3FHIB

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
b'RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fhiB01
1YHFA 4Q0UA 3U10A 2OA2A 2VQAA 4EWDA 3PNAA 1O5LA 5AVPA 3QACA 3JZVA 4XF0A 4WZCA 3RYPA 4PIXA 3H3ZA 1VR3A 4KU7A 4KWKA 4QXKA 5J48A 4IEVA 4MX3A 3I59B 5LEJA 3H9AA 2OZJA 2XL9A 1ZZ9A 1HW5A 1OFNA 1OI6A 3I54A 4QM9A 1SFNA 3QOPA 1ZRFA 1YFWA 4HVRA 3D82A 4Q0PA 2Q1ZB 1CGPA 1X82A 4IETA 2WC2A 2IXLA 3FJSA 2GC3A 1OD5A 4QM8A 4XF1A 4E2SA 3NVCA 5FCCA 4E2GA 3VHRA 1XE8A 3E5XA 3ZDSA 4AVCA 5JSOA 2GH2A 5C6CA 1FI2A 2CAUA 3OTFA 3BCWA 3H3UA 4DINB 2GAUA 2PTMA 5HI0A 3CEWA 2PAKA 3RYRA 3DL3A 3CJXA 1H1MA 1PM7A 4K8FA 4OFGA 2MHFA 2ATFA 4F7ZA 4N9IA 1O7FA 3MYXA 1EYBA 3E97A 4XFAA 4Q0SA 4JVAA 4YSFA 4Q0VA 1O3TA 3LOIA 3H8UA 2HKXA 4H7LA 2D93A 1JUHA 1XRUA 2B9UA 2CGPA 3E5UA 3M3IA 4LA3A 3KMHA 1L3JA 2ET1A 1J59A 5FDBA 4L11A 5FLIA 3ROUA 3TNPB 1ZX5A 3RDIA 2CAVA 3EO6A 4HN1A 1UD1A 3LZZA 4KU8A 2ETEA 3N4MA 1Q5OA 3CO2A 3SHRA 1IPJA 2Z69A 3M70A 2ZKLA 1UPIA 4JV4A 5J7MA 1DGRA 4I02A 4ZU5A 1CAWA 2GC2A 5JR7B 5E16A 3I59A 3USSA 3ELNA 5T3NA 3DN7A 2UY9A 5E1RA 4HLTA 2QVSB 4IEXA 3PVBB 2BNMA 3ES1A 4IEYA 4IERA 5I8YA 5K8SA 2E9QA 1O3RA 3SXWA 3S7EA 4PIZA 4IESA 2K9ZA 3LAGA 2I45A 2XL7A 3FX3A 2PA7A 2XLGA 4FAGA 4IEWA 3GBFA 2C0ZA 3FWEA 4D7SA 4MGKE 1NZCA 5EFUA 2XKOA 4WBBA 3H7JA 2O8QA 2Q0AA 4LUKA 2IXCA 4ORFA 1I6XA 2O1QA 5LEKA 3H50A 4ONUA 4I2OA 4EWAA 4FAHA 4MUVA 4X6RB 3DKWA 1GQGA 1CAVB 3E6CC 5FPZA 1IPKA 1DZTA 2QDRA 5BY5A 5KBFA 4LUMA 4XF9A 4YRDA 4N9HA 1NYWA 1U12A 1J3PA 3ACLA 4PJYA 2PFWA 2PQQA 1WLTA 3TNQA 5I0RA 2GU9A 5I0SA 1ZRDA 1ZRCA 1CAXB 1CX4A 2V09A 1Y9QA 1RTVA 1ZZ7A 5JSPA 2BGCA 2UYAA 4MGYE 4XFCA 4IEOA 3IWZA 4AQ6A 1YFYA 5KHJA 3BB6A 1YFUA 1CAUB 3MPBA 3KGZA 4MGZE 5LRSA 4MH0E 3FHIB 4MV2A 5FPXA 2MPFA 1J3QA 1UIKA 4JTOA 3UKNA 1SEFA 2GZWA 4UXAA 4J1WA 2IXKA 2XLFA 3NL1A 2BEOA 3LA2A 2OYZA 3GYDA 2QJVA 3RZZA 2CV6A 4UBGA 1Y3TA 3MDPA 1J58A 1NXMA 3ST7A 3OGJA 2VECA 4XFIA 3IDBB 1EY2A 2UY8A 2UYBA 4XFGA 4E2QA 5BV6A 4Z07A 3O14A 1H1IA 1GQHA 3LWCA 1VJ2A 1VP6A 4XFHA 1WGPA 1TQ5A 2N7GA 