3FHIB

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fhiB01
3RNSA 2QVSB 4X6RB 1CAVA 1UCXA 1O3TA 2VQAA 4EWAA 2IC1A 3C3VA 3NL1A 4ONUA 5I8TA 4FAHA 1LKNA 3ETQA 1NE6A 2IXCA 3UKNA 3OTFA 2Q1ZB 4J1WA 4QM8A 3UKVA 2IXKA 4WZCA 2ETEA 4LTAA 3SCFA 3BU7A 3E97A 4IEXA 4HVRA 5AVPA 1H1MA 1RUOA 1YFXA 1Q3EA 2IXHA 1SQ4A 4R52A 1PMIA 5LEJA 5I0TA 1TQ5A 3H8UA 1NE4A 1U12A 4BYYA 3DN7A 2VECA 1PM7A 3E6CC 1QXJA 1GQHA 2I45A 4UXAA 1EP0A 1ZRFA 4I09A 3JZVA 3SHRA 5JSRA 1LR5A 2GAUA 3I59B 5I0RA 2ZCWA 4GULA 1GQGA 4KWKA 3S0MA 4HBNA 5KBFA 1CX4A 4MUVA 3SCGA 4PJYA 5KHHA 3S7EA 4Q0SA 4XFFA 1O5LA 1O4TA 1QXRA 4LUMA 4ZU7A 3M3IA 3ES1A 4N9HA 3EO6A 5I93A 5KHKA 3ST7A 4JTOA 3FWEA 2V09A 3KMHA 4YRDA 4YNIA 3RYPA 2CV6A 4XFGA 1O3RA 3UKTA 5LEKA 5J7MA 4ORFA 2H6BA 3NJZA 4QXKA 1CAXB 4I0BA 3LA3A 5JAXA 1JUHA 3ROUA 2HKXA 4TLFA 1YLLA 2EA7A 4BIFA 3FE5A 3FZ3A 4HN1A 2ET1A 1ZZBA 1O7FA 4E2GA 5I0SA 4K8FA 1UW8A 2VPVA 5C6CA 4IEUA 4HN0A 4EROA 2P17A 4QGNA 1UD1A 2PA7A 3HQXA 5HI0A 4YYOA 2XLFA 4WBBA 2WC2A 3IDBB 2PQQA 3KCCA 4WVZA 3WW3A 1SFNA 2EVXA 4QM9A 5KHIA 4AVBA 5FLJA 3OCPA 4HMZA 3MYXA 2H0VA 1EPZA 1YHFA 3EBRA 3BPZA 4O9EA 3CL1A 1I6XA 2QNKA 2QDRA 3E5XA 4IEZA 4I01A 3OGJA 2ET7A 4DINB 1CGPA 1DGWA 4IEYA 4A2UA 4Q29A 4FBFA 5JCTA 5KHJA 4XFAA 4LA3A 2BYVE 1FT9A 2UYBA 1YWKA 2BNOA 1NZCA 2XLGA 2UY9A 2Z2SB 4IESA 4E2QA 1X82A 4BH9A 1O3SA 4Z82A 1J59A 1CAVB 1Y9QA 2H6CA 4P9GA 3FFQA 3TNQA 2MNGA 1CAWB 4J1XA 3CEWA 4HLTA 4D7TA 2WFPA 4F7ZA 4XFHA 2GU9A 1WLTA 4I02A 5D1IA 5LRSA 3RYKA 4AVCA 2CAUA 1VP6A 1ZRCA 1UPIA 3E5QA 2PAKA 4O9GA 1RL3A 4PIXA 4KL1A 4AQ2A 2XLAA 4Q0UA 4FT8A 2Z69A 4N9IA 2O1QA 3D82A 1ZX5A 4LA2A 1FI2A 1YUDA 1DZTA 4H7LA 4XETA 3H3UA 1OD5A 3DKWA 1ZVFA 5I91A 3FHIB 2Q0AA 3RDIA 4HVQA 1QY4A 3IWZA 2OYZA 2Q30A 1ZZ9A 4XF9A 2E9QA 2QJVA 1O5UA 4YSFA 3CF6E 4IETA 5JSPA 1ZREA 3MPBA 1X8MA 4MV2A 5FPXA 2MPFA 2GZWA 5E1RA 2UY8A 3BB6A 3PLQA 4FAGA 1UIJA 1NYWA 5T3NA 2IXJA 4QGLA 2B9UA 2OZJA 3CO2A 3WW4A 4IEVA 1CAUA 3B02A 5EZWA 3WW2A 4XFIA 5CU1A 2XGXA 5FQ0A 1ZRDA 3QOPA 1YFYA 2PHLA 3FX3A 1OI6A 2UYAA 1DGRA 1YFWA 1O3QA 1G6NA 5BUVA 2O8QA 4MGZE 3LWCA 3HT1A 4HSJA 3WW1A 4EWDA 2BNNA 2XHKA 3H7YA 3E6DA 1RUNA 3USSA 1QWRA 3NVCA 2B5HA 1LB2A 1V70A 3CJXA 4LULA 4XF0A 1NXMA 3OD0A 3LAGA 4OFGA 3EJKA 5J3UA 1ZRRA 3IIAA 4XFCA 3ES4A 3KGLA 4Q0PA 3M70A 1RC6A 4QGMA 4Z07A 5FLHA 4META 1RTVA 2PYTA 2Q4SA 4EWEA 2XL7A 3U0ZA 2D5FA 2F4PA 4F8AA 1YFUA 2IXLA 4HSLA 2GC1A 3D0SA 4XEZA 2XKPA 1H1IA 4E2SA 4LUKA 3SMHA 3I54A 4KU8A 1UIKA 5E16A 3L2HA 3GYDA 4UBGA 3LZZA 1Q5OA 3LOIA 5I8SA 2OPKA 2K9ZA 1J3PA 1J58A 1ZZ7A 5KHGA 1ZZ8A 4Q0VA 3NKTA 3H7JA 4B29A 2EAAA 5I0UA 3RZZA 1FXZA 4Q0QA 3SXWA 4I3PA 4IEWA 4XF3A 3BALA 1WA4A 2ZKLA 3BCWA 4ZU4A 4L2NA 4MGIE 4JTNA 5BPXA 3VHRA 4UBHA 5JSOA 3I59A 1CAWA 4EV0A 4OLLA 4QX5A 1Y3TA 3R6SA 1SEFA 4D7SA 4R8HA 4AQ6A 1ZZCA 3H9AA 2PFWA 4X6QB 4XF4A 4MH0E 3N4MA 3I7DA 2BEOA 4PIYA 3H1WA 2CGPA 2PHDA 4RD7A 2Y0OA 4AXOA 4I2OA 3IDCB 3OF1A 1CAXA 2OA2A 2N7GA 5FQ0B 4IERA 4AVAA 3DL3A 1XRUA 1X7NA 1Q43A 3PVBB 4XFBA 5FDBA 4NVPA 1I5ZA 1XE7A 2QCSB 4MGYE 1VJ2A 1ZZ6A 3NSTA 3SCHA 4LEJA 4QMAA 3MZHA 4IEOA 3IBMA 2D93A 4LLOA 2XKOA 1VR3A 3H1YA 5FCCA 1RGSA 3G7DA 2FMYA 5BY5A 2K0GA 3DV8A 2PTMA 3TNPB 2GC2A 2IXIA 4BHPA 4PIZA 4KWJA 3U11A 4L11A 1CAUB 5I8YA 4KU7A 3H1MA 3ACLA 5FLIA 3KGZA 5FPZA 3EHKA 3RYRA 3NW4A 3S7IA 2PAMA 1OMIA 3O14A 4IEPA 5JR7B 5CVRA 4MGKE 2PAEA 4MX3A 1J3QA 4I0AA 2B8MA 3EQEA 3QACA 1J3RA 1OFNA 2BNMA 3LA7A 3RPQA 2D5HA 4HZFA 3HT2A 4JVAA 3HIFA 3E5UA 3H50A 2D40A 3D0JA 3U10A 2MHFA 4ZU5A 1J1LA 1LRHA 2XL9A 3FJSA 3H3ZA 4MZUA 1XE8A 5F1RA 1ZNPA 3E6BA 1WGPA 3ELNA 1IPKA 4HVOA 2CAVA 4KWLA 2GC0A 4CYDA 3KSCA 2DCTA 4XF1A 2GC3A 5LRRA 3MDPA 3CLPA 2KXLA 2BGCA 3GBFA 2HJIA 4JV4A 2OZ6A 5CADA 5C8WA 3LA2A 3ZDSA 1L3JA 1EY2A 2C0ZA 2ATFA 4IEQA 5J48A 5K8SA 2FQPA 1DZRA 5BV6A 1IPJA 1EYBA 1HW5A 1X8EA 3PNAA 5BXXA 2GH2A 4YARA 5EFUA
chains in the Genus database with same CATH superfamily
5F7UA 2CTVA 1O3RA 1YC61 4A4AA 2NMOA 2R32A 3C8XA 4X6RB 3USUA 3ZXAC 4LLFA 5FTTC 1QJZA 4IV1B 3Q8BA 1LENA 2KA3A 3C3VA 3HNYM 1GZWA 3X29B 1N1SA 1R091 2WNVC 2FDIA 3ETQA 1N3OA 2Q1ZB 3WUDA 3DECA 5FZOB 1W9YA 5FY7A 4LTAA 4TN7A 5IJRA 2VC9A 2D44A 2Y38A 3KCYA 4YZ3A 4COZA 2BRTA 2J1SA 4IEXA 4FPJA 4NPMA 3BN6A 4YLZA 1NUKA 2BOJA 1RUD1 1Q3EA 4URTA 3PJQA 3VD5A 4FPOB 1WKYA 1XQNA 4KG0A 1PMIA 1RHI2 1SLIA 2VOWA 4SBVA 5I0TA 5LEJA 1X50A 4Z92B 1TQ5A 1OQ1A 2VZTA 2ZX2A 5EYXA 1T6BX 1U12A 2B39A 3WD5A 1V6OA 4CCOA 4Y22B 4UT5A 2FMDA 2F17A 1GMMA 1PM7A 1QXJA 3LFMA 2WWSA 5K4LA 3LSDA 4IE6A 1RUE1 2RM22 2WR9A 4CDQB 1W6OA 1EP0A 4QU2A 3HVDA 1DQ4A 1ZRFA 2XR4A 2BBVA 3SHRA 3AKSA 5I0RA 5FZLA 3ZLIA 1VBC2 2RE9A 2RDSA 2W68A 2ZBJA 3P3PA 4AGGA 2X5IB 5A3NA 4MUVA 1VE0A 2JDAA 4QB1A 3UJQA 2JICA 4NAMA 4PJYA 5EFUA 4ZS2A 5AVAA 3S7EA 4LT5A 1ZRIA 5F6KA 4M3CF 1O5LA 4ES8A 4OI1A 5CKNA 5EWSA 2JD4A 3J8F2 5CFCA 2W94A 4AVSA 1KXGA 4LUMA 3I8TA 3ES1A 2R061 3EO6A 3PUSA 2D6MA 4JTOA 2BBAA 3NNFA 1JZ7A 1WWYA 3RYPA 4AQTA 4FFHA 2CV6A 5DPNA 4XFGA 1XYOA 2DF7A 1RUC1 2Y6LA 5J7MA 4GIQA 4ORFA 4QXKA 2D7FA 1FPN3 3LA3A 2WN2A 4I0BA 4GWNA 5T5OA 2XPJA 1EAH2 4WM8C 3ROUA 