB 2E9ZA 3MM6A 3Q8RB 2XY7A 5LMUJ 2LDIA 5A8RB 3NCRA 4J9PA 1R6YA 4U7UK 4EZ6A 4LFBF 3KJVB 3UW1A 3BDPA 2YNGA 2Q43A 3C15A 4MK7A 5D0RA 3LA0A 5L46A 1RAGB 3DHWC 1QSSA 4KQZA 4G3IA 3Q24A 3MUVP 2R7OA 3Q8UA 2GAHC 1EIYB 2EWHA 4P2XA 4USMA 2V5HG 4Y2KA 5HLFA 4DCJB 1RTHA 4ZVSB 5HBMB 4NZ0A 4Z37A 2MB0B 2KB2A 4LVNP 1HLWA 1KSPA 5IV4A 1R8HA 4F50A 2K1RB 5C24B 2B8PA 3NG8A 4DPWA 2JLFA 2AHOB 1ZPWX 4O3SA 3WIUA 3H0PA 4LQ3A 2R2RA 4ED0A 4IRDA 3OLBA 1GXUA 4ZVEA 4ZDNA 3QSYB 2CZ9A 2A6MA 4NRTA 2W25A 1S5ZA 1Q82T 2XCPA 3DLBA 2WONB 2RAQA 4HHUA 1H2UX 4L3NA 2YWGA 3HVTA 2RIJA 5F8MA 1URNA 1QDUB 4AYBD 4HI1A 4O4GB 2FDNA 4WZMA 1LNQA 3TVYA 5JMNA 2XWXA 4UW2A 1FTRA 2DNPA 5KFAA 3PYGA 4DL0C 4YY3J 5AE2A 2MQQA 3FBBA 1TVRA 4ZHRA 2R8HA 2AZ1A 3GV5B 3OJSA 3K5PA 3E2EA 1HD1A 3CCWA 4K4ZA 2CWXA 1PJ6A 3KNAA 1ZBTA 4P72A 3GYGA 3A8EA 4RWXA 5KFGA 4ZVHA 2HS4A 3GWCA 3MD1A 2KG1A 4R0JA 3BGRA 2Q79A 4NA3A 3C14A 3K7RA 2IA6A 4NXMF 4LFCJ 1YZ6A 2Z2ZA 2M9KA 1WSRA 3AB2B 4C8ZA 3LP2A 2R7RA 3RAXA 4A8YA 3I55S 2ATLA 4X4SA 1PSDA 1Q0NA 3HD2A 2QLWA 2HNYA 4I1TA 1H38A 1PCAA 3G87A 4ZS6A 2XTJP 3UCGA 2HWHA 2VBYA 3AQOA 1IM4A 1G6BA 1U1MA 1HNXF 4UQTA 2VPXB 1U47A 2QL5B 3OW2R 3LP0A 1SBRA 2W2PP 4CNZA 4C8LA 2DNZA 3ICLA 2ZH3A 1RA6A 2JZ5A 3R5DA 1I6JA 4FNIA 3I56S 3V6JA 1N5YA 1IBLF 1H74A 2CPXA 1SC3B 1HR0F 3A3NB 1AUSL 4RNHA 1HNWF 1Z1ZA 4P75A 4ZOSA 2AEFA 3D1QA 2SXLA 4ED6A 4PXEA 4MIAA 1C1BB 3M2VA 2IC3B 3CJ0A 1HQUB 2FGOA 2E7WA 5DZ7A 3ZTPA 3HP6A 1XIQA 2HK2A 2AJFE 4F25A 3JSMA 1KFSA 1F5BA 2AYEA 2HFZA 3BO2A 1OWXA 1U1PA 4ZLJA 4CI0B 5CYMB 3Q89A 3BKTA 2UUCF 1FVSA 4Q5VA 5J1NA 4JV5F 3TR5A 4A8QA 4ECWA 1ZZFA 2K7KA 1Y5IB 1I1GA 1NK4A 1T9WA 1WEXA 2MZRA 2WVCA 4FF2A 2PEBA 4QIGA 2H1YA 2NUUG 1UZHA 4CLUA 3C6UA 1L3TA 3D6MB 4OJ3A 2M2BA 4WK1A 1WTFA 3KLFA 4Y3CA 2XCAA 3R1LA 4W90B 2UUTA 2JLEA 4O44B 1R31A 4P2MA 4WFBQ 4YR3A 4KHPJ 3AH6A 3H5SA 4F3MA 3L4BC 4I6YA 2IFXA 4NLOA 3KYLA 4FXVA 1CJKA 4QU6A 4QIFA 3CCQS 