3FHGA

Crystal structure of sulfolobus solfataricus 8-oxoguanine dna glycosylase (ssogg)
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
207
structure length
207
Chain Sequence
MLRSLVQNPKVRARVLERVDEFRLNNLSNEEVWFRELTLCLLTANSSFISAYQALNCLGQKIYYANEEEIRNILKSCKYRFYNLKAKYIIMAREKVYGRLKEEIKPLADEDQQLARERLLNIKGIGMQEASHFLRNVGYFDLAIIDRHIIDFMRRIGAIGETNVKQLSKSLYISFENILKSIASNLNMSVGILDLFIWYKETNTIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-glycosylase/DNA lyase
publication title Crystal structures of two archaeal 8-oxoguanine DNA glycosylases provide structural insight into guanine/8-oxoguanine distinction.
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Dna repair, hydrolase, lyase
total genus 90
structure length 207
sequence length 207
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2008-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3fhgA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3fhgA01
4B23A 3N5NX 2JG6A 4E9EA 4AI5A 3FSPA 4B24A 2JHJA 4E9HA 1PU6A 1MUDA 4UOBA 1LWYA 1KG5A 4OFEA 1YQKA 2NOLA 1YQMA 2NOEA 4EJZA 4EVVA 4EJYA 1LMZA 4HSBA 4EA4A 4OFHA 2NOHA 1NGNA 1RRSA 1P59A 4AIAA 3FHGA 4YOQA 2NOZA 4B21A 4E9FA 2NOFA 1KG7A 4UNFA 4AI4A 1PU8A 1WEGA 1NKUA 3S6IA 3N0UA 3I0WA 1N39A 1LWWA 1XG7A 2I5WA 2ABKA 2JHNA 4EA5A 1KEAA 4DK9A 5DPKA 3OGDA 3I0XA 4OFAA 3OH9A 3CWUA 1XQPA 2OFKA 1M3QA 1N3CA 1RRQA 1ORNA 1KG6A 1YQLA 4YPHA 2H56A 1KO9A 1PVSA 4EW4A 5AN4A 1HU0A 3G0QA 1VRLA 3CWAA 3D4VA 3KNTA 5KN8A 3FHFA 1ORPA 1PU7A 1YQRA 2XHIA 1FN7A 3KTUA 1MUYA 3IH7A 3CW7A 1M3HA 2NOIA 1LWVA 3F10A 1KG4A 1WEFA 1MPGA 4YPRA 4B22A 1KG3A 1N3AA 3CVTA 3F0ZA 1MUNA 4E9GA 4EW0A 1P7MA 3CVSA 2OFIA 3CWSA 1EBMA 2YG8A 5CHZA 3CWTA 2NOBA 1XQOA 4PIIA 1WEIA 3OH6A 1KQJA 5KN9A 2YG9A 3IHOA 1KG2A 1DIZA
chains in the Genus database with same CATH superfamily
