3FHGA

Crystal structure of sulfolobus solfataricus 8-oxoguanine dna glycosylase (ssogg)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
207
structure length
207
Chain Sequence
MLRSLVQNPKVRARVLERVDEFRLNNLSNEEVWFRELTLCLLTANSSFISAYQALNCLGQKIYYANEEEIRNILKSCKYRFYNLKAKYIIMAREKVYGRLKEEIKPLADEDQQLARERLLNIKGIGMQEASHFLRNVGYFDLAIIDRHIIDFMRRIGAIGETNVKQLSKSLYISFENILKSIASNLNMSVGILDLFIWYKETNTIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-glycosylase/DNA lyase
publication title Crystal structures of two archaeal 8-oxoguanine DNA glycosylases provide structural insight into guanine/8-oxoguanine distinction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna repair, hydrolase, lyase
total genus 90
structure length 207
sequence length 207
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2008-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3fhgA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3fhgA01
1XG7A 3CWSA 2NOIA 4AI4A 1ORPA 1KEAA 4E9HA 1LMZA 3N0UA 4OFHA 3KTUA 3IH7A 4OFAA 3F10A 5KN8A 1WEGA 4PIIA 3CVTA 1P7MA 2I5WA 3FHGA 1YQRA 3IHOA 4OFEA 2NOBA 1MUNA 1DIZA 1EBMA 1XQPA 4YOQA 4UNFA 5AN4A 2XHIA 1MUDA 1PVSA 3KNTA 2ABKA 3CWUA 2NOLA 4EA4A 4YPRA 4B24A 4AIAA 1XQOA 1YQMA 2OFIA 4UOBA 3OH6A 1KG3A 1M3QA 1NGNA 4EA5A 1PU6A 2JHJA 1KO9A 2YG8A 1M3HA 1RRSA 3OGDA 4DK9A 1P59A 1N39A 1WEFA 4E9EA 3I0WA 1KQJA 4EJYA 1LWVA 2NOHA 3CWTA 3D4VA 1HU0A 3F0ZA 1WEIA 4E9FA 1PU7A 3OH9A 1VRLA 3G0QA 4EJZA 1LWYA 1KG5A 1N3CA 5KN9A 5DPKA 1LWWA 1RRQA 1N3AA 3N5NX 4YPHA 2OFKA 2H56A 2JG6A 3CVSA 4HSBA 4EW4A 4EVVA 1MPGA 3CW7A 4B22A 1KG7A 4E9GA 1KG6A 1KG4A 3FSPA 4B23A 1MUYA 1FN7A 3I0XA 5CHZA 4B21A 2YG9A 1ORNA 1KG2A 2NOFA 4EW0A 4AI5A 2NOEA 1YQLA 3FHFA 2NOZA 2JHNA 1YQKA 3S6IA 1PU8A 1NKUA 3CWAA
chains in the Genus database with same CATH superfamily