1RACB 3R8YA 2LU2A 5H9EK 1VOMA 4NLUA 1JXVA 4ES3A 2GHPA 4DLGA 1JJ2R 1Q5YA 4TYAA 1X4GA 3PKMA 2J0SD 3TA1A 4CRJA 2ADCA 3PKYA 1EQ0A 3QO9B 4WP3A 2RRNA 1YK9A 1HBNB 5GAGU 1Q78A 1ELOA 2C3PA 2VL1A 5I42A 2DGUA 3OTDA 2W8KA 1XJWB 3NWGA 3W1YC 4L76A 4C9DA 4UT4A 1TQLA 1JKHA 2BZ2A 2YKQA 1RHUB 1MROA 4ZLPA 4MT1A 2V9KA 2R7QA 5SZTA 4ZITA 4QIVA 3OVAA 2LFVA 3AD8C 1CBKA 5C25A 4HDGA 3VAIA 2G1HA 3OJUA 4WFXA 4B3MF 2NS1B 4DMZA 1U1OA 3NLCA 3GLJA 2R8GA 3BZQA 2L9DA 2FZKB 2AZ3A 5GAEI 2BXJA 4JI5J 3NKYA 2DKOB 3KJNB 2NXEA 2HVIA 3ZC4A 2KXFA 2K3IA 3M9MB 4BDPA 1JLAB 4J91A 5HROB 5KFVA 1U24A 1SV5B 3M2RA 2G0CA 4K2JA 2VA2A 1I51B 1VBKA 4OHZA 2GQ2A 2RU3A 1F9EB 5DM6Q 2C28A 2WVDA 3ZNUA 2CPYA 3MD3A 2GX8A 3R9LA 4CT9A 1DTQA 3CDBA 5D4NA 2HRTA 4RUBA 4X4RA 4ZVTB 2UUAF 1SJ4P 2KO1A 3IWLA 2VOPA 2CQ0A 3V6DB 3VGVA 5F8IA 3T5LA 3SDEB 4RW6B 4WF9Q 5AXLA 2Z8QA 1R0AA 2XMMA 1S1VB 3B82A 2BE7D 3GQCA 2EPIA 4I6WA 2FJDB 4PXCA 4Q2LA 2V6AA 2P6SA 1S57A 2QMWA 1N88A 4OJGA 2MLZA 1HNZF 2HQFA 4OL8A 3W9JA 1APSA 1JLFB 1KR4A 1JLEB 3LP1B 3MM9B 1UFWA 2JC0A 2UZAA 3ZTSA 3H4DA 4MKYA 5HO4A 2F9DA 1Q53A 3K59A 3IMQJ 4HH1A 1VQOS 3GJRB 3AD7C 2RE1A 1S0OA 2JEGA 3BF4A 1H3DA 5EHHA 1WOOA 2CG4A 3TAMB 3G2XA 4PPDA 1J5EF 4DFMA 9ATCB 3KTQA 3MCOA 1IKVB 4LBIA 3GIKA 1FD8A 2BR0A 5LSRA 1OPZA 3W9IA 4MH8A 2DNGA 2FY1A 5KG4A 3EVMA 4YEAA 1B0TA 4IH5A 1KLMB 3PEHA 1C0UA 1FNMA 2PMWA 3KK1B 3S01A 1KBRA 3N6LA 3I4HX 4L73A 4K5RA 2DCUB 1NPPA 1CQNA 1ITPA 1ZOTA 4M5DB 4RR5A 2E9RX 3DXSX 2CVIA 3RR8A 2C2OB 4Y34A 1YJ9S 3MXHP 2FJAB 1RWVB 4IO9Q 3CCZA 1RADB 4N76A 5CQGA 4OQJA 1X4DA 2M0GB 5GAHI 3H20A 1REVA 3H5XA 1TKXB 4B9SA 4J37A 1SCJB 1P27B 2BM0A 3BKFA 2YH1A 1X5OA 1IBKF 4X64J 2LU1A 2EW9A 2QSWA 5EX0A 2XZWA 4USKA 1FXRA 1N6QA 4TXSA 3NXZA 1G2EA 2I5JA 5CABA 1OY9A 2F1FA 1BMQB 2XO6A 5LOQA 4RZRA 3DMJA 3MOJB 1HPZA 5KFFA 2J9DE 4I0WA 2GO9A 3KLGB 4X65J 2IY5B 1N33F 2UXCF 3MEKA 2P8IA 1O5JA 3J7ZT 1WI6A 4WP8A 4TY8B 4W98A 