1HDKA 1YQ5A 3RZHA 2RDNA 2V4AA 2EXKA 3NJXA 4GAZA 1UZZA 4B7EA 3KQRA 3MW3A 4UW3A 5JLVA 3POIA 3IDAA 2QQWA 4GJZA 4E2GA 5I0SA 5L7OB 3ALQA 1HLCA 2HBTA 2YY1A 2A6WA 3ASIA 2P17A 4QGNA 5DAQA 1GP4A 1UD1A 4AK3A 5IK4A 5HI0A 1N1TA 4YYOA 3MEPA 3GCXA 4PT6A 4I3GA 1IPSA 4JDNA 1CZSA 2CL2A 3AP6A 1C3HA 3IDEA 3KCCA 1YI7A 5IFPA 1SFNA 5HCAA 3T2PA 1ZA4A 1C5IA 4TSVA 2Q8CA 4AW7A 3WF4A 4MXWA 1LOAA 3J7MA 3AZZA 2IWGB 1RJ8A 2VMCA 3ETPA 4TYSA 1GBGA 1WZXA 4Q1RA 5EP9A 4ISQA 1H8TC 1WW4A 4FTBA 2H0VA 1DQ6A 1TME3 2B9VA 2OPWA 1EPZA 3WNPA 1H9WA 1QQP3 4O9EA 3CJIB 3T4VA 1UOFA 1PM4A 2OIIA 3MIGA 1ASJ3 1Q8VA 1OH3A 2ZEWA 1VBE3 4E27A 1I6XA 1MZ5A 2QNKA 4XBLA 1EPWA 3POWA 1JMUB 4IEZA 4YW3A 2GH8A 4BXSV 2IVIB 1S0IA 4PQ9A 2VUAA 4Q29A 4JRLA 1GP6A 4A7YA 1MS3A 4C1XA 1FT9A 3D6EA 5LB6A 2JIJA 1FAYA 4PDWC 1TMF1 2BNOA 4C0BA 1NZCA 1QXPA 2XLGA 2YGMA 3Q9OA 2Z2SB 5FP4A 4CDUA 3PHMA 1J59A 1CAVB 2H6CA 1PMJX 1HB4A 3CEWA 3LPFA 2A75A 1SCRA 4IV1C 1QQP1 3EMRA 3I2IA 4QHOA 1UZVA 3D4KA 4Y3OA 3MIFA 2QQMA 4INDA 4QHZA 4L0PA 1UPIA 4CEYA 3O5SA 2RR13 2DFBA 2YU1A 2ZKNA 2RDQA 5L7OA 1RUF1 5I0DA 3THTA 4DZGA 1NLRA 3I3QA 4AQ2A 2LTNA 3TEXA 3VBHC 5GLWA 3B5LB 4D69A 4GJYA 2VZUA 3KV4A 1VAVA 2O1QA 2JECA 1DGWX 4LA2A 1IS3A 1XJAA 3OPWA 4UF0B 1UY4A 2QFEA 1DZTA 3AZXA 4G3YC 2NQYA 3VBFB 3MIBA 4MXVA 4CEWC 1MS1A 5DABA 3LEKA 3AYEA 4YVWB 4FOWA 1NQDA 4XBNA 3HAGA 4NIDA 4HK9A 1WCKA 1GUIA 2CWSA 1RUG2 3FHIB 4UFJA 4CDQA 1F5JA 3I2DA 3C2UA 1YEWA 2JE7A 1C8M1 2IFRA 2HWB3 4KGGA 3BPSA 3G6JB 1CR7A 1I3HA 1J84A 2VZQA 2JXAA 3ATGA 3VD7A 4XJZA 1UYPA 2W0XA 4KGQA 1FYUA 1AR92 4E4DX 1CPNA 1DYKA 3AMHA 5FZ6A 3NKGA 1ND2B 3ZFFA 1Z7S1 5DMYA 3HEIA 4QQLA 3AKQA 3M3CA 4FFGA 3FHAA 1HKDA 3ZXEA 5HBAA 3SKJE 1Q8SA 2A70A 2UY8A 2R062 3VDDA 1GP5A 4FAGA 1UIJA 1VMJA 3H3LA 1X33A 1Q8OA 1WUVA 2IXJA 3FLPA 4CDXC 3KHCA 3VDCA 2OZJA 3JB4C 4NRQA 2DV9A 2R073 3CO2A 1JXNA 1GOGA 3GHMA 4HPKA 4PDWA 1H2LA 4P14A 1OOPA 5F5CA 4CDUC 5FMOL 5A3TA 4XFIA 5CU1A 5FQ0A 3KB5A 2CU5A 1PGSA 1QH6A 4OVEA 1PGL2 1S0GA 1UOBA 3FLRA 1LU1A 3Q8CA 4QQHA 3W5MA 3N7JA 2FCUA 5ANNA 1GZ9A 3I3MA 3MUY1 2ZHNA 4RFRB 3LOBA 1Y9MA 4OI0A 1POV0 2W39A 1TVGA 3GZEA 1O3QA 3UETA 4EN7B 4S2FA 3NMBA 1IKPA 1W6QA 5JZGA 2X53S 2TNFA 3PVOA 3VBOA 2P6CA 4TXWA 5CEHA 3ZN6A 4EWDA 4XAAA 5L7OC 1NY72 1DQ0A 1LECA 1ZBA3 4GXLA 4JC1A 2W1SA 3RRDA 1RUNA 5KWRA 1X9PA 2B5HA 3OEBA 5FPLA 4K20A 3KF5A 3ORJA 5BNQA 1LB2A 2A3XA 2D3RA 2VZRA 4XHXA 1SCSA 3LEMA 1HIXA 2XXZA 1KFXL 4EE2A 1MQTC 4KH9A 3ZYRA 4LOSA 1W0PA 4OFGA 2Q8DA 1F31A 1W0NA 3VB9A 1HJFA 2YDEA 2VZSA 1YQ2A 4XDPA 5FYUA 2WNEA 1X36A 3NNJA 2PHFA 4BJ0A 1QMJA 3SKVA 2YYOA 4FPGA 4PF5A 4A6SA 5FPBA 4QGMA 2VUJA 5FLHA 1NCRB 2JDHA 5F5IA 2W47A 5LBBA 3L2YA 3WOGA 3VGIA 5C3QA 1ENRA 3H8OA 2D6OX 4LQRA 1WCSA 4W50A 2J7MA 4YZ1A 2W08A 2PYTA 4O65A 2W3JA 1W2UA 1WMDA 2ZGPA 1UN1A 1Q8QA 3AVSA 3GF6A 2RS51 2QTWB 1XNBA 4N8MA 3WP6A 1YFUA 4HSLA 4RR3B 4F8AA 3IM0A 1HRI2 4XEZA 3TN93 1PNGA 1NKGA 3IAPA 4N90A 5JPMB 1K5MA 2OQ6A 4OHZA 1G9FA 1H8VA 4SLIA 4LO8A 4Z1VA 1QEXA 3KF3A 4OQ8A 1UU5A 3HN1A 4UW5A 1SDDB 4F3JA 2IFWA 5DZGA 3I54A 2VH9A 4RGKA 1UIKA 4P5YA 1OA3A 4DRVA 5KXCA 5DZEA 3W20A 2R071 1OOPC 1YI9A 2DVGA 3LOIA 2EALA 1OQEA 2RS52 1AXZA 2XMLA 3AKRA 2C1FA 2WS92 4MXWB 3AFKA 2PHTA 5I8SA 5D21A 4AHWA 1CX1A 3KVBA 4XILA 3ACHA 1J58A 4M3CE 1NLQA 3DEMA 5DG1A 3VBOB 3JBG3 5D8AC 4R4ZA 5FPAA 1JU3A 1ZZ8A 2EXHA 3NAPC 1RUJ2 3AP7A 5CKQA 2WBKA 3RZZA 1O8PA 5LWBA 1FXZA 2LUWA 4AVVA 1Z0HA 3UGGA 3R05A 2WO2A 1ULGA 3ZFEB 1F4AA 4NO4A 4NMIA 4FXKB 1R092 2TBVA 1XYPA 3T09A 2ZKLA 2VNVA 3T4HB 3OGRA 2R49A 1UU6A 2JKXA 2UWAA 1CD3G 2Y60A 4OULA 5F3EA 3VHRA 3USUB 4UBHA 2WYSA 3VKMA 5T52A 1CAWA 1CWPA 4UFKA 3WP4A 4L9BA 1BK1A 5DAXA 5H9SA 5FREA 3R6SA 1VBE1 2W5FA 3CJIC 3O0VA 4LO4B 1KFUL 1ND2A 1AL0G 1PGW1 1YO8A 1ZZCA 2D43A 2WFF3 3GZUC 1HRV1 4ISRA 4AQ6A 1BJQA 2VCCA 4NWVA 4CCEA 1DDLA 3KHBA 4RFT0 3RI9A 1KS4A 1D4M1 4LORA 1UO9A 4XF4A 2Z5WA 4MH0E 5F2SA 4AR2A 5LBCA 4PIYA 1QOSA 3CNAA 3UK9A 1PVC1 5BNPC 2CGPA 1GU3A 4DO0A 2PHDA 2VOKA 3UL2A 2DYCA 3JD72 4RS5B 2VVEA 2Y0OA 1LNSA 3WZ1A 4DUVA 5FR3A 2XVLA 4AXOA 4YVSA 1NA1B 2AACA 1YCIA 3OF1A 2ID4A 3VBFA 4HKWA 3VZMA 1I1EA 2HWE3 4BK5A 4XUPA 1XE0A 3GXUA 1N3QA 1OLME 3LKJA 4XACA 1PZ9A 2E32A 3I4IA 1AR91 4OI4A 4S2DA 2AC1A 4I30A 2UU8A 4GWJA 3U78A 2ZGUA 4DUXA 5A3WA 4ATFA 2TUNA 2QCSB 3IPVA 2RS13 2HWB2 2EF6A 1AYM2 3WF3A 4C8DA 2BOIA 1R1A1 1UMZA 4JZRA 4B1LA 3CZJA 2WAOA 1DP0A 4IV3C 3ZSMA 1LHVA 4IEOA 2D93A 3K4DA 2Y6FA 4YM2A 3VZOA 1DIWA 3N9MA 1VR3A 3H1YA 1W8NA 1YRZA 5FYHA 3G7DA 3ZR5A 2X10A 1JYCA 1LOCA 1WBLA 3I97A 1DF0A 4W65A 1XU2A 4YPJA 2R063 2PTMA 1ZBA1 3TNPB 2E51A 2OUHA 1BCXA 1AYN2 4IGQA 2ZAAA 4KWJA 5LBFA 1HRV2 5DDJ3 1W6NA 5IVCA 1NCRA 5FWEA 4ASLA 4LO7A 2YMZA 5HXMA 3PU8A 4YG0A 4LXLA 2WYFA 3J8F1 4RYDA 5FPZA 3RYRA 3S6PA 2ZGNA 4AGRA 5F9TA 3RZKA 2GNBA 2LALA 3OYWB 4GB33 5DG2A 4MX3A 1ND2C 3O7OA 4NOTA 4CCMA 1J3QA 4JKKA 2B8MA 3MIHA 3CBNA 2BNMA 3U14A 5AC92 3OBTA 3AL6A 3TN91 2E53A 5F8PA 3WVJA 4BQ2A 3J26N 1DGRN 5K0UC 3U10A 5FO8B 2DU0A 3JU9A 4R4XA 4ZU5A 2HWF1 1LRHA 2VQTA 3H3ZA 2WWJA 1XE8A 1ACCA 1OVPA 1P8JA 3M3OA 3BIWE 4NR1A 3VBSA 3OUIA 