3FHIB

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fhiB01
1DZRA 4EWAA 1Q3EA 3JZVA 3ACLA 4JV4A 1CAWA 5FQ0B 2QNKA 5I0UA 5E16A 3LA2A 4GULA 3CEWA 4IERA 4YRDA 5JR7B 4NVPA 1XE8A 3WW2A 4KWKA 3MPBA 3ES1A 5KHHA 5KHJA 3GBFA 3IWZA 4XFGA 4META 4XF9A 4H7LA 1L3JA 4JVAA 1X8EA 1O4TA 5KBFA 3ROUA 3R6SA 2GC2A 2B9UA 1J3PA 3IIAA 1VR3A 3OF1A 5C8WA 5K8SA 3OTFA 2CAVA 4EV0A 4AVBA 3SCHA 3KMHA 2Q30A 2B5HA 2Z2SB 3KGZA 3LOIA 4MGZE 1ZREA 2KXLA 3I54A 4N9IA 2VPVA 1UIKA 3BALA 1ZZCA 4A2UA 1JUHA 5JSPA 3HT2A 2FQPA 4XF4A 1RGSA 1WLTA 4YSFA 3I59A 4LEJA 2OA2A 4KWJA 3E6BA 3N4MA 4ONUA 3LA3A 2E9QA 1CAVB 2UYAA 2MNGA 3L2HA 4MUVA 4HLTA 2I45A 3EBRA 4ZU5A 2GH2A 4I3PA 4QM8A 1VP6A 5I0TA 4O9EA 4HSLA 4J1WA 4AVCA 5FQ0A 4O9GA 1G6NA 5EZWA 4CYDA 3NKTA 2H6CA 3TNPB 2BGCA 3GYDA 2PAKA 1TQ5A 3ST7A 1FT9A 1SQ4A 2K0GA 1CAXA 4Q0VA 3EJKA 3RDIA 4XETA 3CO2A 4B29A 1PM7A 1Y3TA 1ZNPA 1I6XA 4JTOA 1UCXA 1CAXB 4ORFA 2Q1ZB 3QACA 2CV6A 3KGLA 3NW4A 5LEJA 4LA3A 2BEOA 3DL3A 4WZCA 3USSA 4YARA 4LULA 4QXKA 3DKWA 2UYBA 4ZU4A 3WW4A 3D0SA 1SFNA 2UY8A 4Z82A 3QOPA 5I93A 5JSOA 2OZJA 1EY2A 2OPKA 2ETEA 4FT8A 3RYRA 4ZU7A 4IETA 4E2GA 2EA7A 5BY5A 2QJVA 2ZKLA 2IXCA 2CAUA 5CVRA 5JSRA 1ZRCA 5E1RA 1ZZ9A 4IESA 2IXLA 3B02A 1Q5OA 4IEWA 1O3QA 4EWDA 1FI2A 3FFQA 2PHDA 3RYPA 1J3QA 5J7MA 2ZCWA 5BUVA 3UKVA 2IXHA 3VHRA 3H3ZA 4XFAA 2VQAA 3PLQA 2O1QA 1OD5A 1CAWB 2V09A 3HT1A 4DINB 4IEOA 5C6CA 5I91A 1CAUA 4OLLA 3BCWA 4IEQA 5I0SA 1IPJA 4Q29A 5LRRA 3SMHA 2OZ6A 4HVRA 2D93A 4X6QB 2CGPA 4P9GA 2D40A 1XE7A 4I0BA 5JCTA 1UPIA 3CF6E 4MZUA 3H1MA 2EAAA 3PNAA 2XLFA 3C3VA 4UBGA 3FWEA 4MGYE 4F8AA 1SEFA 3RPQA 4HN0A 4KU8A 4XF0A 1H1IA 4AQ2A 1NZCA 3NL1A 1O5LA 4I09A 5EFUA 3RNSA 1ZZBA 3U11A 5CU1A 2XLGA 1CGPA 5KHGA 2PAMA 2WFPA 4IEYA 4TLFA 4MV2A 4PJYA 4XFIA 1RC6A 2ET7A 3FZ3A 5FPZA 1O3SA 1DGRA 1UIJA 4XF1A 5FDBA 4FAGA 1RL3A 2PQQA 2MHFA 3HIFA 2IXKA 4MGKE 2H6BA 4F7ZA 1H1MA 2GAUA 1PMIA 3M70A 4KWLA 4R52A 5LRSA 2WC2A 1ZZ7A 1J1LA 2XL7A 2HKXA 4IEVA 5JAXA 4D7SA 1QWRA 3DN7A 5BV6A 3M3IA 1CAVA 1ZX5A 2QVSB 5HI0A 1EYBA 4LUKA 4X6RB 3FX3A 3MYXA 4WBBA 4BYYA 1OFNA 3FHIB 1XRUA 4Z07A 4UBHA 3LAGA 3EO6A 4LA2A 1EP0A 3E5XA 2IXJA 2XGXA 4YYOA 4LLOA 2F4PA 4QX5A 4Q0PA 5FLJA 2XLAA 2PAEA 2H0VA 2XHKA 4EWEA 2HJIA 4MGIE 4QM9A 4E2QA 3SCFA 1U12A 4MX3A 3S7IA 4BHPA 4OFGA 4AVAA 1QXRA 1LRHA 2Y0OA 4LTAA 3SCGA 2GC3A 3UKNA 5I8SA 3I59B 5D1IA 2Q4SA 3NJZA 2IXIA 5I8TA 3CJXA 1NE4A 2ATFA 3BB6A 2GU9A 1HW5A 2VECA 3KCCA 4XFBA 1YLLA 1GQHA 4FBFA 2EVXA 3NVCA 3NSTA 3MDPA 5KHKA 3IBMA 3S7EA 3H7JA 3WW3A 1X8MA 2P17A 2XKOA 2GZWA 3H8UA 4PIXA 2DCTA 1OI6A 4IEUA 2PTMA 2BNOA 4I2OA 1ZZ6A 4IEPA 2XL9A 4N9HA 3WW1A 3I7DA 2QCSB 4K8FA 3CL1A 2MPFA 5BXXA 1YFUA 1O3RA 2BYVE 4XEZA 5FPXA 4Q0QA 3LA7A 4XFCA 3IDBB 1O5UA 4QGNA 3H50A 2FMYA 1O3TA 4Q0SA 3OD0A 4FAHA 2D5HA 4E2SA 5FCCA 3LZZA 2Q0AA 4WVZA 2PHLA 1LR5A 4I01A 4HMZA 4LUMA 2PFWA 1CX4A 3UKTA 2PA7A 3H9AA 2Z69A 5I0RA 3RYKA 1YWKA 4MH0E 4HVQA 4Q0UA 1ZRFA 1X7NA 3H3UA 2GC0A 3OCPA 2BNMA 4XF3A 2N7GA 4HZFA 5I8YA 1RTVA 4I0AA 1OMIA 3HQXA 1LB2A 2PYTA 1WGPA 3CLPA 3TNQA 3MZHA 1QY4A 3D0JA 3O14A 3E6CC 4KU7A 5J48A 4BH9A 1CAUB 3H7YA 4IEXA 4IEZA 3E5QA 3ES4A 1YFYA 4XFHA 1QXJA 4QGMA 2QDRA 1ZRDA 3E97A 1Y9QA 3S0MA 2B8MA 3PVBB 2C0ZA 2BNNA 3ZDSA 4YNIA 1O7FA 1YHFA 3U0ZA 3KSCA 1YFXA 4PIZA 4BIFA 4HN1A 4AQ6A 2UY9A 1DGWA 3H1YA 1NE6A 1J3RA 4HVOA 3BU7A 3LWCA 2K9ZA 3OGJA 4HSJA 1RUNA 4J1XA 4R8HA 3ELNA 3IDCB 4JTNA 5FLHA 3E5UA 1DZTA 3U10A 1V70A 1NYWA 4PIYA 2OYZA 2IC1A 3ETQA 5BPXA 4AXOA 4QMAA 5J3UA 3SHRA 1UW8A 1YUDA 4I02A 1J59A 4RD7A 1LKNA 1VJ2A 5T3NA 3DV8A 5F1RA 5FLIA 4UXAA 5CADA 1Q43A 1FXZA 3H1WA 3RZZA 4XFFA 2GC1A 4HBNA 4D7TA 5KHIA 5LEKA 1ZVFA 1J58A 4KL1A 2D5FA 3D82A 1YFWA 1I5ZA 4L2NA 3FE5A 1IPKA 3SXWA 1NXMA 1ZRRA 3FJSA 2O8QA 3E6DA 3G7DA 5AVPA 1EPZA 3EHKA 1UD1A 1ZZ8A 4QGLA 4EROA 1RUOA 1GQGA 1X82A 1WA4A 2ET1A 4L11A 3EQEA 3BPZA 2XKPA
chains in the Genus database with same CATH superfamily
4NIGA 3SKVA 4Y1YA 2RDQA 1Q3EA 4EWAA 2NP0A 1LEMA 5K0UB 5A3NA 2FMDA 2LROA 1CVNA 5FQ0B 3LD8A 5E16A 3N9MA 1W8WA 5FBZA 3BYWA 5ERLA 3UL2A 1DDLA 3DYOA 3OUHA 3ZKUA 5JR7B 3MLKA 1JYXA 1REFA 2BBVA 2ZBJA 1U5XA 3QBQA 4XAEA 1JZ8A 1RUG2 1OLME 2WQ4A 1AL22 3GBFA 2W1QA 1YQCA 4HT1T 4D6QA 2OXBA 5T54A 4XF9A 2XJPA 5CFDC 1GZTA 4LBQA 1HV0A 3V64A 3CHXA 2NN8A 4CUCA 3KVAA 1PNGA 1WLCA 4QAWA 3ROUA 2ZZQA 1N3QA 1OVPA 3ITQA 3SH4A 2B9UA 3LKJA 4TSVA 2XWBB 4Q27A 2J1VA 1DYKA 2VBBA 4KNCA 5GZGA 1PHMA 3OF1A 2VXRA 2X8KA 2ZX2A 4Y1ZA 3TEWA 2Q30A 1ULOA 4P9WA 4A7ZA 5FYCA 2B5HA 2O8OA 5JOWA 2ZA9A 3M3OA 2Y6FA 2AR6A 1R1ZA 2KXLA 4FI9A 4Y5SA 4ZPIA 5A3OA 5KHGA 2IZWA 4TLGA 4LO6B 2VPVA 3MW3A 2D98A 3VL8A 3MV01 1JUHA 3VZMA 1NA1B 1N1SA 2QQIA 3HT2A 4NIHA 1WLTA 1BLZA 4MGSA 2WZR3 5DAXA 3OBAA 5T5LA 1SMVA 2OA2A 1G9CA 3N4MA 2R49A 2PQSA 3LA3A 1JU3A 1OH4A 2JDMA 1VPHA 3ACFA 4HLTA 1ENRA 4I3PA 4MADA 5IK8A 2FDKA 3AL6A 2GDFA 4GKYA 1UWWA 1VBD3 4DOUA 4M01A 3LDRA 5H9SA 4AVCA 5FQ0A 3N36A 4BXSV 3ZFEA 2WZR1 5KWRA 4AK3A 3I2KA 1H4GA 3FUQA 4CZSA 3WF1A 3TNPB 1VRH2 4K1ZA 2WNUA 4UFLA 4IXLA 4AI8A 3GYDA 4XUQA 5FPAA 3APBA 2VG9A 1UOBA 4IE7A 2PELA 4V1PA 1FT9A 1RUH1 