1WHVA 3FFIB 4WFZA 3QGIA 5IC4B 3C2PA 1AW0A 2VKZG 2J5AA 1NH8A 2COLA 3J81Y 1N34F 5A6WA 5ETMA 2HK3A 1WG5A 1HYSA 3K5MA 1VRUB 4LF8J 3MTJA 3ETMA 2VFVA 4DG1A 4HACB 2BKOA 1F5CA 2XZTB 2QG9B 3D9BA 1KLNA 5CZXA 4KE5A 4AQYJ 1SUQB 2CNOB 4L6V3 4PXBA 4YB6A 1RT2B 5LXRA 4ZKAA 5M2RA 2WHOA 3TARA 2KZZA 4QWCA 2QYCA 4V1Ak 2W9BA 2OTJS 1YZ7A 1Q7YT 4OYBA 4V19X 4Y0FA 2YQ0A 1XNRJ 2ZD1B 3CVKA 2DISA 2CJXB 5D77A 2C2MB 3N6NA 1M5PC 2J0WA 1FEEA 1MLAA 2YY3A 1HNIA 3IA0A 2DK2A 3H8YA 3CDAA 2CPDA 2EFGA 4WKRA 2G2OA 2BE9B 2ZKTA 1TL1A 4BC9A 1T95A 2MJUA 1VHFA 3FSYA 3NY0A 3AOBA 2R7VA 3TQEA 2MZ1A 4K2XA 4DV3J 2ZE2A 2ZFHA 1XERA 4OX7A 3KK2A 4EBEA 1LQ9A 1CSJA 1DJ0A 2IBKA 2LQBA 1JLBB 3MWBA 3BH7B 1H2VZ 2L08A 4QYZK 5KFDA 3W3SA 4N56A 1SL0A 1N32J 3KLEB 4R25A 1X8DA 4U8YA 1R8PA 3DGPB 3MPDA 3TUPA 1SKRA 1GX5A 2LXFA 3MM5B 1HW9A 4IDKB 4OZNA 2KG0A 1SQEA 2ZC4A 1JLCA 3OL8A 3D2WA 2YTCA 1T7PA 5HQMA 3EUNA 3I5AA 4DU7A 1GAOA 4M63A 2LA6A 4FPRA 3DFEA 2VC1A 1RAFB 4H4KC 4ZIWA 3L09A 2L48A 2ZBPA 5C42A 5IS2A 3BQ0A 2QGFB 1EQMA 3Q83A 3PFOA 2QL9B 3TAQA 4P7TA 1S9GB 2I8EA 2DXFA 4UOHA 2N82B 1NH7A 3OV7A 2CPFA 2NXCA 3TUJC 4ED7A 5FLXU 2RUGA 4DPYA 3OR2B 2IAJB 2VD3A 1KDNA 1Z2ZA 2F9JA 2DY9A 2H9ZA 3CXCR 3JQJA 4LRAA 1UPPA 2AKWB 3A12A 3OTEA 2ZH2A 1S72S 1S59A 3R1HA 3OXGA 2HVHA 3UVJA 3VR1A 2VZ9A 1IKYA 1EB0A 4NLSA 2BE2B 1FXLA 3Q8SB 4DR1F 5KFCA 1XMBA 2B4VA 1YRTA 4PG4A 4XDCA 2IDEA 2P9CA 1K9MT 2DGSA 3W8GA 4O3RA 1X0FA 4DV6F 1GFWB 3HHLD 2ATCB 1P1TA 4QW9A 4ZP8A 3J81j 1T05B 1FKPB 3G82A 1N5TA 2F8HA 5H9EJ 2GHVC 2UUWA 1TZ0A 1AB8A 1U8WA 3B4MA 3K8WA 4Q44A 3AJ1A 2KFNA 2B3TB 3CD0A 3CO9A 2GGPA 4J9UE 3JTOA 3DI6B 1RUSA 4I2PA 2F4FA 3TEGA 1D9FA 5DLGA 4BCAA 2UXDJ 1TK0A 5KG0A 1VQYA 4CO1A 3VQSA 4DWIA 4ZVOB 3W2WB 1ZA2B 2Q1LA 2QZ8A 2E7XA 4J9QA 3HHNB 2GZOA 1X4EA 2JL9A 2W7PA 4E2FB 5C2CA 4J9VA 4KR0B 5HANA 4LSLB 2B5JA 4ITSA 2C3UA 1YJNS 2XMTA 3BGLA 2Y0SD 2DNRA 2GCFA 1HNVA 2O3DA 3H4BA 1R8BA 3EVWA 3VVTA 