4YVSC 1R082 2E33A 4YGCA 1GZCA 4UAPA 1G9AA 2ZHKA 3PU3A 4CYDA 2AZ5A 1XU1A 2C4XA 3KM5A 4L8QA 1CIYA 2GC3A 2WO1A 5F6LB 1US3A 2QBXA 3HMYA 5LY1A 1GNZA 2BGCA 5D8AB 4CPBD 3GBFA 2DCZA 5JUVA 2CDOA 2JB8A 3OB8A 2FDGA 2OUJA 4CU6A 4BZ4A 1WW7A 1WMXA 2WLQA 1NCQB 2VUCA 3GBWA 3DYOA 1OSGA 1EY2A 4PHZA 5J48A 1MPXA 5BV6A 1JN2P 1IPJA 3TEYA 4YW4A 5CISA 1V00A 3PNAA 1EV13 4V1PA 5A6QA 3B9IA 4XYXA 4YARA 1SLAA 2DU1A 2CSGA 3JQWA 5A33B 5FY0A 1CAVA 1UCXA 3NRUA 3VBUC 2W1UA 3LE0A 1O91A 2IC1A 4IE4A 5HV0A 3O1MA 1RUH3 2ORXA 4QX1A 2ZX0A 1NCRC 3J9SA 1KGYA 1UKGA 4WM7C 1NE6A 2IXCA 2ZACA 2IXKA 3MO4A 2ETEA 2A6XA 4HG6B 4XUNA 4A3ZA 3PUIA 1GR3A 1QJY3 3SCFA 1BK0A 2HWF2 1LHNA 3BU7A 5A7QA 3VBHB 2ZGQA 4HVRA 4Q26A 1CN1A 2DUQA 1RUOA 5CG8A 1OLMA 4BLIA 1QU0A 3FBMA 3GNEA 1OURA 1SQ4A 4R52A 1DQ1A 2HWD3 4GH4B 2MEV3 1RINA 4AAPA 2FDJA 1PK6A 1NE4A 3A21A 4YVWC 2HH9A 3M4FA 3GHNA 4N43A 4Y1ZA 1JOJA 1VB2A 2J1AA 3U75A 2P6HA 4ASMB 3E6CC 5A1FA 3LEIA 1GQHA 3AMPA 2I45A 1VBC1 3I2HA 4P02B 4GKXA 3IMNA 3JZVA 1H6XA 3VV1A 2YC0A 4AAXA 1W28A 4AFAA 2K46A 2BFUS 4GULA 5GLTA 1HB2A 3WF0A 1S0EA 4HBNA 1XOYA 2EXJA 1CX4A 3WNNA 2HWC2 1GLHA 4LKDA 5KBFA 4YWAA 4Q4X3 2BW8A 5KHHA 3BOPA 3RVHA 1WLDA 3LFIA 1TZOA 4OHWA 1C8NA 1ENQA 4LHLA 5DQ0A 5F2WA 1JOPA 5GZFA 4AEKA 4CCCA 5JIUA 4NN0A 3H8RA 2XJVA 2QQJA 5FUNA 5I93A 5KHKA 3ST7A 2Q5TA 4BE3A 2Y33A 4XMAA 2OQ7A 4YNIA 4CDUB 1V6IA 4NRMA 1A78A 1EAH1 2ERFA 2CNAA 3LCPA 3WR0A 1OPMA 5FYZA 1S2EA 1CAXB 1MZFA 3SH5A 5FZ3A 4CDWA 2VMGA 1QOTA 5JAXA 1JUHA 3THDA 1F4HA 1OA2A 2BU9A 2WO3A 2EA7A 5FIXA 2W52A 3FE5A 2VBBA 2O8OA 4HANA 2FCTA 3JB8A 3KV5A 3KLSA 2PELA 2A71A 4CU9A 1O7FA 3THPA 5C33A 5JZGB 4K8FA 2VPVA 1AUYA 1IKQA 1UY3A 2GN7A 4QPGA 1GNHA 1ULOA 1IS4A 1ZA7A 4HK8A 5ANQA 5CFCC 1F2NA 4Z8BA 3I49A 2CGOA 5DUXA 4K21A 3WDWA 2D3PA 3O0XA 1D7PM 3HQXA 5IVYA 1W90A 2JG9B 2XLFA 4PBPA 5C4WB 1WCQA 2DTWA 1C57A 3IDBB 5IVEA 5FY1A 2XQRA 4WVMA 2EVXA 5JXGA 3WDVA 2Y64A 4LIUA 5CIRA 4YVWA 1ZBE3 3VKNA 5KHIA 3ENRA 4DY3A 3WNOA 1FMD2 2ZGRA 1ZM1A 4IQPA 5FLJA 2YUEA 2ZZJA 3OCPA 2YBKA 4DRRA 1IQDC 4HMZA 4QB2A 4EQVA 1RUH1 2NZ9A 3Q8AA 1SPPB 3HOBA 5GLVA 4UI9L 1Q56A 1EUUA 4WV8A 5ERLA 2W1QA 4LNVA 5FZ1A 4Y20A 2NM1A 4IGOA 5CFDC 2K2SA 3SNMA 1W8HA 1FX5A 2VCAA 4MSVA 3BIEA 1VMFA 4AZZA 1AVBA 2QDRA 1OA4A 2RS11 3VHNA 1F5FA 4I01A 4BU2A 4C1WA 4A3XA 1TMF3 2ET7A 4DINB 3K51A 3PIGA 1TEIA 5KHJA 1VRBA 3MUZ1 3M7AA 5FP7A 1QNYA 5A7PA 5BNPB 3JCIA 1S2KA 4ZXKA 2UYBA 3WHUA 1XPWA 1RJ7A 1YWKA 2J22A 5C8CB 3AXDA 3B9CA 4IESA 2WZR1 3I2JA 1NA1C 1Y43B 2DVDA 2O14A 3R4UA 2YXSA 4AWDA 1KJRA 2JKBA 3U4SA 4BH9A 2FDKA 1HRI3 4P9GA 1QJEA 1PIV2 2MNGA 3TN92 4LO6B 5DN2A 4D7TA 4F7ZA 4NIGA 4XFHA 3BOWA 1CVNA 1LAJA 2PLV3 4I02A 4PCRA 5D1IA 3PL0A 1W3VA 5IFTA 2UURA 2R072 4GZ9A 4AVCA 2EAKA 4CXXA 1UZWA 4RN5A 1YQCA 1SBFA 2BTVC 2WNOA 1R64A 4OHYA 3I2GA 2PAKA 5LASA 5FBJA 2HEVF 2F4LA 3EXUA 4PIXA 4XCBA 4XQWA 5GM0A 2P1BA 4FT8A 4N9IA 5FOBB 4H14A 2P2KA 2W1WA 3C7HA 2VGDA 4P9WA 4PLMA 4BWOA 4AI0A 1FI2A 1N47A 3ILRA 4DXRA 5IAXA 3UGHA 3O1PA 5FK8A 2HLEA 1D2SA 1PO12 1D0HA 3MW4A 4LKFA 2ZMLA 3ZYPA 1GWKA 2QZ3A 2DFCA 2DURA 1BVP1 1GNYA 2BVVA 5E88A 1QOOA 5FKBA 5C7GA 4CEYC 1LGBA 2XJSA 2Q30A 4UFLA 3M3QA 5F5QA 2C24A 1ZZ9A 2VZOA 4FOQA 4XF9A 2MEV2 3NNLA 1CZTA 4YSFA 2HYXA 3KT4A 3I3EA 5CFDA 4RQPC 5FBZA 1FPN2 4KMQA 1X8MA 3V0AA 4Q4V1 5E1RA 2GZWA 4UOJA 3N35A 2NP0A 1L7RA 3BB6A 3U1XA 1V6NA 2VW0A 3GGLA 3M2MA 3OGSA 4QGLA 2B9UA 1RUD2 2WDBA 3AMMA 1Z7S2 3HNMA 3LB9A 1ND3A 4P9LA 1CAUA 1XNKA 2VD7A 4LBNA 4YVSB 4CA9A 4QU1A 2DVAA 2J1EA 4ES9A 4Q4X2 1ZRDA 1LCLA 4DEQA 2FCVA 3T0BA 3FX3A 1KDKA 4E4HA 1DGRA 4CCKA 5A7SA 2QE3A 5BUVA 2ZA9A 4MGZE 2BZDA 3IPVB 1OKQA 4ARXA 4ASKA 3W58A 2XHKA 3H7YA 2F6BA 3E6DA 1CJPA 4EN6B 1AR62 3USSA 1QDCA 3HPNA 3ZSLA 1H30A 2WABA 5M0TA 5FP9A 1RYYA 3CJXA 2NN8A 4HL0A 3V0BA 4WVMB 4XF0A 1WD3A 1IGOA 1NXMA 3OUJA 4CPBA 4E8DA 1JTZX 4JQTA 1OVSA 2JDZA 4OUSA 3LAGA 2A6YA 5LZ6A 2YC2A 1MS5A 1ZRRA 1OF4A 2OKXA 2XVGA 2PN5A 1WA6X 2R0HA 3ZXLA 5J3UA 1HRI1 2QQVA 2VMDA 4FVVA 1PX3A 3DUIA 3KGLA 2NLRA 3MF6A 1FNYA 5KXEA 1TNFA 1XBFA 4Z07A 2B45X 4XHBA 4OQ9A 4E8CA 2ENRA 1OH4A 4WM8A 5LY2A 4GA9A 5A32A 1UOJA 4QHBA 1VBB3 4EWEA 2DCYA 1HXS2 1RXGA 1SBDA 2BGPA 2D5FA 1CJDA 1NXD1 4FPLA 4D7YA 2F4PA 4B1MA 2IXLA 4BISA 4Y1XA 2GC1A 2ADDA 5E8AA 5EPAA 2GP3A 3B69A 3ZXFA 2CY6A 2RR12 2XKPA 1AJKA 4QX8A 5JVVA 3K4ZA 4GH4C 4EN9B 5C8CA 3SMHA 3KCXA 4M01A 5APAA 4HPKB 4PDWB 5C3OA 2XJQA 2P3YA 1Y4WA 5DAPA 4KNCA 4O61A 1RUE2 1UMIA 2RM21 2EICA 2JWPA 5FZBA 5HXVA 2XQXA 2WT2A 3LIHA 3GYDA 3CZUA 4UBGA 5GALA 5B2GB 5EXOA 1Q5OA 4YM3A 1AYM3 4P08A 4DOUA 4TZDA 5A7OA 3GZTB 3CKHA 1BBT1 1DCSA 1N3PA 2J1RA 3F2ZA 5CG9A 2VVDA 2DBNA 3WG2A 2VQUA 5IHRA 1DLLA 4P9YA 4OZXA 1SPPA 1ZZ7A 5IK8A 4PQQA 1BHGA 1LODA 3WEZA 2X5IC 2ES3A 3URFA 4QWNA 1SLLA 2X29A 4LKSA 4B4RA 2ADEA 4GMP1 4K8RB 3S30A 2J1VA 2ZX4A 1OLRA 3ZFFB 3SXWA 2GP5A 3ZR6A 5L36A 3H8XA 2ZGMA 3DGTA 3ZYBA 4MVTA 4CU8A 1US2A 3RJRA 1O8SA 1QGLA 3IN9A 4FOYA 1PO22 1JYNA 2D6PA 5B4NA 1CQ9A 4UFHA 3LIGA 2FD8A 1DQ5A 4NPRA 1W6OB 4QQOA 4ZU4A 4MGIE 5JOWA 4HXCA 2YFUA 4P00B 2G9ZA 4XOGA 3QCWA 4IV1A 4AFCA 4XMIA 4AOCA 4WM8B 