1RUOA 4IEUA 5FQ0B 4L2NA 3SCFA 2D5FA 1J1LA 3U0ZA 1J3RA 1NE4A 2WFPA 5BPXA 3WW2A 5C8WA 3R6SA 4NVPA 3HIFA 3OD0A 4I0BA 2Q30A 2H6BA 4EROA 1QY4A 4ZU7A 4CYDA 2OZ6A 3WW1A 3KGLA 5CADA 2XGXA 1G6NA 3IIAA 1ZREA 1LB2A 4RD7A 4IEPA 2BNOA 4XEZA 2QCSB 1CAVA 4HVOA 3WW4A 1NE6A 4AXOA 3EHKA 2DCTA 4EWEA 1Q43A 4J1XA 1LKNA 4META 3EQEA 3S0MA 3L2HA 1CAXA 4JTNA 1ZZ6A 2KXLA 2Z2SB 4LEJA 5I91A 4EV0A 5I0UA 3U11A 5J3UA 3IDCB 1O5UA 1Q3EA 4LTAA 4D7TA 3E6DA 1UW8A 4AVAA 1CAUA 4XF3A 3E5QA 3ETQA 4HBNA 4WVZA 2B5HA 4HSLA 1EP0A 1ZZCA 1RGSA 1O3SA 3NW4A 4KWJA 4BIFA 4P9GA 2MNGA 3HQXA 1PMIA 4QMAA 5BUVA 4BHPA 3CL1A 3RYKA 2H6CA 1QXJA 3D0SA 3UKTA 4BH9A 5JSRA 3BU7A 3FZ3A 2B8MA 4O9GA 2D40A 2EA7A 4OLLA 1YLLA 2IXIA 3SCGA 1YFXA 1CAWB 3RPQA 1V70A 4XF4A 3MZHA 2XKPA 3OCPA 4LULA 4HVQA 1LRHA 4Q0QA 4QGLA 1ZVFA 3BPZA 3S7IA 5FQ0A 3KCCA 2ZCWA 4A2UA 4QGNA 3ES4A 2HJIA 1QWRA 2D5HA 4XFFA 3RNSA 1RUNA 3CF6E 3I7DA 3UKVA 2Y0OA 5CU1A 1O3QA 5JAXA 2VPVA 5I8TA 2ET7A 1UCXA 2PAMA 3CLPA 5F1RA 1O4TA 1WA4A 2QNKA 4R8HA 1QXRA 4YYOA 1X8MA 4O9EA 4Z82A 4XETA 4BYYA 4IEQA 4LA2A 5D1IA 3HT2A 1I5ZA 3BALA 4HMZA 3FFQA 3LA3A 2PHLA 1YWKA 4FBFA 5JCTA 3C3VA 2H0VA 1YUDA 3LA7A 2K0GA 4B29A 4ZU4A 2PAEA 5FLJA 3PLQA 3H1YA 2IC1A 4HN0A 5EZWA 5CVRA 1UIJA 4R52A 1RL3A 2XHKA 3KSCA 4MZUA 2P17A 2IXJA 3FE5A 1ZRRA 4FT8A 3D0JA 2EAAA 3EBRA 1X7NA 1ZZ8A 2PHDA 2PYTA 5BXXA 3OF1A 2BYVE 3EJKA 3G7DA 4KWLA 1XE7A 4KL1A 4I0AA 1FT9A 3WW3A 3NJZA 3H1WA 5KHKA 4I3PA 3E6BA 4I01A 3B02A 1ZNPA 3H1MA 2F4PA 3NKTA 4PIYA 4QGMA 4X6QB 1OMIA 3HT1A 4IEZA 2Q4SA 4XFBA 4AVBA 4QX5A 3NSTA 1DZRA 4GULA 2XLAA 3SCHA 2EVXA 2BNNA 4I09A 4HSJA 5KHIA 4TLFA 4Q29A 4AQ2A 1X8EA 5I93A 3SMHA 5KHGA 2FQPA 1ZZBA 4MGIE 3DV8A 1DGWA 1LR5A 2OPKA 4UBHA 4F8AA 2IXHA 4YNIA 2GC1A 2FMYA 5LRRA 4YARA 5KHHA 4LLOA 1EPZA 1RC6A 1SQ4A 3IBMA 5FLHA 5I0TA 3H7YA 4HZFA 5I8SA 2GC0A 1FXZA
chains in the Genus database with same CATH superfamily