3GONA 2KTQA 2NUHA 3I87A 3MECA 4M8LA 3L7UA 1LWFB 4B3OB 1IBMJ 3C66A 3QSIA 3MMCA 3PEJA 3B8HA 4HKQA 3PV8A 4OYOA 4LF5F 2ZWOA 1VQ9S 2OLWA 4WYWA 2ZUGA 2AF6A 2EVZA 1U1KA 3M4XA 2H5JB 4USIA 3FSIA 3BSOA 3OSPA 2DJWA 4K8RA 2ZZMA 4OHVA 3T1AA 1R0CB 2CAJA 2OP5A 3TQ1A 3T1HF 1RWNB 1S9EB 4PG8A 1S77D 4ECYA 1TAUA 2PA3A 4OZ2A 1BC6A 4CH0S 2XI2A 2DHXA 3E3XA 3LO3A 4CLPA 3C16A 4DSKA 3E01B 1NPKA 5EUHA 1QLNA 2V63A 3DRSA 1S0VA 5KFYA 2PSZA 2V69A 3CO0P 3KG4A 4G1QB 3P8BB 3BYRA 3WHIA 2D9OA 3EGWB 3RW6A 3G8QA 4DV7J 4NI2B 2RMLA 2EKYA 1NB7A 1KOOA 1SKSA 3PW5A 5K8NA 2G4BA 1KOHA 5T7LA 2G0JA 3BQ2A 4ZPBA 3W63A 1RHQB 1HR0J 3DU5A 2G2ZA 2FVRA 1HNWJ 1U45A 3J7YI 2HVZA 4ILMA 2VH7A 4IR1A 4MFBB 1NHUA 4PXDA 1TP7A 2DR8A 4NCGB 2V8HA 4OX6A 3R5GA 1NK5A 4ZA1A 1MU2B 2V94A 3OR1B 2DEIA 3Q0AA 1RT7A 4JI4F 4KV8B 2YKMA 1J27A 1WJ9A 2HHUA 2F8MA 1ZM2A 3GCWP 2XWYA 3N28A 3AXKA 4ENOA 3AHPA 2MQOA 4NXNF 2UVWA 4A4JA 1N54B 2OD6A 3NGKA 4JI8J 1O6XA 1TMJA 3TYTA 4LFAF 4WXOA 4DV0F 1WACA 2UUCJ 1YWXA 1W2IA 2JLGA 1HBUB 4JV5J 2XSFA 2ZITA 1UVKA 1SC4B 2OKQA 5B0FA 2VQEF 4U6PA 3CC7S 5LXYA 2C2NA 2R7WA 1CG2A 2XLKA 1TL3A 2NXJA 2XI3A 1BXNA 1FK9A 2BV3A 1FFGB 3E51A 3AOCA 5L38A 1MG7A 2C3MA 2NPFA 4L72B 1Z4UA 4NX9A 4N41A 1KVIA 2XS5A 1WKKA 1FJEB 1XQIA 2R2UA 4JOUA 5CYQB 4IQMA 2V8GA 2LQJA 3Q8VA 2E5LJ 3Q86A 4GC6A 3GG0A 1WORA 3M30B 5IXUA 2XSJA 5EGYA 4X4NA 3GMGA 2PO4A 1VFJA 5E0OA 4QJVA 1FRIA 3OFHA 2Z56B 2IM1A 2AJ1A 2XMUA 3JTNA 2DNHA 4DR6F 1TMMA 4HHJA 1E6VA 1DLOB 4DUZJ 4FYVB 2R7UA 3S6EA 4WXWA 3BH6B 1YJVA 5ETVA 4YFUA 5HMWA 5FJ4A 2F40A 3O5TB 5KFUA 3PO4A 3NS6A 4RW8A 4A8SA 3FMWA 3RZAA 1AUDA 4M94A 3K57A 1M5SA 1VBXA 2ZNZA 1H0HB 2EG1A 2BJ3A 3IO1A 1AFIA 4F8RA 4JI3J 1VYAA 2J7UA 4PQAA 1HWKA 3KMQA 1FKOB 3T9ZA 1UW4A 5F0WA 2X1BA 3SQGB 2XHCA 3RG6A 2ZKUA 4NLGA 4RBTA 3V6HA 3CJRA 1EKSA 2PIIA 3W62A 4ZPDA 2BW7A 1NMEB 3O3LA 3UFCX 4F3QA 2WOMA 2WW4A 1UEKA 5IC6B 1AZSA 4NLWA 4KGXB 4BC7A 1V3RA 2X51A 