3OBAA 1OT5A 4OLLA 4XIOA 4QX5A 4RHV1 5D8AA 2PMWB 3ECQA 5H9PA 5IAVA 3H0OA 3T2OA 4D7SA 3VZJA 3BODA 1W9FA 3PVEA 4R9BA 4R8HA 2W91A 1XNCA 3M1HA 3AL5A 1STMA 1E5HA 1W06A 5DDJ2 1YQ6A 5JI7A 4LBMA 4B7KA 2XH6A 2XVKA 3U07A 3VBHA 4CUGA 5C71A 4HKOA 2RG4A 3JD71 2B46X 2G9GA 2ZAHA 5JR2A 1PO11 2BEOA 2PLV1 4B4QA 4QXHA 4CCDA 3DXTA 3MLJA 2YFZA 3VBRB 3TAYA 5C8CC 5IVFA 3JQXA 1W03A 3FL7A 4I2OA 3IDCB 4D8MA 3VKOA 1FV3A 1VBA3 1NT0A 2OA2A 5G04L 3WDUA 2RDRA 3OEAA 4IERA 3DL3A 1XRUA 3TYJA 4HKLA 4E4ZA 4CDQC 1RIRA 2WN3A 1LESA 2ARCA 4I0WB 3ZPYA 1W6PA 4NVPA 4ZPIA 5F32A 4AYUA 4UFIA 1RUD3 5LA9A 4CE8A 5FK7A 4Y1UA 1FOD1 3AYAA 1GYKA 4M3CA 3QBQA 1BKZA 3SCHA 1SLTA 2X5IA 4UWDA 2XBO1 1H0BA 3IBMA 4Q2FA 5FUPA 3MLKA 4GMP3 1JZ5A 1UU4A 5A7NA 2ARXA 1W05A 3TOJA 1HV1A 3WCRA 1BQPA 4FPFA 3RSJA 4BOWA 1S1AA 1YIFA 2ZGKA 5FXZA 2FMYA 2RV9A 3MFAA 4Q8LA 4AFBA 2CWMA 1QDOA 4AEJA 4BB3A 5FMOS 3VBFC 4YFZA 1IQAA 2VOXA 1PZ7A 4FQZA 4PIZA 5J96B 5FZHA 1C8M2 3T2TA 2KR2A 2BQPA 1ENXA 4LITA 3J7HA 2ARBA 4JQRA 4NIHA 2YC4A 5HCBA 2FDHA 4Y20B 5FLIA 4CTEA 1JUIA 4FQ4A 1VIWB 2WA4A 4BPZA 5SV8A 2W9XA 3NW4A 3S7IA 4YZ5A 5BNOA 2WINB 3QH6A 3VDBA 1PHMA 5E89A 4IEPA 5JR7B 5JZGC 1ULDA 3IB3A 4Q4Y3 3EQEA 5F3IA 1J3RA 3LA7A 3RPQA 2WIIB 1AX1A 4Q4W2 5G05L 3HT2A 3TB0A 5GLZA 3ZN6B 5C3PA 3JBG2 4N53C 2D40A 4CCNA 3WHTA 3T0DA 2NPIA 5CBLA 5T55A 2MHFA 4RHV2 2YPDA 5J1XA 4A42A 3FJSA 1MEC1 4MZUA 1JS9A 3N7LA 5F1RA 5T54A 4OHVA 1WGPA 4Y33A 1IPKA 3ZFGC 3K3NA 2GC0A 4W6YA 4ZZ8A 3CU7A 1YQ8A 1QKQA 4XF1A 2VY0A 3MDPA 2VMEA 3CLPA 1GOFA 3HBZA 4YM1A 4FXGB 2Q1MA 3RGBA 3VD3A 4FOVA 1W9SA 1JI6A 1K45A 3A23A 1U0AA 1W04A 2FDFA 1RUG3 1SG3A 2OZ6A 5CADA 1WMEA 3MGUA 2VZ3A 1HXS3 2E7TA 3AP4A 1LULA 5ACA3 1GV9A 1L3JA 3NJYA 5K8SA 3IMMA 2HWE1 5FP8A 2FQPA 1DZRA 4D6QA 3BUCA 2VCBA 2ZPXA 4GD4A 4W4ZA 2YU2A 3VBSC 3MV11 2WKKA 1GICA 1HW5A 2YHJA 3K77A 1UL9A 1JYIA 1X82A 5JMCA 3RNSA 5A7WB 2QVSB 1O3TA 3ZVXA 2R043 3VL9A 2VQAA 4EWAA 2W95A 4ONUA 1RB8G 2O0OA 3DF0A 3TWIA 4BK4A 5C9AC 1LKNA 4QPIB 4BMEA 1PIV1 4V2WA 3N9QA 3OTFA 4QM8A 3UKVA 1LHUA 1OHFA 2LW8A 4WZCA 4PLOA 4OHXA 3WNKA 4AI3A 4CP9A 2IUWA 3HWJA 4RGAA 1A8DA 4A7KA 1AYN3 1H1MA 3NV1A 2YZ4A 4NRPA 2W2IA 4ARYA 1T2XA 2GN3A 4M3CB 3BVCA 2IXHA 2RS12 2Z4FA 3RZGA 2PHRA 5TSWA 3WQBA 1W9WA 4N53A 4HETA 4ATEA 1W6MA 1RHI1 4BYYA 4DXSA 4H55A 1QH7A 2QQKA 2ZGSA 2DVFA 1NY71 2FHRA 4FPCA 1YIPA 1PVXA 4GWMA 2EIEA 2OVUA 2WQ8A 4AEDA 4CEWA 1B09A 1MEC2 2B42B 3K46A 1SLCA 4NAOA 2XJUA 3ZFGA 3O1SA 1JBCA 4Q5OA 1DFQA 5JSRA 4UYBA 5C3RA 3ZPOA 2GAUA 4ZY9A 2ZCWA 5LCWL 1D4M3 2R30A 3SCGA 2VU9A 3O1UA 2VZ1A 4QAWA 5EQUA 3ZFFC 1O4TA 1QXRA 5FMBA 3ZKUA 3OGVA 1O59A 3R0RA 2E31A 1D4M2 1GFF2 2QDNA 2XJRA 4K6BA 4JKMA 3M3IA 3B94A 3KV6A 4N9HA 5CB7A 3VKLA 5C5UA 5BNNC 2J1UA 3FWEA 3OOXA 4E9KA 3WY6A 2WS93 1KQRA 2VO5A 3AP5A 4YRDA 5A33A 5JDBA 1S55A 3ME2A 3POFA 4FPKA 4CCLA 5H9RA 5FYSA 1UX6A 3EYPA 1C4RA 1RUF2 1D0GA 1TMF2 1XSRA 2BUKA 2PHUA 2R1DA 3C7GA 4XBQA 3UKTA 3WLUA 1QJX2 1DLCA 2HEYF 2I74A 4X8PA 1AR72 4NIIA 2HKXA 2WNUA 4TLFA 5T5JA 1G86A 1YLLA 4BIFA 5FZOA 5FZEA 5EJ1B 2RS33 1AXKA 1W2NA 1LGNA 3DCQA 1SLBA 1G8WA 1T6GC 2DWRA 2BERA 2E63A 2QKDA 1OUXA 3ZOIA 3OD4A 3EB7A 1GKBA 3NAPB 4IEUA 4M0NA 5A3LA 1SZBA 1K5MB 2WS91 4YG6A 2D6LX 3AJYA 2YPJA 4IV3A 1PVC2 1W8TA 4J6GA 4YZ4A 5GKAC 5H9QA 4COVA 3TRSB 1ASJ2 4A44A 4WBBA 3WDYA 1VBA1 2R7EB 4JKLA 3ZN4A 2WC2A 1AL21 1LEDA 2AH2A 2PQQA 4UF0A 3MF9A 1SHWB 1OXCA 2ILMA 4WVZA 3WW3A 5DDJ1 3N7KA 2GNMA 4K1ZA 4LK6A 5LA2A 1PVC3 2AR6A 2GNDA 3DPRA 5FZ4A 1BEV2 1UPSA 1UXXX 3VZKA 1ZBA2 2Y6KA 3RZJA 4FCAA 4L99A 4ET7A 3O1TA 4MADA 2RJKA 5FZAA 4A6OA 5FXVA 5CA6A 3MIEA 1W6QB 1C1FA 5FZ0A 1JYVA 1YJLA 3CL1A 5FYVA 4P9JA 1EV11 3POSA 4MG2A 2Y6JA 3GJBA 1AL23 3IIIA 4CXWA 1ZYBA 2DVBA 3NNGA 3NV4A 3T3YA 4BQWA 3OGJA 4B4PA 1DGWA 4IEYA 4A2UA 3APBA 5JOXA 1COV3 1GOHA 2P3KA 4FSJA 2BYVE 3BGAA 1NLSA 2QQOA 1GQPA 2IZWA 2DBIA 3D5OA 3KS7A 4YW2A 3VBRC 4BDVB 4QDQA 4FO9A 4NWWA 2UWCA 2BWCA 3T1MA 3I2OA 5IYYA 1REEA 2VTXJ 3AMQA 4LJHA 4E2QA 4CZSA 3NO8A 3TNQA 3FFQA 1N1VA 1WD4A 2IVJA 1OOPB 3RMXA 3WF1A 2WFPA 4LMFA 1W2OA 2RVAA 1SBEA 4XJWA 2G1MA 1AJOA 3RG0A 5F3CA 4XTMA 2X09A 4K1YA 4Y5SA 2R16A 1Z7S3 1ST8A 3JD73 4MHUA 4YW1A 3RYKA 3V65A 2OXBA 1JZ8A 1U5YA 2OW4A 1W2TA 1V6MA 1DYPA 1RL3A 4KL1A 1UZ0A 4F83A 2HWE2 4QB6A 2R042 2XLAA 4Q0UA 1LTEA 1J83A 3RS6A 3ZIWA 2A3WA 2WZ8A 1YUDA 3T30A 2DCJA 2C9KA 2XJTA 4H7LA 4XETA 1QJU3 5FYYA 3WDXA 2J42A 3Q8EA 4XUOA 4V2VA 5FZDA 4DIQA 5C70A 3SH4A 2NMNA 3O1VA 1AR63 1GWLA 4QDSA 4H7MA 1EUTA 1ZVFA 3OGGA 2ZEXA 1W6PB 3ZFGB 4YZ2A 3P5BA 3RDIA 1W8OA 2LS6A 1OC1A 2D97A 5GZDA 3IWZA 4GB32 2OYZA 3OBZA 1FPN1 1D2QA 3TEZA 4XC9A 3UJOA 1WW6A 2E9QA 3HD8B 4J25A 2EIDA 3T1LA 3N9LA 4CP1A 3CF6E 4IETA 5FRAA 1A6CA 5LA0A 3ZM8A 1ZREA 2HWD1 3MPBA 4Q4V3 4OMDA 5A3OA 1UYXA 1I9RA 3ZN5A 2XUEA 4MV2A 4JCKA 4XTPA 2JE8A 2B4KA 1UOGA 2WSVA 4LBQA 4FP3A 3FBYA 3PLQA 5K0UB 1NYWA 3MIDA 5A3PA 5T3NA 1AYM1 1IHMA 5FZ7A 4CXYA 5FY5A 5A1LA 3O1OA 4GMP0 3WW4A 1WLCA 4IEVA 4YW5A 3ZYFA 1ULCA 2JDUA 4N43C 2RM23 1QJX1 1W6MB 4XJUA 2AREA 2QQPA 2XGXA 3A0KA 4FI9A 3IT8A 3QOPA 4XDQA 1G7YA 4DY5A 3LGRA 4AQSA 3PIJA 