1UX7A 1W6QB 3UGGA 1O8PA 5C3SA 1VMJA 1W99A 3LFMA 1NLSA 5F37A 2D6MA 3O12A 2HWB3 2YB7A 3EJKA 3K4DA 3OBTA 1RMU2 4XVHA 1KD7A 5C3QA 5FJHA 3VKMA 1FV3A 4A42A 4CDXB 5JWPA 2FDGA 4YVSB 1Y3TA 4XIOA 1NY72 1UCXA 4OHXA 4OQ9A 3SEEA 1VBE3 2PHXA 5LBFA 5FMCA 2GN7A 3USUB 5C4WC 3B9IA 2LTNA 2FD8A 1O8SA 1MVQA 2Z42A 4LA3A 2R1DA 1DIWA 3W9AA 4ATEA 4BK4A 5IHRA 1GNHA 2WUHA 2W52A 3HJRA 3T3YA 4LBMA 2EAKA 3U14A 2D6PA 4CP0A 2YV8A 3GF6A 5F7UA 1OQEA 3DKWA 1ACCA 2HWF1 2XUMA 3B93A 3D0SA 2Q8DA 1AX0A 2UY8A 4Z82A 2VZ3A 1SLCA 2R073 1O4ZA 3URFA 5JSOA 2EIDA 4HETA 4IV1A 3IDEA 1CN1A 1EY2A 1G9FA 3GBWA 2OPKA 3VBFC 5CFDB 4ZONA 1ALYA 1BEV3 1HXS3 2ETEA 3LEMA 3JBG3 3Q8AA 1DCSA 4YGBA 4FT8A 4CP2A 4K21A 2QUOA 1JZ7A 1SBEA 1GR3A 1DYOA 1UZVA 1RUI2 2XDVA 1YC61 3D6EA 5C8CA 5JSRA 2FDFA 4BMBA 1DYPA 1UY4A 2IXLA 1UPSA 4IESA 1R091 1VAMA 2ZGOA 3B02A 1VAKA 5IATA 1Q5OA 3FC0A 4IEWA 1RITA 4CA9A 1O3QA 1S55A 1GBGA 3FFQA 5HCBA 1WD3A 1GWMA 4ZHNA 4XABA 2ZMLA 4CEWA 2P3JA 3VD9A 3T4HB 3M1HA 2JWPA 4RGGA 3NO8A 2XJVA 1U5YA 4Q4X3 1LOFC 1LULA 5L9VA 2TEPA 4A6OA 3H3ZA 1UYXA 5A3UA 3LB9A 2DCJA 2O1QA 2J42A 4G4FA 4LMFA 1ZYBA 1SG3A 2V09A 3HT1A 2BOJA 4WVWA 1H2NA 3ZYRA 4Z2AA 2JKXA 3BCWA 2VZ1A 1XQNA 5I0SA 1FPN3 4QWNA 1LGCA 2QQOA 5H9RA 2OZ6A 5GLWA 4DXTA 4HVRA 4BQ4A 2A6ZA 4FTEA 1ASJ2 1GANA 3WUCA 1YQ8A 2RS13 4N90A 1FNZA 2D40A 2JB4A 1DF0A 3V0AB 3O1TA 3I3BA 4S2GA 3WNXA 1A8MA 4ATFA 1UPIA 4PLMA 2G4IA 5F3EA 1S0IA 1GFF2 1LGBA 1PVC1 4F8AA 1GZWA 1POQA 3AZVA 3EXUA 2ZXQA 1Q8SA 3ZN5A 2WQ8A 4AYUA 4HN0A 4XF0A 4Q4V2 5J98B 1O5LA 1W8TA 5A33A 2J1SA 4Z2WA 2DVDA 3WLUA 4M3CF 1CGPA 1ENXA 1SACA 3GZAA 4IEYA 4TLFA 1YXWA 2QDNA 2DUPA 4XACA 3ZFEC 1OHFA 2A73B 1N1TA 1L7LA 3KB5A 1RC6A 2ET7A 4CPBA 3BTZA 1UIJA 3L9JT 4HANA 3NWKA 1JYCA 2VMCA 1COV3 4XF1A 3TN92 2PQQA 2MHFA 3HIFA 1AL23 4QHZA 2IXKA 3LEKA 4MGKE 3NQHA 4BMEA 5LWBA 4JZRA 1RYYA 3WHUA 2X5IB 2ZAHA 3M70A 4R52A 5LRSA 1ZZ7A 1RVF3 4R9AA 5LASA 3ACGA 2DCKA 1KITA 3P3PA 4YGCA 4JGYB 5EV7A 5FYIA 1HV1A 1D4M1 1Q8PA 2P1BA 3U1XA 3RJ2X 5IW0A 1OC1A 4Q4Y3 4ZZ8A 3ON7A 4KQ7A 1AYM1 1F4AA 1YI9A 4YLZA 1UU5A 2QVSB 1W8UA 1RUE1 2WFF2 1EYBA 2RJLA 4DUVA 5AFEA 5IUQA 1AYN2 2LM3A 4BB3A 2WRAA 2ZACA 4AVTA 5CKQA 1POV0 1RXFA 4IV3A 4WBBA 3AVSA 5HBAA 3Q8EA 2W87A 1XRUA 4Z07A 1W3VA 3WG2A 5L9BA 1ENSA 5A6QA 3LAGA 3EO6A 4LA2A 2YDEA 2XH6A 5EYXA 3IM0A 1CZVA 2G19A 2VR4A 4OYUA 3CJIB 4M4RA 1PK6A 1RHI2 1WCQA 3AP7A 3NNLA 2F4PA 4QX5A 5FY7A 1JODA 2A70A 5LA2A 3WY6A 1UO9A 5BNNC 1JYNA 3E6CC 3AC0A 4N7UA 1W6OA 3GDBA 1AXKA 1HX6A 4P9XA 3ASIA 3ZDVA 2AYHA 2HJIA 1Z0HA 3T2PA 1PO13 4CDUC 4D3WA 5FXWA 1FNYA 2ZAAA 3U37A 5FZ1A 3T1LA 4Y5Z0 3VKOA 5A7SA 4JGYC 1HXS1 2ZGMA 1JW6A 1LENA 1JTZX 1UKRA 3AMHA 4Y24A 3PU8A 4Y5TA 5D1IA 5DG2A 1HDKA 5GLTA 4BWOA 3AYCA 2RS52 3BPSA 3WQ7A 2GMMA 2WA4A 4IE5A 4LORA 1HW5A 1K5JA 4M3CB 5FKCA 1YLLA 1GQHA 1NCRA 4DO0A 4LBKA 3U78A 2HWD3 5D8AA 1U0AA 4BZ4A 3VDAA 3WF0A 3ZSKA 5J36A 1JS9A 3OB8A 3HR9A 3OYWA 2BRTA 2FDJA 1V6OA 2EXKA 5JMOA 2XKOA 3H8UA 3ZKYA 1ZA7A 2DCTA 3HWJA 3LCPA 3ZLIA 4LITA 4P14A 2BNOA 4UAPA 5IVCA 4GJYA 4IEPA 2XL9A 3J7HA 5JPNB 4BLJA 5FZCA 3WW1A 4WV8A 1XSRA 2ARBA 2WN3A 2XJTA 1Y43B 1TEIA 5FWJA 3ZXLA 4C91A 3WNKA 3CJIA 4K8FA 3CL1A 2MPFA 2ERFA 1C8M2 3MO4A 1NLQA 1UYPA 1YFUA 1O3RA 2YXSA 4Q8LA 4JDNA 4RHV2 4AG4A 3CU7A 3N9PA 1HIXA 5IFTA 3J8F3 2QQLA 3ZFGB 2C24A 3IDBB 1BEV2 1O5UA 1WA6X 1XNTA 2WNOA 3AMPA 3DPRA 3M8LA 1RMU3 3GM8A 4GALA 3IMNA 5DUUA 1SCRA 2VCCA 1O3TA 4W6XA 4JQRA 1A3KA 4FAHA 3OD0A 1OD3A 1W8FA 3ORJA 4N7IA 2ZOEB 2VMIA 1H8TA 1UAIA 2JXAA 3ZYJB 4CSWA 2D5HA 2VY0A 1W04A 3AMQA 1GV9A 1OKOA 1Y9GA 5FPLA 3T1MA 2Y33A 3JQWA 4I01A 1MS3A 4OULA 5LATA 4XMAA 3AKTA 2EF6A 1JOJA 3UKTA 1GICA 2PA7A 3H9AA 3UK9A 3VD5A 1S1AA 3HBZA 5I0RA 1YWKA 3O1OA 1X7NA 3T4VA 2VZRA 2W92A 5FZIA 3AKPA 2Q8CA 1OSGA 3I2DA 4BIOA 1CQ9A 4XURA 2DVBA 2GP3A 2V4AA 4Y22A 4BQXA 4HZFA 4QKNA 1RTVA 2LS6A 1QJEA 4DRRA 2CHHA 2VMHA 4QX0A 2RG4A 4ZXKA 3BTXA 1OT5A 2JE8A 5FIXA 5BNOC 1KEXA 4WZFA 3SXWA 3BODA 1BBT1 4URTA 5D8AC 5EJ1B 3D0JA 5GKAC 5A3PA 1RUI3 3R05A 2W2IA 3INAA 3A0KA 1W6OB 4LK6A 5J48A 5KXCA 3JD71 1VBA2 4K3UA 1JYTA 1SLIA 4IEXA 5FZ6A 5FZMA 1W2UA 4AVSA 4BDVB 1AR61 1ASJ3 1YFYA 4Y20B 3VZLA 4P08A 1QXJA 1GOHA 2HLEA 2VJXA 3M3CA 3Q8FA 3ZMNA 3ZR5A 2OVUA 2ZHLA 3J7LA 5LA1A 1YJLA 3O0VA 4PHZA 2RDRA 3C7HA 4CDXC 2VZOA 5A7WB 5EP9A 1NUKA 1K12A 4HG6B 5FOJB 1Y9QA 5A7NA 2GSYA 4GMP0 3HD8B 1OUXA 2BNNA 3SITA 3B00A 4PLNA 4QB1A 5F3IA 5JZGB 1HN0A 1YFXA 4YM0A 4CDUA 2VW2A 4JGZC 4O7XA 3DPRC 3H1YA 3T2TA 4JGZA 2VW1A 2OIIA 1J3RA 1WW5A 5BNNA 2CDOA 3WG4A 2Y6GA 3P6BA 3LWCA 4RS5C 1AJKA 1XJAA 2K9ZA 2W68A 3ILNA 4EN0A 3VHNA 4J1XA 3PJYA 4MYEA 3B01A 4PCRA 2I07B 3ELNA 2XB6C 2Q8EA 5CFCA 1GOFA 2A7AA 4GB33 1TE1B 3DECA 3KT1A 1S0BA 5JXHA 5F5AA 1SPPB 1XYPA 3K48A 5IWFA 3T08A 3K46A 3I8TA 1NYWA 2W47A 1D7PM 1SHWB 1UZZA 2IC1A 2JB8A 3ACHA 5C9AB 2UWCA 1V6MA 1YQ6A 2WZ8A 5BPXA 4CXWA 4AXOA 3DCQA 3GHMA 4YG3A 1UW8A 1YUDA 4I02A 3SHRA 4XPVA 4CCLA 4CP9A 4HOOA 4EYUA 1RXGA 2CGOA 5EXOA 1MVEA 2VO5A 3FLRA 3MEPA 5T3NA 3VZOA 4CP1A 4DIQA 1QDCA 3GJAA 1LU2A 1N1YA 1IPSA 1PX4A 2KR2A 2ZX3A 4UFKA 2SBAA 3AMMA 4LJHA 