3FHCB

Crystal structure of human dbp5 in complex with nup214
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
224
structure length
224
Chain Sequence
NQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mRNA export protein DBP5 binds RNA and the cytoplasmic nucleoporin NUP214 in a mutually exclusive manner
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/hydrolase
molecule keywords Nuclear pore complex protein Nup214
total genus 64
structure length 224
sequence length 224
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00270 DEAD DEAD/DEAH box helicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fhcB00
2NO7A 2QROA 4OJQA 4HDCA 4HUQA 2D62A 2F1JA 1GG2A 1ZUNB 2OT3B 3HYTA 4MUBA 5KDOA 2WJGA 1FTNA 2H5EA 1SVLA 3DL0A 4GSYA 2H92A 4Q66C 4ZCLA 3U3KA 3UKDA 1VMAA 2VSOA 3QPVA 5AUOB 3MFYA 2NGRA 1J90A 2ZSDA 4DLVA 5HKKA 3VAAA 4A92A 1CU1A 1T3HA 1KNXA 1YZTA 2WM9B 3ASZA 3GLHA 2R62A 3WBJA 1OJLA 5L3SB 2VP9A 4NYIQ 4EQ6A 2V55B 2ZRNA 5FTLA 2WAYA 5JLJA 4Q03A 1YZGA 2FOLA 421PA 1VCNA 1X3SA 3P27A 2EFGA 2QAGC 4IKEA 2A5GA 4JLJA 1LTQA 4Q1EA 3UWKA 1V5WA 4ZDJA 4BWYA 3GLFB 2KBEA 3OESA 3RSOA 3BORA 1N0UA 5JZVA 1N2CE 2AHOA 4JIMA 1NN0A 4L9SA 1I4DD 2GVDC 2ZRFA 4QJ4A 3GLIA 2BM1A 3CRVA 3TRFA 2ZRMA 1E98A 2XITA 3NDPA 2PJZA 2CL0X 2OESA 3QQ5A 4B2LA 1XU4A 4AG6A 2Q3MA 4GMDA 4IW3B 2PT7A 1NVVQ 4A2PA 4PPGA 1XJ0A 4IEIA 1RRCA 3K9HA 4GOXA 2H7VA 2IYSA 4TLDA 1YJ5A 5KNDA 3FKSA 4AD8A 1N6OA 3FMPB 4RFVA 4ZI3A 4TYPA 2IYZA 1XPUA 3BB3A 4YMSA 3NBFA 1P2VA 1XF9A 3NEYA 4TQ9A 3DVLA 1T0JB 4PSKA 1E9RA 1U94A 2W6JD 2F55A 3K9GA 3TNFA 4A0FA 4EQ6B 2JJ1A 2ZVPX 4M22A 5J4LA 1AGPA 1Z2CA 5EE1A 1HV8A 1U90A 5DYIA 4BUJA 1HQCA 3B8HA 1UM8A 4TQUS 3C41J 2XXAB 1L7VC 2JDIA 1A5TA 3ADDA 4ASUA 4PSAA 4TWZA 1XTJA 1Z8FA 3VR5A 2V8OA 3LVQE 5IHPA 1TEXA 4NONA 1EX7A 2VTKA 3NKVA 1AS0A 2PCLA 2J7PA 2XZOA 2XNDD 2AWOA 2CLSA 4US0R 4RKEA 4D81A 3FMFA 4N0EA 1CJKC 4FMDB 3R9WA 2FFBA 3GP8A 1ZC3A 1GOTA 1LS6A 2VHTA 2JLXA 2ZSAA 3JZMA 4DDUA 3QSYA 4JLAA 4URZR 1S96A 3IIMA 4DLTA 1H8EA 1RIFA 1G3RA 4JVLA 1E2LA 2OFWA 2P5SA 1JALA 3R20A 4JLNA 1E2GA 3JVVA 2ZR0A 1Y63A 2EW1A 1ZCAA 4LRWA 3SQWA 1M7HA 2N1BA 2ORVA 1XDBA 2G0TA 3EARA 3M1IA 4XTCS 5EQTA 4CYMA 1XJQA 3BK7A 1TUIA 1MABB 2WWIA 3AKDA 2HJGA 5LDDC 3U6KA 1MRNA 4NCNA 4BECA 3GMTA 4OI1A 2ZRLA 4Q18A 4C0SA 3AVOA 4D4KA 2CE2X 1NMXA 2C03A 4LHZA 4MKFA 3HPQA 2BV3A 3E70C 4MKIA 4PR0A 1R7RA 3IEUA 1FL9A 4R2IA 1RKBA 1SHKA 2ZPTX 2GEDA 3IGFA 5J4HA 1BIFA 4Z51A 2BJWA 2VLIA 3OEHD 1K5GA 2EFHB 5DI3B 1ZD8A 1UFQA 1E9CA 4NP6A 1DO2A 1G7SA 4Q1DA 1OW3B 2W83A 1FFHA 1CIPA 2R6CA 2BMDA 5KPDA 5KPJA 2BOVA 2QPAA 1QVAA 1VG8A 4IXMA 4PTLA 4XD7D 2A2ZA 2QRZA 4HAZA 1Z0AA 3GCGA 5GVRA 4IEEA 4OYHA 5LB2A 4DCVA 1QHXA 3A36A 4MGKR 3W9YA 2FSHA 3CX7A 3ZQJA 4R2HA 5CDFA 4DCSA 1E2PA 1ZAKA 2XJ4A 3EIHA 1GFIA 4NMMA 3DZ8A 5C2JB 3CNNA 2QMOA 4QHYA 4KYIB 4Q7MB 2NPFA 4CT5A 1PJRA 2ORWA 5GJVC 1W0KD 1XBTA 2F3RA 4TMVA 1B23P 4DSUA 4O2RA 2ZJ5A 2IS6A 4MUAA 1IXRC 3THWB 1DAGA 2A3RA 2DB3A 2XGJA 2GILA 2XX3A 1E2IA 1X1SA 4RZ2A 621PA 1ANKA 1JPNA 4NYJQ 2F43B 2QQEA 3R7WB 4BGDA 1OFUX 3FOZA 4FIDA 1HTWA 1H8HA 1NBMA 2A7QA 3BGWA 5A4JA 1T4GA 2ECKA 1U98A 4JT2A 2ZJBA 3TVDA 3QG1A 5HE9A 5C46F 4HZUB 1FPMA 1IY2A 4GP7A 1TEVA 2GETA 4I99A 4HAWA 2ZJ2A 3UIEA 5B58C 2VQSA 1COWA 3NWJA 5L8VA 2C95A 1KY2A 5HZHA 1TTTA 3LX8A 5EXPA 1G17A 1F2UA 3KKPA 4ZCIA 1ZUIA 1I2DA 4JLDA 2IC5A 2ZREA 2WWFA 4QGGA 4B3CA 1D8TA 3KJGA 3A1SA 4MGZR 3UATA 1KGDA 5G53C 3NH9A 2C2HA 4EDHA 5JS7A 4DIDA 3FMOB 2RGXA 2NQ2C 1EG7A 4UQOA 4HLUA 3PCRB 3J81k 3NBYC 4QFMA 3U3JA 3CPJB 3R8CA 1M74A 3SHWA 4JL5A 1VTKA 4LCBA 5CYOA 1QZXA 4PZYA 3WP0A 3QUSA 4HUQB 2JLRA 3QOFA 3ZZTA 4DLUA 2V6JA 4GBMA 2PL3A 2J9RA 3KQLA 3VR1A 4PC2A 4WW0A 1TF2A 3K0FB 2CE7A 2GJ8A 4GNKA 4TTPA 4O25A 1Z6XA 4M2LA 4TTQA 4A9AA 4MH0R 1P6XA 1W5SA 2R8RA 3U7FB 2CK3A 2ZJ8A 3OEED 3QJYA 1G5TA 1DTSA 3AGQA 5JSZB 1NKTA 2VO1A 3BAFA 4URWR 4GL2A 1QDEA 1ZVQA 3NXSA 1S3GA 2GJAA 3EZ9A 3QEJA 3WYFA 4B47A 3PJRA 1JR6A 5CJ2A 1D9XA 4MYHA 3U3OA 1UBEA 4DCNA 1OH5A 2XOKA 3QXXA 4EPYA 4EFLA 4UJ3A 5EP2A 1UKEA 4PQFA 3F5FA 4BFTA 1KK1A 3KKNA 1US8B 4E03A 1LFDB 4AY2A 4Q47A 2F9LA 1P61B 3MD0A 3P26A 1ZNZA 1FMLA 1NIJA 1U8YA 3CWQA 1Q22A 2YYZA 3BH0A 4Q7JB 4BEJA 2BKEA 3TGPA 3G0HA 3TE6A 3LAWA 3QKSB 1G3UA 1P73A 2ZXUA 3T5GA 2AXNA 1Q1QA 2BBTA 2JLZA 3KTAA 5CIWA 3H86A 3G82C 4D0LB 3NBZC 4DCUA 5TMPA 1ELOA 2ZSFA 5FL7A 1GRRA 3GLIB 3D6TB 4LJ4A 4YXWA 1E2FA 5AJWA 4IDOA 4AC9A 5F3WB 2OAP1 4EPTA 4LK2A 3DOEA 2VSXA 3B85A 4AIIA 2FNAA 2ZI5A 3FTQA 2QY9A 3TR5A 5HTKA 5K8UA 2NO9A 4TL6A 1FP6A 2WIAA 1G291 3X1DA 1NVXQ 2AD1A 1OB2A 2A5YB 4BFWA 1PUJA 1AGRA 1D2NA 3VTKA 1QVRA 3Q7QA 4RD0A 4RFSB 3X2SA 2PLRA 1IY1A 2I4IA 5KSZA 2PEZA 4WXPA 2ZUDA 3AVPA 2VA8A 2FPMA 3T1QA 3GLIE 4Q4AA 3PEYA 4HAUA 4GOJA 1N6RA 4DUGA 3GEEA 3WRYC 4V0NA 1Q21A 3BJIC 3QF7A 4R98A 4F91B 5DN6D 3EAQA 3IKJA 1U9IA 4LHXA 3FFAA 2NO6A 3K53A 4BZXA 2BVNA 3QKTA 1ZUHA 1E0JA 1OHHD 4BLSA 5J5CA 3EZ7A 4JSTA 4MGIR 4TMTA 1NG1A 2C5LA 1BMFA 1GM5A 4BASA 3QXHA 2J0QA 5CB8A 1OXSC 4G01B 3T1VA 5J47A 1QHIA 1TMKA 2YHSA 2V54A 3KJHA 2J7PD 1F6BA 2F1HA 3L0PA 2WJHA 2MSDB 3RWMB 2JJ2D 2Q9CA 2HT1A 3WBKA 2QGNA 