1YFYA 3DPRB 2R041 4XW3A 5BNOB 1VRH2 5J09A 5L19A 1VBC3 3UT0A 4ZZ5A 3WX5A 3MV01 2WNVB 5ABJC 1PGL1 4DNYA 4RQPA 1YFWA 1UWWA 2A5ZA 3K3OA 4WZFA 2XONA 1G6NA 4YM0A 5FMDA 2O8QA 4W6XA 3LWCA 3HT1A 4DXTA 4KI5M 3WW1A 5FOJB 2GNTA 3F95A 1F15A 4IV3B 1TME1 2QQNA 2KM2A 4LHKA 4IL7A 4Q27A 2GMMA 2HWC1 4MGTA 4LBKA 1F8VA 3VKFC 2P5BA 3I2FA 3MLLA 1V70A 4LKEA 1VBD2 1K3IA 5FY9A 1CIWA 1MZ6A 3QH7A 1WCUA 4LULA 4Q1PA 3WXPA 3OD0A 2VE1A 1S2BA 2WZPP 4NROA 1DZQA 4XUQA 2DUOA 4N7UA 4XCAA 1V6LA 4Q0PA 4EZ4A 2DTYA 5IK7A 3VHPA 2W87A 1RC6A 1W6NB 3M70A 4RL7A 4BQ5A 1G9CA 3B7MA 4META 4NHLA 4XAEA 4NHKA 1COV1 1RTVA 3K4AA 4KG8A 3AJZA 4JGYA 5FKCA 5CFDB 3ZYGA 1AR73 4HFSA 5GZEA 5JPNB 5IWFA 3WP3A 4CVUA 5IVBA 1XXNA 1BZWA 3D0SA 5C5TA 2OX0A 3V56A 4BIOA 3VD9A 5FMCA 1IZ3A 5JXJA 3LD8A 5L9VA 2RHPA 1H1IA 4GB31 4E2SA 2WQ4A 1VRH1 5A7WA 4Q4W1 1QJU1 3BTZA 4XZPA 4KU8A 3J8F3 5E16A 3PTYA 3PMSA 3POEA 1XSQA 3W9AA 1BBT2 3WINE 3HN3A 4CP2A 1O3SA 3WQ7A 3L2HA 2YROA 1K12A 3LPGA 1POV3 4A7ZA 1ULEA 2VULA 2WNVA 3LF7A 4RHV3 4KBZA 1J3PA 1PO21 3N9PA 1KS5A 3GZAA 3A22A 2JE9A 1RVF2 2C5DA 4Q0VA 1OF3A 2EAAA 3AVRA 4S2GA 2XBO3 4Q0QA 3TBDA 2JDNA 3SLIA 3V0AB 1PK6B 2HBUA 4I3PA 2YG0A 3BALA 1SFPA 3VBSB 1QQP2 4M4RA 2FZ1A 1BXHA 1B35B 1S0CA 1TG7A 5FJKA 4AEDB 1COV2 1BYHA 4XABA 4BM8A 4BQYA 1KITA 5T5LA 5EIYB 3K48A 1UY0A 5DAWA 1PZ8A 1VB4A 4RGGA 4XXPA 4CCJA 4L2NA 4JTNA 5BPXA 4FFIA 4EV0A 4ZHNA 5JWPA 5FUIA 5A32B 1Y3TA 1YYNA 4M00A 1SEFA 3J7LA 4JGZC 5T5PA 1RUI2 3WNLA 4FP2A 2L9LA 4JGYC 1OFSA 3H9AA 5HV4A 3VDDC 2A73B 4CP9B 4CUBA 3D3AA 3SQOA 4C90A 1GZTA 2PFWA 3AM2A 5IATA 3LSEA 2XB6C 4LOTA 2E6VA 3WQ1A 5C4WC 1HJGA 3ACFA 4FTEA 2BPA2 3I7DA 2CDPA 3ZDVA 3FMGA 5ISLA 3HQUA 5FZKA 3KT7A 1DGLA 3WP5A 3OUHA 5J37A 2V72A 5FFOC 5IVVA 4S2HA 3NWKA 1AHSA 1VALA 1JZ4A 5FAXA 2H0BA 2VMIA 4U36A 4LE3A 2D6NA 5FQ0B 4AVAA 1RUI1 4JX0A 3PMEA 1SDWA 4LBLA 3U4XA 1Q43A 1W99A 3PVBB 3I3BA 4O7XA 4EYUA 1AR93 5LATA 5FDBA 5JMOA 1I5ZA 1RUJ1 2ZS6B 5FPUA 2W92A 4QPGB 3WNXA 4MGYE 1VJ2A 1UZYA 3AYDA 2JB4A 1LU2A 1K5JA 4G4FA 1MR5A 3RWNA 4XJ9A 4LEJA 3LEGA 5HCFA 1R083 1RUC3 4R9DA 4P9XA 4FPHA 2ZEZA 4Q4V2 3WSOA 3ZMOA 4C0HA 4MYEA 3ZYIB 2JDPA 1V6KA 1JYTA 1RGSA 2P37A 3ABZA 2P3JA 5JOYA 2VR4A 2BVBA 1NAEA 2VQ0A 1RMU1 1ND3C 2A7AA 1UX7A 3SEPA 4D6SA 2GC2A 4BHPA 4BA6A 3O1RA 3U11A 1HB1A 1D4VB 4L11A 4RSUA 4D94A 1AZDA 4BCUA 4D6RA 3A7QA 2VG9A 1ZBE2 3H1MA 1BMV2 4Q4X1 4W8JA 5KC6A 2VNGA 3CQOA 3KGZA 3MBWA 3PUQA 2VL4A 2Q8OA 1VBD3 4IDZA 1F9KA 3D8CA 4AEMA 1OMIA 1WW5A 2G4IA 4XUTA 3O14A 4JGZA 5CNAA 1VRH3 1AR83 4MGKE 5FY4A 2PAEA 3O12A 3FC0A 3OY8A 4XJ8A 2ZABA 4BQXA 4D3WA 1QJX3 1K5MC 2LROA 3IZOA 3P1IA 1Y7BA 3QACA 4I0AA 1OFNA 4IW3A 3PTRB 4IXLA 1LEMA 2D5HA 2VNOA 3KVAA 3UGFA 1HN1A 1O4YA 5C3SA 2JG9C 2DCKA 3S5QA 3MICA 2P3IA 3KZ4C 4M4PA 5C4WA 1AR71 2X05A 1HQWA 3FFZA 2SBAA 3BTXA 2ZGOA 1RHI3 1H2MA 1J1LA 3AKTA 2VTFA 4H3WA 1EAH3 2VW1A 1TNRA 3ZFEA 4DB5A 3HNBM 3NV3A 1MACA 1C1LA 1XC6A 5LBEA 2R6QA 1AXYA 2HWF3 3RQ0A 1A34A 4A41A 4AI8A 3KSCA 1U5XA 2DCTA 3ZXKA 5BNOC 5LRRA 1R1A2 4B3NA 1VPHA 3RFRA 5A6YA 5A3MA 4WVVA 3NAPA 3R4SA 2ZHMA 2PLV2 4XIKA 5FJHA 1GSLA 1FATA 2A3YA 5DAVA 5L73A 2Q1FA 2QZ2A 4CU7A 3POBA 1O6UA 1UXZA 2HJIA 3WDTA 4JV4A 3AX4A 5DUWA 4LK7A 3ZDSA 4AHYA 2ATFA 3ZXDA 1FV2A 2AEYA 2CYFA 5F5AA 3ACIA 3CDZB 4XPVA 1E57A 1ASJ1 2TEPA 1TME2 1X9TA 5FZGA 2GH2A 3CMGA 5BXXA 2RS53 1UAIA 4XXAA 4DMIA 5AC93 5FYCA 3IAQA 3FLTA 4A45A 5JOZA 1RMU3 3NL1A 1H9PA 4AVTA 3CJIA 2P34A 4FAHA 5I8TA 4XQ4A 1GANA 1BVVA 4UW6A 4AGVA 2I2SA 3UKNA 3KV9A 1JW6A 1S0DA 4J1WA 3WUCA 1AYN1 3NQHA 3OBRA 4LHNA 4Y4RA 4COWA 1RMU2 1RITA 4EZHA 1QJY1 1HV0A 3E97A 4LBQB 3K2OA 5F39A 3WQ0A 3VDDB 5J36A 1ULFA 1G9DA 2LRPA 5AVPA 1L7QA 1UQXA 5BNPA 5CAZA 4MLOA 4DS0A 1YFXA 1VAMA 2ZGLA 1AX2A 4NJ4A 4Y1VA 3DYMA 1R093 3ACGA 3C7EA 2EIBA 2XWBB 3BI3A 1M4WA 3H8UA 3BTYA 4Z2WA 1DYOA 3DN7A 2VECA 4BMBA 5E6HA 5DXDA 2VCMA 2C26A 4Q4Y2 5D2AA 1LGCA 5FPVA 1QJY2 5FO9B 5FZIA 2GSYA 4UXAA 4I09A 1LR5A 1JZ2A 3ILFA 3I59B 4JDMA 3VUOA 5IVJA 4Y5TA 2WUHA 4ZXEA 4DPNA 1GQGA 4KWKA 3S0MA 5LA1A 3VBOC 1LHOA 2YV8A 1LJ7A 4RR3C 2JD9A 5HCHA 4XQDA 5BYNA 3RWKX 1HRV3 1BBT3 2D3SA 2D98A 4Q0SA 2P4EA 4XFFA 2XHNA 4NUBA 1K42A 5A80A 3VN4A 4GKYA 4WVWA 2VW2A 4KBBA 4YW7A 5EV7A 4CDXB 3B93A 4CP0A 1VBB2 3AB0A 2GDFA 4ZU7A 1H2NA 1MQTA 5EYYA 2FZ2A 2V09A 4L97A 3KMHA 4Q4W3 4AEDC 4QDRA 1ND3B 3QD6A 5K9YA 5GZCA 2BJSA 3PUAA 3WCSA 5LEKA 3DYPA 2H6BA 3NJZA 1NX9A 1W9TA 3ZO0B 1IS6A 4R9CA 3JUUA 4FPYA 2VXRA 1V6JA 1H8TA 4Y1YA 5A1AA 3N7MA 4LPLA 2A6ZA 4OCTA 5DUUA 1LOEA 2WZR3 4JGZB 3UESA 2PXJA 3FZ3A 4HN1A 5FWJA 2WJSA 4PF1A 4UFMA 1V9U1 1ZZBA 1VBB1 2ET1A 3WG1A 5KXDA 3AXEA 1UW8A 5C6CA 4AFDA 1Y9GA 2PHXA 4L92A 2ZZQA 3SEEA 2VZVA 4HN0A 4H2AA 1MS0A 5FV3A 4EROA 1RXFA 5DZFA 2ZMKA 2PA7A 1PO23 3WNMA 3T2QA 4MGSA 3MFCA 4HOOA 4M0HA 1ONAA 3A0NA 3V0BB 3E1F1 2WSUA 5CYYA 1HB3A 3I2KA 4QM9A 4Y5Z0 1QF3A 1W0OA 4GQ7A 4PLNA 4CSWA 5ACA2 2Z42A 4AI9A 4AVBA 4QPWA 2Q8EA 3AKPA 2RR11 4OI2A 4YFWA 3ZXJA 4EJRA 2OS2A 2WQZC 3C7OA 2WT0A 2ZJCA 3ZYHA 3MYXA 3IKWA 3P3NA 3K75B 1YHFA 1H2KA 1OQDA 3EBRA 3M3EA 5JI9A 3BPZA 1GZWB 2SLIA 3H42B 4XDOA 3KQ4B 1HX6A 