3VLBB 5CADA 1W05A 2E31A 5FUPA 3U4XA 3AB0A 2BJSA 3H1WA 2G9FA 3RZZA 3AMNA 3KF3A 5J96B 1I1EA 3R4SA 1JH5A 2HH9A 5FYZA 4GH4C 3KV5A 4OQ8A 1BMV1 1ZVFA 3O1UA 1UZWA 4AF9A 1J58A 1HJFA 1LOAA 1O91A 5FZOB 4AEJA 1TG7A 2P3IA 3D82A 3AM2A 1XPWA 5FUIA 5ANQA 4BJ0A 4L2NA 3FE5A 2X09A 5F6LB 3IMMA 2C26A 3G7DA 2A6YA 5AVPA 2ARCA 1CX1A 1QXPA 3ZPYA 1W0PA 1UX6A 4M3CA 4F3JA 4INDA 1ZZ8A 3VBRA 3CMGA 3DUIA 3HOBA 1RUOA 4QB6A 1W6PA 2QFEA 1QOOA 1JZ5A 5ABJC 3BPZA 4DNYA 5C5UA 2OQ6A 1DZRA 2JX9A 1XE0A 4PDWB 3JZVA 1HQLA 5FXVA 2ZGPA 2JDYA 3ACLA 1CAWA 3EMRA 5E89A 4A7YA 5I0UA 1GNYA 2D43A 2AC1A 2P6CA 2RJKA 2UWBA 3J4UH 3VV1A 4GULA 4XTPA 3FUOA 4QDSA 3MPBA 3RFRA 2HWB1 3PL0A 1GU3A 3OGSA 1F8VA 4FTSA 1C1LA 2VE1A 5ABJB 5KC6A 4ARYA 4EE2A 1LOCA 2ARAA 1H2KA 1L3JA 1R1A2 4Y3OA 4COWA 4JVAA 2Y0IA 3ME2A 1JOPA 4QDRA 1NCQC 2RR13 2WINB 4MSVA 3ZN6A 3AL5A 4DEVA 2GC2A 3S5AA 1FX5A 3P1IA 3OPZA 3Q9OA 2F6BA 4LO7A 1BBT3 1N3PA 3IIAA 1IGOA 4Q4V3 5A3WA 1UYYA 5K8SA 2YGMA 2CAVA 1Y4WA 2G1MA 3GZUC 3PUSA 3MFCA 1JXNA 4LQRA 3KMHA 4AI0A 4AVBA 1BMV2 1J1TA 4NN0A 1V9U3 2E7TA 3KGZA 3ZR6A 5B4XA 3HEIA 1ASJ1 1AR63 2ORXA 4IE6A 4MHUA 1ZREA 1RUD2 4K6BA 3T0DA 1K5MC 2ZJCA 1JZ2A 4A2UA 1C5IA 1COV2 2XJSA 4ITCA 4GMP1 3WEZA 1HQNA 2XXZA 3POWA 1SBFA 2Y60A 4KWJA 1IS5A 4YVWB 3JCIA 4ONUA 4OI2A 1BCXA 3OPTA 2VCBA 3OY8A 2YY1A 4Q4X1 3GCXA 3L2HA 1XYNA 2I45A 2ZGLA 3FFZA 4ZU5A 2GH2A 3V56A 4Q5OA 2L9LA 1VP6A 4ISQA 2WNVC 5I0TA 3MW2A 1UQXA 4J1WA 1VIWB 4CCNA 5IK5A 5GALA 3ETPA 3EYPA 2QQPA 2JECA 3RWKX 4FOWA 4C0HA 5DUXA 3C2UA 3H42B 1C1FA 1IQDC 1PO22 4OUEA 3DPRB 3NKTA 5FZHA 2H6CA 3T09A 5IVBA 2JKBA 5FZ7A 3MLLA 2RV9A 2PN5A 3KZ4C 1X50A 3MHZA 5F2WA 2YBSA 4Q1PA 1MQTB 1UY0A 1PVC2 3OEBA 2WNVA 3BU0A 2BERA 1CJPA 1DQ1A 4BM8A 4JKLA 2K0GA 1UZYA 1CAXA 3MIFA 4A44A 3AP4A 4Q0VA 4RQPA 3BVCA 3RDIA 5FP8A 3R4UA 1B09A 1BYHA 4XETA 3CO2A 3KV6A 3TAYA 1W3XA 4DZGA 2VTXJ 3VBHB 4AFCA 2XQRA 2ES3A 5LCWL 3OGVA 4NHYA 3THPA 1QJX3 4FTBA 5KXEA 3N9OA 3C8XA 3KGLA 1AHSA 5LEJA 1MACA 1B35B 1ND2B 1W6MB 3BOWA 3JD72 5A7WA 2WFF3 2C6SA 5D8AB 2NYYA 5JUVA 1AYN3 5C71A 2PLV1 2YBPA 4ISRA 4XDPA 1OKQA 1SFNA 3PU3A 4XW3A 4AFMA 5AC93 3GHNA 4NROA 1NCQA 3KS7A 3QOPA 1HRI2 4WM8B 2GN3A 4LBOA 3RSJA 3AK0A 3UGHA 5E88A 1XNAA 2CU5A 2WO1A 2YGLA 1CPNA 1URXA 2OS2A 3N7KA 3MPPG 4N53A 4XE9A 4AW7A 2HWC3 1JU4A 1QF3A 1ND3A 1SFPA 3VZJA 4AEMA 4ZU7A 3J7MA 4G9SB 1D2QA 3O1PA 4UWDA 2J1EA 5JXGA 4SLIA 1F15A 2VOWA 2W1UA 3LEGA 4NHLA 5FY5A 5CB7A 5IVEA 4R4XA 4QXHA 1COV1 2EXIA 5A7OA 3UETA 1AZDA 3M3EA 2BWAA 2IFWA 1F5FA 4KGQA 1F5JA 4QB2A 1XXNA 2WLQA 5A32A 5IT6A 4MXVA 5GJ6A 1W6NA 3RYPA 5ABJA 1QJU3 1PNFA 1AR83 1NT0A 2ZCWA 1IS3A 5FYHA 1MZ5A 1VBC3 5ACA3 1JMUB 2W39A 3RZJA 5CFDA 1UOFA 1SLLA 4RHV3 4IGOA 2A3YA 4A7KA 3PLQA 5FYBA 3VBHA 1CAWB 1H1AA 3I2GA 5JZGA 2Z5WA 1DQ2A 1FOD1 1PIV1 2VUCA 3ZXKA 4DINB 4XJZA 2HYKA 4IEOA 4P00B 5LY2A 5C6CA 4AOCA 5I91A 2JDUA 2GNDA 3POFA 4IEQA 4OI0A 1AR71 4YW1A 5FRAA 4FFHA 2VGDA 4CEWC 5IYYA 2RS51 4Q29A 2ID4A 5D21A 3SMHA 5CBLA 1S2BA 2R071 3LEIA 3U4SA 2CWSA 3ZSJA 2Q5TA 5FZ3A 2WQZC 3KVBA 4AGVA 2MEV1 2NLRA 3BKZA 5K0UA 2CSGA 5JXJA 1AXZA 2YFZA 4XYXA 4XUOA 3NJVA 5DZGA 3MIBA 3LFIA 3WG1A 5B4NA 2B4KA 4DQAA 4K9SA 2XLFA 1IOAA 1C8M3 3LSDA 2DUOA 1LHWA 4MGYE 1JUIA 2B42B 2BDRA 4YZ4A 3MUZ1 3THTA 3DXUA 4XHBA 4Z1VA 2DBNA 4I09A 1GYKA 1ZZBA 3M7AA 2AREA 1LCLA 3NAPA 4A6SA 4A3XA 4E4SA 3AYEA 4COUA 1BK1A 1Q8QA 3THDA 2W08A 1C8M1 1DGRA 1K3IA 5FDBA 3DXTA 3USUA 4NRQA 4N43C 4WM7A 3WUDA 1RL3A 1QJY2 4B4QA 4FAGA 4P9LA 5TSWA 1JOBA 2XUEA 3VUOA 3KWVA 4CCEA 2H6BA 4XBLA 2BOIA 4AWDA 4QPYA 2CY6A 1H9PA 4KWLA 5G04L 1J1LA 3CNAA 2XL7A 3CJIC 5BYNA 4IEVA 1WBLA 2DTWA 2R041 4NUBA 3S30A 1NCQB 4AI3A 2VD7A 1XU2A 2YUEA 3T0AA 1OOPB 1BBT2 5HXVA 1GSLA 4RGKA 4Q2FA 4UW3A 1CAVA 2B46X 4YW2A 2VVFA 4LUKA 1IKPA 1OF3A 4YVWA 2R7EB 5K7PA 4LXLA 2FCUA 1ZA4A 4Q4W1 3FHIB 2BU9A 3ZPOA 3H8XA 2WNEA 2R043 3OEAA 3A0NA 3VD3A 1PMJX 1UNBA 4A3ZA 2XGXA 3B3QE 4LPLA 4YYOA 5F8PA 4PBOA 2YPDA 2VBPA 5LY1A 5AFBA 2Y64A 1IG3A 1BVP1 4FPLA 3VBSC 2ZTNA 3ZOIA 2XHKA 1C8NA 5LZ6A 2P3YA 2VMEA 4CU7A 4MX3A 5FYSA 3S7IA 4OFGA 4GD4A 4QKBA 1QXRA 1FPN2 3AP9A 4YVSA 2Y0OA 2G9ZA 2JDHA 2P34A 4RS5A 4FFIA 3K3NA 3OUJA 4XCAA 5FZEA 2VC9A 1UOJA 5I8SA 3D8CA 2OX0A 3F2ZA 2Q4SA 3D4KA 2GH8A 1IHMA 1ZRIA 3CJXA 4RSUA 4LR4A 3TEZA 1Z7S2 2XVKA 4PI0A 1JHNA 2D6NA 2GU9A 2VECA 3IPVA 4DY5A 2XWJB 1RUD1 2HWD1 4OUMA 1OF4A 1UXXX 1C28A 2JG9B 5FO9B 3ZFEB 4NHKA 5FV3A 1TME1 1RINA 3IBMA 2WR9A 1DQ4A 4IV3C 1TZOA 4GA9A 4S2HA 1US2A 3AKRA 1LOGA 1GP4A 1X8MA 3WNPA 4AFAA 3W59A 1MQTA 5IVJA 4CDWA 1OI6A 4IEUA 2VQ0A 4JC1A 5EHDA 5C4WB 3BUCA 5JOZA 2VUAA 4N9HA 4NWVA 1V6IA 1VB2A 2YC0A 1DLCA 1FAYA 1AJOA 4B8EA 4YVSC 5HCAA 2IVIB 3IAQA 4NAOA 1HB4A 5FZ8A 3PMSA 5BXXA 1PO11 2BYVE 2R30A 5FPXA 2JICA 2VULA 5ANNA 3ZXGA 3WXPA 3LA7A 2DDUA 3WP5A 2D44A 2W95A 2ZKNA 1ULFA 1QIQA 4QGNA 3HQUA 2R061 5FP4A 1KDKA 2E33A 3H50A 4TWTA 1R093 1Y7BA 1A78A 1QKQA 3JU9A 4CDQC 5EQUA 3O0XA 2DCYA 3AKQA 2ZHMA 2QKDA 3NV4A 2QZ2A 2BVBA 1W0NA 4IGPA 5JMCA 3D5OA 2FHRA 4UFJA 4WVZA 2X29A 4R9DA 2XBO3 2AGSA 1MEC2 1MZFA 5L19A 5JZGC 3JBG1 1SLTA 2ZEWA 5CKMA 1RIRA 3RYKA 