3LQQA 5EXSA 2FZLA 1XMSA 3TSOA 1T3LA 2GTPA 5FI0B 3CF0A 3ZVRA 5HPYB 1PLKA 1BH2A 3EW9A 3AF2A 2YWHA 5AUQA 1E1RD 4FI3C 2GCPA 2F6RA 1IHUA 1FUKA 1Q1ZA 3KKOA 1Z06A 4BFYA 1Y3AA 2WWXA 1RE0A 4U5XA 4FMCF 3WNDA 2ZS7A 4MRRA 4GMXA 3L8ZA 1P9WA 1MO3A 2AR7A 2LWIA 1XD2A 2Q9AA 3F8TA 1Z08A 2QI9C 4QG7A 2QAJA 3AKEA 3MJRA 4JYCA 4DLXA 1Q1BA 1XEWX 3T1TA 2J46A 2HLDD 4JL8A 1EFCA 3CKLA 1G21E 5L3SA 2IYYA 1KO5A 4Q21A 3K70C 3QI2A 4URVR 1BYIA 1RRGA 2W6IA 1OB5A 4XOIA 4NBSA 2ZRGA 2OSBA 4M8NE 2SHKA 3E5HA 3W5JA 1JAIA 1AQUA 4QM7A 4HYYA 3LQRA 5FH9A 1E2NA 1XTQA 2QL6A 2ZYUX 3KL4A 4N1AA 3T34A 3ZVLA 4BLRA 2ASEA 3ZS9A 3SE0A 2WTUA 5E7JA 1YZQA 1Z6GA 1R10A 3OFNA 4I1SA 4O0MA 4KO8A 5E4FA 3ZS8A 4IOJA 1CEEA 2QSZA 4NE2A 2NO1A 4Y0AA 4C0HA 1F2UB 2F3TA 4US2R 2ZYTX 1YE8A 2B8WA 2P2LA 1BKDR 3O47A 1P2SA 2NIPA 5BW8A 1X8LA 1OH7A 2ZRJA 5FBQB 1XX6A 1M7BA 4PSVA 1AS2A 5JJIA 2EQBA 3L43A 4WBSA 3TR0A 3NHBA 2OAQ1 3SFVA 2O8EB 1Z0DA 3I62A 2W0SA 1Z83A 2NZ8A 3L82B 1KDRA 2W0MA 3TQCA 1FP7A 3W6OA 3F3YA 3AH8A 2F43A 2Q3FA 3BH6A 1IN4A 4DDVA 3U44B 1KTVA 3BH7A 3RS5A 4JLMA 1G20E 1NI3A 1ZJ6A 3HR8A 4O2LA 3TJZA 3VR6A 1NVUQ 2WAXA 4L4UA 1S1CA 4XTRA 4DBLC 2AD5A 3CNLA 4UNRA 4XVUA 3CR8A 3OIUA 1DAMA 2QORA 1KOFA 4TN1A 4F38A 1KHTA 1R0WA 1ZM2A 2CDNA 3AEZA 4NKRA 4Q4HB 5JSZA 1LV7A 3OIWA 2H17A 2Q3HA 3K09C 4H1VA 4R9UC 4GRAA 3PXGA 2MSEB 3IPYA 4G5GA 3AM1A 3NEJA 1WQ1R 1N0VC 2EWVA 4NYIR 2QM7A 3EIEA 1Z29A 3RS7A 3SJAA 2PH1A 2PX0A 5DHAA 1P7CA 5K8IA 3VMFA 4K46A 4W5WA 1ZM9A 5HR5A 1AQYA 1KMHA 4WZAE 5K8LA 2EYUA 1L8QA 4LBVA 2C78A 3MUFA 2GJSA 5LBIA 4XSGA 2HF9A 4HAXA 3W8NA 3OIVA 4PAOA 5FFMA 2R6GA 1E2JA 2ORIA 3ADCA 4Q5IA 1TAGA 1UBFA 4WIAA 2CL7X 4UXIA 1P5ZB 1CXZA 2RH5A 3ETLA 4OJKA 1L2TA 3RDPA 1F2TB 2QM8A 1A2KC 4YDHB 3KUCA 2YVUA 1JXMA 5JHGB 2IYRA 1LF0A 2REOA 4N0DA 1GNQA 1X8KA 3BERA 1PVOA 1A4RA 4M1KA 1DAIA 1VYUA 4MKGA 1SVSA 1G7TA 3IDQA 2OXRA 3KFXA 5BWMA 1MOZA 2GA8A 1W5TA 2Z4SA 1GIAA 2YC2C 4XD7A 4LYFA 2YV5A 3THXA 2IS4A 3KZ1E 3ADKA 4A2WA 1RJ9B 2YOGA 4HUTA 1VKJA 5JRJA 5L3VA 2EU8A 2B21A 5JI3E 4WZBE 3DDCA 3GLFA 1XCPA 2VHJA 3SYLA 3KQKA 4A0RA 3VX3A 1KMHB 2IYTA 4G0NA 1ZBDA 2FX3A 2IW3A 3A8TA 4QNMA 1II8B 3GQBA 4RCYA 4Q9IA 4D4LA 4JBWA 2W2TA 2FSGA 5DI3A 4BZQA 4TZ6A 3SI7A 1XWIA 2CLDX 1W1WA 3EPJA 1KO4A 3W8RA 3LH5A 2ZRHA 4CEHA 2O8FA 1HE8B 1E6CA 1RW4A 4ZIRB 2DHRA 1OXTA 1N6PA 2J5XA 5SZHB 3BFVA 2H1LA 2O8DB 4ACAA 4CEJA 1O87A 1J2JA 1TQ4A 1XPRA 3L0SA 1IJFA 4OHZA 4QC2A 5C18A 3SYNA 3N2IA 1A82A 1UBCA 2A78A 2FGJA 3HPRA 4OHVA 1MO5A 2VP0A 3ZVMA 2I1VB 2FFAA 4II7A 2Q0HA 5H70A 2G88A 4ILEA 5BYJA 1XD2B 3KB1A 2ZJYA 5FUYA 1QHGA 4GFDA 1JR3A 3QKRB 4XWOA 2O0JA 3GJ6A 4DDWA 1RPZA 2W6ID 3OZXA 3EASA 1T5LA 2BKUA 1KKLA 3TMKA 3EIQA 3KXLA 2HDNB 2ZROA 2WSSA 3K70B 3OAAA 1RVDA 5HCNA 4Q9HA 3K9LA 5D3MB 2WIBA 2ZYWX 3FPAA 4LDJA 4C30A 2QN6A 3B7GA 2ZEJA 4TL9A 1XXHE 5TARA 1ZIOA 4DSOA 2YZ2A 1KI4A 1E2HA 3DM9B 4KAXA 1OIXA 3SS8A 1CRQA 1S1MA 2ZJZA 1W2GA 2ZE8A 1YR8A 4IOLA 5B57C 4BFVA 1KI6A 4JBYA 4BFUA 1SXJE 1QHHA 2YWFA 3R7WA 1VYVA 3W6NA 3EZFA 3GFTA 3HDTA 3CIOA 4ITRC 4J0QA 4N3NA 3TK1A 2VL7A 4B43A 3AP3A 5EXXA 3UG6A 1E99A 2YKGA 4BRUA 2C8VA 2WWHA 2JJ2A 2GF9A 3MRSA 4D25A 1JNYA 4P33A 4P4UA 3WYAA 2A9KA 4AKEA 1FQJA 4ZV4A 4IDNA 1AJEA 1XMJA 3RANA 2ZI7A 2GJKA 2VH5R 1D5CA 1HT1E 2GZHA 4MITA 5GVSA 1WB9A 1G7RA 1YZNA 2R65A 2RCNA 4LBZA 4GZMA 1NLYA 5J4VA 4US1R 2GCNA 3BIFA 1KO8A 1IJEA 4NDZA 2DPXA 2ODBA 3A58B 4C0QC 1U0LA 5IF9A 1GL9B 2Z6VA 3LFUA 3OEHA 4TL7A 3ND8A 1F60A 4DLRA 4JL6A 3U3MA 5KSYA 2HYDA 4LV5B 1ODFA 1OFIA 2PT5A 4G5RA 4GT1A 4UXHA 5CK5A 3TW8B 2CLCX 3I73A 1GP2A 2ZETA 3L0OA 1OXXK 2OV2A 1T8UA 2A5JA 2CNWA 4M9QA 4CVNA 1VDZA 4EJSB 4PC3A 3QPUA 3TQFA 1G3IA 3H4MA 5FTMA 2DWQA 3C14C 4KFRA 1XP8A 4LUCA 3V00A 4OBEA 5EXTA 4PQRA 1AZSC 1CS4C 1KDOA 5DNYB 5G3ZA 2WKPA 4EFMA 3CF6R 1GL6A 1AM4D 1TX4B 2HXSA 3PUYA 2Y8EA 4MRSA 4XJXA 5JWHA 4D6PA 2O0HA 4M9SA 1G8HA 1KZ7B 1QBKC 1PUIA 4DKXA 3GJ4A 3CZQA 5LB4A 2ZI3A 1DPFA 5FOSA 1US8A 4WXRA 2RGCA 1SHZA 4HAVA 3NDBB 2HUPA 1UEJA 1N6KA 3CX6A 1KI8A 3TH5A 2X1VA 5EUQB 3KQNA 3MLEA 3GJ0A 4AWXA 3EA5A 2IEZA 3WP1B 2GZAA 3FB4A 1XMVA 2ZYVX 4LGMA 1UDXA 1IN7A 4GPTA 3IUYA 3VQTA 1MH1A 3VX4A 1E9BA 2W2XA 3EC1A 3GD7A 4DSNA 3WHLA 1AS3A 1NF3A 3SR0A 3U7GA 3ZD6A 3ZDQA 3IHLA 1OYYA 1E32A 2TMKA 3QVVA 4NL4H 3VR2A 4Z1MD 5B30A 3LWNA 1E96A 2QT0A 2HV8A 3NHAA 4X8OA 5JRZA 4Z54A 2W6JA 3SU8A 4LJ8A 2FEMA 3KTAB 1UAAA 4D82A 4KJZA 2VP6A 3DMNA 1IN6A 3DEFA 3K0EA 3TW4A 3U7HB 2IYXA 1NMYA 1ZM3A 2VSFA 3IO5A 1CR2A 2WOJA 2WSSD 3FKSD 2WWGA 3GLGB 4CEIA 2AWNA 2C99A 1QHHB 1ZNYA 4YMTA 2O8FB 5KYKA 1QHYA 1JI0A 4M9XA 3GJ3A 3VHXA 1JR3D 4RZ3A 3SBDA 4E07A 4Q4AB 1G5PA 2GVZC 3U4QB 4FN5A 4C9BA 2ZU6A 3QIAA 2VEDA 3TAHA 2AX4A 3TIFA 4E22A 1VCIA 2NMVA 5IDVA 2AL7A 5CM8B 4F4CA 2JAQA 2QRNA 3GJXC 2BMJA 2GEVA 2ZQ5A 3A37A 3D7MA 4CDGA 1T6NA 5FL3A 3RRZA 2FSIA 4EIWA 4F93B 1G3QA 1Q3HA 1OYWA 3HR7A 3FHCB 3IPXA 4X8LA 1N0WA 3T06B 4WVFA 1U2RA 3LW7A 4Q4HA 521PA 3B2EA 2KWIA 5SZIA 4RD4A 2VRWA 5D3QA 4A6XA 5DSZA 4LJ6A 5SZKB 4KLZA 3AVYA 3FVQA 4L15A 1LNZA 2GDJA 4B71A 1KI6B 3GJ8A 3W3AA 4OQMA 4TTRA 2FMXA 5KOYA 2E87A 5E7MA 2GXAA 3REGA 5AJVB 4G5OA 2OUKA 1FX0B 3CF2A 5FL7D 2F7SA 2IYWA 3BFKA 4K81B 4LHWA 