4E7LA 1XG7A 3CWSA 2NOIA 4AI4A 1ORPA 1KEAA 4E9HA 1LMZA 3N0UA 4OFHA 3KTUA 3IH7A 3VW4A 4OFAA 3F10A 5KN8A 1WEGA 4PIIA 3CVTA 1P7MA 2I5WA 3FHGA 1YQRA 5FRNA 3IHOA 4OFEA 2NOBA 1MUNA 1DIZA 4BDZA 1EBMA 4BACA 1XQPA 4YOQA 3OYMA 4E7IA 4UNFA 5AN4A 2XHIA 1MUDA 1PVSA 3R2XC 3KNTA 2ABKA 3OYDA 3OYJA 3CWUA 4E7KA 2JPSA 4EA4A 2W04A 2NOLA 4YPRA 3OYCA 4B24A 4AIAA 1XQOA 3OYGA 1YQMA 2OFIA 4UOBA 3OYEA 1KG3A 3OH6A 4E7HA 1NGNA 1M3QA 3L2UA 4EA5A 1PU6A 2JHJA 3OY9A 1KO9A 2YG8A 5FROA 1M3HA 1RRSA 3OGDA 4DK9A 1P59A 4ZTFA 1N39A 4IKFA 3OYLA 3LCNA 1WEFA 4E9EA 3I0WA 1KQJA 4EJYA 1LWVA 3S3MA 2NOHA 3CWTA 3D4VA 1HU0A 3F0ZA 3OYFA 4ZTJA 1WEIA 4E9FA 1PU7A 3OYHA 3OH9A 1VRLA 3G0QA 4BE1A 3S3OA 4EJZA 3L2VA 1KG5A 1N3CA 3OYBA 1LWYA 3OYIA 5KN9A 5DPKA 3L2QA 1LWWA 3OS2A 1RRQA 1N3AA 3N5NX 1U84A 4YPHA 2OFKA 2H56A 2JG6A 2V75A 3OS1A 3CVSA 4BDYA 4HSBA 4E7JA 4EW4A 4EVVA 1MPGA 3CW7A 4NZGA 4B22A 4BE2A 1KG7A 4E9GA 1KG6A 1KG4A 3FSPA 4B23A 1MUYA 2W03A 1FN7A 3I0XA 5CHZA 4B21A 2YG9A 1ORNA 1KG2A 2NOFA 3L2RA 4EW0A 4AI5A 2NOEA 3OS0A 1YQLA 3FHFA 2NOZA 3NNQA 3S3NA 5FRMA 2JHNA 3L2WA 1YQKA 3S6IA 4BE0A 3OYKA 1PU8A 3OYAA 1NKUA 3OYNA 3CWAA
chains in the Genus database with same CATH topology
1XG7A 3CWSA 2NOIA 4AI4A 1ORPA 1KEAA 4E9HA 1LMZA 3N0UA 4OFHA 3KTUA 3IH7A 4OFAA 3F10A 5KN8A 1WEGA 4PIIA 3CVTA 1P7MA 2I5WA 3FHGA 1YQRA 3IHOA 4OFEA 2NOBA 1MUNA 1DIZA 1EBMA 1XQPA 4YOQA 4UNFA 5AN4A 2XHIA 1MUDA 1PVSA 3KNTA 2ABKA 3CWUA 2NOLA 4EA4A 4YPRA 4B24A 4AIAA 1XQOA 1YQMA 2OFIA 4UOBA 3OH6A 1KG3A 1M3QA 1NGNA 4EA5A 1PU6A 2JHJA 1KO9A 2YG8A 1M3HA 1RRSA 3OGDA 4DK9A 1P59A 1N39A 1WEFA 4E9EA 3I0WA 1KQJA 4EJYA 1LWVA 2NOHA 3CWTA 3D4VA 1HU0A 3F0ZA 1WEIA 4E9FA 1PU7A 3OH9A 1VRLA 3G0QA 4EJZA 1LWYA 1KG5A 1N3CA 5KN9A 5DPKA 1LWWA 1RRQA 1N3AA 3N5NX 4YPHA 2OFKA 2H56A 2JG6A 3CVSA 4HSBA 4EW4A 4EVVA 1MPGA 3CW7A 4B22A 1KG7A 4E9GA 1KG6A 1KG4A 3FSPA 4B23A 1MUYA 1FN7A 3I0XA 5CHZA 4B21A 2YG9A 1ORNA 1KG2A 2NOFA 4EW0A 4AI5A 2NOEA 1YQLA 3FHFA 2NOZA 2JHNA 1YQKA 3S6IA 1PU8A 1NKUA 3CWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG7 A;  3CWS A;  2NOI A;  4AI4 A;  1ORP A;  1KEA A;  4E9H A;  1LMZ A;  3N0U A;  4OFH A;  3KTU A;  3IH7 A;  4OFA A;  3F10 A;  5KN8 A;  1WEG A;  4PII A;  3CVT A;  1P7M A;  2I5W A;  3FHG A;  