1V6JA 4HVQA 3H3UA 1D0HA 1YIFA 4HKWA 3OCPA 5AC92 3TOJA 2BNMA 2JIGA 2WBKA 2ENRA 2QQNA 4XF3A 5F32A 5L36A 4XQ4A 5I8YA 4I0AA 5GZCA 2E7QA 3RZGA 1OVSA 4IL7A 1HRI1 4Y1XA 3WDTA 4E27A 3S57A 3MZHA 2JG8A 1WGPA 2CGNA 3CLPA 1RUD3 1UF2C 3K3OA 4Q26A 5FWEA 3WDWA 1R082 5FZDA 2O0OA 4ZS3A 1LESA 1LJ7A 5LB6A 3B7MA 2ZGRA 1ONAA 3O14A 3POGA 1DG6A 1DGWX 4KU7A 4XJWA 2AUYA 4Q4V1 2EIBA 1LOEA 4QX1A 5FAXA 2J1TA 3H7YA 3TWIA 4AFDA 3LSEA 1A8DA 2UURA 3E5QA 4L92A 3ES4A 1WMFA 1S0EA 1QQP2 4HK9A 4N8MA 4HFSA 5FY8A 4XFHA 1YO8A 4EN7B 4QGMA 5FYUA 1RUF2 4D69A 4HONA 5CISA 1AR72 3U07A 5GLVA 3E97A 1MS1A 3S0MA 2C0ZA 1QHDA 1KFUL 2Z79A 3MF6A 3WQBA 4ARXA 3ZDSA 3M3QA 5A3TA 1O7FA 3AZWA 4HXCA 4COZA 1PO23 1SDWA 3U0ZA 4K1YA 5FZGA 1HB2A 5GLUA 4P02B 4OHVA 3WP3A 1W9WA 1AR62 5HCHA 5FMOS 3ZXJA 3KV9A 4H55A 1VBB3 4LLFA 3RJRA 5T5OA 1C5HA 5K0UC 1KS5A 4RN5A 2HYXA 2WLPA 3BU7A 5HV4A 1KDMA 2VUDA 2QQJA 5DUVA 1HQWA 1W0OA 3I3EA 2A1XA 5A7QA 4HSJA 2WZEA 3DKQA 4FXGB 1I3HA 4FPEA 1V00A 3WHTA 3OOXA 1VBA1 2W91A 3IDCB 3OBRA 5DDJ3 4RL7A 5FLHA 3VBUC 4EQVA 3ZXFA 1OLRA 2XBO1 4RQPC 1DZTA 4XUTA 4HPKA 4LKEA 2WWUA 1IKQA 2JENA 1ZBE2 2ZGUA 4BQ2A 3N35A 3ETQA 1XOYA 2I2SA 3GZTB 4BISA 2HWF3 4RGAA 4UT5A 5FY4A 4Q4X2 2VZQA 2J7MA 5CYYA 5FREA 5JOXA 1C57A 4Q1RA 2WO3A 5BNQA 3MGUA 1JYWA 1LKNA 4AHYA 4DEQA 3SISA 1PGSA 2DF7A 4W50A 5FLIA 5F1RA 3H3LA 2QBXA 3VD4A 2WDBA 3CZJA 4FCAA 1WW4A 4AI1A 3PJQA 3LIGA 4UXAA 3N9LA 1PVXA 3HVDA 4JKKA 1FXZA 4N53B 4AI2A 3X29B 5JPMB 5DAWA 1PGW1 1QJX2 1RJ7A 1TNRA 4OHWA 3ZFFA 5BNPC 5LEKA 5FPVA 1LOFA 1MPXA 4CPBD 5FZAA 2D5FA 5FZFA 1RUI1 1YFWA 3WQ1A 1IPKA 2EICA 1NXMA 1ULCA 1X9TA 3NV3A 4JGZB 1TME3 4JQTA 4QPWA 4R4ZA 1REEA 1Q8VA 1V6KA 2HWE3 2O8QA 2R6QA 1EPZA 2WABA 4LBQB 1QJU2 1AR82 1F35A 4EROA 3NNGA 4QGLA 5C3PA 3MIHA 5K9YA 4GWMA 4NHXA 2Q1MA 1GQGA 2PXJA 3ECQA 3VB9A 2VVDA 3HN1A 1CIYA 2XKPA 3POYA 2DURA 1NG0A 3OGRA 4J25A 1OOPC 4JHTA 1FPN1 3HPNA 5A1AA 5LK5A 1JZ4A 1LECA 2VM9A 5BNPA 3NKGA 1UXZA 3AVRA 2RJ2A 1G9AA 2WAOA 1GWKA 4NIDA 1JZ6A 5CAZA 3CEWA 4IERA 4QX7A 4NVPA 1XE8A 1VBD2 4NE9A 2NM1A 2LALA 4KWKA 4RHV1 5FO7B 5GM0A 3RG0A 4FQZA 5KHHA 3IWZA 5KHJA 3TEYA 3BN6A 3AZXA 1FMD1 2A6XA 2GMPA 2P37A 4ES8A 2HEVF 1J83A 1MS0A 2W5FA 3IZOA 2X05A 1VRH3 2ZPXA 1LOBA 5KC5A 4IV1C 3VBFA 1O4TA 3POEA 1YJKA 3CQOA 1S2KA 2Q1FA 4XZPA 4GB32 3I3MA 2JG8C 2VOKA 3JQXA 4XJAA 5EJZB 1H8VA 5APAA 2YFUA 3ZFFB 4EV0A 1Z7S3 3SCHA 1CIWA 5K4LA 1H0BA 2JDNA 2VTFA 2Z2SB 4MGZE 2RDNA 2MEV2 2FCVA 5L7OC 2JD4A 4JCKA 1QNWA 5FZKA 4QQLA 1UIKA 3BALA 5FOBB 1MR5A 5JSPA 2BZDA 5JIUA 2GMEA 2IFRA 4AGGA 4XF4A 1RGSA 3LDKA 3AX4A 2E53A 1DLLA 2I74A 2ORZA 2W0XA 3I59A 1PGL1 3E6BA 3RGBA 1PO12 1RVF1 1FOD2 1EPWA 1PIV2 1VRBA 1XNDA 2RHPA 4W4ZA 2P5BA 5FMOL 3SEPA 3ZFGC 3TN91 2RM22 1RUH2 2ARXA 1YI7A 2YC4A 4QKFA 5CFCB 4QM8A 3VN4A 5C8CC 2J22A 1DQ5A 4HSLA 1XNCA 3I4IA 3RWNA 3JXSA 5G05L 1WCKA 2V4VA 3F95A 4O9GA 4S2FA 4Y4RA 1LEDA 3WDVA 2BV4A 4CYDA 4QXCA 2RS53 4JRAA 3VZKA 1AR91 4RFT0 5A1LA 3AZYA 1D4M2 1A6CA 2BGCA 5C5TA 1ENQA 4JRLA 1KGYA 5CFCC 4Y22B 2VNOA 2RR11 1BJQA 2Y34A 4LBJA 4CEYC 4GXLA 1G86A 1KS4A 3ST7A 1SQ4A 1GOGA 4FPCA 4OI4A 4KBBA 3SH5A 1ULGA 2VZPA 3VKNA 3HMYA 4CXYA 4B29A 4OVEA 1PM7A 2AACA 2C5DA 1GZ9A 4L97A 4NR1A 3DF0A 1ZNPA 3RI8A 3B94A 3ZXEA 4Q8KA 1CAXB 4ORFA 2Q1ZB 3B69A 3QACA 5LBEA 4UFIA 4GWIA 4RFRB 3PURA 4COYA 3K51A 1V0AA 4O65A 3H0OA 4YG6A 3NW4A 4MXWB 4NPLA 2WFF1 4XCBA 4FPKA 3O5SA 4QPIC 2WT1A 5FZOA 3DL3A 4E8DA 4WZCA 1PM4A 1AYN1 1KRIA 3BOPA 4QPGA 3USSA 3RS6A 4CDXA 4D6RA 1AVBA 1CR7A 5C3RA 1AL0G 2G9GA 1XU1A 4QXKA 1W2OA 2UYBA 3RZMA 4FQ4A 4IUGA 3ZSMA 1XC6A 4BQYA 5LA9A 1QQP1 3WD5A 1WMDA 1XSQA 2XHNA 2DVAA 5I93A 3MF9A 4GB31 3U75A 5T52A 3MICA 1RHI1 5DUWA 1F31A 4OZOA 1W9YA 3VBOA 1WWYA 5KR7A 1QNYA 2IVJA 1S4CA 1XNBA 3OGGA 5FP9A 1HN1A 4IETA 4QHBA 5T5JA 3KV4A 2EA7A 3M2MA 2QJVA 2QQMA 2C9AA 2IXCA 4AZZA 1EUUA 3UGFA 5A1FA 5CVRA 3BTAA 5FK8A 4YZ2A 1HRV3 1SLAA 2VU9A 3GNEA 3PDQA 4IV1B 3VBFB 1RUC1 2RS32 1ZZ9A 4Y1UA 3UJQA 4B4RA 4LBLA 3B9CA 5A70A 2ZZJA 3C7FA 4JHZA 5J37A 4P9IA 5ISLA 1AL21 3VHPA 5SV8A 2IUWA 4EWDA 1M4WA 2PHDA 1J3QA 5J7MA 5IK7A 1H6XA 5FUNA 5IAVA 4CEYB 1NA1A 2UWAA 4LO4B 1OLMA 2OUHA 3RVHA 3AP5A 4EN9B 2PLV2 1HRV1 1K45A 3PUIA 3WCRA 4FPJA 3UKVA 1OA3A 1PZ8A 4I30A 4P5HA 4XFAA 4G3YC 1TVGA 4YW3A 3VBHC 3GGLA 4MO3M 2X5IA 1RUE3 2A3WA 1R092 2VTXA 1TMF1 1W2TA 2XR4A 3PIJA 1CAUA 4L8QA 4QPGC 1BXHA 4QX8A 3VL9A 1ND2A 1W6MA 4H3WA 2W1WA 5LRRA 4WVMB 2XJUA 4ZXEA 5I0DA 1VMFA 1QOTA 2D93A 4X6QB 3ZXAC 5GLZA 2CGPA 2K46A 4YWAA 3WCSA 3K75B 2D3RA 1YCIA 3ZYPA 5FTTC 2B9VA 2R16A 4I0BA 4YFWA 3AYAA 4CRQA 5JCTA 3VGIA 1TME2 3CF6E 2EALA 2BW8A 1NOVA 2KA3A 3H1MA 2EAAA 5EPAA 1UZ0A 3PNAA 2BPA2 3ZO0B 4TXWA 5DN2A 2AEZA 4GH4B 4UBGA 3UNPA 3FWEA 2WNVB 1LODA 3WP4A 4EZHA 5FYTA 5T50A 2NMOA 4KU8A 4QHOA 1U5ZA 4N53C 5JVVA 1BK0A 4AQ2A 3PHMA 3RNSA 3NL1A 3U11A 1EUTA 4HKLA 4IQPA 2XLGA 5E8AA 4BQ5A 4MV2A 1OH3A 1QJU1 2JE7A 4XFIA 2JDKA 2Y6HA 5DABA 1NKGA 4MOAA 3SNMA 5ACA1 5FMBA 5FPZA 4WVVA 1MEC1 1HLCA 5F5CA 3N3HA 2BVVA 4CE8A 2RMU2 1YRZA 4Y33A 4CXXA 2OUJA 4YFZA 4AEKA 1W9TA 4Y1VA 5JIAA 1KXGA 4DRVA 4F7ZA 1H1MA 1SCSA 