4BPBA 4LJYA 4OK3A 1YKSA 1OT3A 1CR0A 5B64A 4D26A 1QHNA 2J41A 1NJGA 4G5SA 2O52A 2CBZA 3KDSE 4BFZA 2VP5A 1AA9A 2WV9A 1YZUA 4EPXA 4DLSA 4YC7A 1WE2A 2VF8A 1ESMA 1SVIA 5GJCA 4O3MA 1G4AE 4C0LA 4P32A 2QENA 2IEYA 3LD9A 1JEDA 4DDTA 2QBYB 4WA7A 1Z6AA 2BC9A 1NBMD 3EA0A 4M1SA 1MABA 2CL6X 3RC3A 4XSHA 4YMVA 1KJWA 3CONA 4U7DA 3AF4A 3D8BA 2UVQA 1G9XA 2YINC 3OF5A 3TKLA 3RABA 2JA1A 1L4UA 2FPKA 1E9AA 3BS4A 3CX8A 3M6AA 4LPKA 2FU5C 4IDPA 3NIBA 1ZP6A 5AJXA 3E2IA 5FOUA 3RS2A 4BLTA 5FPKA 2KBFA 5DHFA 5CJPA 1JBKA 1YRBA 1AK2A 1SKQA 2UZ3A 4TYQA 1EGAA 2RGNC 3KQHA 3ICEA 2VHCA 1F5NA 2C9OA 2VHQA 2AKYA 3PVSA 2F1RA 4IRUB 4LYJA 1EK0A 1WF3A 2ZUCA 3NC0C 2P5TB 4JLVA 5DYGA 4PO1A 5L3QB 4TQAA 2WJJA 3U44A 4BEBA 4LYAA 1OXUA 3MMPA 2FFHA 4BLOA 5CDFE 2BBSA 4CEJB 4HLUC 3PG5A 4ZPXA 1T8TA 2D2FA 3DOFA 4Q4JA 2BBWA 3LLMA 4PANA 5CITA 3UPUA 3KX2A 2H16A 2O8BB 3BRWD 5ELXA 1YQTA 4OHYA 2VYFA 5G41A 2G1JA 2GRJA 5JECA 3B1XA 4LV6A 3HU2A 1KY3A 3QBVA 1I2MA 1COWD 1U0HC 2C98A 4ARZB 2IHBA 3BXZA 1N5LA 2RGGA 1ONBA 2HLDA 3O8BA 4CT4B 3FKQA 2R6FA 3OE7A 4JKYA 3VKGA 1N5IA 4L5BA 4DZZA 5CM9C 3RS4A 3U6BA 1W2HA 1TF5A 4LHYA 1IONA 2QSYA 3GLHB 3PEVA 4U02A 4TYWA 2P6UA 3LA6A 1N5KA 3T12A 2OFOA 2FWRA 2N46A 1MRSA 1X1RA 5FPYA 4BZPA 3I1FA 4JZKA 4RCZA 2GESA 3BD9A 4H1UA 4B3DA 1LY1A 4DJTA 4A8JB 3U3RA 2JCSA 4IVQA 5FUWA 2W2VA 4GDFA 2FH5B 2VPPA 2OLJA 1N6HA 2FN4A 3OE7D 4CRWB 1IY0A 1GVNB 2JLSA 2XNDA 5AUPB 4D80A 2RHDA 1JPJA 3CBQA 4LSGA 3I61A 3MAAC 4EKDA 4ZIRA 3FHOA 5EP3A 5FBRB 2JLYA 4Q01A 1OFTA 1CJUC 2B7BA 3ZIAA 3V9PA 1ZMXA 2QU8A 5FOXA 3ZYCA 4ZKEA 4Q7KA 5JS8A 3CW2A 3GLGE 1U8ZA 1E9DA 4W7SA 1RYFA 2RGDA 4G1UC 5HCIA 1DAKA 2QQ0A 4DCTA 2OCAA 3THWA 1KAGA 2CXXA 1EFTA 4QHSA 4YONB 3U7EB 4D0NA 5JWRA 1OH8A 1DEKA 4B34A 1N6LA 2ZRPA 3SJZA 5JJLA 3B1YA 3EWSA 2RGBA 2AK3A 3C5HA 3WNCA 1P75A 2HYIC 1II9A 1OPXA 1J8YF 2D7CA 4OKSA 4LC1A 3Q9LA 5J40A 5J4KA 4R7ZA 1FNMA 1ZRHA 1NY6A 1GL7A 2QMEA 1NP6A 1M2OB 3I4LA 2KJQA 4MYTA 1KAOA 2C77A 4P4SB 1A2BA 5A5GA 2IA5A 1XXHA 1NKSA 1U9IC 2RKOA 2WOOA 3V4RA 1BS1A 2IF2A 2IWRA 1G16A 2ZE5A 1WBBA 3CR7A 4DRZA 2PJRA 2ZAMA 4HEJA 4C3ZA 4IOKA 5DGXA 1OFHA 821PA 1R5OA 5JMTA 3EPKA 1DELA 2IUTA 3B78A 5KNCA 5KNBA 3TAUA 2PX3A 5JCPA 3MSXA 2K5UA 4KSBA 5P21A 4TYNA 3GJ5A 5FTJA 1VPLA 1XCMA 2J87A 3OAAD 4F4IA 3QY0A 3RSLA 3LY5A 1DAHA 3CH4B 2H18A 3QXSA 3AF1A 4L9WA 3SJCA 1OIWA 4TT3A 3KXIA 5F9FA 4WZ6A 3LNCA 2HXYA 4PHFA 1Q20A 2JDID 2ZU0C 2FJUA 4AURA 1SKYB 3FYHA 4KHZA 4V0KA 1VG0B 3AP1A 4NYMR 5DE3A 4MA4A 2OG2A 4BLPA 3C16C 2XZPA 5TDHA 3WXMA 1EWQA 1MR3F 1ZU5A 4KVGA 4EPRA 1PZNA 2WPDA 3L0IB 4MRPA 4DHEA 2VP4A 3IHWA 3KXKA 3MWKA 5F2EA 1MO4A 4YXWD 1JJVA 1G5RA 3IILA 4PXAA 3WMGA 3IO3A 2XJ9A 4IXNA 2O8CA 4QJ5A 4IFEA 1FNNA 2QBYA 1S4QA 1TQ6A 4BRWA 5BYKA 1ZM7A 3BOSA 2ZANA 1UEIA 3A1TA 3ASYA 3QKUA 1E69A 5SZJA 1V43A 3MWLA 1GRNA 5AK0A 3RS0A 3IBGA 3UMRA 2QUZA 4JLBA 2WJVA 2ZVQX 3MWJA 4OHXA 5L3QA 1OKKD 3KKMA 5JFGA 4C7OB 4MRVA 1YVDA 3PV0A 3NC1C 2QZ4A 2OCPA 1P3JA 3EC2A 2F1IA 3MG9A 2JGNA 2QNRA 5TB5A 4A2QA 4HATA 1G8YA 4AK9A 1R0ZA 3TVTA 4ARZA 2J0SA 1K8RA 4QL3A 1SXJB 2BEJA 3AKYA 1LVGA 1LF5A 1XD8A 3Q5EA 4G5QA 4ABYA 3TUJC 2QAGA 4YMUA 3CNOA 3GPLA 2IUUA 3SFZA 3NTUA 1GZSA 3T15A 3C8UA 1P9NA 2J0VA 2X2EA 4C2UA 1MKYA 4B2IA 1FOEB 3AB3A 4ZDWA 1ZNWA 1CRPA 2BBOA 2WPDD 3CPHA 4PAMA 4B48A 3ZH9B 3IQWA 1R5BA 4DVGA 5F9HA 1XTRA 4NYMQ 4AKGA 4FINA 2XXAA 1OSNA 4M0LA 5LPNA 3S1AB 4ERNA 1KKMA 1W0KA 4BQSA 5EP4A 4GOKA 3K0FA 4LWZA 2OXCA 5FOTA 4YDSA 5KSOA 2HJVA 3K0CA 1NSFA 1P2TA 3PUWA 2NZJA 4I81A 4QM6A 4OQNA 1S0UA 2OO7A 3K9NA 1F2TA 2IS2A 5ANRB 4XH9B 4UNNA 4TYYA 3X1ZA 4B3BA 4LJAA 5E7IA 2ZI4A 2I3BA 2GAAA 2J3EA 5TV2A 1OH6A 1XJCA 1QG4A 1ZU4A 4IFBA 2B8TA 2IYUA 1W48A 2R6DA 2WWYA 1HY3A 3O8DA 1EESA 2ZIAA 4DLZA 2ZE6A 1DO0A 2FA9A 1Q12A 3P4YA 3KQUA 3B9QA 3LV8A 1E2KA 3H0KA 4KBGA 4OL0A 3VNUA 1NVVR 1HEIA 1Z0IA 2BCJQ 3QNUA 2D2EA 4X8MA 3KFVA 3LLUA 3PIRA 2GCOB 4HB0A 1R8SA 3AF3A 4HZIA 2V1XA 3LRPA 1KZGB 4TLAA 3AVUA 1E94E 4KI0A 2XSZA 4M21A 3RRYA 1E2EA 2A5FA 1OV4A 4LBYA 5IK2D 1HYQA 2OBNA 2O8CB 1BMFD 3PITA 2B7CA 2R6AA 2ZS8A 4QOSA 3KJIA 4A15A 2OE2A 4LPSA 4PO9A 3B1ZA 2G77B 221PA 3HYRA 4KVAA 2ZR9A 1CLUA 3ADBA 4RD1A 1XZPA 2L0XA 4EFNA 1SVOA 1ZC4A 1VCMA 2XNSA 4KFSA 4XVRA 3THXB 2P6NA 2AFIE 4CEIB 2FDCA 4A6PA 3MWYW 1CJVC 2IL1A 1OIVA 3UWOA 1II0A 3ZIAD 1AIPA 1L4YA 4QBGB 4JBXA 5FR1A 2ONJA 5A0FA 4KBFA 4TL8A 1Z5ZA 3DM5A 2QEQA 4XWKA 3H2YA 2WMOB 4B2PA 1II8A 1BYUA 1E4YA 1T5IA 3QF4B 5GADl 4TMKA 1E0SA 4ZCMA 2AKAB 2GWHA 4DEYA 3P20A 3THYB 2E1RA 3B1WA 3TSZA 1CF4A 1ZIPA 4Z1MA 1XEFA 3RRMA 4E5UA 2FZ4A 3OFND 3AUYA 5KTYA 1EFUA 2JJ1D 1OLOA 1XEXB 3LX5A 1KK0A 1A7JA 4PPFA 3MJHA 5C1BA 1H65A 2ANBA 4DLWA 4Z8YA 5JHHB 3P32A 3P1JA 4DT1B 2WBLC 2NOAA 3PFIA 3AUXA 1GSIA 2F9MA 1KDTA 1T0HB 4A36A 4GI7A 3VNVA 4DLYA 4Q00A 2A5DA 2BDTA 3W90A 4CEHB 1YZLA 1KI3A 1D9ZA 2CCKA 3BWDD 5AUNB 2JATA 3QG5A 3Q8XB 4ASUD 5DLQC 1TADA 2P67A 3WY9A 1XCGB 1D2MA 4F92B 1XB2A 1XNJA 2W00A 3N70A 2QMUA 4PPNA 3ZZ0A 4FCVA 3UMSA 3X1XA 4CF7A 4QBFA 1E9EA 3IBYA 1XMIA 2YWEA 4OK6A 1K5DA 4PZZA 4QNRA 1J99A 2FFQA 2PMDA 2QPOA 4AI6A 3PR1A 3OHMA 3K0AA 1W46A 1SKYE 3RRNA 1R0XA 1SXJD 1E0AA 5EE5B 1RRPA 5TVKA 1W4RA 3RLFA 1GNRA 