1YQR A;  3IHO A;  4OFE A;  2NOB A;  1MUN A;  1DIZ A;  1EBM A;  1XQP A;  4YOQ A;  4UNF A;  5AN4 A;  2XHI A;  1MUD A;  1PVS A;  3KNT A;  2ABK A;  3CWU A;  2NOL A;  4EA4 A;  4YPR A;  4B24 A;  4AIA A;  1XQO A;  1YQM A;  2OFI A;  4UOB A;  3OH6 A;  1KG3 A;  1M3Q A;  1NGN A;  4EA5 A;  1PU6 A;  2JHJ A;  1KO9 A;  2YG8 A;  1M3H A;  1RRS A;  3OGD A;  4DK9 A;  1P59 A;  1N39 A;  1WEF A;  4E9E A;  3I0W A;  1KQJ A;  4EJY A;  1LWV A;  2NOH A;  3CWT A;  3D4V A;  1HU0 A;  3F0Z A;  1WEI A;  4E9F A;  1PU7 A;  3OH9 A;  1VRL A;  3G0Q A;  4EJZ A;  1LWY A;  1KG5 A;  1N3C A;  5KN9 A;  5DPK A;  1LWW A;  1RRQ A;  1N3A A;  3N5N X;  4YPH A;  2OFK A;  2H56 A;  2JG6 A;  3CVS A;  4HSB A;  4EW4 A;  4EVV A;  1MPG A;  3CW7 A;  4B22 A;  1KG7 A;  4E9G A;  1KG6 A;  1KG4 A;  3FSP A;  4B23 A;  1MUY A;  1FN7 A;  3I0X A;  5CHZ A;  4B21 A;  2YG9 A;  1ORN A;  1KG2 A;  2NOF A;  4EW0 A;  4AI5 A;  2NOE A;  1YQL A;  3FHF A;  2NOZ A;  2JHN A;  1YQK A;  3S6I A;  1PU8 A;  1NKU A;  3CWA A; 
#chains in the Genus database with same CATH topology
 4E7L A;  1XG7 A;  3CWS A;  2NOI A;  4AI4 A;  1ORP A;  1KEA A;  4E9H A;  1LMZ A;  3N0U A;  4OFH A;  3KTU A;  3IH7 A;  3VW4 A;  4OFA A;  3F10 A;  5KN8 A;  1WEG A;  4PII A;  3CVT A;  1P7M A;  2I5W A;  3FHG A;  1YQR A;  5FRN A;  3IHO A;  4OFE A;  2NOB A;  1MUN A;  1DIZ A;  4BDZ A;  1EBM A;  4BAC A;  1XQP A;  4YOQ A;  3OYM A;  4E7I A;  4UNF A;  5AN4 A;  2XHI A;  1MUD A;  1PVS A;  3R2X C;  3KNT A;  2ABK A;  3OYD A;  3OYJ A;  3CWU A;  4E7K A;  2JPS A;  4EA4 A;  2W04 A;  2NOL A;  4YPR A;  3OYC A;  4B24 A;  4AIA A;  1XQO A;  3OYG A;  1YQM A;  2OFI A;  4UOB A;  3OYE A;  1KG3 A;  3OH6 A;  4E7H A;  1NGN A;  1M3Q A;  3L2U A;  4EA5 A;  1PU6 A;  2JHJ A;  3OY9 A;  1KO9 A;  2YG8 A;  5FRO A;  1M3H A;  1RRS A;  3OGD A;  4DK9 A;  1P59 A;  4ZTF A;  1N39 A;  4IKF A;  3OYL A;  3LCN A;  1WEF A;  4E9E A;  3I0W A;  1KQJ A;  4EJY A;  1LWV A;  3S3M A;  2NOH A;  3CWT A;  3D4V A;  1HU0 A;  3F0Z A;  3OYF A;  4ZTJ A;  1WEI A;  4E9F A;  1PU7 A;  3OYH