3UCZP 2OEKA 5KT7A 8AT1B 3CD5A 1PKUA 3CJSA 5DG7A 3BB5A 4L75A 1REGX 3T6BA 4JV1A 4BS2A 4IOBA 5HMZA 1IM6A 4F2RA 3QAEA 2HQ3A 1RA7A 3Q23A 5ITHA 2K7JA 4JV2A 1WC3A 4CTAB 2OEJA 1PIEA 4X66F 3HF5A 2UUAJ 4YOEA 2VJVA 3DRPB 1F60B 2VG6B 3ZZRA 5IM0A 2E5GA 3LH2S 4URGA 2BJ9A 2Z2YB 1S0MA 2HG4A 2RSQA 4KT0C 2N4DA 2HPUA 1L5UA 1TELA 2MLXA 3SYZA 2BMBA 2V34A 3TUIC 4NLQA 2F7VA 3OXFA 1PYSB 3ENVA 2AD9A 4NLVA 1UTAA 4YHHJ 1K73T 3NGDA 1SJRA 4R5PB 4ECUA 4DXLA 1CULB 4DFKA 1I94J 2VFTA 1GQEA 2R8IA 2LXIA 2DNKA 3TP2A 3UDVA 2MQNA 3MEGA
chains in the Genus database with same CATH topology
2J9DA 4ZPCA 4QU7A 1VQ8S 3ULHA 3TO8A 3RRGA 4JI7F 4I6AA 4ZK7M 2HLUA 2IVFB 2V5HG 4Y2KA 3PACA 2FC9A 5HLFA 1RTHA 2R2TA 4K4YA 4MK8A 4YDXA 5HBMB 3OR1A 4NZ0A 1KD1T 3OL7A 3GIIA 4Z37A 4DPOA 5KOXA 1X4HA 2MB0B 2KB2A 4C0HA 4EWTA 4LVNP 4KC5A 2FHJD 5LT5A 1S48A 3PW2A 1KSPA 2AYMA 4FBUA 1R8HA 3O2IA 1HBOA 2GIRA 4F50A 2K1RB 2I0XA 5C24B 5B0GA 5HP1B 2N7CA 4F4XA 5I3QA 4FF1A 3NG8A 2E66A 2BQRA 2JLFA 3SFUA 5LMUF 4C3KA 5JUMA 2HMIB 4A8WA 1ZPWX 4O3SA 2KVIA 3QPIA 4LQ3A 1QY7A 5KT4A 2AGOA 2R2RA 2YQ3A 3PY8A 2WOMB 4ED0A 1JX4A 2DRBA 5J2MA 3AA8A 4IRDA 3OLBA 3HFKA 4X4UA 5B0DA 1WF0A 3C3LA 1GXUA 2ZHOA 4ZVEA 4ZDNA 4DQIA 2B43A 4YHHF 1HBUA 2W25A 4NRTA 1Q82T 5L39A 2XCPA 5I42B 1ZM3A 3DLBA 2WONB 4O23A 3DYAA 1SB6A 2GMLA 1HMVA 5GVQA 1H2UX 4L3NA 2YWGA 3HVTA 5GADU 4Y6IA 2KYZA 3CPWR 3CCSS 5HMYA 1I94F 1LXJA 2E9TA 2RIJA 4KB7A 4RBVA 2RQCA 5F8MA 1C1BA 1LWEB 5KT2A 1URNA 5G0RA 4K50A 4AYBD 4HI1A 3HZGA 1LW0A 4O4GB 2FDNA 1JKHB 5AXNA 4IR9A 5KFWA 2XMJA 5D4PA 4ZPAA 4OI4A 6FD1A 1HQUA 4WZMA 1ZZNA 5DLFA 3F41A 3TVYA 2FLLA 5L1IA 1B0PA 2FIUA 1UWBB 3I96A 2V8VA 4I4BA 3G96A 4RU2A 3DC2A 4CO4A 2XWXA 2W9CB 2BBEA 3DLEB 4UW2A 3S7RA 3T5KA 3PW4A 2DRAA 1VIOA 2DGTA 4RBUA 5EN1A 2M52A 1S10A 1QVFR 2XO7A 2JVRA 1RGVA 1FTRA 1BQMA 2DNPA 4Y2IA 5KFAA 4DL0C 3D0GE 1KN6A 1T02A 3FSXA 1KQKA 1HA1A 5AE2A 2MQQA 1XBWA 3MR2A 4PWUA 