3R8FA 4Q9LA 1HUQA 2O5VA 1X8JA 2ZI6A 4KCGA 3T35A 4W9MC 3SJBA 3QXJA 3EZ6A 4NCJA 3HU1A 2WJYA 3RAPR 1G7CA 1W36C 2RB4A 1UBGA 4LJ7A 5KHOC 4C0KA 3QENA 1WRBA 1G6HA 1NY5A 4I1UA 2BMFA 4CIDA 4PC6A 1WA5A 2WJIA 1UDWA 2ODNA 3SOPA 5HZKA 2QGZA 1W47A 2JLVA 4W5JA 1YU9A 4RZUA 1AZTA 1G41A 3IIKA 4M1OA 4HSEA 5DN6A 3SYKA 1G6OA 1P60A 2CVFA 4CZ2A 1P9RA 2PZGA 1GDDA 1LS1A 2WZQA 2QA5A 4P0TA 1SZPA 4QXAA 3AVQA 1BOFA 4MDFA 4LI0A 3W6PA 4B44A 4HLDA 2C9CA 1R6BX 2JEOA 4Q48A 4M9ZA 1IQPA 4JJZA 2BM0A 1SVKA 4LZZA 3RVBA 1YHNA 1NMZA 5HE8A 2CJWB 1ZW6A 2RHMA 2VBCA 3PQCA 3V4FA 2QMHA 2XTMA 4B76A 4B3XA 2NTYC 1IM2A 2OZEA 2ZRIA 3AVVA 3QF4A 1E9FA 2ZS9A 1KJYA 5DISB 3ZJYA 3IIJA 1P72A 1VYTA 4ON9A 1RZ3A 5JI2E 4LC0A 1Z6TA 1Z22A 1J8MF 4PAQA 2CK3D 3OEEA 4XIGS 3QKRA 3BBPA 4DB2A 4JS0A 2WKRA 2FPLA 4K8OA 4OHWA 4UXJA 5JBQA 6Q21A 3TUIC 3RHFA 1ETUA 2PEYA 4GP6A 1JJ7A 3EXAA 3SEAA 2IHYA 5D3MA 4MDEA 4G3XA 4X8HA 1JQLB 3K70D 4D4JA 3A4LA 4P31A 3I3SR 4M1WA 4Z8XA 1KMQA 5EZ5A 3S1AA 1DBSA 3TLXA 4FCTA 1KYIA 1FW6A 3N5CA 1UKZA 3HWSA 1S3SA 1Z0KA 1UKYA 1GKYA 4HI0E 1Q57A 5DO9A 4EJSA 3DZDA 2P3SA 4POAA 3WNBA 2V4ZA 4UKDA 4OQFA 4UNQA 3RNLA 3U60B 1KO7A 5EE0A 4DC9A 4W5HA 1RFLA 4TMWA 3SN6A 2GBLC 1NG9A 3WMFA 5C4GB 1KI2A 3BE4A 2Z4RA 4A4DA 4AKHA 4UNSA 2RAPA 5FTNA 4B73A 1X6VA 1UPTA 2JLQA 2VF7A 4A1FA 2REBA 2V1UA 2EFEB 1H8ED 3NG1A 1Z63A 2ZRKA 3IEVA 1TQ2A 1P2UA 2AK2A 2IYLD 1Z6YA 4P4SA 2XZLA 4B3FX 3ND9A 3U2QA 4B35A 1EFHA 2DFNA 1J70A 2CHVA 4PPQA 4D0GA 1JB1A 1NN1A 1R4AA 3T61A 4A0HA 2GK7A 3U61B 4TLEA 1U81A 2RGAA 4RD6A 1TL7C 4NHOA 2AN9A 3LBIA 2R2AA 4URYR 2G0NA 3THOA 2ANCA 4KU4A 4CGZA 4ZKDA 2ZRBA 3SC3A 2W58A 2PZFA 3C7KA 4ZDIA 1NVWQ 4IVPA 4M1YA 3LXXA 2NO0A 5CK4A 4PX9A 5B2ZA 4UJ5A 4AYWA 1FTSA 1QHSA 4PO8A 1G1MA 3B1VA 3EWAA 2HCBA 3FWYA 4I1VA 2G9NA 4D4MA 5KUTA 1U8AA 2ERXA 3FHTA 4AKIA 3KKQA 2QP4A 4HDOB 4NCHA 2Q21A 4NH0A 1F3OA 1E1RA 1CP2A 2Q9BA 2WKQA 3R9IA 2RMKA 2GAOA 121PA 4JLOA 2XB4A 4KODA 4QGHA 2CJWA 2OFXA 1B0UA 1W4AA 4PC7A 3U4QA 3VHLB 1CKEA 3MGCA 1KSHA 2D74A 4MYUA 3ZQ6A 2X2FA 1KDPA 4DT1A 1VHLA 3VKWA 3CRRA 1IN8A 1E2DA 3CRQA 4Q19A 2DFKB 4LBWA 3RYTC 1HT2E 2GCOA 2WSMA 4IHQA 4Y0VA 1AKEA 2ZAOA 4M1TA 1M1YE 5E3HA 4KFTA 4RVCA 5H68A 1WBDA 1IBRA 1JQJC 1SULA 2R44A 2GHIA 2FEOA 4B32A 3W3ZB 1SVWA 4JVNA 3T1OA 4A0GA 1DARA 5EZ6B 4DUGD 4HDQB 2XTZA 1XEWY 2EWWA 1U99A 2DR3A 4D2IA 4ZDKA 1T9HA 2ZRAA 3M0EA 3VU9A 4BFSA 3PUZA 3NBXX 1G18A 1G64A 4V02A 1IN5A 1RC8A 1KSFX 5KSPA 1X86B 4TLCA 4LJ9A 1K6MA 4B6EA 5AR1A 4Q4JB 2O8DA 1TU4A 4NCIA 5HKKD 2GXUA 2KB0A 2O8EA 1E79A 1WXQA 1N5JA 1GILA 3ICQB 1Q3TA 2GXQA 5BXQC 3QXCA 1ZYUA 3QE0A 2GK6A 1O3YA 2V7QD 2J1LA 3GFOA 3ZGXA 3Q85A 5C4MA 3BFXA 4JLKA 5L3RA 4NZYA 4ESVA 4Q4LA 2C96A 1NJFA 1DVRA 4TLBA 5GJBA 3IQXA 5G40A 3JZAA 4OK5A 5KDDA 4LYHA 2XAUA 4JSYA 2ZSEA 1E1QA 4KV9A 2GBLA 3VR3A 2O8BA 4XWAA 1AN0A 5FBVB 4PQYA 2PZEA 1W4CA 4BLQA 4XVQA 5K8TA 4I1OA 2BHRA 3PEWA 2UZIR 4LY6A 2HF8A 4HB3A 2YWGA 5CYPA 2EVWX 1YR6A 1ESNA 721PA 4Q9JA 2C9YA 1GUAA 2V6IA 3CPEA 4JT4A 3LBNA 4DEXA 1Q44A 1FX0A 2OILA 2YNMA 2IXGA 1IOZA 5DI9A 2ZM5A 1M34E 4KSCA 1P4SA 2HEIA 1GWNA 4TSFA 4EAQA 4LHVA 4EUNA 3LW8A 4DXAA 1MT0A 1ZNXA 4WOPA 4URXR 1A1VA 5LD2C 3SQXA 2GNOA 4JYBA 2HCJB 4L16A 1GNPA 2PCJA 4TMXA 3GEHA 3I8XA 2RGNA 3C4JA 3REFA 2QT1A 3DMDA 4RFSA 4E09A 3TBKA 2DWPA 5CLLA 3AF0A 1DAEA 2QPTA 3RC8A 5FOWA 4QGAA 1TNDA 1VHTA 1GKUB 5FTKA 1S2MA 1D6JA 4RJLA 5FPTA 3WHKA 2P0EA 5TXGA 3I5XA 2R9VA 4GZLA 3CZPA 1U0JA 2MSCB 1DE0A 2J59A 3I8SA 3PEUA 3WYGA 1D2EA 1DAFA 1RYHA 4DSTA 1GKIA 1VIYA 3K09A 4I4LA 2GJ9A 2IBMA 4C0BA 4S2EA 1DG3A 1DADA 4EPVA 1VG1A 3CO5A 1NN5A 3I92A 4FW9A 1GRQA 3PENA 4Q1FA 2QE7A 4MGYR 1EFRA 4KITB 1FQKA 3CWZA 4P4TA 1H8HD 4ZI2A 1XTSA 4RD2A 2D4HA 4OI4A 3Q7PA 4OQLA 5EJEA 1W0JD 2WHXA 3C15C 4QGFA 4M53A 4FCWA 1WMSA 4KXFB 1ZCBA 1YR7A 1M7GA 1WDTA 5TY0A 3AVXA 2WWWA 3CH5A 2EYQA 3AKCA 2OBMA 4Q1CA 3RWOA 3NVAA 2GXSA 1G8PA 1R5NA 1NRJB 2C04A 2YOHA 3B82A 4TT3D 4R71A 2D3WA 3AQ4A 3X1WA 4ESHA 5M04A 3I72A 3Q72A 4KLNA 1UADA 1IAQA 2OEPA 2ZRDA 1E9SA 4MYCA 3UXMA 1KI1A 4OQXA 5FI1B 2XB2A 1VG9B 1N6NA 5G3YA 4AYTA 4LJ5A 1NL3A 1TQDA 2HT6A 1CJMA 4ZO4A 4DIEA 3VKHA 4LX0A 1I4TD 2OM2A 2XEXA 5CIQA 2LCFA 4C4PA 5KU1A 2CHQA 2PMKA 2XTNA 3A6PC 1N3BA 3QBTA 1FUUA 2FG5A 4FD2A 3BB1A 4KFUA 5CB6A 4NU0A 2IT1A 3GJ7A 3Q5DA 3K0SA 3AGPA 1FMJA 2CHGA 1KSGA 2PLFA 2QTVB 2QTFA 4FWTA 3DO6A 4YMWA 2DWOA 3KUDA 1FZQA 3QEOA 1R8QA 3HJNA 2JJ8A 5H8WA 5JEEA 2Q6TA 2OBLA 2D7DA 1HURA 4B3GA 3UK6A 3UG7A 4FMDF 3CUEF 4FXPA 1KO1A 1XXHB 1N25A 1Z0JA 2ZITA 4A82A 1S9DA 1XZQA 2ZJAA 3I32A 4B75A 4BE7B 4B74A 3HU3A 2VIIA 2JLUA 3EZ2A 3CRMA 1G8FA 4IDHA 5LD2B 3FGNA 1PV4A 2GZDA 4FMCB 3GLHE 4RSGA 1KJZA 4V0OA 4Q02A 4EJSC 4V0LA 4RKFA 3O8CA 3B13B 4JMPA 2FE4A 2IYVA 1KIMA 2ZSBA 3C5CA 1Z2AA 3JVUA 2BCGY 3K8YA 4OI2A 5GJWC 4Q1BA 1GITA 1TUEA 2Z83A 2DBYA 4C0JA 4L8GA 4S35A 2IS1A 1UJ2A 1WCV1 8OHMA 2JLWA 1C1YA 2OCYC 2V9PA 2X77A 1OE0A 1OF1A 1XEXA 1YZKA 3L8YA 4IVRA 3EPHA 3DHWC 2B92A 3E1SA 3MCAA 3K0AB 1KK2A 4NPHA 2DY1A 2IWHA 2DFTA 2MMGA 1E1QD 2GKSA 1G4UR 1M8PA 5FOVA 1E3MA 3TSWA 4JJKA 4QBIA 1SXJA 1NLZA 3K0CC 2WICA 4TSFD 3EX7C 3ECCA 3VR4A 2ZRCA 4P3YA 1S9HA 2CCJA 4UNPA 1W4BA 3QVUA 3SDZA 2AFHE 