4JGYB 1BEV1 1DG6A 4AHZA 5IW0A 2NYYA 5FP3A 4AI1A 3E5XA 4XJAA 4LHSA 1QIQA 3RJ2X 4RR3A 5IK5A 1XYNA 3INAA 2HYKA 3OY8B 4QT6A 1ALYA 4Y4YA 5F3GA 5T50A 1CGPA 4NHYA 4FBFA 4XE9A 5JCTA 4XFAA 4LA3A 2V5YA 1JYXA 3B3QE 1U5IA 3SITA 4K3UA 1DU3D 2RMU2 2Z79A 4IE0A 1NQJA 2VOTA 5FZ8A 3VBUA 4AI2A 2UY9A 1LHWA 2J1TA 2VM9A 4IE5A 4GH4A 4Z82A 3FUQA 1Y9QA 5GLUA 2Y0IA 1H1AA 3NJVA 3ZMNA 4CRQA 3POYA 1CAWB 4J1XA 1V9U2 4HLTA 3RZMA 4GWIA 1WBFA 5FXWA 2LM3A 4GALA 4ZKTB 4QPIA 2GU9A 2YGLA 1WLTA 5C9AB 3PVNA 1PO13 3RZLA 1C5HA 1TE1B 2C9AA 3WG4A 2HWD2 5LRSA 2CAUA 1VP6A 5FYTA 3BU0A 1ZRCA 3CHXA 3RMYA 4FTSA 3E5QA 1FMD1 4O9GA 2RJLA 4P5HA 4YG3A 1E5SA 4K9SA 4HT1T 2Z69A 1PK6C 3VBRA 3VZNA 1UY1A 3D82A 1ZX5A 2ZTNA 3POJA 2BDRA 1EV12 2A6VA 3PUHA 4N53B 1WLWA 1OBNA 1AR61 2BP6A 4YGBA 4AHXA 2WRAA 2CHHA 3KT1A 1W8WA 1F35A 3LDRA 1W8ZA 3H3UA 3T08A 2VBDA 2VBPA 1RUH2 1OKOA 2E7QA 2ZHLA 2VNRA 1OPOA 1YNAA 1OD5A 4CDXA 3A4UA 5KC5A 3FN9A 3DKWA 2XWJB 5DUVA 5I91A 1APNA 2E26A 1S0JA 2Q0AA 3NNMA 1KEXA 2WWUA 4QXBA 1QY4A 1PGW2 4HVQA 1PX4A 1FNZA 1PNFA 3UV9A 3SH3A 1KRIA 2DUPA 2QJVA 5IT6A 1O5UA 4DFSA 2BV4A 5JSPA 2HEWF 2JIGA 2WNUB 2MEV1 3N36A 3QLQA 4LBJA 2WA3A 3DKQA 3JBG1 4IE7A 2Y6HA 5FPXA 2MPFA 2WZEA 1XNDA 2R0FA 4R9AA 3VLBB 5A3UA 4G9SB 2WT1A 1FOD2 1R1A3 4QQPA 4RS5C 1MS4A 1JYWA 3W5NA 5A6ZA 5BNNB 3SISA 3JXSA 1S0FA 3B02A 5EZWA 1JH5A 3WW2A 4OUMA 3AFGA 3GCWA 2C6SA 1OLQA 4NIAA 3WG3A 1G9BA 3LQCA 5JIAA 3LDKA 3VL8A 2PHLA 3BKZA 3O0WA 1VBD1 1OI6A 2UYAA 4QPIC 5BY5A 4JHTA 3AMNA 3OYWA 4WM7B 5FXXA 4QPGC 4Q8KA 3KWVA 1IS5A 1C28A 3T0AA 2VVFA 2XDVA 4HSJA 3LDBA 5L9RA 4QKFA 3AP9A 1XNTA 2BNNA 1FMD3 1LOBA 1HXS1 4MO3M 2KD7A 1CESA 3OG2A 3M8LA 1QWRA 3NVCA 5FYIA 1KDMA 2VTXA 1QJU2 3SC7X 2GMEA 4TTGA 2Y26A 4COYA 2OT7A 3BYWA 4P9IA 3I3DA 1R081 4FFFA 4XURA 2GALA 1REFA 1ENSA 2G9FA 3EJKA 3IIAA 4OUEA 2G19A 4OMCA 3ES4A 4XFCA 4EN0A 2BGOA 1SMVA 2BFUL 3VBUB 1BLZA 2FBEA 1REDA 5FYBA 3AYCA 5ABJA 2VUDA 1JU4A 4E4SA 1E5IA 2ZGTA 1RVF1 5JXHA 2Q4SA 4KQ7A 4ZS3A 4U2AA 3RI8A 3W21A 3FHQA 2XL7A 4HONA 4LBOA 1W2AX 4KWUA 2JG8C 1OD3A 4CDWC 3U0ZA 2ORZA 3GALA 2WAAA 5FYMA 3ZYJB 4AG4A 1C8M3 1HQNA 1NOVA 3OPTA 4QKNA 4COUA 4JHZA 4RA0A 3S57A 1M06G 3ZSJA 4QXCA 1O4ZA 5FY8A 4B8EA 1SFYA 1N1YA 3UYJA 5A70A 1LOGA 2EIGA 1UF2C 5ACA1 4LUKA 1IG3A 3UNPA 2GMPA 1KJLA 3Q8FA 4QX3A 2QQIA 5FZ9A 4RS5A 1RUG1 2AGSA 2JDMA 3GBGA 3P6BA 3HJRA 3J4UH 4LBQD 3CIHA 3J7NA 1JZ6A 2I07B 4IGPA 1POV1 3LZZA 5EJZB 1I5PA 5K7PA 4N7IA 2OPKA 2K9ZA 2QUOA 4WM7A 4BQ3A 2RMU3 3GDBA 2PQSA 1MS9A 3ZX7A 5KHGA 4K40A 3N3HA 3ZXGA 1J1TA 4LR4A 1CZVA 1VLNA 1MEC3 1V9U3 3H7JA 1URXA 2Y6GA 3NKTA 4B29A 3S5AA 1VBA2 2AENA 1NCQC 1RUE3 2VOVA 4PBOA 2JDYA 4NPLA 5I0UA 2RS31 4QD2A 4IEWA 1CPMA 4BQ1A 4OZOA 5FZFA 4XF3A 1W8UA 1NZIA 3MPPG 4QX0A 1WA4A 1Q8PA 1MS8A 4QX7A 4AFMA 3BCWA 1CONA 4Z2AA 1L7LA 1UYYA 1A3KA 4Y26A 1JHNA 5KR7A 1LOFC 3FUOA 1UMHA 4BLJA 2DDUA 5JSOA 1AR82 4TWTA 3ZSEA 3I59A 1HN0A 2RMU1 4JRAA 2AUYA 3NV2A 1NG0A 1BMV1 1MVEA 1QJFA 3AC0A 5C9AA 3OPZA 4YW6A 1DBNA 2YBSA 2JENA 4QQ2A 4AF9A 1RUF3 2CGNA 2JG8A 3ITQA 3PURA 1PIV3 1AX0A 4QKDA 5EHDA 4JDOA 3VDAA 4X6QB 1VMHA 4NE9A 1UNBA 2ZXQA 4OYUA 3ZIXA 3N4MA 1POQA 2XUMA 4MOAA 4NHXA 4XZUG 3H1WA 1PMHX 4W6WA 3GJAA 2UWBA 3THCA 4AE2A 5F37A 4RD7A 3AZVA 5KXBA 3N9OA 1U5ZA 1OUSA 1HQLA 4JAAA 1CAXA 3BTAA 1DHKB 4PI2A 4ZONA 3C7FA 2N7GA 4NHMA 1Z78A 4XVHA 5JXIA 2ZX1A 3PDQA 1RUJ3 1H8TB 3B01A 1X7NA 5FZMA 2V5DA 2X8KA 5L9BA 1AL22 1YJKA 1QNWA 3AZWA 4XFBA 4CUCA 3TEWA 1RVF3 2WLPA 1XE7A 2QQUA 4D0QA 1ZZ6A 3NSTA 3PJYA 3ZSKA 1S0BA 4UW4A 2AEZA 4BQ4A 5IUQA 4IUGA 1H6YA 2XBO2 1BEV3 1V0AA 4BXFA 4X8NA 1KD7A 1MVQA 1IG0A 1UY2A 4QMAA 3VD4A 3MZHA 4DQAA 5FZCA 2WO7A 4LLOA 5HPOA 2XKOA 3L9JT 4QX2A 1H4GA 1NCQA 2V4VA 4DUWA 5LW9A 5FCCA 1JHJA 5GJ6A 5CKMA 1A8MA 2K0GA 1B35A 1W39A 1ODMA 5K0UA 2JX9A 2JDKA 3DV8A 4CEWB 1MQTB 1SACA 2B7YA 3MW2A 4LIVA 1ZBE1 2IXIA 3R4DB 1MZEA 2YB7A 3ON7A 2WFF1 5A6XA 5BNNA 1CAUB 2ZX3A 2VMFA 4YGDA 5I8YA 1LOFA 3OJBA 4KU7A 1ULPA 1VBE2 3AZYA 3ACLA 4EN8B 2R1BA 1GWMA 2PHWA 5LK7B 1ODNA 4Q4Y1 4DEVA 3EHKA 2JEMA 4TLGA 3VHOA 2PAMA 1AR81 4DXZA 1H4HA 2EXIA 2ZMNA 2WNUC 3OSDA 3MHZA 2JG8B 5CVRA 4CDWB 4RQPB 4MGQA 3ILNA 1JZ3A 5CFCB 1XB9A 1XNAA 2BWAA 2Y8KA 3ZKYA 4AL9A 4HZFA 5GZGA 1E5RA 1WCDJ 2XOMA 2W46A 2AYHA 3POGA 2WFF2 4JVAA 3HIFA 3E5UA 3H50A 2WZR2 3MI8A 1UYZA 2QQLA 1W3XA 3D0JA 3W59A 5LK5A 2RS32 1NA1A 2XL9A 1DQ2A 5B4XA 3KD4A 5AFBA 4Y22A 1ZNPA 3V64A 2VMHA 4LE4A 3E6BA 4N43B 2VAUA 1AF9A 2ZEYA 3B00A 3ELNA 2RJ2A 3HR9A 4PI0A 3WT3A 4K7JA 4HVOA 3U37A 2VXJA 4URAA 1JOBA 2CAVA 4KWLA 4QKBA 3DPRC 4CEYB 2XG3A 4FPEA 2V73A 3HQRA 2HWB1 2KXLA 5ABJB 4MHRA 2JJ6A 1FOD3 3AK0A 2WL1A 2D6KA 5J98B 1WMFA 1JODA 5FO7B 4C91A 2E7AA 1RUC2 2JG9A 1YXWA 2A1XA 2ZOEB 3GM8A 3WF2A 2HWC3 2XJPA 1W8FA 5SV5A 5C8WA 3LA2A 4ITCA 4LO5B 2YBPA 4IEQA 2C0ZA 1RUI3 4CUAA 5AC91 1UKRA 4Y24A 1EYBA 5CZKA 2ARAA 3DXUA 2VZPA 3HBKA 4YGEA 3N9NA 1VAKA 1QHDA 4QPYA 5EJ3A 2Y34A 1X8EA 2VJXA 1IOAA 3ZFEC 3VZLA 1S4CA 5AFEA 1B35C 3WV6A 1R1ZA
chains in the Genus database with same CATH topology