1V6HA 5K8PA 1TVRA 1EP4A 2ZOFA 1VK8A 2C3OA 3SSSA 4D3GA 4DJBA 1D1UA 4ZHRA 3C46A 4YB1P 2UXBF 3DLGB 3EX7B 5CZVA 2WBRA 2R8HA 4R0EA 2PI5A 2GJ2A 1QAXA 2I38A 2JVOA 2V2KA 3FMBA 4DL6A 2RNEA 3H59A 2Q66A 3QJLA 1C1CB 2VBZA 3CJ3A 3GV5B 1UJ4A 3OJSA 1HARA 4BBYA 3K5PA 3DHXA 3E2EA 3GFHA 3NMRA 1NK0A 1B7FA 2K3KA 1HD1A 1RTIA 2VG7A 2P5VA 5CYMA 4O4RA 3CCWA 2ZC3A 4DL7A 2DO4A 5K14A 4X4OA 4C7QA 4HTIA 3PDNA 2M7SA 5FDLB 4NLYA 5KFTA 3M1VA 5KG2A 4K4ZA 3KNAA 1ZBTA 2CQDA 3HHLC 4YMEA 2AJ4A 1RTJA 4QWEA 1VC6A 4RWWA 2HQIA 2QEXS 5B0AA 2R2SA 1X4CA 3A8EA 3QIDA 4RWXA 1TV6A 3ENWA 2OFGX 5KFGA 4ZVHA 3BQ1A 1Y4ZB 5F9NA 1NKCA 3C6TB 4WKYA 2HS4A 3FQLA 3GWCA 2YNIA 1L3KA 4ECZA 2IHR1 3MD1A 2KG1A 3BO4A 3TX8A 2KM8C 4R0JA 3RBDA 3LF0A 1Q8LA 4C8OA 3BGRA 3MM6B 4NYPA 2FJWA 1VQNS 2HNDA 2Q79A 4CO3A 1X4FA 1Q1KA 4H4KA 4NA3A 3K7RA 3TNVA 1EETA 2DGXA 4N8OA 4XDDA 2IA6A 4NXMF 3M2RB 3MEEB 3MHYA 3MM7A 2O5DA 5B7WA 4B9TA 1KONA 2M9KA 4KKOA 3MMJA 4PUOA 2ASJA 3AB2B 4C8ZA 4DV2F 3LP2A 2OPQB 2R7RA 2YNGB 3SV4A 3NL0A 3B78A 2F8EX 4YY3F 2CIMA 3RAXA 2VFSA 1JXLA 4A8YA 3GIMA 1DQAA 4YR2A 5GAEU 1SC6A 3I55S 4Q0BA 4X4QA 2ATLA 5CYJA 4ILRA 4X4SA 1PSDA 2L3MA 4I2QA 1WWHA 3H2VE 4O44A 5DM7Q 2ACYA 2QLWA 4DHVA 2HNYA 5FD1A 2QA2A 4I1TA 4ZPWR 4OLOA 2BUNA 1H38A 3MEGB 4GKJF 2IJFA 4F4YA 1U1RA 2PI4A 2DHGA 4ZS6A 5U47A 2D3UA 2CQ3A 3C8YA 5HQ8A 3UCGA 2CPJA 2HWHA 2VBYA 3IR7B 1IR0A 1YG0A 3AQOA 5E3QA 3DCAA 5HLFB 2LYVA 1IM4A 3SQGA 4C8YA 4J9KA 2VG5A 4ED3A 3GG1A 1G6BA 1U1MA 4KGMA 4CCHA 3M8QA 1HNXF 3CTRA 4UQTA 2LCWA 2VPXB 1U47A 3OHBA 3OW2R 3LW5C 3LP0A 1K0TA 3UDLA 2PE8A 2CQPA 2MPUA 1HBOB 2EFVA 1SBRA 2AV5A 2OMLA 2ZH7A 1L3SA 1LV5A 1KRPA 1MMNA 1YJWS 1JIHA 4PG7A 1D0EA 4CNZA 4C8LA 1OIAA 2DNZA 3ICLA 4NL5A 2ZH3A 3TAPA 5G4DA 3HT3A 2EFQA 2VPZB 1RA6A 3LQVA 1M1KT 4OI2A 5E3AA 3VAFA 4LFCF 2JZ5A 4XAKA 2M3DA 3R5DA 1FNOA 1FXDA 3QO9A 1FT8A 1I6JA 4FNIA 3I56S 3V6JA 4ZP9A 5J2MB 1N5YA 1IBLF 4JYAF 1HBNA 2IRYA 