4U00A 1EX6A 3X1YA 3PUXA 3L2OB 4HB2A 4LOAA 1HQYE 2ZJOA 3DPUA 1I4LD 3OIYA 2A30A 5BQ5A 2EFCB 3A4MA 5KDLA 1J7KA 1LB1B 1KSJA 5JCZA 2CEAA 3B5JA 1JEEA 2ATXA 2ATVA 4AG5A 3GFPA 3H1TA 3QKSA 3R9XA 2ZI9A 4QBHA 1JECA 3B9PA 4RY2A 1PLJA 4HB4A 5EE3A 3EPLA 4CW7A 1NSTA 1Q1EA 2IF0A 1W49A 5F98A 1NN3A 1NNEA 4OI0A 5H1YA 2IYQA 3PUVA 4URUR 4B6FA 2LKDA 3NH6A 1VCOA 1CULC 2MMCA 3KJEA 1UF9A 2YJTD 2BMEA 3SNHA 4C2TA 2JIZD 1QRAA 2IUSA 1OXVA 2ODWA 1W44A 1XFAA 2J45A 4M1MA 2V7QA 3M4YA 1Z07A 2ZUBA 4ACBA 2CCGA 1MV5A 5FUXA 1KI7A 2E9SA 3U5ZB 1NLFA 3FFBA 1E79D 4PHTA 1SXJC 4Q1AA 4B33A 2KI5A 1LW7A 3AVWA 2XSZD 2G1KA 1VIAA 5UKDA 4DWJA 3UANA 3B60A 3CRW1 1TPZA 1DOAA 1HA3A 1S8FA 3GLFE 1PLLA 2CNWD 5E95A 1ZINA 1W36D 4A8JA 1VECA 2BIFA 1CJTC 2QP3A 4NTZA 5BN5A 3AVTA 3Q3JB 3I5YA 1CR4A 4QRHA 3DKVA 2OLKA 1WP9A 3B6EA 4IJMA 2FSFA 3BC1A 3CLVA 4Q9KA 5J4YA 4HLQB 2IXFA 4IOMA 4PFSA 3W5IA 5IRCD 1OHHA 5DH9A 2AXPA 1SGWA 2JIZA 1R0YA 3SHFA 2P65A 2X19A 3F0TA 4V03A 1XD9A 5JEDA 4PHGA 1XPOA 2FGKA 3CB4A 3VFDA 2ODEA 4H9GA 3FMIA 2QG6A 2G3YA 5FBWB 2J0UB 1Z3IX 5AJYA 4V0MA 3WMEA 4AYXA 3LDAA 3D3QA 2Z5FA 1C9KA 1P62B 2J0UA 1RJ9A 4Q7LA 5BN3A 4YLGA 3THYA 1KNQA 2G83A 4TMZA 5EP1A 3RS3A 3K1JA 3ZZUA 2WMNB 4QHTA 4EPWA 1G19A 1QG2A 4HLCA 1NIPA 1JR3E 4JVMA 2VP2A 3ONWA 5FPHA 3WRXC 2OHFA 2ERYA 5AJZA 3P4XA 2IX3A 3FE2A 1GAJA 2OCBA 1JAHA 1SQ5A 2CVHA 1XRJA 3QPWA 2LKCA 2XOKD 2UKDA 2VHUA 5FR2A 1AKYA 5JWOA 3A4NA 5BN4A 1T3SA 1MO6A 1TF7A 4JKIA 5EE9A 4BFXA 2IXEA 4QKQA 4FMBB 2QE7D 4NCKA 4PZLA 1KK3A 1CBUA 4FWIB 3VU9B 2ZR7A 2KSQA 1N6IA 2Z43A 4V0ME 3H84A 1G8GA 3AV0B 1Q0UA 4A8JC 1T91A 2JASA 2KE5A 2Z0MA 2YOFA 2PBRA 4IDQA 1W7AA 1E4VA 4MRNA 5KO2A 1HH4A 3W34A 1NBME 2P6RA 1EWRA 1F48A 4F4JA 3UMFA 4QJ3A 1E0KA 1G3MA 3ZD7A 2DFLA 2EFDB 2ONKA 2N42A 3LBHA 3GLGA 1KI9A 4PHHA 5CLQA 5FPSA 4TZ0A 2GF0A 4YQFA 3G5UA 2X8AA 3TUZC 3D31A 4M4SA 3AP2A 3GEIA 3KB2A 4PC1A 1UKVY 1OKKA 2YC4C 4DB4A 1GTVA 3SZRA 3LO5A 5FBLB 5IK2A 1Z0FA 2REXB 3HP1A 2J7KA 1ZD9A 4C0AC 1XTKA 1E2QA 2NG1A 2BJVA 2DYKA 1ZM4A 1HE1C 1DG1G 4KYUA 3ZVNA 1JXOA 2V3CC 2H57A 3BB4A 4MQBA 1Z28A 3LVRE 4LV8B 2WVJA 4F7WA 2G6BA 2GEUA 1W36B 1BO6A 1IXSB 1CR1A 2IK8A 2BWJA 5IT5A 3A1VA 5EUMA 3O8RA 1EXMA 2I1QA 1C4OA 2CMKA 2O0KA 4C7OA 5JJKA 3EG5A 4WAUA 2NPIA 2H8KA 3DKPA 1W0JA 1SVMA 1YR9A 2ZE7A 5DIFA 4NYJR 1R2QA 2FV8A 1CTQA 4RD3A 2DCUA 4JVSB 1EFRD 1QF9A 1Z47A 2D06A 4HAYA 4RZXA 3CM0A 2FF7A 2RGEA 1RRFA 2BEKA 2QAGB 3LXRA 2B6HA 1M6NA 3A1UA 2ZTSA 3A1WA 1XTIA 1TU3A 3ZLJA 1YRAA 1E2MA 1ZD1A 3FDIA 4MKHA 5AWFC 2QP9X 2QTHA 5FUVA 3N2EA 4JLPA 3T5DA 3SBEA 1IXZA 1DS6A 4HZUA
chains in the Genus database with same CATH superfamily
2WE8A 4OJQA 1GTRA 4HAOA 1ZCJA 1NVEA 4R84A 3MELA 5MFPA 2JEZA 1WY5A 4L4XA 4Q66C 3U3KA 3EDRA 1TW2A 2HWWA 1SCJA 3COSA 1VMAA 3KPJA 3Q1KA 4S1VA 3JQDA 3MWGA 4ZCLA 3TDNA 2FW0A 1EFPA 3MFYA 4BNHA 1QZZA 3GDOA 2QL9A 5F51A 3VAAA 4RX1A 1HO3A 4A92A 3HRHA 4UATA 1YZTA 1ZOIA 1DJMA 2X0JA 4LRYA 3V6LA 1OJLA 3U80A 4LRQA 2V55B 3JZIA 1B0AA 1DU4A 4HX5A 4O08A 1YZGA 1VE7A 4JB0A 2QAGC 3HYNA 3G8DA 2JANA 3NTXA 5I8PA 4O4IA 2AN3A 2J3LA 4KV7A 2KBEA 1YULA 3UUFA 5JC8A 3BORA 4GLFA 1N2CE 3HLYA 3SIRA 4L9SA 4FUTA 3P4UA 3AIIA 3RYFB 1V4BA 1KBQA 2ORED 1MPXA 2GVDC 1ZLYA 3VZRA 2BM1A 4ERXA 4DE5A 1F7VA 2W6NA 3ZWQA 2ZRMA 5I9IA 2AFIB 1Q1AA 2XITA 4WFQA 4AWBA 2BE9A 3OLVA 3RUEA 2D5IA 1ZMTA 2FRDC 2Q3MA 3TEMA 1YHZA 2HWUA 2VA9A 2PT7A 1EZ4A 4PPGA 4A2PA 1UP7A 3AX6A 5C32A 5K09A 5M2QA 3UBTA 5JXJA 4WI1A 4FDTA 1SKUA 3HFSA 2CDAA 1GTG1 1C41A 2XE8A 1VJDA 5CH5A 2X76A 3EIWA 4R8RA 3CFYA 2QR2A 4PFQA 2SBTA 1MX3A 3EPRA 2A3NA 3BM5A 5T7BA 5AIAA 3BTUA 1HSOA 1Z5UA 2IYZA 3G9XA 4JA0A 4P5PA 1Z2PX 3BB3A 1P7VA 3BBLA 1HNWB 3IJPA 1FFXA 4HTFA 1UXGA 1IUPA 2W6JD 3DMRA 2F55A 4PSCA 4P08A 4A0FA 4EQ6B 3ZYZA 2JJ1A 5FX2A 5JW6A 3R0XA 1AGPA 1XOIA 4FLFA 4KQJA 1J00A 1O7JA 2C2KA 2OZVA 1QH9A 5HJ7A 3MMSA 4C3OB 1HQCA 4BUJA 2Q46A 4DC0A 1NASA 2Z2YA 3C41J 3L93A 1P45A 4HPWA 4L1KA 5TF4A 1ULAA 2EKLA 2JDIA 2RBKA 1PZXA 2Y1KA 4A91A 3N3AC 1DEXA 4ZAVA 3UQZA 3VR6H 4LK3A 4ASUA 1Z8FA 5K3SA 5G2OA 1PEDA 2KLHA 2R25B 2YVKA 1R9JA 3FFXA 4G1BA 3HDYA 3OQJA 3TLEA 4BHTA 4NI5A 1XROA 3TWOA 5IABA 1EX7A 2VTKA 2FXVA 2WF5A 2VH2A 3MGGA 3B5IA 4FGJA 2AWOA 2CLSA 2R8XA 1INLA 3QH4A 1HGXA 2O4CA 3DO8A 5IVDA 1CJKC 2IU3A 3AI3A 3WLQA 4BB5A 1GPUA 2DETA 2JGLA 3EEQA 1NW3A 1YB1A 3KCNA 3PIIA 1S7CA 4H7KA 3KPWA 1EUDB 2CXPA 1KOLA 3TQHA 3ZCTA 4YV2A 3VKVA 4M99A 5IKEA 2VN8A 2TMDA 1YCDA 5EEHA 5B53A 2QT9A 4DLTA 1H8EA 4KEAA 4JSRA 1E2LA 2NO5A 3H11B 2X0RA 3MJVA 3R20A 1X7YB 1WUYA 4K9NA 5ALQA 4I5FA 5BUQA 1MB9A 4GGOA 1I7SB 4FX5A 2AOUB 2EW1A 2JGMA 2WJ6A 3RHZA 4UU7A 1Q11A 4LRWA 3W78A 1M7HA 1TCCA 2N1BA 1XDBA 2OC4A 3ENNA 3LK7A 3M1IA 4I46A 5DFAA 1M2WA 4QATA 3BHNA 3BK7A 5EKTA 2QLFA 1S7GA 1MABB 1XTBA 2WWIA 3PHLA 2XIJA 4R9NA 3DCYA 3ENKA 3ZUGA 4OI1A 3U4CA 3C1OA 3RASA 5CLIA 1D1TA 2F3QA 1KPGA 1VA5A 1NMXA 3EZYA 4LQ4A 3V46A 4MKFA 1EHIA 2BV3A 4YCMA 1ZJ5A 4MKIA 2I7CA 3RYHA 5IAAA 1OPRA 5KJ1A 4H2DA 3AETA 1H4SA 1JTVA 1O8BA 1E59A 5AXDA 4KKXB 1E3LA 2ZPTX 3DE7X 3IGFA 5J4HA 2ZVJA 1UOEA 1BIFA 3PWSA 4LJKA 2OYCA 4Q9DA 3HL0A 4Z51A 2PZJA 2P7IA 5HKOA 5KAPA 2H1OA 3K1YA 2OV8A 1DO2A 3G9TA 4ZT5A 5AVYA 