2CTVA 2NMOA 2R32A 4X6RB 3ZXAC 3USUA 4LLFA 5FTTC 1QJZA 4IV1B 1LENA 2KA3A 3C3VA 1GZWA 3X29B 1N1SA 1R091 2WNVC 3ETQA 1N3OA 2Q1ZB 3WUDA 4LTAA 2D44A 2Y38A 3KCYA 4YZ3A 4COZA 4IEXA 4FPJA 4YLZA 1RUD1 1Q3EA 4URTA 3PJQA 4FPOB 1XQNA 4KG0A 1PMIA 1RHI2 1SLIA 2VOWA 4SBVA 5I0TA 5LEJA 1X50A 1TQ5A 1OQ1A 2ZX2A 5EYXA 1U12A 2B39A 3WD5A 1V6OA 4Y22B 2FMDA 1PM7A 1QXJA 2WWSA 3LSDA 1RUE1 2RM22 4CDQB 1W6OA 1EP0A 4QU2A 1DQ4A 1ZRFA 2BBVA 3SHRA 3AKSA 5I0RA 1VBC2 2RE9A 2W68A 2ZBJA 3P3PA 4AGGA 2X5IB 4MUVA 3UJQA 2JICA 4PJYA 5AVAA 5EFUA 3S7EA 4LT5A 5F6KA 4M3CF 1O5LA 4ES8A 4OI1A 5EWSA 2JD4A 3J8F2 5CFCA 4AVSA 1KXGA 4LUMA 3I8TA 3ES1A 2R061 3EO6A 2D6MA 4JTOA 3RYPA 4AQTA 2CV6A 4XFGA 1XYOA 2DF7A 1RUC1 5J7MA 4GIQA 4ORFA 4QXKA 2D7FA 1FPN3 3LA3A 4I0BA 2XPJA 4GWNA 5T5OA 1EAH2 4WM8C 3ROUA 1HDKA 2EXKA 1UZZA 4B7EA 3KQRA 3MW3A 4UW3A 5JLVA 5L7OB 4E2GA 5I0SA 3ALQA 1HLCA 2YY1A 2A6WA 3ASIA 2P17A 4QGNA 5IK4A 4AK3A 1UD1A 5HI0A 1N1TA 4YYOA 3MEPA 4I3GA 4JDNA 2CL2A 3AP6A 1C3HA 3IDEA 3KCCA 1YI7A 1SFNA 5HCAA 1ZA4A 1C5IA 4TSVA 4AW7A 4MXWA 1LOAA 3AZZA 2IWGB 1RJ8A 4TYSA 1GBGA 4Q1RA 4ISQA 1H8TC 1WW4A 4FTBA 2H0VA 1DQ6A 1TME3 1EPZA 1H9WA 1QQP3 4O9EA 3CJIB 2OIIA 3MIGA 1ASJ3 1Q8VA 1VBE3 4E27A 1I6XA 1MZ5A 2QNKA 4XBLA 1EPWA 3POWA 4YW3A 4IEZA 2GH8A 1S0IA 4PQ9A 2VUAA 4Q29A 4JRLA 4A7YA 1MS3A 4C1XA 1FT9A 3D6EA 1FAYA 4PDWC 1TMF1 2BNOA 4C0BA 1NZCA 1QXPA 2XLGA 2YGMA 3Q9OA 2Z2SB 4FTEA 4CDUA 3PHMA 1J59A 1CAVB 2H6CA 3CEWA 2A75A 1SCRA 4IV1C 1QQP1 3D4KA 3MIFA 4INDA 4CEYA 1UPIA 3O5SA 2RR13 2DFBA 2ZKNA 5L7OA 1RUF1 3THTA 4DZGA 1NLRA 4AQ2A 2LTNA 3VBHC 5GLWA 3B5LB 4D69A 1VAVA 2O1QA 2JECA 1DGWX 4LA2A 1IS3A 2QFEA 4G3YC 1DZTA 3AZXA 2NQYA 3VBFB 3MIBA 4MXVA 4CEWC 1MS1A 3AYEA 4YVWB 4FOWA 1NQDA 4XBNA 3HAGA 4HK9A 1WCKA 2CWSA 1RUG2 3FHIB 4CDQA 1F5JA 3I2DA 3C2UA 4KGGA 2JE7A 1C8M1 2IFRA 2HWB3 3G6JB 1CR7A 1I3HA 3ATGA 2JXAA 4XJZA 2W0XA 4KGQA 1FYUA 1AR92 4E4DX 1CPNA 1DYKA 3AMHA 3NKGA 1ND2B 3ZFFA 1Z7S1 4QQLA 3AKQA 3M3CA 1HKDA 3ZXEA 5HBAA 1Q8SA 2A70A 2UY8A 2R062 3VDDA 4FAGA 1UIJA 1X33A 1Q8OA 1WUVA 2IXJA 3FLPA 4CDXC 2OZJA 3JB4C 2DV9A 2R073 3CO2A 1JXNA 3GHMA 4HPKA 4PDWA 1H2LA 4P14A 1OOPA 4CDUC 5FMOL 4XFIA 5CU1A 5FQ0A 3KB5A 1PGSA 1QH6A 4OVEA 1PGL2 1S0GA 3FLRA 1LU1A 4QQHA 3N7JA 1GZ9A 2ZHNA 3LOBA 4OI0A 1POV0 2W39A 1O3QA 4EN7B 4S2FA 5JZGA 1IKPA 1W6QA 2X53S 2TNFA 3PVOA 3VBOA 5L7OC 3ZN6A 4EWDA 1NY72 1DQ0A 1LECA 1ZBA3 4GXLA 4JC1A 3RRDA 1RUNA 5KWRA 2B5HA 4K20A 5BNQA 1LB2A 2A3XA 2D3RA 4XHXA 1SCSA 1HIXA 1KFXL 1MQTC 4KH9A 3ZYRA 1W0PA 4OFGA 1F31A 2YDEA 2WNEA 1X36A 2PHFA 1QMJA 2YYOA 4FPGA 4PF5A 4QGMA 2VUJA 5FLHA 1NCRB 3L2YA 3WOGA 3VGIA 1ENRA 2D6OX 1WCSA 4YZ1A 2W08A 2PYTA 1W2UA 1WMDA 2ZGPA 1UN1A 1Q8QA 3GF6A 2RS51 1XNBA 3WP6A 4F8AA 1YFUA 4HSLA 4RR3B 3IM0A 1HRI2 4XEZA 3TN93 1PNGA 4N90A 5JPMB 1K5MA 4OHZA 1G9FA 1H8VA 4SLIA 4LO8A 4Z1VA 1UU5A 3HN1A 4UW5A 4F3JA 2IFWA 5DZGA 3I54A 2VH9A 1UIKA 1OA3A 4DRVA 5KXCA 5DZEA 2R071 1OOPC 1YI9A 2DVGA 3LOIA 2EALA 1OQEA 2RS52 1AXZA 3AKRA 2C1FA 2WS92 4MXWB 3AFKA 2PHTA 5I8SA 4AHWA 4XILA 1J58A 4M3CE 5DG1A 3VBOB 3JBG3 5D8AC 4R4ZA 1ZZ8A 2EXHA 3NAPC 1RUJ2 3AP7A 3RZZA 1FXZA 2LUWA 4AVVA 1Z0HA 3R05A 1ULGA 3ZFEB 4NO4A 4FXKB 1R092 2TBVA 1XYPA 2ZKLA 2R49A 1UU6A 2UWAA 1CD3G 4OULA 3VHRA 3USUB 4UBHA 3VKMA 5T52A 1CAWA 3WP4A 4L9BA 1BK1A 5H9SA 3R6SA 5FREA 1VBE1 3CJIC 3O0VA 4LO4B 1KFUL 1ND2A 1AL0G 1PGW1 1YO8A 1ZZCA 2D43A 2WFF3 3GZUC 1HRV1 4ISRA 4AQ6A 1BJQA 4NWVA 1DDLA 4RFT0 3RI9A 1KS4A 1D4M1 4XF4A 2Z5WA 4MH0E 4PIYA 1QOSA 3CNAA 3UK9A 1PVC1 5BNPC 2CGPA 2PHDA 2VOKA 3UL2A 2DYCA 3JD72 4RS5B 2VVEA 2Y0OA 3WZ1A 2XVLA 4AXOA 4YVSA 1NA1B 1YCIA 3OF1A 3VBFA 4HKWA 3VZMA 1I1EA 2HWE3 3LKJA 1N3QA 1PZ9A 3I4IA 1AR91 4OI4A 4S2DA 4I30A 2UU8A 2ZGUA 4ATFA 2TUNA 2QCSB 3IPVA 2RS13 2EF6A 1AYM2 2HWB2 1R1A1 1UMZA 4IV3C 3ZSMA 1LHVA 4IEOA 2D93A 4YM2A 3VZOA 1DIWA 1VR3A 3H1YA 1YRZA 3G7DA 4W65A 1JYCA 1LOCA 1WBLA 1DF0A 1XU2A 2R063 2PTMA 1ZBA1 3TNPB 2E51A 2OUHA 1BCXA 1AYN2 4KWJA 2ZAAA 1HRV2 5DDJ3 1W6NA 1NCRA 4ASLA 4LO7A 2YMZA 4YG0A 5FPZA 3J8F1 5F9TA 3RYRA 3S6PA 4AGRA 2ZGNA 2GNBA 2LALA 3OYWB 4GB33 5DG2A 4MX3A 1ND2C 3O7OA 4NOTA 1J3QA 2B8MA 3MIHA 2BNMA 5AC92 3OBTA 3TN91 2E53A 3WVJA 3J26N 1DGRN 5K0UC 3U10A 5FO8B 2DU0A 3JU9A 4R4XA 4ZU5A 2HWF1 1LRHA 3H3ZA 1XE8A 4NR1A 3M3OA 3BIWE 3VBSA 4YVSC 1R082 4YGCA 1GZCA 1G9AA 2ZHKA 4CYDA 2AZ5A 1XU1A 3KM5A 4L8QA 2GC3A 5F6LB 3HMYA 1GNZA 2BGCA 5D8AB 3GBFA 2DCZA 2OUJA 4BZ4A 1WW7A 2WLQA 1NCQB 3GBWA 1OSGA 1EY2A 5J48A 5BV6A 1JN2P 1IPJA 4YW4A 1V00A 3PNAA 1EV13 4V1PA 3B9IA 4XYXA 4YARA 1SLAA 2DU1A 3JQWA 5A33B 1CAVA 1UCXA 3VBUC 1O91A 2IC1A 1RUH3 2ZX0A 1NCRC 3J9SA 1UKGA 4WM7C 1NE6A 2IXCA 2ZACA 2IXKA 2ETEA 2A6XA 1GR3A 1QJY3 3SCFA 2HWF2 1LHNA 3BU7A 3VBHB 2ZGQA 4HVRA 4Q26A 1CN1A 2DUQA 1RUOA 5CG8A 4BLIA 1QU0A 3FBMA 3GNEA 1SQ4A 4R52A 1DQ1A 2HWD3 4GH4B 2MEV3 1RINA 1PK6A 1NE4A 4YVWC 3M4FA 3GHNA 4N43A 4Y1ZA 1JOJA 1VB2A 4ASMB 3E6CC 1GQHA 3AMPA 2I45A 1VBC1 4GKXA 3IMNA 3JZVA 3VV1A 2YC0A 4AFAA 2BFUS 4GULA 5GLTA 1S0EA 4HBNA 5KBFA 2EXJA 1CX4A 2HWC2 1GLHA 4Q4X3 2BW8A 5KHHA 3BOPA 1WLDA 4OHWA 1C8NA 1ENQA 4LHLA 5GZFA 4AEKA 5JIUA 4NN0A 2XJVA 5I93A 5KHKA 3ST7A 2Q5TA 4BE3A 4XMAA 