2CPXA 1HR0F 2FGCA 3UE2A 4PPZA 1ZAXA 4IFYA 3I6PA 3M8RA 5F41A 2BQUA 1SJQA 4RNHA 1HNWF 1JLQA 1WF2A 4DQPA 5EWEA 1RT1A 1Z1ZA 5MLCV 4ZVGA 3DYAB 3UQSA 5J2PA 4ZOSA 2JX2A 2OPSA 1FDNA 1HMVB 3D1QA 4FS1A 2OO4A 3BEGB 4DFPA 2DD8S 2SXLA 3HVTB 1U25A 3OTCA 2HW3A 2HHVA 3IRXA 4ED6A 4Y2CA 4PXEA 4MIAA 1C1BB 2XBPA 3PHEA 4WTYA 3JAMY 1LW0B 2DNLA 3OL9A 5THWA 3DM2A 4FZVA 3M2VA 2IC3B 1TR0A 3CJ0A 1KFDA 4KAIA 1HQUB 2FGOA 1QVGR 1QM9A 5A0YB 2UP1A 1LK7A 2E7WA 4WE1A 1SIZA 3CWJA 1U1LA 1RT5A 2MKSA 3SV3A 1TK8A 3BGFA 1N52B 2WTFA 3EYZA 2R4FA 5F3ZA 3HP6A 3AY0A 1BQMB 4J9NA 1W2BR 1HI8A 3RAMA 4CTAA 3BDEA 5BR8F 3ZZOA 3W2VB 2JFKA 3HKZD 4WU2A 3IFEA 4QOTA 3ZZPA 1TVRB 3FRYA 5KAKA 1A9NB 2AJFE 3MR3A 4ES2A 4ZHRB 2KH9A 3RYLA 2LXUA 4F25A 2HRUA 4OI1A 4WJBA 5KFEA 4XO0A 4AL5A 2EFPA 2KRBA 3JSMA 4TYBA 4ERDA 1KFSA 4LVOP 5DG9A 1N36F 2VG6A 1F5BA 4OJHA 1LFPA 2AYEA 2HFZA 1OWXA 3BO2A 1U1PA 5F8GA 2FJXA 2KT5A 4J5OA 1RTIB 4CI0B 2VG7B 3OTOF 5CYMB 4DF8A 2HRYA 2J9CA 4JUZA 1KNZA 4LIRA 4JI0F 2KFZA 5K14B 4C4WA 3ISND 3R5CA 1ZTWA 2NYIA 1FVSA 2DCLA 3GYXB 2UUCF 3PM9A 3M1VB 2OPPB 4Q5VA 2FVQA 5L1KA 2KJVA 4OX8A 5J1NA 4JV5F 3TR5A 1VBZA 2W9AA 2OJ3A 3FGVA 1XNRF 1DQ9A 2G1DA 1RTJB 2B4UA 2MKKA 4A8QA 1RKJA 4ECWA 1ZZFA 2K7KA 4RW4A 1AXQA 4H4MB 1TV6B 2E5JA 2BRKA 1S1UB 1Y5IB 1I1GA 3QJJA 1NK4A 2LLZA 3N4WA 3J80Y 4FN5A 4J9SA 2GW8A 2MZJA 2B6AA 4Q8EA 1WEXA 2MZRA 4C11A 3WDOA 3KHRA 4CNYA 2Y1IA 4FF2A 5KOWA 1VQSA 4QIGA 3BGRB 1GTEA 3AAWB 2NUUG 4NA2A 3SXLA 1FVQA 4WZQA 4DV5F 5HROA 4CZCA 4HYKA 1SV5A 4J9RA 1IUJA 5DQIA 4B9LA 2YWFA 3MM7B 2CQCA 3VAKA 2B9XA 2HHSA 2WAQD 4NCBA 3C6UA 2RRBA 4OX9F 4KKOB 1S49A 4PUOB 3PJWA 3IR5B 3MEDA 4ZCLA 2LMIA 3GIJA 1L3TA 1O0PA 1TUVA 2O66A 3HHDA 3TRGA 1KQFB 4F02A 3IS9A 4OJ3A 3V81A 1JJHA 2M2BA 4WK1A 4O0IA 1WTFA 4R5PA 3VAMA 3KLFA 2MZTA 4DUYF 3LAMA 1RYSA 2ADBA 4Q0BB 1U4BA 4Y3CA 2XCAA 4O3QA 2IBOA 4FXDA 3TUZC 4I2QB 1M90T 1RDRA 1RYRA 1W25A 3G86A 4YR0A 3R1LA 