1NXTA 2XRMA 1FFHA 2FW1A 2G1UA 4XDYA 1MH9A 5KPDA 5KPJA 2BOVA 1MZVA 1QVAA 1VG8A 1KP9A 2ZGVA 4IXMA 4EBFA 1DBQA 4PR3A 3GCGA 4NNPA 2PH7A 4IEEA 1Y80A 5LB2A 3OE5A 3A36A 3WIOA 3A31A 3AI1A 4LDZA 2XTAA 1YASA 3PI7A 1MMFB 5EHNA 1H2WA 3ZQJA 4L9AA 3CGGA 4HMQA 4HPJB 5JDCC 2EG9A 4XWGA 1ZAKA 4NMMA 1G2IA 5DTQA 3F6SA 3ZX5A 2WF6A 2R1VB 3DZ8A 3EIFA 5IN5A 5JS6A 4RMJA 3FPBA 1B43A 1GADO 1P5RA 4Q7MB 1T36A 2VJKA 5GJVC 3MHTA 1I24A 4KQCA 4YWJA 3D8TA 4TMVA 5EKXA 4M7PA 3ME5A 2PQMA 2ZJ5A 4NDNE 4WASA 2HREA 2RHTA 1XWWA 4D56A 2GILA 3HUEA 1UPXA 1X1SA 1DIRA 2YXDA 4RZ2A 3T3EA 621PA 5HDBB 1GAWA 1YA8A 3EN0A 5AI6A 2FY8A 5LYYA 2G72A 4P54A 3FOZA 2DFPA 2OORC 1YACA 3VKUA 1QP8A 1MHPA 4IF6A 4MLPA 5IWAB 2A67A 5DTIA 2ECKA 1O4WA 1PGNA 3ESQA 3QG1A 1YJQA 1YI0A 5HE9A 3SMVA 3O0DA 2Z2XA 3O1HB 4EA9A 2EQ5A 2YL2A 5C46F 1TEVA 2GETA 2NU9A 1SK8A 3IEKA 1DO8A 4PYQA 2VQSA 1TTTA 4UM9D 3CZ9A 4NBRA 2VNJA 2FF5A 1WM1A 1ZUIA 1I2DA 4JLDA 2G36A 4FT4A 5F7JA 3EVFA 1EK2A 3KJGA 3UATA 5E2IA 4F8YA 1YFLA 2PUFA 1QU3A 4EDHA 3V1TC 5DYWA 3EGXB 5GAJA 3IUPA 1EG7A 3C8HA 2RSLA 3U3JA 5HM6A 4X65B 1MQ8B 1ZHHA 3DV0B 3U56A 4PZYA 4ECEA 1XQ6A 4RC9A 4E3ZA 4HUQB 1MP0A 2JLRA 3CXRA 1MJNA 1VPTA 3DWGA 3E8SA 1D7AA 4KP7A 3RTDA 3W3AD 3ZTTA 3ZZTA 4CLRB 2PL3A 5DMXA 2J9RA 4DMRA 2NUPA 3TL6A 4PC2A 4F1JA 3UK1A 3WGUA 4ENSA 2JHPA 2QJOA 3V34A 1EFPB 1PT7A 3PSAA 3PJFA 4U3JA 3ND6A 4MH0R 3EGVA 4O4HA 5DYYA 1A9QA 4GICA 2HRRA 2CK3A 1UK8A 1O08A 1FUYB 3CE9A 1K9VF 3AJRA 1NKTA 1BDHA 1Z0UA 2VO1A 3BAFA 1M6WA 2ACKA 1QDEA 2PXCA 3NXSA 4FYPA 1DKNA 4KTVE 4Y30A 3PJRA 1R0LA 3P7MA 1S4MA 3AEKA 1D9XA 4R81A 5K3CA 4YN3A 4DCNA 1L7EA 1UBUS 3TTYA 1E6WA 5BNZA 3QXXA 4UFNA 2V7VA 1OI4A 5ALIA 3VISA 5CURA 5EP2A 4E11A 1UKEA 4KWTA 4BFTA 3F5FA 3K2IA 1EVJA 5J2UA 4E03A 2OCKA 2GN0A 3R3XA 2QR3A 5A3SA 3PDWA 1FYWA 4MWTA 3S40A 2Q4RA 1P61B 2PUHA 5AD1A 5JAHA 2NVOA 3VKFA 1SU7A 1ZNQO 2Q41A 4NENB 4BKPA 2HMUA 2R00A 4LKOA 1MEEA 1UPUA 4S24A 3HVKA 1NPYA 3U13A 2NUTB 3LAWA 1G3UA 3DZHA 3DBHB 5AVQA 3T5GA 2NYUA 1FFSA 3T3IA 1Q1QA 2BBTA 4EY8A 3DMTC 5ICMA 2JLZA 2VF2A 3R5SA 2VJCA 4D4HA 3Q8MA 1C9YA 4ZXFA 3UAVA 2Y27A 4PX2A 4ND8A 5TMPA 4BJ5A 3LTNC 4QQFA 3TXAA 1T8PA 2PRIA 4LJ4A 3SM9A 5KNCD 1JIXA 4ABTA 2X0FA 1SRRA 4AC9A 5LP6A 4PU0A 4YRJA 3T7EA 4WERA 3TOSA 4CCAA 3MBKA 3D6UA 2AJ8A 3TPCA 5KWEA 4G4SO 4RPKA 2H7CA 1T35A 4AIIA 4PG8A 1KZYC 4KWCA 1T2VA 3AEYA 1IYZA 2PQ2A 2NO9A 3MGBA 3KVNA 4H16A 4TL6A 1YKFA 4ESOA 2ZIXA 4OKNA 5KWSA 4KYTA 1NVXQ 2AD1A 3PNKA 3CLSC 4P5EA 3TRKA 2A5YB 4BFWA 1PUJA 1AGRA 1OB2A 1FDTA 3EUWA 2VYQA 1SVNA 3NNSA 3DPSA 1IY1A 2GN8A 3Q7QA 4JBGA 4MVJP 3RG8A 2I4IA 3ZE6A 1YUMA 5F1YA 1LWOA 3OICA 4IH9A 5EG5A 2ZUDA 2F3PA 3G2MA 2VA8A 2X7HA 1J2RA 2WU1A 2VQDA 3DLHA 2JK1A 4Q4AA 1S02A 1U4NA 2P1ZA 2W37A 3A4VA 2UVDA 3TCXB 5CB4A 4GOJA 1M2OA 1N6RA 2Y2VA 4OU4A 4Z4FA 3CZCA 4G0QA 3BRSA 1IOVA 3H5TA 4R98A 4RSMA 3BAZA 1KS2A 5DLPA 1YJ8A 5CXUA 5DN6D 4PNHA 3A2MA 1IM8A 4NBWA 1WWKA 3IKJA 4EW2A 4LG1A 1K08A 3DDHA 3ZBPA 3SR4A 4DPKA 1XCBA 4ZOLF 4EK9A 5JJBA 4BZXA 1RYBA 1UCFA 3KQSA 5KTOA 1ZUHA 3QWBA 1OHHD 4OOFA 5J5CA 5ALUA 5AK5A 5JNRA 4TMTA 4LZNA 3TNDA 1J9EA 3EQ6A 3GUYA 4GD3Q 2IEBA 3IMGA 2J0QA 4G01B 4BLUA 5ARBA 5J47A 1GHTA 4L4YA 2E3JA 2F1HA 3L0PA 4FC6A 2WJHA 3PGLA 1JDUA 3WL5A 1GAQA 1XI2A 5LOVF 1JWLA 2JJ2D 1PL8A 3WBKA 2FHPA 3UMYA 1F9AA 1XMSA 4MMZB 2GN6A 2GTPA 1KQNA 1XQVA 5HPYB 3KSZO 1BH2A 1PHPA 3CMMA 1T8YA 3I4CA 1YQEA 2C94A 5AUQA 1E1RD 1A50B 1IHUA 3K15A 5A9SB 5TPWA 3W7VA 3GRPA 2JNWA 5F5NA 1AO0A 3SC4A 3I3OA 1VB3A 3WNDA 1U1IA 2ZS7A 4J1TA 4EUSA 4UTPA 4ZVTA 2PX2A 1CHDA 1DJQA 1C8VB 2PWAA 2GKGA 4F1WA 1NBWB 4O0LA 4ZOCA 3WIEA 3GUCA 3D43A 1WW3A 4BGEA 4PGMA 4PLWA 4DLXA 1C3OB 1XEWX 2HLDD 5A9TA 3TLKA 2P2ZA 2Q28A 4EVQA 1RXSA 4QFDA 2A1UB 3QI2A 2DC1A 1NV8A 1CE8A 1BX3A 3MJEA 1XU7A 4GBED 4XOIA 2NM0A 1OVMA 4FDAA 4QLBA 2BTQB 2ZRGA 4GECA 2H63A 5J2TF 3W5JA 2OP1A 2VQ6A 1JAIA 1AQUA 3HDQA 4OKIA 2DUWA 2M1XA 4ZOLA 3LQRA 5JXIA 1E2NA 1NXVA 1ONOA 3EXHC 3HA5A 4YJHA 3T34A 4MW1A 1EG2A 3ZVLA 2PUGA 4HNSA 3G23A 3IAAA 4BKOA 4K2AA 1Z6GA 3DHNA 1TMGE 2I5PO 1KY4A 4GW3A 2GPAA 4IOJA 4O0MA 5DEIA 4A26A 4DDMA 4FQ7A 4NE2A 3TGWA 5LXTF 1QB7A 4C0HA 2F3TA 1HYHA 2Z98A 1DAPA 2YV4A 1YE8A 4LHEA 4UE6A 3WOVA 5KU7A 3GUZA 2C7VA 3O47A 4GI2A 5IEBA 2NIPA 2DKFA 3R74A 1OH7A 3GGSA 5EJ6A 1VYHA 2WUEA 4N03A 4NDAA 3SIXA 4TXJA 1WDWB 2QXYA 3U1TA 4B6SA 4FYYA 3L1JA 2WR8A 1NSYA 1Y3FE 1D5WA 4ZMBA 1JVBA 1C3VA 2WIGA 4KLRA 1QRTA 3I62A 1Z83A 2NZ8A 3L82B 5TQ2A 4JT9A 5CAEA 3GLQA 4G41A 2HTEA 3IAEA 1FP7A 4EYOA 3RR2A 4C21A 3AH8A 2F43A 3HADA 3MVEA 5CNMA 5DX1A 2XNCA 4GX2A 3V1MA 5FWXB 3FBTA 3HABA 4GVLA 3GH1A 2QTTA 4E5SA 1XL0A 2A9VA 1ZJ6A 1ZWLA 5FO0A 3VR6A 1FP4B 2AG1A 4AZ0A 5HJEA 4B3TB 1EEXB 3UYKA 3CR8A 4JUAA 5JJ5A 3V4OA 2OGUA 5EHXA 2IITA 5JLAA 2LGJA 4U7PB 4WNAB 5JSZA 4I5IA 2AOVA 4K1LA 1LV7A 3AEUA 3LGXA 1QIKA 4CIWA 3R3YA 2QVZX 2Z08A 4JQCA 3PE6A 3OZCA 2PLWA 1V41E 2XQFA 2MSEB 4DANA 1V1JA 5I9NA 4X84A 3BMOB 4LF6B 3AM1A 3SGLA 4C20A 2DTEA 1N0VC 2EWVA 2JGIA 4ZVLA 4C7BA 1N8TA 1GAEO 3FSEA 5JY1A 4ZU3A 1Z29A 3OWHA 2YDXA 3SJAA 3E7PA 1RXIA 1YAJA 5K8IA 1O8CA 3VMFA 5DSXA 3DTVB 3P2EA 4L3VA 1AQYA 4YTEA 1G20B 1SCIA 3JQQA 4WUTA 1DZIA 3KZNA 4HBZA 