1PMIA 1W06A 2WC2A 3S6PA 1RUJ3 2BBAA 4YW6A 1DZQA 5C9AC 1G9BA 5E6HA 5FY0A 2D6KA 4EZ4A 2AEYA 1ULPA 2VQTA 4M0NA 5JAXA 5L9RA 3LOBA 1OXCA 1WCSA 4AEDC 4GZ9A 5FMDA 3R0RA 1XBFA 4PDWC 3MFAA 4OHZA 3M3IA 2WA3A 1ZX5A 5HI0A 5JI9A 2D3PA 3LE0A 4X6RB 5HPOA 3FX3A 3MYXA 4QPGB 1ND3B 4BOWA 4BYYA 2P4EA 1CWPA 2PHTA 4D6SA 4E9KA 1WLDA 2ZGNA 4IW3A 4UBHA 1KJRA 2W46A 4MGTA 4AI9A 1FATA 1UKGA 2IXJA 3T2OA 1VBC2 5LA0A 2WYSA 4BCUA 3SKJE 4QT6A 5DAQA 3W5NA 4Q0PA 1QU0A 2XLAA 4CCMA 5C7GA 1FOD3 1PIV3 2QE3A 2PAEA 1JYIA 2H0VA 3NAPC 2RM23 4JKMA 4EWEA 4XDQA 5HV0A 1WW6A 4RR3B 4QM9A 4E2QA 2ADEA 1U12A 3SCFA 2VOVA 4BHPA 2D6LX 3GJBA 1AUYA 4P9YA 3HQRA 1LRHA 1YQ5A 4MHRA 4LTAA 2KD7A 1VBB2 5KXDA 3UKNA 1HJGA 2Y6JA 1RVF2 2EXJA 2DTYA 4D0QA 1BZWA 1OUSA 5CG9A 5F2SA 2VH9A 2NQYA 2DVFA 2IXIA 2RM21 2ATFA 5FBJA 4A4AA 1S0DA 3BB6A 1MS9A 1BQPA 4H7MA 2XMLA 4Q4W2 5M0TA 4GJZA 4PI2A 3MBWA 1PK6B 4XFBA 2WSVA 4XDOA 3KF5A 1FV2A 1IG0A 3NVCA 4UW4A 3WNMA 3G6JB 2QQKA 3NSTA 2DWRA 3QH6A 1AR92 4EJRA 1NCRC 1REDA 4K8RB 4CU9A 1ZBE3 1Y9MA 1SBDA 3H7JA 3SC7X 3WW3A 3VBUB 1LTEA 3MW4A 1UN1A 2GZWA 2E7AA 4PIXA 4XAAA 2VOTA 2BGPA 3LIHA 2DFBA 3NV2A 2PTMA 4I2OA 1UY3A 5DZEA 1ZZ6A 4URAA 3RZKA 4C90A 4RS5B 3FBYA 2V73A 2VMGA 3GCWA 4YW4A 4JGYA 3KHBA 3KQ4B 2Z4FA 4A41A 3VDCA 1V9U2 2Y6LA 2R32A 1VBC1 4NO4A 1IQAA 2VAUA 4LKFA 2OKXA 2FDHA 3ZN4A 1LHUA 4Q0QA 5J1XA 1QJX1 1VLNA 2A6WA 5DMYA 3PMEA 2V5DA 2DV9A 4IV3B 2VZSA 4LOTA 2D97A 3I2IA 3MIEA 1JZ3A 4Q0SA 4FXKB 2ZGSA 3WVJA 2JG9C 2X10A 2ZABA 3FLPA 3BIEA 5FCCA 5AVAA 3LZZA 2GNTA 4FOQA 2Q0AA 2XONA 5CKNA 4XJUA 2YMZA 3ZSEA 2HWE2 5C4WA 1LR5A 4HMZA 2VUJA 2J1AA 2IWGB 2VW0A 3L2YA 2B7YA 4DUXA 2VXJA 3WSOA 2YPJA 2Z69A 4CU8A 4GH4A 4MH0E 1K5MA 4Q0UA 2GC0A 5A7PA 4BQ1A 3T2QA 2DYCA 3I2JA 5DAVA 1RUC2 5IJRA 4DUWA 2JD9A 2WS91 1QH6A 2XQXA 1L7RA 4XQWA 4BA6A 3PVOA 3V0AA 2A3XA 3POJA 1VBD1 4CDUB 2ZGQA 3WF3A 1QJZA 3V0BB 2W3JA 1MZEA 5D2AA 4IDZA 1RUE2 3VKLA 1N1VA 2FZ2A 3ACIA 4B7EA 2QZ3A 2LW8A 4J6GA 4QPIB 5GZDA 4QQOA 1HRV2 4BH9A 1CAUB 4XJ9A 4CCJA 3WDYA 5BNOB 1DGRN 5IVYA 2ZHNA 4AFBA 4CP9B 5DG1A 4NJ4A 3ZYIB 1A34A 1RUH3 4FOVA 2J1RA 2F17A 3VD7A 3ZYHA 2PHUA 2XJQA 3S5QA 2R0FA 4LHSA 2O14A 4LOSA 3IB3A 3I97A 3KD4A 2YU1A 3OSDA 1N3OA 1JBCA 1QJY1 1UMZA 2VZUA 3PVBB 1W6QA 3PUAA 4YNIA 1STMA 2JG9A 3WT3A 4CCOA 2P6HA 3W21A 3KSCA 3T30A 1WD4A 2E26A 4PIZA 1AX2A 1RUG3 1VAVA 3IPVB 2MEV3 4FPHA 4HN1A 3MV11 4AQ6A 3AYDA 4ASKA 4BQWA 1ODMA 1CZSA 2TNFA 1UYZA 1OQDA 4KBZA 3NJXA 4H14A 4BLIA 2UU8A 5DPNA 4Z8BA 5J09A 3BTYA 1H4HA 2BWCA 2D6OX 3OGJA 4XUPA 4QU1A 2AZ5A 2ZEXA 4K40A 5DXDA 3OUIA 2OW4A 4R8HA 1NX9A 2YU2A 4JTNA 1ZBA2 2CNAA 5FP3A 4NIIA 1LHNA 3OPWA 1MS8A 1T2XA 4D7YA 4PIYA 4XMIA 2OYZA 1H2MA 1LAJA 4UF0B 2DU1A 2ZGTA 3ENRA 3MI8A 4OZXA 3ZN6B 1PGL2 4RYDA 2P2KA 3RZHA 2WNUC 2BQPA 2WT2A 4QMAA 4YZ3A 3UJOA 3VDDA 5EJ3A 1W2AX 5BNPB 3GZEA 4YGEA 2RVAA 1W39A 2ZX0A 3KLSA 2VMFA 4GIQA 4WM7B 4AAXA 1VJ2A 1S0JA 5BNOA 3H8RA 1WZXA 4R9CA 1US3A 3DV8A 2PHWA 5FJKA 3SQOA 2LUWA 4CUGA 2FCTA 1XYOA 5FR3A 4DPNA 3TB0A 1DQ0A 4QKDA 1VB4A 5A6YA 2Q8OA 4UI9L 4LKDA 1R1A3 4NMIA 4CDWC 1IS4A 1KJLA 2RMU1 5JI7A 2DU0A 2YHJA 4KL1A 2RS33 1RHI3 4DS0A 1QOSA 4CVUA 1JN2P 3KCXA 3QH7A 4PQ9A 5T55A 3P5BA 1G9DA 2ADDA 1ZRRA 1ZBE1 2A6VA 2JG8B 4AGRA 1EV13 3FJSA 4K7JA 3E6DA 4RQPB 3PIGA 4Q4Y1 1OFSA 4MVTA 4GQ7A 2XVLA 2CL2A 1UD1A 3VBRC 2JE9A 4MG2A 2HWB2 2RS11 2XOMA 1X82A 3NNMA 4XHXA 4LKSA 3EQEA 3HAGA 3WF2A 1RUF3 4H2AA 1W8ZA 1AR73 4LHKA 4Q4W3 1EV11 3AP6A 4JV4A 5SV5A 2SLIA 4QDQA 2QNKA 1DBNA 4DXSA 5KXBA 3KT4A 1ZM1A 4PT6A 4YZ5A 3LA2A 5EIYB 4FFGA 3HNMA 4YRDA 3AFKA 3WW2A 3DYMA 4XTMA 1AYM3 4BQ3A 4ZKTB 2OPWA 4RR3A 2X5IC 1OPOA 1W6PB 3CBNA 3ES1A 1FMD3 1UMIA 1UY1A 3QD6A 5CIRA 4YPJA 5F9TA 3VBSA 1E5RA 1UU6A 4XFGA 2R072 4META 5CNAA 4QQPA 4XIKA 3WNNA 1YYNA 4IGQA 4DXRA 4H7LA 4WM8C 1X8EA 2BP6A 1PZ7A 5FXZA 3WV6A 3POIA 2QTWB 4C1WA 4DXZA 1PVC3 4EN8B 5KBFA 4LT5A 3R6SA 1BKZA 4M3CE 4KG0A 4CCKA 2VBDA 2HEYF 1J3PA 1VR3A 2VCAA 4L9BA 5F5QA 5C8WA 4X8PA 1B35C 3OTFA 1HKDA 2X53S 5C70A 3AZZA 3WZ1A 5LBCA 4AHWA 3LOIA 1EAH3 4W65A 1MZ6A 4CDWB 3I54A 3DGTA 3LPGA 4MXWA 3KQRA 1ST8A 4N9IA 4NPMA 5A80A 3K2OA 1ZZCA 1OURA 3C7EA 1G8WA 1F4HA 4GAZA 3O1RA 4UW6A 2FQPA 1QMJA 1O4YA 2J1UA 4FPGA 2TUNA 4LEJA 4IE4A 4B1MA 4YSFA 5LK7B 2JJ6A 1OQ1A 2E9QA 4LIVA 1CAVB 3UV9A 4B7KA 2UYAA 4E4DX 2MNGA 1TMF2 3ZIXA 4MUVA 1RUJ2 1GZCA 1MQTC 3EBRA 1EAH1 5DZFA 2QQUA 4L0PA 1GMMA 1F9KA 3N9NA 4N43A 4WM7C 5FPBA 4O9EA 2GP5A 2WWJA 3M4FA 2WNUB 5F3GA 1WMXA 1G6NA 5HCFA 4JX0A 5JR2A 1LNSA 5EZWA 2R042 2HWC2 1SLBA 5FZ0A 5LW9A 2WT0A 5FY9A 4ET7A 1PO21 2OQ7A 1E5IA 4GWJA 3WNOA 1J84A 3J8F1 3HBKA 3WOGA 2V72A 2HWE1 4CTEA 3MIDA 2RS12 5LBBA 4TYSA 1UMHA 1W03A 2F4LA 4B3NA 3AJYA 1LHVA 2PAKA 1TQ5A 2E6VA 1CPMA 4XQDA 5FO8B 4C8DA 4BK5A 4FPFA 1D4VB 5FZ9A 4B1LA 2WS92 4ZS2A 1NA1C 1O6UA 1VMHA 2WL1A 1I6XA 4JTOA 1B35A 3ILFA 4L99A 2VMDA 4YGDA 4CU6A 1VBA3 5DDJ1 2CV6A 5ACA2 2GALA 3IKWA 4V2WA 2WIIB 4OUSA 1OLQA 1DQ6A 3OG2A 3PVNA 2GNMA 4ASMB 2EXHA 4DB5A 3TEXA 1NLRA 2BEOA 4X8NA 3BI3A 4KMQA 4LBNA 1MS5A 3RMYA 4YARA 2XVGA 4LULA 5A6ZA 3WW4A 4GWNA 4P5YA 1F2NA 4ZU4A 1X33A 3TN93 