2GNMA 4XJ8A 1QJX3 3BOPA 1HB4A 3N7MA 4LK7A 4EWDA 4UF0A 2ZZQA 4Y1YA 1MPXA 3MW2A 4F3JA 4AFBA 1A6CA 5JMCA 3GHNA 3Q8CA 4PLNA 4DQAA 3URFA 2QE3A 4XF0A 3KV4A 1TZOA 5GM0A 2WYFA 2XVLA 4M4RA 3POBA 4WZCA 4ATEA 5FPVA 1RUI1 4QKBA 2XVGA 4CCLA 1VR3A 4KWKA 2D44A 4PBOA 3VLBB 4AEMA 4D69A 2LS6A 1BXHA 4IEVA 3GJBA 3VB9A 3I59B 1PX3A 2X5IA 1HJFA 2VMDA 1H2MA 1RVF3 1W8UA 4YGDA 3OJBA 1TNRA 4L8QA 5FZ0A 1RUH1 1ZZ9A 1PNFA 4BQ2A 2VXJA 1RUE3 1OA2A 2W92A 2VBDA 3HBKA 5JI9A 1XYOA 4JHTA 3ZFEA 1W6QB 2IVJA 3RFRA 2Q1ZB 3GBWA 1UZZA 3LSEA 1NY71 1SPPA 4OMCA 3POYA 4QB2A 2VCMA 2WC2A 2IXLA 1IG3A 2NMNA 1BYHA 5SV8A 3A4UA 3AP5A 4CDXC 3GZAA 1PGL2 2WO7A 4YGBA 3ZYRA 2FCUA 4J25A 4BLJA 1S0CA 3LFIA 1BEV2 3VHRA 1ND2A 3ZSLA 2DTYA 3USUB 2NQYA 1H6XA 3E5XA 3SEPA 3T2PA 3ZDSA 4AVCA 2J42A 3DECA 5JSOA 2WZR1 4P5YA 2G1MA 1HXS3 1PZ9A 2CAUA 3PMEA 4CSWA 4BQ3A 5FYUA 3H3UA 4P9YA 3AZYA 2YG0A 2GAUA 1GNZA 5HI0A 3CEWA 5BNOC 2PAKA 3F95A 3HNMA 3PDQA 2G4IA 1PZ8A 1V9U3 1BBT3 5DZGA 4R4XA 2R0HA 2P4EA 3CJXA 1H1MA 3T0AA 3HNYM 1WD3A 2HWE1 3PVNA 4K8FA 4R9CA 4DEQA 1AR73 3ZN4A 4CEWB 4OFGA 5CA6A 4F7ZA 4MG2A 4CDWC 1XNDA 3AC0A 4YW4A 1HV0A 2QZ2A 3DXTA 3T2TA 2VZVA 4SLIA 4QPIB 4URAA 4JGYA 1YCIA 3BIWE 5JIAA 1SACA 2QDNA 2HKXA 2PLV1 2QQOA 2QQMA 4QX3A 1GP6A 1IPSA 3E5UA 2V72A 3THTA 4LA3A 4K6BA 2UWAA 1L3JA 1O59A 3I2IA 4NAMA 3AZXA 4OMDA 1BK0A 4FPLA 2X09A 1J59A 5FDBA 1OQDA 4L11A 3ROUA 1NCRB 2CGOA 2P3JA 2CAVA 4MO3M 1LOCA 3MLLA 3TBDA 5IVVA 3LZZA 4KU8A 1UU4A 1WW7A 2ETEA 1CPNA 3ATGA 1Q5OA 2HWF3 5FTTC 3T30A 3AKSA 2A7AA 1BZWA 2QBXA 3SHRA 5C5TA 2W95A 4CUBA 3LEIA 2ZGLA 2W1SA 2Z69A 5F5IA 3VHPA 2OKXA 3VDCA 2I07B 4HG6B 4JV4A 4N43B 1VBE1 3R4UA 4QB6A 1AR81 1AYN3 3USSA 2D7FA 3ELNA 1VBC3 1RITA 3FLPA 4P9WA 4IEXA 3PL0A 3PVBB 2AEZA 4IERA 3KM5A 4J6GA 5F5CA 4FPEA 5K8SA 3NJVA 1KS5A 3AP4A 1TMF2 2BOJA 5FJHA 3U4SA 3NNGA 1Q8OA 3A21A 4XZUG 3VBFB 4C0HA 4JDNA 4FFGA 1UY1A 5IYYA 5FYBA 4BXSV 2XLGA 2NM1A 4COUA 4IEWA 1RUG1 2WZPP 5CEHA 4TN7A 3INAA 1NZCA 1UYXA 3PJYA 3VDBA 5GLUA 4PLOA 2B42B 4OHYA 3NNMA 1UX6A 4NUBA 5A7WB 1HQLA 2BDRA 2WZEA 2XKOA 2P1BA 5IFTA 3H7JA 2VUCA 4LMFA 3QH7A 1PMJX 2WFF2 2NPIA 1LOEA 1C8M3 1A3KA 4JX0A 1XNCA 4E8CA 1TME2 3I49A 4ORFA 5KXBA 1I6XA 5DZEA 5EJ3A 2O1QA 2VH9A 