2C78A 4HQOA 4LBVA 5ALDA 3LUPA 3UM9A 5KWJA 3KTOA 4PAOA 5AMXA 3HMQA 5KHLB 1E2JA 3BQ9A 1B93A 4RGVA 3UAGA 3ADCA 2W2KA 1F20A 2CL7X 2C29D 2C2OA 1P5ZB 1CXZA 2OZLB 3OSUA 3IUJA 2IDMA 4ZYYA 1AHHA 1F2TB 4EZBA 5HEKA 2QM8A 1KU6A 1XTZA 2M6KA 2R60A 3L9XA 4H7JA 5JHGB 3DB1A 2DUUA 2P27A 4WLOA 2V9ZA 1Y9AA 1QH0A 1X8KA 3CX3A 1A4RA 1W19A 4Q4CA 2H4ZA 1F1JA 1VYUA 4G9BA 2Q2VA 2HQSA 1SVSA 4CKEB 1G7TA 1NONA 4Q16A 5IWCA 1CG6A 4P6VF 1EM8B 4X7MA 3DMYA 3KFXA 4YBZA 5BWMA 1Z5GA 2GA8A 2AMJA 1JX6A 2AT1A 2PBFA 2OYRA 3W9UA 1IXYA 5BRAA 3MGAA 1I1OA 1FYVA 2YC2C 1CERA 4L2IB 4XQCA 4EKNB 4CQLA 1XTTA 1FUEA 1YS7A 2GI4A 4YJ2B 1HMPA 1JI3A 1O94C 3G7SA 4HP8A 1IIBA 2B21A 4YJ3A 4UFPA 3HUTA 5JI3E 5BRJA 1TEZA 4BN5A 5K05A 5CEFA 3C6BA 3LT5A 5GINE 3KQKA 1E1NA 4A0RA 1YZFA 4ZAFA 2BTOA 3H8SA 2CSUA 5E8JA 3QPAA 1HEUA 3I5MA 4QNMA 3GQBA 1S2OA 1N2JA 5FEUA 4D4LA 4LYGA 4QUGA 1BMDA 4JBWA 2FSGA 1MVLA 1NBHA 2BGUA 4BZQA 2R68A 1QTNA 1KO4A 3ML1A 1R9GA 2B8EA 1YBAA 4G8DA 3DEZA 3LH5A 2V9CA 3W8RA 2KS6A 4B6QA 2F8SA 1QQ5A 2ECFA 3MC1A 4KRGA 2RJ3A 2PX8A 3C70A 3KT0A 2O8FA 1NJ2A 1F2VA 4WDQA 4MI3A 2XVAA 5LWQA 1YT5A 3G9QA 3RFXA 3ZCSA 4CEJA 2KX7A 1XPRA 3L0SA 1SIOA 4GMHA 3O9ZA 1TW3A 1HWYA 3SYNA 1ZH4A 3EY9A 1LDGA 1A82A 1UBCA 2FGJA 4PRZA 3D4OA 4GI5A 4ARSA 3ZVMA 4F86A 5DNWA 4I4TA 3NFYA 1JGTA 2QHXA 2FFAA 1WTCA 3G88A 5H70A 3DEIA 5BYJA 3I52A 1ISMA 1Q77A 1R0BA 1I01A 4CIYA 1LPPA 2PRJA 5ARDA 4G8JA 1B8PA 1JR3A 1KH2A 2ATIA 2O0JA 2PSEA 3MEQA 4MMXB 4LQCA 2W6ID 3IR7A 3OZXA 3TMKA 2M1ZA 1CF9A 2HDNB 1FZTA 2WW8A 3OAAA 3FJYA 4QD3A 4F04A 5D3MB 4EJ6A 1EI9A 3WV5A 2ZYWX 1NF2A 2GLXA 3FPAA 5DGHA 3PQ6A 5H81A 5C37A 1WXHA 2HSJA 1XXHE 2Z1DA 1UWVA 3BMQB 2VAVA 1UZLA 5TARA 3ZU5A 4MKXA 3WLMA 4DCGA 1NHWA 1NXPA 5AOCA 1THGA 1KI4A 2R2GA 2X9GA 1P1JA 3WGJA 3D64A 1XE3A 4ZAWA 1F6WA 4K6GA 4CNQA 1S1MA 2ZJZA 4E33A 3U17A 3LBFA 4N0PA 1D04A 3K5PA 1CZHA 1AZLA 3N0TA 4GWKA 1KVUA 1SXJE 1QHHA 1MJFA 2YHIA 4H31A 3R7WA 2VP3A 1H2ZA 4BQRA 3HDTA 3FIUA 3SXUB 3HG7A 3TK1A 2VPTA 2VL7A 4CG3A 4ZGBA 1BGXT 1IJKA 4X63A 5EXXA 4OTZA 3WGKA 1HFEL 3TMAA 3UV3A 7MDHA 2O5EA 3BWVA 1DJLA 3KOXA 2A0KA 3FF1A 2YKGA 2YASA 1E5QA 4JXXA 3F97A 1Z2DA 1LZLA 2C8VA 2CN1A 1QO0A 2WWHA 2JJ2A 2F3SA 3PVZA 3O83A 1KHHA 3MRSA 3M3DA 3TZCA 1PNTA 1D6SA 4WT7A 5FQNA 1O9GA 4P33A 5C8YA 2W70A 2NU7A 4ZV4A 4IDNA 1XMJA 4JP3A 4BC1A 4PG7A 7REQB 2VH5R 3H1GA 4X54A 5GVSA 2VJQA 5GTDA 3P9KA 4ZVNA 5JDCA 1B0ZA 3HCFA 2R65A 1E6UA 1FSZA 1L7BA 1P74A 2HGZA 1NNUA 1SK9A 1PL7A 2IHVA 1E0DA 1KO8A 3PHHA 4NDZA 3AJAA 1W4LA 3N87A 3FPGA 4TVKA 4OD0A 5TQJA 3BXFA 3OEHA 1U7WA 3BGOS 4TL7A 3GMIA 3ND8A 1ML4A 1DBVO 3DYBA 1JG6A 1FW8A 1QX4A 2P3OA 3A6DA 3IKMB 5EN4A 5FWYA 3FNHA 1YNOA 4J9UE 1OFIA 4H0CA 1RE1A 3WOHA 3P2KA 4TSRA 3AXTA 1Q84A 1RSZA 2CLCX 2Y0DA 2QNBA 3ZW7A 4EUHA 1GP2A 1G4HA 2ZETA 3L0OA 4O2AB 3TKYA 1VMIA 2Y1FA 5JYDA 1DQRA 4YJHB 4PGGA 1X19A 4EKYA 4CVNA 1EZ1A 2CV1A 4G8CA 3TTUA 4ADSG 1Z12A 2BFFB 3QPUA 4LNHA 1G3IA 3H4MA 4H15A 2DWQA 4EABA 3CZ5A 4LUCA 2PKYX 4AZWA 1O97C 4Y0NA 1YFJA 1AZSC 4B3JA 1KDOA 1ENYA 4FN4A 1TMOA 4RVHA 3BULA 5DNYB 3DFUA 1YUNA 4I50F 1TX4B 1AM4D 1GGFA 2HXSA 4LXGA 4EAAA 5LLDA 1IN1A 2GBFA 3O94A 2WWRA 4MRSA 2Z58A 1AXEA 3R6GA 4D6PA 4M9SA 3LLSA 1KZ7B 1R8XA 1AQJA 1PUIA 1USGA 1P1BA 2IHTA 3UJCA 3JQGA 4G0XA 2PQ0A 2ZI3A 3F67A 2WJPA 3TJRA 3ZQUA 2JBHA 3HJGA 1SQ6A 3F7NA 2P78A 5EOVA 1SHZA 2PGAA 4B6JA 3V4PB 4EHJA 3NDBB 1TAUA 1GGVA 1UEJA 1UJ6A 3MIIA 4Y3UA 4A2CA 3THRA 4CF5A 1EXVA 3F2VA 1KI8A 5A4DA 1Y9EA 3N7TA 2HJ9A 4WACA 4BDSA 2HMAA 1LRKA 1H2RS 3PD7A 2IEZA 3WP1B 3AHJA 2F67A 2EBHX 2IFTA 3BL6A 2ZYVX 2ZIFA 3BRWA 1UDXA 1IN7A 3EMBA 2HNKA 4YWHA 4BWFB 3PX2A 3O5AA 2DE0X 1SUEA 3WDLA 2V74B 2W2XA 5AIBA 1AZWA 2JHGA 1Z4LA 1V39A 1AS3A 1NF3A 1WQ4A 2BLLA 1CUVA 2P9CA 1ZQ1A 3GRFA 5FFNA 4HNUA 1EYZA 3FYCA 5A1TA 3AIMA 4I5EA 3I2JA 1G5IA 2V4UA 3E7WA 3D6JA 1DRKA 4NL4H 4ZV7A 4C4AA 5JMWA 5COAA 4C4OA 2B5VA 1K6EA 2QT0A 2YFYA 3AERA 3NHAA 1GZ3A 4X8OA 4WOCA 1E60A 1G0NA 4OJMX 4D9HA 2WM8A 3QELB 4YRGA 1IBKB 1U1DA 1VL0A 1PF7E 1MW8X 5E38A 3LHIA 2F00A 1VGQA 1HPLA 1UDAA 4KJZA 3VDXA 3WISA 3DMNA 4GPIB 3K0EA 4JJ7A 3TW4A 2WY2D 3WQQA 4B82A 5C7OO 5IJ9A 2IYXA 2WQ6A 2JLAA 5BQXA 3T9CA 1G20A 1CR2A 1MJHA 2WOJA 3FKSD 1DBWA 2C2GA 4KW7A 3OMLA 4TTVA 1AGNA 3HP7A 4BX9A 1FDUA 4CEIA 1AUQA 3OPVA 2QPLA 3PJEA 3H1BA 1QHYA 1JI0A 4IIBA 5K0EA 3S55A 1JR3D 1T2NA 4M60A 3SBDA 4WLFA 4I4TB 4Q4AB 3ZXIA 2IW1A 3KT8A 1GRCA 1C80A 1ESCA 3MTJA 3T7SA 4HUJA 1TUGA 4E22A 2W11A 1ZIDA 3HA7A 3HZOA 3K96A 3RRBA 2YXPX 1T9GS 2IZ6A 3QU7A 3QU4A 5IDVA 2OXIA 4F4CA 2MR6A 1RWVA 3GJXC 3WL3A 3TIIA 4WBNA 2HK6A 2FWAA 5DOVA 1H3FA 2ZQ5A 3OURA 5IKOA 1K92A 3GXOA 1JJBA 3JYOA 1IOWA 5C3UA 1TKBA 2AJLI 3PA8A 5IVKA 3A26A 3F3KA 5TJ9A 2EX4A 2FPIB 3L4SO 3UJ7A 4ZO8A 4Z3DA 4MS4A 1G3QA 5I45A 5KINB 4OLJA 4FFVA 1URPA 2XDWA 3IPXA 4X8LA 4IZOA 1DBPA 3EDQA 2AG5A 5L95A 1ZR2A 3B2EA 4GX0A 4F0JA 2WEKA 2WNSA 3D8UA 4HWTA 4TTSA 2N47A 4MPTA 4AP6A 4YRBA 5BUSA 2VRWA 3EULA 3KNZA 2IYFA 4LFCB 4NMLA 4P3PA 1ICEA 3FVQA 4O33A 4B71A 5LR6A 1K3FA 2HA6A 5JDIC 4X60A 3RHTA 3HZHA 1ARZA 2JIRA 1GJRA 3KV1A 3OTIA 3RREA 4N6GA 2CZGA 2ZJ3A 4IX9A 1PNQA 2NQTA 3AR4A 2J32A 3G1TA 4ND5A 5G1OA 3H6KA 1ZJWA 3KOWA 3OZBA 