4U2AA 5GZFA 1K5MB 3O0WA 3WG3A 3FN9A 1GQPA 4RR3C 2OZJA 3CIHA 5FYMA 1VALA 1X9PA 4UFMA 5CZKA 2YZ4A 5DQ0A 3O7OA 4AL9A 3RYRA 1RUJ1 2W1SA 1E57A 1PX3A 1WCDJ 4E2GA 5B2GB 4W6YA 3V0BA 1Z7S1 2ZKLA 5BY5A 4ZY9A 3IAPA 3ZIWA 2CAUA 2Y8KA 5L7OA 2DBIA 2XBO2 5F6KA 4I0WB 1I9RA 2E32A 3KHCA 1ZBA3 1ZRCA 5E1RA 4BPZA 1WUVA 2Y26A 4HKOA 1VBB1 3PTRB 1BHGA 3A21A 2B45X 2R0HA 1S2EA 1W8NA 1OA2A 2W9XA 4BXFA 1T6BX 3NAPB 4CDQB 5JLVA 1FI2A 2AH2A 1PGW2 3D3AA 3GXUA 4R9BA 1IZ3A 1P8JA 2LRPA 2ZGKA 1GNZA 4E4ZA 4AQSA 2BTVC 2GNBA 2QQWA 4NAMA 3PUHA 2C1FA 3KCYA 5BUVA 2IXHA 1H9WA 3VHRA 4E4HA 3OYWB 4FP3A 4NRPA 2VQAA 4CEYA 3AXEA 1OD5A 4UOJA 1LGNA 3J7NA 2JDAA 4QQHA 3JB8A 5A33B 2C9KA 2R1BA 3PUQA 3O1MA 4OLLA 4LO8A 1W9SA 3K77A 4YM2A 1IPJA 3O1SA 3HN3A 4BE3A 1RB8G 4WM8A 1D2SA 1D4M3 4QX3A 1T6GC 4P9GA 2A5ZA 2NPIA 5T5PA 5C3OA 1KFXL 4C1XA 1I5PA 2HBUA 3BGAA 3UT0A 1XE7A 4YW7A 3J26N 1PZ9A 4NWWA 2ZEZA 2K2SA 3RZLA 3FL7A 3VDDC 3WP6A 4MZUA 2ILMA 2XPJA 1POV1 3VBOB 4SBVA 3JB4C 1HB1A 1VRH1 3C3VA 2JDZA 4PQQA 1ULDA 1SEFA 4M4PA 4N43B 1R083 4QX2A 3RPQA 3ZYBA 3VBOC 2VZVA 2R062 1H1IA 2WN2A 1NZCA 5EFUA 4COVA 4LO5B 4QQ2A 5CU1A 2YG0A 3N7MA 2PAMA 2WFPA 3OD4A 4UFHA 5F39A 4YW5A 5A32B 2CYFA 4PJYA 5A6XA 2BFUL 2PMWB 3WX5A 1POV3 5CG8A 5IAXA 3FZ3A 1O3SA 4KG8A 2XJRA 1PK6C 2VNVA 1CJDA 3P3NA 4HL0A 4OMDA 4ZZ5A 4MGQA 4QPIA 1W2NA 3I2FA 4QXBA 5FZ4A 4OCTA 4A45A 3AKSA 1FMD2 1IS6A 3A22A 3I3DA 3K4ZA 1W8OA 4NOTA 4UW5A 1C4RA 2GAUA 1Q8OA 1EV12 4KWUA 2W94A 1K42A 4XZUG 4Y26A 2HKXA 3BIWE 3POBA 2WZPP 2WAAA 1W28A 3RQ0A 2RE9A 3LGRA 4D7SA 4W6WA 1QWRA 3DN7A 2YROA 4TZDA 4KGGA 5BV6A 3OY8B 4BU2A 1ND3C 2VNGA 4AHXA 4DFSA 3MUY1 4CUBA 4EN6B 3VBSB 3I49A 1OFNA 1OOPA 4AQTA 3N9QA 4K20A 4XUNA 5CEHA 1C3HA 2ZEYA 3LDBA 5FYVA 1EP0A 4AAPA 3GBGA 3E5XA 1HXS2 1NQJA 1RUG1 3ABZA 4AR2A 4LLOA 3NV1A 3ZMOA 3FHQA 3HNBM 5FLJA 3DYPA 5F5IA 5FXXA 3WDXA 1BVVA 5FP7A 1Z78A 3W20A 3I2OA 1JI6A 1V6NA 2KM2A 3ZFGA 1TMF3 1DU3D 3NJYA 2WSUA 3RI9A 2BUKA 4MGIE 1DGLA 1WW7A 5A3LA 2DVGA 4FP2A 4AVAA 3VBRB 3QLQA 1W90A 4AEDB 2VOXA 1QGLA 1OBNA 4XC9A 3E1F1 4YZ1A 1L7QA 3POSA 4TTGA 3CKHA 2GC3A 2PHRA 3SCGA 5FPUA 3I59B 3ZVXA 2WJSA 3N7LA 4XXPA 2DFCA 1EAH2 2NZ9A 3JD73 4QU2A 3NJZA 1O59A 5I8TA 4P9JA 4RA0A 1NE4A 5JDBA 3A23A 1YEWA 3IDAA 1ZBA1 3DEMA 4WVMA 1OPMA 1U5IA 2ZX4A 3KCCA 3NNJA 3I3QA 4FBFA 2JIJA 2EVXA 4DY3A 5IVVA 1HRI3 3OBZA 2B39A 2YBKA 1CD3G 3MDPA 5FKBA 3UESA 5EWSA 2HWC1 3JUUA 2A75A 1XB9A 5KHKA 1QEXA 5EYYA 1DHKB 4LE4A 1DFQA 1R64A 3S7EA 4ES9A 4QD2A 4PF1A 2P17A 4FPOB 2WYFA 1N47A 4NRMA 4PLOA 3IT8A 4LIUA 2DUQA 2OT7A 1GP5A 2VNRA 3FBMA 4CEWB 3TBDA 1R1A1 2CTVA 3ZSLA 1PMHX 3B5LB 4GMP3 3A7QA 1CONA 2RMU3 3I7DA 3QCWA 4M00A 3RMXA 2V5YA 3N7JA 1H8TB 2QCSB 2RS31 1GWLA 3ALQA 4XBNA 1AR81 1UOGA 3W58A 1VE0A 4XEZA 4AE2A 4CCDA 4KI5M 3NMBA 4XFCA 4F83A 5GZEA 1LHOA 1W6NB 1QJFA 2FDIA 5H9QA 2FMYA 2JDPA 4CDQA 1ULEA 1RMU1 4YG0A 2YC2A 4FOYA 1AXYA 2WZR2 1H6YA 4E2SA 2AENA 4YM1A 1X36A 2ZHKA 4HPKB 1ODNA 5JXIA 2WWSA 5L7OB 2JEMA 3ZYGA 2PHLA 2VVEA 3LPFA 1E5HA 1R081 1Q56A 2VL4A 2WO2A 3EB7A 4LUMA 4W8JA 3WNLA 2PFWA 1GUIA 1VBE2 1CX4A 2VCMA 2YYOA 3WINE 3GALA 4S2DA 3ZFFC 5L73A 3WQ0A 3Q8BA 2H0BA 4CCCA 1SDDB 4NPRA 1ZRFA 4E8CA 3KT7A 3R4DB 1WLWA 4OMCA 1W9FA 1YIPA 3I2HA 3SH3A 1D0GA 2PHFA 2E51A 4XOGA 5AC91 1S0GA 2N7GA 1NY71 3V65A 4Q4Y2 1V9U1 1WMEA 1OMIA 4U36A 4Y20A 2BFUS 1SZBA 3HQXA 4Y4YA 5FZBA 3O1VA 1LB2A 2PYTA 3TNQA 4LHNA 3THCA 1S0FA 1G7YA 2HBTA 2ZMNA 1AYM2 1QY4A 3WF4A 1H2LA 1ND2C 3JBG2 2D7FA 2VQUA 4M0HA 3ZYFA 3AXDA 3ZXDA 2VZTA 3A4UA 3Q8CA 2HWF2 5IK4A 4XBQA 1CZTA 3NRUA 4IEZA 5CA6A 1UU4A 1OA4A 2ZMKA 2EIGA 5DAPA 4YM3A 1CESA 4PDWA 4XXAA 4HK8A 4PF5A 2QDRA 4LNVA 4XILA 3VBUA 1QJY3 1UY2A 4FFFA 3LF7A 3W5MA 1ZRDA 1V6LA 2C4XA 3K4AA 2B8MA 1GP6A 3MLJA 1XNKA 3VZNA 5A3MA 1AR93 4O61A 2TBVA 4Z92B 2CDPA 2EIEA 4FPYA 1KQRA 1YHFA 1H30A 1NXD1 2A71A 2R063 1MEC3 3C7GA 4AEDA 4BIFA 4FSJA 2WO7A 2Y38A 4B4PA 2UY9A 1DGWA 1QH7A 2HEWF 3AJZA 4C0BA 1UL9A 4MLOA 3IN9A 1NE6A 1JYVA 3FLTA 3RRDA 4HVOA 2XG3A 5C9AA 4FVVA 1HB3A 1RUF1 3H8OA 1SPPA 2QQVA 2WS93 4V2VA 5HXMA 1RUNA 2RR12 5IVFA 5C8CB 1E5SA 4OI1A 2BGOA 1NAEA 2FBEA 3IIIA 1QDOA 5FY1A 2CWMA 2HWD2 3E5UA 2E63A 3U10A 1V70A 1WBFA 3C7OA 4YVWC 3TRSB 3WDUA 2FZ1A 3T0BA 3FHAA 4XJ8A 3PVEA 1NZIA 1H8TC 5FFOC 1FYUA 2RDSA 2DCZA 4D8MA 2PLV3 3FMGA 5J3UA 1QQP3 1GKBA 1VBE1 1J59A 4AHZA 3HNYM 3KM5A 4JAAA 4RD7A 4NIAA 3NNFA 1TNFA 3MIGA 4UYBA 4AVVA 4LHLA 3WR0A 3VDDB 3ATGA 1JHJA 3CZUA 4DMIA 4FO9A 5FYYA 3VKFC 2NMNA 1W8HA 4UF0A 3VHOA 4TN7A 4NHMA 5F3CA 4KH9A 2Y6KA 2ZS6B 3VDBA 1AF9A 1NCRB 4ASLA 4JDOA 4GKXA 1Q43A 5H9PA 4CUAA 3J8F2 1M06G 5FZLA 4XFFA 1GLHA 5IFPA 2GC1A 4HBNA 1GZWB 3LQCA 1RUC3 1SFYA 1WKYA 3TYJA 1LU1A 4OHYA 4D7TA 3AFGA 5KHIA 5C33A 2ZX1A 4LE3A 3SLIA 4I3GA 3UYJA 1BEV1 4PBPA 3ZM8A 5JOYA 3PTYA 2WKKA 4LBQD 1AX1A 5BNNB 1S0CA 1WCUA 1I5ZA 1APNA 3J9SA 4JDMA 1RJ8A 3ZX7A 1YNAA 1YQ2A 5DDJ2 5FK7A 3EHKA 1NQDA 4D94A 4IE0A 3OJBA 1MS4A 1WA4A 4LK7A 2P3KA 3CDZB 2ET1A 2D3SA 4L11A 3ILRA 1DP0A
chains in the Genus database with same CATH topology