4YNIA 4CDUB 1V6IA 1A78A 1EAH1 2ERFA 2CNAA 3LCPA 3WR0A 1OPMA 3SH5A 1CAXB 1MZFA 2VMGA 1QOTA 5JAXA 1JUHA 1OA2A 2EA7A 2W52A 3FE5A 2O8OA 4HANA 3JB8A 3KLSA 2PELA 2A71A 5C33A 1O7FA 3THPA 5JZGB 4K8FA 2VPVA 1AUYA 1IKQA 2GN7A 4QPGA 1GNHA 1IS4A 4HK8A 5CFCC 1F2NA 4Z8BA 2CGOA 5DUXA 4K21A 3WDWA 2D3PA 3O0XA 3HQXA 5C4WB 4PBPA 2JG9B 2XLFA 2DTWA 1C57A 3IDBB 4WVMA 2EVXA 3WDVA 5CIRA 3VKNA 5KHIA 4YVWA 1ZBE3 3ENRA 4DY3A 1FMD2 2ZGRA 1ZM1A 4IQPA 5FLJA 2YUEA 2ZZJA 3OCPA 4DRRA 4HMZA 1RUH1 2NZ9A 5GLVA 1Q56A 4WV8A 4LNVA 4Y20A 2NM1A 5CFDC 2K2SA 3SNMA 1FX5A 4MSVA 1AVBA 2QDRA 1OA4A 2RS11 1F5FA 4I01A 4C1WA 4A3XA 1TMF3 2ET7A 4DINB 3K51A 1TEIA 5KHJA 3M7AA 1QNYA 5BNPB 3JCIA 1S2KA 4ZXKA 2UYBA 3WHUA 1RJ7A 1YWKA 5C8CB 3B9CA 3AXDA 4IESA 2WZR1 3R4UA 1NA1C 1Y43B 2DVDA 4AWDA 2YXSA 1KJRA 2JKBA 4BH9A 1HRI3 4P9GA 1PIV2 2MNGA 3TN92 4LO6B 4D7TA 4F7ZA 4XFHA 3BOWA 1CVNA 2PLV3 4I02A 4PCRA 5D1IA 2UURA 2R072 4AVCA 2EAKA 1SBFA 2BTVC 4OHYA 2PAKA 2HEVF 3EXUA 4PIXA 4XQWA 5GM0A 4FT8A 4N9IA 5FOBB 4H14A 2P2KA 4PLMA 2VGDA 4P9WA 4BWOA 4AI0A 1FI2A 1N47A 3ILRA 3MW4A 1D2SA 1PO12 1D0HA 2ZMLA 3ZYPA 2QZ3A 2DFCA 2DURA 1BVP1 2BVVA 5E88A 1QOOA 4CEYC 1LGBA 2XJSA 2Q30A 4BOWA 3M3QA 5F5QA 1ZZ9A 4FOQA 4XF9A 2MEV2 4YSFA 3KT4A 5CFDA 4RQPC 5FBZA 1FPN2 1X8MA 3V0AA 4Q4V1 5E1RA 2GZWA 3N35A 2NP0A 3BB6A 1V6NA 2VW0A 3M2MA 4QGLA 2B9UA 1RUD2 3AMMA 1Z7S2 3LB9A 1ND3A 4P9LA 1CAUA 1XNKA 4LBNA 4YVSB 2DVAA 4ES9A 4Q4X2 1ZRDA 1LCLA 3FX3A 1KDKA 1DGRA 2QE3A 5BUVA 2ZA9A 4MGZE 3IPVB 1OKQA 3W58A 2XHKA 3H7YA 2F6BA 3E6DA 1CJPA 4EN6B 1AR62 3USSA 1QDCA 3ZSLA 1H30A 3CJXA 2NN8A 4HL0A 3V0BA 4WVMB 4XF0A 1WD3A 1IGOA 1NXMA 1JTZX 2JDZA 4OUSA 3LAGA 2A6YA 1MS5A 1ZRRA 5J3UA 3ZXLA 2XVGA 2PN5A 2R0HA 4TZDA 1HRI1 4FVVA 3DUIA 3KGLA 2NLRA 3MF6A 1FNYA 5KXEA 1TNFA 4Z07A 2B45X 4XHBA 2ENRA 4WM8A 4GA9A 5A32A 4QHBA 1VBB3 4EWEA 2DCYA 1HXS2 2D5FA 1SBDA 4FPLA 1CJDA 1NXD1 4D7YA 2F4PA 2IXLA 4Y1XA 2GC1A 5E8AA 3ZXFA 3B69A 2CY6A 2RR12 2XKPA 1AJKA 5JVVA 4GH4C 4EN9B 5C8CA 3SMHA 3KCXA 4M01A 4HPKB 4PDWB 2XJQA 4KNCA 1RUE2 2RM21 5HXVA 2WT2A 3GYDA 5GALA 4UBGA 5B2GB 5EXOA 1Q5OA 4YM3A 1AYM3 4DOUA 3GZTB 1BBT1 1N3PA 5CG9A 2VVDA 3WG2A 1DLLA 4P9YA 4OZXA 1ZZ7A 5IK8A 1LODA 2X5IC 2ES3A 3URFA 1SLLA 2X29A 4B4RA 4GMP1 3S30A 2ZX4A 1OLRA 3ZFFB 3SXWA 5L36A 2ZGMA 3DGTA 4MVTA 3RJRA 1QGLA 3IN9A 4FOYA 1PO22 2D6PA 1CQ9A 1DQ5A 4NPRA 1W6OB 4QQOA 4ZU4A 4MGIE 5JOWA 4XOGA 3QCWA 4IV1A 4AFCA 4XMIA 4WM8B 4OLLA 4XIOA 4QX5A 4RHV1 5D8AA 3ECQA 5H9PA 3H0OA 4D7SA 3VZJA 3BODA 3PVEA 4R9BA 4R8HA 1XNCA 3M1HA 5JI7A 5DDJ2 4LBMA 4B7KA 2XH6A 2XVKA 3U07A 3VBHA 4HKOA 3JD71 2B46X 2G9GA 2ZAHA 1PO11 2BEOA 2PLV1 4B4QA 3MLJA 3VBRB 3TAYA 5C8CC 3JQXA 4I2OA 3IDCB 3VKOA 1FV3A 1VBA3 2OA2A 3WDUA 4IERA 3DL3A 1XRUA 3TYJA 4HKLA 4E4ZA 4CDQC 1RIRA 1LESA 4I0WB 3ZPYA 1W6PA 4NVPA 4AYUA 1RUD3 4Y1UA 1FOD1 3AYAA 1GYKA 4M3CA 3QBQA 1BKZA 3SCHA 1SLTA 2X5IA 2XBO1 1H0BA 3IBMA 4Q2FA 3MLKA 4GMP3 1UU4A 2ARXA 3TOJA 1HV1A 3WCRA 1BQPA 4FPFA 3RSJA 1S1AA 2ZGKA 1YIFA 2FMYA 3MFAA 4Q8LA 4AFBA 2CWMA 1QDOA 4AEJA 4YFZA 5FMOS 3VBFC 5BY5A 1IQAA 2VOXA 1PZ7A 4FQZA 4PIZA 5J96B 1C8M2 3T2TA 2BQPA 1ENXA 2ARBA 4JQRA 5HCBA 4Y20B 5FLIA 4CTEA 1JUIA 4FQ4A 1VIWB 2WA4A 4BPZA 5SV8A 3NW4A 3S7IA 4YZ5A 5BNOA 2WINB 3QH6A 1PHMA 5E89A 4IEPA 5JR7B 5JZGC 1ULDA 4Q4Y3 3EQEA 1J3RA 3LA7A 3RPQA 2WIIB 1AX1A 4Q4W2 3HT2A 3TB0A 5GLZA 3ZN6B 3JBG2 4N53C 2D40A 3WHTA 2NPIA 5CBLA 5T55A 2MHFA 4RHV2 3FJSA 1MEC1 4MZUA 3N7LA 5F1RA 5T54A 4OHVA 1WGPA 1IPKA 3ZFGC 2GC0A 4W6YA 3CU7A 1QKQA 4XF1A 2VY0A 3MDPA 3HBZA 3CLPA 4YM1A 4FXGB 2Q1MA 4FOVA 1U0AA 1RUG3 2OZ6A 5CADA 1WMEA 3MGUA 1HXS3 2E7TA 3AP4A 1LULA 5ACA3 1GV9A 1L3JA 5K8SA 2HWE1 2FQPA 1DZRA 2ZPXA 3VBSC 2YHJA 2WKKA 1HW5A 1GICA 1UL9A 1JYIA 1X82A 5JMCA 3RNSA 2QVSB 1O3TA 3ZVXA 2R043 3VL9A 2VQAA 4EWAA 4ONUA 1RB8G 2O0OA 3DF0A 3TWIA 5C9AC 1LKNA 4QPIB 4BMEA 1PIV1 3OTFA 3UKVA 4QM8A 1LHUA 1OHFA 4WZCA 4PLOA 4OHXA 4AI3A 3HWJA 4RGAA 1A8DA 4A7KA 1AYN3 1H1MA 3NV1A 2YZ4A 4M3CB 2GN3A 2IXHA 2RS12 2PHRA 5TSWA 4N53A 4HETA 4ATEA 1W6MA 1RHI1 4BYYA 4H55A 1QH7A 2ZGSA 2DVFA 1NY71 2FHRA 4FPCA 1YIPA 1PVXA 4GWMA 2OVUA 4AEDA 4CEWA 1B09A 1MEC2 2B42B 1SLCA 2XJUA 3ZFGA 1JBCA 1DFQA 5JSRA 2GAUA 2ZCWA 1D4M3 2R30A 3SCGA 2VU9A 3ZFFC 1O4TA 1QXRA 3R0RA 1D4M2 1GFF2 2QDNA 2XJRA 4K6BA 5CB7A 3M3IA 3B94A 4N9HA 3VKLA 5BNNC 3FWEA 4E9KA 3WY6A 2WS93 1KQRA 3AP5A 4YRDA 5A33A 5JDBA 1S55A 3ME2A 4FPKA 5H9RA 1UX6A 1C4RA 1RUF2 1D0GA 1TMF2 2BUKA 2PHUA 2R1DA 4XBQA 3UKTA 3WLUA 1O3RA 1QJX2 2HEYF 2I74A 4X8PA 1AR72 2HKXA 2WNUA 4TLFA 5T5JA 1G86A 1YLLA 4BIFA 2RS33 1AXKA 1LGNA 1SLBA 1G8WA 1T6GC 2DWRA 2E63A 2QKDA 3OD4A 3NAPB 1GKBA 4IEUA 4M0NA 5A3LA 1K5MB 2WS91 4YG6A 2D6LX 3AJYA 2YPJA 4IV3A 1PVC2 4J6GA 4YZ4A 5GKAC 5H9QA 4COVA 3TRSB 1ASJ2 4WBBA 3WDYA 1VBA1 3ZN4A 2WC2A 1AL21 1LEDA 2AH2A 2PQQA 3MF9A 4WVZA 2ILMA 3WW3A 5DDJ1 3N7KA 2GNMA 4K1ZA 1PVC3 2AR6A 2GNDA 3DPRA 1BEV2 1UPSA 3VZKA 1ZBA2 4FCAA 4L99A 2RJKA 5CA6A 3MIEA 1W6QB 1C1FA 1YJLA 3CL1A 4P9JA 1EV11 3POSA 1AL23 1ZYBA 2DVBA 3NV4A 3OGJA 4B4PA 1DGWA 4IEYA 4A2UA 3APBA 5JOXA 1COV3 2P3KA 4FSJA 2BYVE 1NLSA 3D5OA 4YW2A