4NLRA 4W90B 2UUTA 2JLEA 4O44B 2Q6BA 2HS3A 1R31A 2HNYB 2CZ4A 2FD2A 3V6DA 4WFBQ 2L41A 4EYIB 4YR3A 2FVCA 1VIXA 3SDEA 4ETXA 3AH6A 4Z2XA 4LF9F 3H5SA 1FRJA 4F3MA 4MMOA 3KHHA 3BJYA 4I6YA 2IFXA 5J2QB 2BANA 4NLOA 1F9FA 4XPCA 2UU9F 3KYLA 1Q8IA 4FXVA 4QBUA 2MZQA 3ENQA 2OAUA 1HPZB 2GIQA 1U7LA 2EK6A 2RJZA 2IM2A 2UV8A 2OSQA 4QU6A 3S8SA 2QT7A 3L95X 4QIFA 3CCQS 3VAJA 4AE5A 2E44A 2DR5A 2LU2A 3T3FA 1WNEA 4DL4A 1VOMA 3BREA 4NLUA 5C24A 4JI2F 1UP1A 4ES3A 4ES1A 5HP1A 2CDQA 2GHPA 4DLGA 2DPIA 2W4DA 3DLJA 1JJ2R 1ULRA 2MSSA 2QO3A 4TYAA 1X4GA 3PKMA 1OQ3A 1FJGF 1DURA 2J0SD 2GQQA 3TA1A 4EZ9A 1QTMA 1JLFA 2ADCA 3MAHA 1JLEA 4RW9A 1SI9A 3PKYA 3QO9B 2ABYA 2RRNA 1HBNB 4QWBA 2KJWA 3CCTA 3M6XA 4DDFA 1Q78A 5GAGU 3K2YA 1ELOA 3DNCA 2C3PA 2VL1A 5KG5A 5C5JA 4IFYB 3X3UA 1KVJA 1HYSB 5A6PA 3LOUA 2VKRA 5I42A 2DGUA 3D0HE 3OTDA 4UY8T 2W8KA 1JLQB 1YJUA 3M32B 2WONA 3M2UA 1HHTP 1G3OA 3GV7B 5KG7A 1N56A 2D41A 1RT1B 2OPSB 1VLYA 3NWGA 4QWAA 2KT3A 4KFBA 4QQBA 2XMWA 2NZ4A 3PX6A 4OZLA 3IRXB 1Y3JA 3TA2A 1LW2A 3NAHA 5K8OA 2BJEA 3CCES 4C9DA 1TQLA 1JKHA 2BW2A 2BZ2A 2ZHBA 2YKQA 4KHRA 3M2VB 2HS0A 3BO3A 4KHPF 2AGPA 1MROA 2X3GA 3FCHA 3PZPA 5LMNF 1C0TA 2YNFB 2PMZD 1NHVA 1UWBA 3UI3A 4ZLPA 3AB4B 1RT5B 2M8HA 2MKJA 2W9CA 3TAMA 1WHXA 2GV1A 4DR4F 2O01C 3OVSA 4N47A 2GMJA 5B09A 3FZ2A 2V9KA 3GFYA 2R7QA 5E3PA 5SZTA 4QIVA 4QYZJ 3OVAA 3O6QA 1HWJA 1IKVA 1X4AA 2HLTA 5E33A 4C2MA 1OQ6A 5C25A 4Q43A 1RAJA 3CD6S 3QWUA 2DTJA 4HDGA 3MFIA 4WFYA 1JMTA 4QIEA 3VAIA 3OJUA 3P96A 3B4DA 4WFXA 2MYFA 1BD6A 4FVMA 3JSMB 3TI0A 4B3TF 4B3MF 3QJPA 2BDPA 2NS1B 4I69A 2D3OR 5I4MA 1WEYA 1KLMA 2YNHB 4DMZA 4QWDA 1U1OA 3NLCA 1HNIB 5KT5A 3OHAA 2R8GA 1WTBA 1NKEA 5F8LA 2WB1D 5KFMA 2F3JA 3BZQA 1T3NA 5D4LA 1U2FA 4WYLA 5D4OA 2X1AA 2JHEA 1XK8A 2L9DA 2CZVC 4RNMA 1KQSR 2JJ4D 5GAEI 1JWWA 3J7A1 2BXJA 1WELA 3NKYA 1V3ZA 2VASA 3LPYA 1ZYQA 2A18A 5IQ6A 5KTQA 1V9OA 5HN0A 2IA0A 2HVIA 4KO0A 3ZC4A 2ERRA 2KXFA