4Y1YA 4EWAA 1Q3EA 2NP0A 1LEMA 5K0UB 2FMDA 1CVNA 5FQ0B 5E16A 5FBZA 3UL2A 1DDLA 2BBVA 5JR7B 3MLKA 1REFA 2ZBJA 1U5XA 3QBQA 1RUG2 2WQ4A 1AL22 3GBFA 4HT1T 5T54A 4XF9A 2XJPA 5CFDC 4LBQA 1HV0A 3V64A 2NN8A 1PNGA 1WLCA 3ROUA 2ZZQA 1N3QA 3SH4A 2B9UA 3LKJA 4TSVA 2XWBB 4Q27A 1DYKA 5GZGA 4KNCA 1PHMA 3OF1A 2VXRA 2X8KA 2ZX2A 4Y1ZA 2Q30A 4P9WA 4A7ZA 2B5HA 2O8OA 5JOWA 2ZA9A 3M3OA 2AR6A 1R1ZA 2KXLA 2IZWA 4LO6B 2VPVA 3MW3A 2D98A 3VL8A 1JUHA 3VZMA 1NA1B 1N1SA 3HT2A 1WLTA 2WZR3 5T5LA 1SMVA 2OA2A 1G9CA 3N4MA 2R49A 3LA3A 4HLTA 1ENRA 4I3PA 5IK8A 2GDFA 4GKYA 1VBD3 4DOUA 4M01A 5H9SA 4AVCA 5FQ0A 3N36A 3ZFEA 2WZR1 5KWRA 4AK3A 1H4GA 3FUQA 4CZSA 3TNPB 1VRH2 4K1ZA 2WNUA 4AI8A 4IXLA 3GYDA 3APBA 2VG9A 2PELA 4V1PA 1FT9A 1RUH1 1W6QB 1NLSA 2D6MA 3O12A 2HWB3 3EJKA 3OBTA 1RMU2 1KD7A 5JWPA 3VKMA 4CDXB 1FV3A 4YVSB 1Y3TA 4XIOA 1NY72 1UCXA 4OHXA 1VBE3 2PHXA 2GN7A 3USUB 5C4WC 3B9IA 2LTNA 1MVQA 2Z42A 4LA3A 2R1DA 1DIWA 3W9AA 4ATEA 1GNHA 2W52A 4LBMA 2EAKA 2D6PA 4CP0A 2YV8A 3GF6A 1OQEA 3DKWA 2HWF1 2XUMA 3B93A 3D0SA 1AX0A 2UY8A 4Z82A 3URFA 1SLCA 2R073 1O4ZA 5JSOA 4HETA 4IV1A 3VBFC 3IDEA 1CN1A 1EY2A 1G9FA 3GBWA 2OPKA 5CFDB 1ALYA 1BEV3 1HXS3 2ETEA 3JBG3 4YGBA 4FT8A 4CP2A 4K21A 2QUOA 1SBEA 1GR3A 1RUI2 3D6EA 5C8CA 5JSRA 4BMBA 1DYPA 4IESA 2IXLA 1UPSA 1R091 3B02A 1VAMA 2ZGOA 1VAKA 1Q5OA 3FC0A 4IEWA 1RITA 1O3QA 1S55A 1GBGA 3FFQA 5HCBA 1WD3A 2ZMLA 4CEWA 2P3JA 3M1HA 4RGGA 3NO8A 2XJVA 1U5YA 4Q4X3 1LOFC 1LULA 2TEPA 3H3ZA 3LB9A 2DCJA 2O1QA 4G4FA 1ZYBA 2V09A 3HT1A 4WVWA 1H2NA 3ZYRA 5I0SA 3BCWA 1XQNA 1FPN3 1LGCA 5H9RA 2OZ6A 5GLWA 4HVRA 2A6ZA 4FTEA 1ASJ2 1GANA 3WUCA 2RS13 4N90A 1FNZA 2D40A 1DF0A 3V0AB 4S2GA 3WNXA 1A8MA 4ATFA 1UPIA 4PLMA 2G4IA 1S0IA 1GFF2 1LGBA 1PVC1 4F8AA 1GZWA 3AZVA 3EXUA 4AYUA 1Q8SA 3ZN5A 4HN0A 4XF0A 4Q4V2 5J98B 1O5LA 5A33A 4Z2WA 2DVDA 3WLUA 4M3CF 1CGPA 1ENXA 1SACA 3GZAA 4IEYA 4TLFA 1YXWA 2QDNA 2DUPA 3ZFEC 1OHFA 2A73B 1N1TA 3KB5A 1RC6A 2ET7A 1UIJA 3L9JT 4HANA 3NWKA 1JYCA 4XF1A 1COV3 3TN92 2PQQA 2MHFA 3HIFA 1AL23 2IXKA 4MGKE 4BMEA 3WHUA 2X5IB 2ZAHA 3M70A 4R52A 5LRSA 1ZZ7A 1RVF3 4R9AA 2DCKA 1KITA 3P3PA 4YGCA 4JGYB 5EV7A 1HV1A 1D4M1 1Q8PA 3RJ2X 4Q4Y3 4KQ7A 1AYM1 1YI9A 4YLZA 1UU5A 2QVSB 2WFF2 1RUE1 5AFEA 1EYBA 2RJLA 5IUQA 1AYN2 2LM3A 2ZACA 4AVTA 1POV0 4IV3A 4WBBA 5HBAA 4Z07A 1XRUA 3WG2A 1ENSA 3LAGA 3EO6A 4LA2A 2YDEA 2XH6A 5EYXA 3IM0A 3CJIB 1PK6A 1RHI2 3AP7A 2F4PA 4QX5A 2A70A 3WY6A 5BNNC 3E6CC 4N7UA 1W6OA 1AXKA 1HX6A 4P9XA 3ASIA 2AYHA 2HJIA 1Z0HA 4CDUC 1PO13 4D3WA 1FNYA 2ZAAA 3T1LA 4Y5Z0 3VKOA 4JGYC 1HXS1 2ZGMA 1JW6A 1LENA 1JTZX 1UKRA 3AMHA 4Y24A 5D1IA 5DG2A 1HDKA 5GLTA 4BWOA 3AYCA 2RS52 3WQ7A 2GMMA 2WA4A 1HW5A 4M3CB 1YLLA 1GQHA 1NCRA 4LBKA 2HWD3 5D8AA 1U0AA 4BZ4A 3ZSKA 5J36A 3HR9A 3OYWA 1V6OA 2EXKA 2XKOA 3H8UA 2DCTA 3HWJA 3LCPA 4P14A 2BNOA 4IEPA 2XL9A 5JPNB 4BLJA 3WW1A 4WV8A 2ARBA 2XJTA 1Y43B 1TEIA 3ZXLA 4C91A 3CJIA 4K8FA 3CL1A 2MPFA 2ERFA 1C8M2 1YFUA 1O3RA 2YXSA 4Q8LA 4JDNA 4RHV2 4AG4A 3CU7A 1HIXA 3J8F3 3ZFGB 3IDBB 1BEV2 1O5UA 3AMPA 3M8LA 3DPRA 4GALA 1RMU3 5DUUA 3IMNA 1SCRA 1O3TA 4W6XA 4JQRA 1A3KA 4FAHA 3OD0A 4N7IA 2ZOEB 2VMIA 1H8TA 1UAIA 2JXAA 3ZYJB 2D5HA 2VY0A 3AMQA 1GV9A 3T1MA 3JQWA 4I01A 1MS3A 4OULA 4XMAA 3AKTA 2EF6A 1JOJA 3UKTA 1GICA 2PA7A 3H9AA 3UK9A 1S1AA 3HBZA 5I0RA 1YWKA 1X7NA 3AKPA 1OSGA 3I2DA 4BIOA 1CQ9A 2DVBA 4Y22A 4HZFA 1RTVA 4DRRA 2VMHA 4ZXKA 5BNOC 4WZFA 3BODA 1BBT1 4URTA 5D8AC 5GKAC 3D0JA 1RUI3 3R05A 3INAA 3A0KA 1W6OB 5J48A 5KXCA 3JD71 1VBA2 4K3UA 1SLIA 4IEXA 4AVSA 1W2UA 1AR61 1ASJ3 1YFYA 4Y20B 3VZLA 1QXJA 3M3CA 3ZMNA 2OVUA 2ZHLA 1YJLA 3O0VA 4CDXC 5FOJB 1Y9QA 2GSYA 4GMP0 3HD8B 2BNNA 3SITA 3B00A 4PLNA 5JZGB 1YFXA 4YM0A 4CDUA 2VW2A 4JGZC 3DPRC 3H1YA 3T2TA 4JGZA 2VW1A 2OIIA 1J3RA 1WW5A 5BNNA 3WG4A 3LWCA 4RS5C 1AJKA 2K9ZA 2W68A 3ILNA 4EN0A 3VHNA 4J1XA 3PJYA 4MYEA 3B01A 4PCRA 2I07B 3ELNA 2XB6C 5CFCA 2A7AA 4GB33 1TE1B 3KT1A 1S0BA 3K48A 1XYPA 3I8TA 1NYWA 1UZZA 5C9AB 2IC1A 2UWCA 1V6MA 5BPXA 4AXOA 4YG3A 3GHMA 3SHRA 1UW8A 1YUDA 4I02A 4XPVA 2CGOA 5EXOA 1MVEA 3FLRA 3MEPA 5T3NA 3VZOA 4CP1A 1QDCA 1LU2A 1N1YA 2ZX3A 3VLBB 2SBAA 3AMMA 5CADA 3U4XA 3AB0A 3H1WA 2G9FA 3RZZA 3AMNA 5J96B 1I1EA 3R4SA 1JH5A 4GH4C 1BMV1 1ZVFA 4AF9A 1J58A 1LOAA 1O91A 4AEJA 2P3IA 3D82A 3AM2A 4L2NA 3FE5A 5F6LB 3G7DA 2A6YA 5AVPA 1QXPA 3ZPYA 1W0PA 1UX6A 4M3CA 4F3JA 4INDA 1ZZ8A 3VBRA 3DUIA 1RUOA 1W6PA 2QFEA 1QOOA 5ABJC 3BPZA 4DNYA 1DZRA 2JX9A 4PDWB 3JZVA 1HQLA 2ZGPA 3ACLA 4A7YA 1CAWA 5E89A 5I0UA 2D43A 2RJKA 2UWBA 3J4UH 3VV1A 4GULA 4XTPA 3FUOA 3MPBA 2HWB1 1F8VA 4FTSA 1C1LA 5ABJB 5KC6A 1LOCA 1H2KA 1L3JA 1R1A2 4COWA 4JVAA 2Y0IA 3ME2A 1NCQC 2RR13 2WINB 4MSVA 3ZN6A 2GC2A 1FX5A 3OPZA 3Q9OA 2F6BA 4LO7A 1BBT3 1N3PA 3IIAA 1IGOA 4Q4V3 5K8SA 2YGMA 2CAVA 3GZUC 4AVBA 3MFCA 1JXNA 3KMHA 4AI0A 1BMV2 1J1TA 4NN0A 1V9U3 2E7TA 3KGZA 1ASJ1 1AR63 1ZREA 1RUD2 4K6BA 1K5MC 2ZJCA 4A2UA 1C5IA 1COV2 2XJSA 4ITCA 4GMP1 1HQNA 3POWA 1SBFA 4KWJA 1IS5A 4YVWB 3JCIA 4ONUA 4OI2A 1BCXA 3OY8A 2YY1A 4Q4X1 3L2HA 1XYNA 2I45A 2ZGLA 3FFZA 4ZU5A 2GH2A 3V56A 1VP6A 4ISQA 2WNVC 5I0TA 3MW2A 4J1WA 5IK5A 1VIWB 5GALA 2QQPA 2JECA 4FOWA 4C0HA 5DUXA 3C2UA 1C1FA 1PO22 3DPRB 