4B23A 3OYBA 3N5NX 2JG6A 3NNQA 4E9EA 4AI5A 3L2VA 3S3NA 3FSPA 3OYHA 4BE1A 4BDYA 4B24A 2W03A 2JHJA 4E9HA 1PU6A 4E7HA 1MUDA 4UOBA 2V75A 1LWYA 1KG5A 4BDZA 4OFEA 1YQKA 2NOLA 3OYCA 1YQMA 2NOEA 4EJZA 4EVVA 4EJYA 1LMZA 3OYEA 3L2UA 4HSBA 3OS0A 4EA4A 4OFHA 2NOHA 3L2QA 1NGNA 1RRSA 4IKFA 1U84A 1P59A 3VW4A 5FRNA 4AIAA 3FHGA 4YOQA 2NOZA 4B21A 4E9FA 2NOFA 1KG7A 4UNFA 4AI4A 3OYIA 1PU8A 1WEGA 1NKUA 3S6IA 3N0UA 3I0WA 1N39A 1LWWA 1XG7A 3OYDA 2JPSA 2I5WA 2ABKA 2JHNA 4BE0A 4EA5A 1KEAA 3OYKA 4DK9A 5DPKA 4NZGA 3OGDA 3I0XA 4BE2A 4OFAA 3OH9A 3R2XC 1XQPA 3CWUA 2OFKA 1M3QA 1N3CA 1RRQA 3L2RA 4E7LA 1ORNA 1KG6A 1YQLA 4YPHA 2H56A 3OY9A 1KO9A 5FROA 1PVSA 4EW4A 3OYGA 3OYJA 5AN4A 3OYLA 4E7IA 1HU0A 3G0QA 1VRLA 3CWAA 3D4VA 3KNTA 5KN8A 3FHFA 1ORPA 1PU7A 1YQRA 2XHIA 3OYFA 3KTUA 1MUYA 3IH7A 1FN7A 3CW7A 1M3HA 5FRMA 1LWVA 3OYMA 2NOIA 4E7KA 4ZTFA 3F10A 1KG4A 1WEFA 1MPGA 3OYAA 4YPRA 4B22A 1KG3A 1N3AA 3CVTA 3F0ZA 1MUNA 3OYNA 4E9GA 4BACA 4EW0A 1P7MA 3CVSA 2OFIA 3L2WA 3CWSA 1EBMA 3S3MA 2YG8A 5CHZA 3CWTA 2NOBA 3OS1A 1XQOA 3OS2A 4E7JA 4PIIA 1WEIA 2W04A 3OH6A 1KQJA 5KN9A 3S3OA 2YG9A 3IHOA 4ZTJA 1KG2A 3LCNA 1DIZA
chains in the Genus database with same CATH topology
4B23A 3N5NX 2JG6A 4E9EA 4AI5A 3FSPA 4B24A 2JHJA 4E9HA 1PU6A 1MUDA 4UOBA 1LWYA 1KG5A 4OFEA 1YQKA 2NOLA 1YQMA 2NOEA 4EJZA 4EVVA 4EJYA 1LMZA 4HSBA 4EA4A 4OFHA 2NOHA 1NGNA 1RRSA 1P59A 4AIAA 3FHGA 4YOQA 2NOZA 4B21A 4E9FA 2NOFA 1KG7A 4UNFA 4AI4A 1PU8A 1WEGA 1NKUA 3S6IA 3N0UA 3I0WA 1N39A 1LWWA 1XG7A 2I5WA 2ABKA 2JHNA 4EA5A 1KEAA 4DK9A 5DPKA 3OGDA 3I0XA 4OFAA 3OH9A 3CWUA 1XQPA 2OFKA 1M3QA 1N3CA 1RRQA 1ORNA 1KG6A 1YQLA 4YPHA 2H56A 1KO9A 1PVSA 4EW4A 5AN4A 1HU0A 3G0QA 1VRLA 3CWAA 3D4VA 3KNTA 5KN8A 3FHFA 1ORPA 1PU7A 1YQRA 2XHIA 1FN7A 3KTUA 1MUYA 3IH7A 3CW7A 1M3HA 2NOIA 1LWVA 3F10A 1KG4A 1WEFA 1MPGA 4YPRA 4B22A 1KG3A 1N3AA 3CVTA 3F0ZA 1MUNA 4E9GA 4EW0A 1P7MA 3CVSA 2OFIA 3CWSA 1EBMA 2YG8A 5CHZA 3CWTA 2NOBA 1XQOA 4PIIA 1WEIA 3OH6A 1KQJA 5KN9A 2YG9A 3IHOA 1KG2A 1DIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B23 A;  3N5N X;  2JG6 A;  4E9E A;  4AI5 A;  3FSP A;  4B24 A;  2JHJ A;  4E9H A;  1PU6 A;  1MUD A;  4UOB A;  1LWY A;  1KG5 A;  4OFE A;  1YQK A;  2NOL A;  1YQM A;  2NOE A;  4EJZ A;  4EVV A;  