A;  3OH9 A;  1VRL A;  3G0Q A;  4BE1 A;  3S3O A;  4EJZ A;  3L2V A;  1KG5 A;  1N3C A;  3OYB A;  1LWY A;  3OYI A;  5KN9 A;  5DPK A;  3L2Q A;  1LWW A;  3OS2 A;  1RRQ A;  1N3A A;  3N5N X;  1U84 A;  4YPH A;  2OFK A;  2H56 A;  2JG6 A;  2V75 A;  3OS1 A;  3CVS A;  4BDY A;  4HSB A;  4E7J A;  4EW4 A;  4EVV A;  1MPG A;  3CW7 A;  4NZG A;  4B22 A;  4BE2 A;  1KG7 A;  4E9G A;  1KG6 A;  1KG4 A;  3FSP A;  4B23 A;  1MUY A;  2W03 A;  1FN7 A;  3I0X A;  5CHZ A;  4B21 A;  2YG9 A;  1ORN A;  1KG2 A;  2NOF A;  3L2R A;  4EW0 A;  4AI5 A;  2NOE A;  3OS0 A;  1YQL A;  3FHF A;  2NOZ A;  3NNQ A;  3S3N A;  5FRM A;  2JHN A;  3L2W A;  1YQK A;  3S6I A;  4BE0 A;  3OYK A;  1PU8 A;  3OYA A;  1NKU A;  3OYN A;  3CWA A; 
#chains in the Genus database with same CATH homology
 1XG7 A;  3CWS A;  2NOI A;  4AI4 A;  1ORP A;  1KEA A;  4E9H A;  1LMZ A;  3N0U A;  4OFH A;  3KTU A;  3IH7 A;  4OFA A;  3F10 A;  5KN8 A;  1WEG A;  4PII A;  3CVT A;  1P7M A;  2I5W A;  3FHG A;  1YQR A;  3IHO A;  4OFE A;  2NOB A;  1MUN A;  1DIZ A;  1EBM A;  1XQP A;  4YOQ A;  4UNF A;  5AN4 A;  2XHI A;  1MUD A;  1PVS A;  3KNT A;  2ABK A;  3CWU A;  2NOL A;  4EA4 A;  4YPR A;  4B24 A;  4AIA A;  1XQO A;  1YQM A;  2OFI A;  4UOB A;  3OH6 A;  1KG3 A;  1M3Q A;  1NGN A;  4EA5 A;  1PU6 A;  2JHJ A;  1KO9 A;  2YG8 A;  1M3H A;  1RRS A;  3OGD A;  4DK9 A;  1P59 A;  1N39 A;  1WEF A;  4E9E A;  3I0W A;  1KQJ A;  4EJY A;  1LWV A;  2NOH A;  3CWT A;  3D4V A;  1HU0 A;  3F0Z A;  1WEI A;  4E9F A;  1PU7 A;  3OH9 A;  1VRL A;  3G0Q A;  4EJZ A;  1LWY A;  1KG5 A;  1N3C A;  5KN9 A;  5DPK A;  1LWW A;  1RRQ A;  1N3A A;  3N5N X;  4YPH A;  2OFK A;  2H56 A;  2JG6 A;  3CVS A;  4HSB A;  4EW4 A;  4EVV A;  1MPG A;  3CW7 A;  4B22 A;  1KG7 A;  4E9G A;  1KG6 A;  1KG4 A;  3FSP A;  4B23 A;  1MUY A;  1FN7 A;  3I0X A;  5CHZ A;  4B21 A;  2YG9 A;  1ORN A;  1KG2 A;  2NOF A;  4EW0 A;  4AI5 A;  2NOE A;  1YQL A;  3FHF A;  2NOZ A;  2JHN A;  1YQK A;  3S6I A;  1PU8 A;  1NKU A;  3CWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...