3NKTA 2H6CA 2JKBA 3MLLA 2PN5A 3KZ4C 1X50A 4Q1PA 1MQTB 1PVC2 2WNVA 1CJPA 1DQ1A 4BM8A 2K0GA 1UZYA 1CAXA 3MIFA 3AP4A 4Q0VA 4RQPA 3RDIA 3R4UA 1B09A 1BYHA 4XETA 3CO2A 3TAYA 4DZGA 3VBHB 4AFCA 2ES3A 3THPA 1QJX3 4FTBA 5KXEA 3KGLA 1AHSA 5LEJA 1MACA 1B35B 1ND2B 1W6MB 3BOWA 3JD72 2WFF3 5D8AB 2NYYA 1AYN3 2PLV1 4ISRA 1OKQA 1SFNA 4XW3A 4AFMA 5AC93 3GHNA 4WM8B 1NCQA 3KS7A 3QOPA 1HRI2 2GN3A 4LBOA 3RSJA 3AK0A 5E88A 2YGLA 3N7KA 1CPNA 1URXA 4N53A 4XE9A 3MPPG 4AW7A 2HWC3 1QF3A 1ND3A 3VZJA 4AEMA 4ZU7A 4G9SB 1D2QA 4SLIA 4NHLA 2VOWA 5CB7A 4R4XA 1COV1 2EXIA 1AZDA 3M3EA 2BWAA 2IFWA 1F5FA 4KGQA 1F5JA 1XXNA 2WLQA 5A32A 5IT6A 4MXVA 5GJ6A 1W6NA 3RYPA 5ABJA 1QJU3 1PNFA 1AR83 2ZCWA 1IS3A 1MZ5A 1VBC3 5ACA3 2W39A 5CFDA 1SLLA 4RHV3 2A3YA 4A7KA 3PLQA 3VBHA 1CAWB 1H1AA 5JZGA 2Z5WA 1DQ2A 1FOD1 1PIV1 4DINB 3ZXKA 4XJZA 2HYKA 4IEOA 5C6CA 5I91A 2GNDA 4IEQA 4OI0A 1AR71 4YW1A 5FRAA 4CEWC 2VGDA 2RS51 4Q29A 3SMHA 5CBLA 1S2BA 2R071 2CWSA 3ZSJA 2Q5TA 2WQZC 4AGVA 2MEV1 2NLRA 5K0UA 1AXZA 5DZGA 4XYXA 3MIBA 3WG1A 4DQAA 4K9SA 2XLFA 1IOAA 1C8M3 3LSDA 2DUOA 1LHWA 4MGYE 1JUIA 2B42B 4YZ4A 3THTA 4XHBA 4Z1VA 4I09A 1GYKA 1ZZBA 3M7AA 2AREA 1LCLA 3NAPA 4A3XA 4E4SA 3AYEA 4COUA 1BK1A 1Q8QA 2W08A 1C8M1 1DGRA 5FDBA 3USUA 4FAGA 4N43C 4WM7A 3WUDA 1RL3A 1QJY2 4B4QA 4P9LA 5TSWA 3VUOA 2H6BA 4XBLA 4AWDA 4QPYA 2CY6A 1H9PA 4KWLA 1J1LA 3CNAA 2XL7A 3CJIC 5BYNA 4IEVA 1WBLA 2DTWA 2R041 3S30A 1NCQB 4AI3A 1XU2A 2YUEA 1OOPB 1BBT2 5HXVA 1GSLA 4UW3A 4Q2FA 4YW2A 1CAVA 2B46X 2VVFA 4LUKA 1IKPA 5K7PA 4YVWA 1ZA4A 4Q4W1 3FHIB 2WNEA 2R043 3A0NA 2XGXA 3B3QE 4YYOA 4PBOA 5AFBA 1BVP1 4FPLA 3VBSC 2ZTNA 2XHKA 1C8NA 4MX3A 3S7IA 4OFGA 1QXRA 1FPN2 3AP9A 4YVSA 2Y0OA 2P34A 4RS5A 5I8SA 3D8CA 2Q4SA 3D4KA 2GH8A 1IHMA 4RSUA 3CJXA 4LR4A 1Z7S2 2XVKA 1JHNA 2D6NA 2GU9A 2VECA 3IPVA 4DY5A 2XWJB 1RUD1 2HWD1 4OUMA 1C28A 2JG9B 5FO9B 3ZFEB 4NHKA 1TME1 1RINA 3IBMA 1DQ4A 4IV3C 4GA9A 4S2HA 3AKRA 1LOGA 1X8MA 4AFAA 3W59A 1MQTA 4CDWA 1OI6A 4IEUA 2VQ0A 4JC1A 5C4WB 5JOZA 2VUAA 4N9HA 4NWVA 1V6IA 1VB2A 2YC0A 1FAYA 1AJOA 4B8EA 4YVSC 5HCAA 3PMSA 5BXXA 1PO11 2BYVE 2R30A 5FPXA 2JICA 2VULA 3ZXGA 3WXPA 3LA7A 3WP5A 2D44A 2ZKNA 1ULFA 4QGNA 2R061 1KDKA 3H50A 4TWTA 1R093 1Y7BA 1A78A 1QKQA 3JU9A 4CDQC 3O0XA 2DCYA 3AKQA 2ZHMA 2QKDA 3NV4A 2QZ2A 2BVBA 5JMCA 3D5OA 2FHRA 4WVZA 2X29A 4R9DA 2XBO3 2AGSA 1MEC2 1MZFA 5L19A 5JZGC 3JBG1 1SLTA 1RIRA 3RYKA 1V6JA 4HVQA 3H3UA 1D0HA 1YIFA 4HKWA 3OCPA 5AC92 3TOJA 2BNMA 2ENRA 4XF3A 5L36A 4XQ4A 5I8YA 4I0AA 5GZCA 2E7QA 4IL7A 1HRI1 4Y1XA 3WDTA 4E27A 3MZHA 1WGPA 2CGNA 2JG8A 3CLPA 1RUD3 1UF2C 4Q26A 3WDWA 1R082 2O0OA 1LESA 1LJ7A 3B7MA 2ZGRA 1ONAA 3O14A 4XJWA 1DG6A 1DGWX 4KU7A 5FAXA 2AUYA 4Q4V1 3SISA 1LOEA 3TWIA 4AFDA 3H7YA 3LSEA 1A8DA 2UURA 3E5QA 4L92A 3ES4A 1WMFA 1S0EA 1QQP2 4HK9A 4HFSA 4XFHA 1YO8A 4EN7B 4QGMA 1RUF2 4D69A 1AR72 3U07A 5GLVA 3E97A 1MS1A 3S0MA 2C0ZA 1QHDA 1KFUL 2Z79A 3MF6A 3ZDSA 3M3QA 1O7FA 3AZWA 4COZA 1PO23 1SDWA 3U0ZA 4K1YA 5GLUA 4OHVA 3WP3A 1AR62 5FMOS 3ZXJA 4H55A 1VBB3 4LLFA 3RJRA 5T5OA 1C5HA 5K0UC 1KS5A 2WLPA 3BU7A 1KDMA 5DUVA 1HQWA 1W0OA 4HSJA 4FXGB 1I3HA 4FPEA 1V00A 3WHTA 1VBA1 3IDCB 5DDJ3 3OBRA 3VBUC 4RL7A 5FLHA 3ZXFA 1OLRA 2XBO1 4RQPC 1DZTA 4HPKA 1IKQA 2JENA 1ZBE2 2ZGUA 3N35A 3ETQA 2I2SA 3GZTB 2HWF3 4RGAA 4Q4X2 5FREA 5JOXA 1C57A 4Q1RA 5BNQA 3MGUA 1LKNA 4AHYA 1PGSA 2DF7A 5F1RA 5FLIA 4AI1A 4FCAA 1WW4A 3PJQA 4UXAA 1PVXA 1FXZA 4N53B 4AI2A 3X29B 5JPMB 1PGW1 1QJX2 1RJ7A 1TNRA 4OHWA 3ZFFA 5BNPC 5LEKA 1LOFA 2D5FA 1RUI1 1YFWA 3WQ1A 1IPKA 3SXWA 1NXMA 1ULCA 3NV3A 4JGZB 1TME3 4R4ZA 1REEA 1Q8VA 1V6KA 2HWE3 2O8QA 2R6QA 1EPZA 4LBQB 1QJU2 1AR82 4EROA 4QGLA 3MIHA 5K9YA 4GWMA 2Q1MA 1GQGA 3ECQA 2VVDA 3HN1A 2XKPA 3POYA 2DURA 1NG0A 1OOPC 1FPN1 5LK5A 1LECA 5BNPA 3NKGA 1G9AA 5CAZA 3CEWA 4IERA 4NVPA 1XE8A 1VBD2 4RHV1 2NM1A 2LALA 4KWKA 5FO7B 5GM0A 3RG0A 4FQZA 5KHHA 3IWZA 5KHJA 3AZXA 1FMD1 2A6XA 2GMPA 2P37A 4ES8A 2HEVF 1MS0A 1VRH3 2ZPXA 1LOBA 5KC5A 4IV1C 3VBFA 1O4TA 1YJKA 1S2KA 4XZPA 4GB32 2JG8C 2VOKA 3JQXA 4XJAA 1H8VA 3ZFFB 4EV0A 1Z7S3 3SCHA 1CIWA 1H0BA 2Z2SB 4MGZE 2MEV2 5L7OC 2JD4A 4JCKA 1QNWA 4QQLA 1UIKA 3BALA 5FOBB 1MR5A 5JSPA 5JIUA 2GMEA 2IFRA 4AGGA 4XF4A 1RGSA 1PGL1 3AX4A 2E53A 1DLLA 2I74A 2W0XA 3I59A 3E6BA 1PO12 1RVF1 1FOD2 1EPWA 1PIV2 1XNDA 2RHPA 5FMOL 3ZFGC 3TN91 2RM22 1RUH2 2ARXA 1YI7A 5CFCB 4QM8A 3VN4A 5C8CC 1DQ5A 4HSLA 1XNCA 3I4IA 3RWNA 1WCKA 4S2FA 4O9GA 1LEDA 3WDVA 4CYDA 2RS53 4JRAA 3VZKA 1AR91 4RFT0 3AZYA 1D4M2 1A6CA 2BGCA 1ENQA 4JRLA 5CFCC 4Y22B 2VNOA 2RR11 1BJQA 4LBJA 4CEYC 4GXLA 1G86A 1KS4A 3ST7A 1SQ4A 4FPCA 4OI4A 4KBBA 3SH5A 1ULGA 3VKNA 3HMYA 4B29A 4OVEA 1PM7A 3RI8A 2C5DA 1GZ9A 4L97A 4NR1A 3DF0A 1ZNPA 4Q8KA 3B94A 3ZXEA 1CAXB 4ORFA 2Q1ZB 3B69A 3QACA 4COYA 3K51A 4YG6A 3H0OA 3NW4A 4MXWB 2WFF1 4FPKA 3O5SA 4QPIC 2WT1A 1KRIA 3DL3A 4WZCA 1AYN1 3BOPA 4QPGA 3USSA 3RS6A 4CDXA 1AVBA 1CR7A 1AL0G 2G9GA 1XU1A 4QXKA 2UYBA 4FQ4A 3ZSMA 1QQP1 3WD5A 1WMDA 5I93A 2DVAA 3MF9A 4GB31 5T52A 3MICA 1RHI1 5DUWA 1F31A 3VBOA 1QNYA 1XNBA 3OGGA 4IETA 4QHBA 5T5JA 2EA7A 3M2MA 2QJVA 2C9AA 2IXCA 5CVRA 3BTAA