4EJY A;  1LMZ A;  4HSB A;  4EA4 A;  4OFH A;  2NOH A;  1NGN A;  1RRS A;  1P59 A;  4AIA A;  3FHG A;  4YOQ A;  2NOZ A;  4B21 A;  4E9F A;  2NOF A;  1KG7 A;  4UNF A;  4AI4 A;  1PU8 A;  1WEG A;  1NKU A;  3S6I A;  3N0U A;  3I0W A;  1N39 A;  1LWW A;  1XG7 A;  2I5W A;  2ABK A;  2JHN A;  4EA5 A;  1KEA A;  4DK9 A;  5DPK A;  3OGD A;  3I0X A;  4OFA A;  3OH9 A;  3CWU A;  1XQP A;  2OFK A;  1M3Q A;  1N3C A;  1RRQ A;  1ORN A;  1KG6 A;  1YQL A;  4YPH A;  2H56 A;  1KO9 A;  1PVS A;  4EW4 A;  5AN4 A;  1HU0 A;  3G0Q A;  1VRL A;  3CWA A;  3D4V A;  3KNT A;  5KN8 A;  3FHF A;  1ORP A;  1PU7 A;  1YQR A;  2XHI A;  1FN7 A;  3KTU A;  1MUY A;  3IH7 A;  3CW7 A;  1M3H A;  2NOI A;  1LWV A;  3F10 A;  1KG4 A;  1WEF A;  1MPG A;  4YPR A;  4B22 A;  1KG3 A;  1N3A A;  3CVT A;  3F0Z A;  1MUN A;  4E9G A;  4EW0 A;  1P7M A;  3CVS A;  2OFI A;  3CWS A;  1EBM A;  2YG8 A;  5CHZ A;  3CWT A;  2NOB A;  1XQO A;  4PII A;  1WEI A;  3OH6 A;  1KQJ A;  5KN9 A;  2YG9 A;  3IHO A;  1KG2 A;  1DIZ A; 
#chains in the Genus database with same CATH topology
 4B23 A;  3OYB A;  3N5N X;  2JG6 A;  3NNQ A;  4E9E A;  4AI5 A;  3L2V A;  3S3N A;  3FSP A;  3OYH A;  4BE1 A;  4BDY A;  4B24 A;  2W03 A;  2JHJ A;  4E9H A;  1PU6 A;  4E7H A;  1MUD A;  4UOB A;  2V75 A;  1LWY A;  1KG5 A;  4BDZ A;  4OFE A;  1YQK A;  2NOL A;  3OYC A;  1YQM A;  2NOE A;  4EJZ A;  4EVV A;  4EJY A;  1LMZ A;  3OYE A;  3L2U A;  4HSB A;  3OS0 A;  4EA4 A;  4OFH A;  2NOH A;  3L2Q A;  1NGN A;  1RRS A;  4IKF A;  1U84 A;  1P59 A;  3VW4 A;  5FRN A;  4AIA A;  3FHG A;  4YOQ A;  2NOZ A;  4B21 A;  4E9F A;  2NOF A;  1KG7 A;  4UNF A;  4AI4 A;  3OYI A;  1PU8 A;  1WEG A;  1NKU A;  3S6I A;  3N0U A;  3I0W A;  1N39 A;  1LWW A;  1XG7 A;  3OYD A;  2JPS A;  2I5W A;  2ABK A;  2JHN A;  4BE0 A;  4EA5 A;  1KEA A;  3OYK A;  4DK9 A;  5DPK A;  4NZG A;  3OGD A;  3I0X A;  4BE2 A;  4OFA A;  3OH9 A;  3R2X C;  1XQP A;  3CWU A;  2OFK A;  1M3Q A;  1N3C A;  1RRQ A;  3L2R A;  4E7L A;  1ORN A;  1KG6 A;  1YQL A;  4YPH A;  2H56 A;  3OY9 A;  1KO9 A;  