4KE6A 1K2WA 5AM4A 2WKSA 2VUHB 1VKOA 4GQIA 4EHAA 2IZZA 1KS9A 1S8AA 1YKSA 4LS3A 1OT3A 2R8ZA 5CBPA 2NP6A 3OKCA 4D26A 1XVTA 3GJRA 3IJEB 3ZE2B 1G1AA 5HTOA 4O59O 1I6MA 2PJUA 1QYWA 2O52A 5BSRA 5EPEA 1QS0B 5IC6A 2VP5A 4BFZA 5CT5A 1YC2A 2AFRA 4J4BA 3ZHUA 1WE2A 1TYZA 1GQQA 3HYSA 4C0LA 1CNMA 1TUBB 5JD5A 4H35A 5F1OA 3PNLA 3LD9A 1WXEA 3EYWA 3QJ5A 1I1HA 5KNBD 3QYPA 3PQFA 2QBYB 4WA7A 3SSNA 2JFXA 2DSNA 4GLLA 1SH7A 3RC3A 4XSHA 3FCUB 4MQ4A 1B16A 2MYUA 1KJWA 4AJEA 2Z9DA 4HFJA 4EB6B 4DQUA 5IH3A 2UVQA 1J97A 1G9XA 1QG0A 1XKQA 1S3FA 3OF5A 3BEDA 2XV1A 1BEUB 3A6LA 1NI4B 1ZH2A 3OFJA 5AJXA 3RS2A 2RHBA 3QLTA 2XYPA 3AY7A 3I9OA 2UZ3A 1SKQA 1LNSA 1NUHA 9ABPA 1EGAA 1Q5PA 3HXTA 4S1WA 4ZQBA 3WLAA 5K5EA 2BMAA 3PVSA 2BTQA 2YCLA 4F85A 2NT4A 4YCJA 5AQ1A 1WF3A 1YB4A 1M2EA 3AFIA 5AW9A 1MC5A 3M6WA 3ZCXA 4TQAA 1NV9A 2GCGA 3AFHA 4FEGA 3RU2A 3TD9A 2R5NA 4BMSA 4KRYA 1H4VB 5I4KA 4NG5A 3K9CA 3PUHA 5B7GA 3RODA 4DTCA 4CEJB 3D0RA 2TYSB 4JBLA 1OY1A 2YS7A 3OZSA 3VVBA 1BROA 4Q4JA 1CB7A 1FTYA 1LX7A 1MLDA 1FS6A 1L4BA 4MQFA 4PANA 3S7ZA 3CHYA 1NC1A 4IFTA 3GFGA 2W42A 4E1AA 4C76A 5JFOA 4OHYA 4QECA 2AFHA 2G1JA 5G41A 4N12A 3B1XA 3HU2A 3FVVA 1J25A 1KY3A 1NDUA 3AZOA 1F2DA 1Z82A 3GNTA 3H9UA 1I2MA 3HQ4O 4J49A 1COWD 1U0HC 1X14A 3I09A 4RWZA 2IHBA 2JBAA 3JX9A 1N5LA 2RGGA 3WYDA 2LV8A 5I7AA 1UFOA 2DQSA 2EEZA 1O0SA 2J3MA 1YDHA 1E6KA 2MT9A 4LY9A 3L02A 4TS9A 1A7AA 1PR6A 2EL9A 4A8PA 4RHFA 1MPTA 2FWRA 1ZAYA 2RC5A 1SFRA 4QFCA 5E9AA 1C4XA 5MHTA 2V6FA 2X6RA 4G5XA 4LQDA 2A84A 4P7GA 3OT1B 2XUHA 4WZAB 4RCZA 4R0NA 5DMHA 3MCVA 2Z1NA 4H1UA 3UMJA 1EVKA 4JR2A 1LY1A 2VDKB 4YJFA 5I4CA 4PN3A 1QQAA 2JCSA 3W6ZA 3BSWA 5FWAA 1FJXA 2OLJA 3KKEA 2FN4A 4I8DA 4MW6A 3UJ8A 4CRWB 6ABPA 2C42A 3ZHQA 1WZCA 1OVGA 4J3JA 2QTZA 2GN1A 3O4RA 3R5KA 3VOTA 3FHOA 2FQQA 4S1TA 4BLWA 5I8WA 1YNSA 4GAEA 3DNPA 4UAVA 3BMCB 1Y8RA 2HK8A 3PPIA 4Q01A 3IP8A 3V9PA 4UBLA 3CCCA 4IEFB 1ULSA 2P30A 3L0DA 4WLUA 4AJNA 2G5CA 5EFOA 4D8XA 4LIPD 3JZDA 1LX6A 4C87A 2ZKLA 1HT0A 1U04A 3S5UA 4JYAB 4DCTA 2XOEA 1KAGA 3H9EO 4D0NA 2C5FA 1DEKA 5L7WA 1SCDA 3FCSB 1N6LA 1TM3E 2O3QA 4L27A 2ZYRA 3B1YA 3EWSA 3O2QB 3QLUC 3UAYA 5CA0B 3WL6A 5T4EA 4B80A 3VMMA 4EJ0A 1OTHA 3WNCA 4D9JA 4MR8B 1M54A 5LQMA 1P75A 5BNIA 1H66A 4D57A 1T4CA 3OPYB 3P8ZA 4XQGA 1J8YF 4D98A 2D7CA 1NGSA 3PNPA 4DRYA 1H85A 5J40A 1I3LA 1OBHA 3ST7A 1ABBA 1ZRHA 4DA8A 2XYRA 4DA7A 1R4MA 2JGEA 3MAJA 3N2KB 2IXTA 1KAOA 4KJXA 1KJQA 1KEEB 2C77A 3LYHA 2Y1GA 4LMRA 1TPYA 4PE5B 1M1ZA 4QXMA 5CYGA 2D6FA 1PYDA 4RVSA 1RXVA 1U9IC 1HFJA 5K0GA 5JAUA 1RU3A 4Z9YA 1G16A 3HFGA 4J91A 3LP6A 3GOQA 1L1QA 2PZAA 3ROZA 3C45A 1KYXA 4IOKA 1W5EA 3E3LA 5EQFA 1R5OA 3I23A 4AQ7A 4OLHA 5JMTA 1DELA 4BQOA 5DNDA 4RIGA 4K03A 4TROA 1ORWA 1SUWA 1Y5LA 3ZE8A 5KNBA 2X6QA 4D8UA 4F45A 3LP8A 1PG2A 3RJTA 1NZFA 3FYUA 1PN3A 1VPLA 2ZYDA 2YJ4A 3OAAD 4R3UC 4YAFA 1E58A 3RSLA 5DHUA 3DVSX 3LY5A 3PTZA 1DAHA 2FEKA 3SJCA 1IQRA 4EATA 4AS3A 4F6LA 5F78A 1QGDA 1U1EA 2B7LA 3RTBA 5A4FS 5ES3A 1H2FA 3W77A 3KXIA 4M9CA 4ML3A 2WJ3A 5DCWA 4JITA 3C5WP 4EVRA 2A1IA 3TOXA 5AW4A 1Q20A 2JDID 1K63A 3CUKA 3OP4A 3L6DA 4JYZA 3S2EA 3NM4A 1S89A 1VG0B 4YROA 3VBEA 4MA4A 3G2OA 3EVTA 2O7SA 1QAOA 4FR2A 2PBLA 5TDHA 3WXMA 1EVZA 5AI9A 3DZKA 3RUHA 4WBNB 1PZNA 2WPDA 3KUKA 2X5OA 1DTEA 4DHEA 5K9ZA 2VP4A 5C34B 2K6GA 1E62A 2VCHA 4EEXA 3AM3A 4EG3A 3FDXA 1AA6A 3RIEA 4RHCA 2A1UA 4MMYB 1BRTA 1R9MA 4X1YA 4XIIA 1V8OA 4QJ5A 1U8TA 2O8CA 3A2LA 1S4QA 5BYKA 4JYPA 4DR4B 1AD2A 2O1XA 1A2OA 4PHCA 1Z25A 2IIVA 5AI8A 5AICA 1E69A 3QPBA 4PCAA 4R1PA 1L5GB 2JRLA 5TVGA 1NFRA 1KMCA 5AK4A 4DLPA 2ZVDA 4N82A 3IBGA 2ZUTA 3M83A 3MB8A 2IPAB 1R50A 2ZVQX 2CV2A 2EF1A 3WE7A 4JBNA 1H05A 3KE9A 3AZQA 4LGYA 3FCOA 2PGJA 2R8OA 3NC1C 3H9QA 4M87A 2RHLA 4AKSA 2OCPA 3UCFA 3TECE 3GHYA 3TSCA 5KJEA 3VUEA 2QNRA 2HMSA 4A2QA 1Z74A 3ZLVA 2NN3C 3RE1A 3IVXA 4FFBA 1XNGA 3RC2A 3TVTA 4O4HB 4U7GA 4E4RA 4CFYA 2EZUA 5LU8A 2PL9A 4YXFA 2AEEA 1JLRA 1LF5A 1XD8A 3TRJA 1TAHA 1UMKA 2PZ8A 1UXIA 1V45E 1ZX1A 2FFRA 2VZ8A 4IV8A 1H9BA 5DTJA 3IB6A 2IUUA 2VJOA 1SXHA 4CUKA 1Y82A 5D6NA 3FPJA 3C8UA 4IIUA 1N1EA 5BQOA 1N9GB 5JD6A 5I7VA 4DA4A 4P22A 3P2IA 3VHQA 3AB3A 3WSVA 2XMBA 3I28A 4WZAA 3ZBUA 1GUFA 3PFGA 1UBLS 5HIKA 3CRZA 3ERCA 5K8VA 2W48A 2UZ4A 2WU4A 3CPHA 4LCJA 4YYZA 4PAMA 1RAIA 2Z5LA 2OGTA 3N58A 3TNJA 1R5BA 4BVAA 4K0RA 2AMYA 5IBPA 1C4WA 2XXAA 4X9XA 3TQRA 1OSNA 1BXKA 4KGZA 4LKRA 4ND7A 5G0WA 2OV3A 3LX6A 4XYLA 2E37A 3JQAD 4BQSA 3GCXA 4YDSA 2EJUA 4YRKA 3WQRA 3MS4A 1NSFA 4ND2A 5LNK6 3UMCA 1J21A 1L7NA 2C54A 1EMDA 1GY8A 2OO7A 8ADHA 3K6SA 2I7VA 1KRWA 2C5AA 4GG1A 3G8BA 1OAOA 1G2QA 4J7UA 4QLOA 3VDNB 2OVBA 3QYAA 5K03A 4TYYA 1W2WB 3X1ZA 3L0ZA 1JTEA 4ITUA 3SJUA 1V1MA 3FXAA 2I3BA 3H42B 5KX5F 1MFPA 3T9EA 1U7OA 1C8BA 5CA1B 3ZDBA 3AEXA 4OHKA 1W48A 4L8LA 4F4FA 2ID7A 3DC2A 4RF5A 2VT2A 2OC9A 1MT3A 2G4CA 2NACA 2EG5A 1HY3A 3O8DA 4D9MA 1OX5A 2GCEA 3ITEA 2FRVA 3PNQA 3U37A 3MK31 1AMNA 1HE2A 4EMTA 2D00A 3ETGA 2B83A 4ZK6A 3B9QA 2K7FA 1E2KA 4RPLA 2WHPB 3B52X 4K9PA 4TKVB 4X8MA 4PSDA 5EIWA 3C74A 1M1XB 3P0RA 3KFVA 1RPTA 4I3GA 3PIRA 2GCOB 4C6TA 4FYKA 3BICA 4XWYA 4W9NC 1Q50A 4U7WA 1DPGA 4TLAA 4AU1A 1F8YA 1E94E 4FYWA 5CPBA 4KI0A 2XSZA