5FRO A;  1PVS A;  4EW4 A;  3OYG A;  3OYJ A;  5AN4 A;  3OYL A;  4E7I A;  1HU0 A;  3G0Q A;  1VRL A;  3CWA A;  3D4V A;  3KNT A;  5KN8 A;  3FHF A;  1ORP A;  1PU7 A;  1YQR A;  2XHI A;  3OYF A;  3KTU A;  1MUY A;  3IH7 A;  1FN7 A;  3CW7 A;  1M3H A;  5FRM A;  1LWV A;  3OYM A;  2NOI A;  4E7K A;  4ZTF A;  3F10 A;  1KG4 A;  1WEF A;  1MPG A;  3OYA A;  4YPR A;  4B22 A;  1KG3 A;  1N3A A;  3CVT A;  3F0Z A;  1MUN A;  3OYN A;  4E9G A;  4BAC A;  4EW0 A;  1P7M A;  3CVS A;  2OFI A;  3L2W A;  3CWS A;  1EBM A;  3S3M A;  2YG8 A;  5CHZ A;  3CWT A;  2NOB A;  3OS1 A;  1XQO A;  3OS2 A;  4E7J A;  4PII A;  1WEI A;  2W04 A;  3OH6 A;  1KQJ A;  5KN9 A;  3S3O A;  2YG9 A;  3IHO A;  4ZTJ A;  1KG2 A;  3LCN A;  1DIZ A; 
#chains in the Genus database with same CATH homology
 4B23 A;  3N5N X;  2JG6 A;  4E9E A;  4AI5 A;  3FSP A;  4B24 A;  2JHJ A;  4E9H A;  1PU6 A;  1MUD A;  4UOB A;  1LWY A;  1KG5 A;  4OFE A;  1YQK A;  2NOL A;  1YQM A;  2NOE A;  4EJZ A;  4EVV A;  4EJY A;  1LMZ A;  4HSB A;  4EA4 A;  4OFH A;  2NOH A;  1NGN A;  1RRS A;  1P59 A;  4AIA A;  3FHG A;  4YOQ A;  2NOZ A;  4B21 A;  4E9F A;  2NOF A;  1KG7 A;  4UNF A;  4AI4 A;  1PU8 A;  1WEG A;  1NKU A;  3S6I A;  3N0U A;  3I0W A;  1N39 A;  1LWW A;  1XG7 A;  2I5W A;  2ABK A;  2JHN A;  4EA5 A;  1KEA A;  4DK9 A;  5DPK A;  3OGD A;  3I0X A;  4OFA A;  3OH9 A;  3CWU A;  1XQP A;  2OFK A;  1M3Q A;  1N3C A;  1RRQ A;  1ORN A;  1KG6 A;  1YQL A;  4YPH A;  2H56 A;  1KO9 A;  1PVS A;  4EW4 A;  5AN4 A;  1HU0 A;  3G0Q A;  1VRL A;  3CWA A;  3D4V A;  3KNT A;  5KN8 A;  3FHF A;  1ORP A;  1PU7 A;  1YQR A;  2XHI A;  1FN7 A;  3KTU A;  1MUY A;  3IH7 A;  3CW7 A;  1M3H A;  2NOI A;  1LWV A;  3F10 A;  1KG4 A;  1WEF A;  1MPG A;  4YPR A;  4B22 A;  1KG3 A;  1N3A A;  3CVT A;  3F0Z A;  1MUN A;  4E9G A;  4EW0 A;  1P7M A;  3CVS A;  2OFI A;  3CWS A;  1EBM A;  2YG8 A;  5CHZ A;  3CWT A;  2NOB A;  1XQO A;  4PII A;  1WEI A;  3OH6 A;  1KQJ A;  5KN9 A;  2YG9 A;  3IHO A;  1KG2 A;  1DIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...