4O7XA 4W6YA 4YFZA 3J4UH 1RUF2 1PGW1 4X8PA 4XMIA 4I30A 4EE2A 1COV2 2JDKA 2ZGPA 4BLIA 3TN92 3JBG1 4X6RB 2DFCA 5IJRA 5FZOB 1LULA 4QX7A 5F3EA 5LK5A 4CDUB 2DCJA 1CAVB 3U07A 1PO12 5C8CB 3OUHA 1A8MA 2GH8A 5FBZA 4PLMA 1FPN1 4ARYA 2J22A 2SBAA 5FYYA 3WP5A 3SISA 1U12A 3ACLA 4GQ7A 4CCJA 1F4AA 2Q5TA 1TMF1 3CMGA 2PQQA 3AZZA 3TNQA 3MV01 5IVFA 1VMFA 2LALA 3JD72 4NN0A 5DZFA 3O1TA 4IUGA 2AEYA 3WDTA 1OOPB 2CGNA 1JYTA 1AXYA 5F5QA 1Z0HA 3ZSMA 1RTVA 1PVC1 2DVFA 3IN9A 4S2GA 5FUPA 3C7FA 1YC61 5C4WB 4QT6A 1NQJA 2BGCA 4B1LA 4X8NA 4MGYE 5FRAA 1UX7A 1REEA 3IWZA 3M3QA 5FUIA 3ZMOA 4NE9A 3JQXA 1W6PB 2JE8A 1H8VA 4EZ4A 2F17A 1MS4A 2Y6GA 2JDAA 5FPXA 3K51A 1J3QA 1RUF1 5C9AB 1COV1 5IWFA 1SEFA 2WLQA 3MF9A 2WL1A 4YM1A 2A3WA 3O0WA 4ZS2A 2JE9A 1LGBA 4J1WA 2A1XA 2XLFA 1BLZA 4XXAA 4OUMA 1HB3A 1S55A 2X29A 1FMD3 1PO11 2XDVA 3LA2A 5H9RA 2OYZA 2QJVA 2BP6A 1HN0A 1NUKA 2RM21 3OYWB 4AFDA 4EN9B 1UZ0A 3MBWA 3ST7A 5A3UA 5CKQA 3RMYA 2UYBA 3C7HA 2ES3A 3ECQA 3JD71 3PURA 4H14A 4LNVA 1NCQA 4E2QA 4Z07A 1M06G 4H3WA 1S0DA 3L9JT 3LDRA 3B69A 1VJ2A 4ZZ8A 2ARCA 1XB9A 2VCAA 1VP6A 3WNPA 1WGPA 2ZGOA 1TQ5A 4GD4A 1E5RA 2BW8A 2QQWA 5T5OA 4YGCA 2JG9A 1XNAA 1VBA3 1VBD3 4IDZA 5JXHA 3FFZA 5D8AC 4NRQA 1CJPA 4YVSB 1GR3A 1RUOA 3WINE 2J1EA 3MW3A 3WY6A 5ACA1 1KFUL 1WZXA 3RI8A 4EQVA 3MEPA 1MQTB 1KDMA 3WW2A 3ZXGA 2A6VA 4PDWA 4FTSA 4FO9A 3LDBA 4I0BA 1QJU1 3O12A 1YEWA 4EROA 1EAH3 1WCSA 1S0FA 4CZSA 4CYDA 2OZ6A 4DOUA 2Y6KA 2TUNA 1NA1A 4KGGA 4XCAA 1G6NA 4YVWC 1PO21 1DFQA 4IE4A 4IEPA 2BNOA 3SH3A 2AR6A 5D21A 2QKDA 2VMHA 2BBVA 5IHRA 2J1RA 2W5FA 3IT8A 1W6NA 3PJQA 1QQP1 2P3YA 1JTZX 4EWEA 1GOHA 2QQPA 4NIHA 1QEXA 4PCRA 1X9TA 5FFOC 2R30A 4L97A 3ZFGA 1RHI3 1UXZA 1C1LA 1MEC1 3JQWA 3POGA 4GWJA 3WLUA 4NIGA 1CAXA 4JTNA 1HRI2 2XWJB 2Z2SB 5F5AA 4CXWA 5FWJA 4GKXA 5I91A 4NRMA 1G9FA 4GA9A 3O0VA 3QCWA 3IDCB 4H55A 5CKNA 5J98B 3WG4A 2E51A 5A70A 1CZTA 4AVAA 4XJWA 1HKDA 4XF3A 2JKBA 3OBAA 4HBNA 1LOGA 2IFWA 4K8RB 1POQA 5CADA 2HWC2 4QHOA 3P1IA 3UETA 4M0NA 5CZKA 4CE8A 1BHGA 1EP0A 1W8OA 2VCBA 2ZZJA 4QWNA 4C8DA 4YZ2A 4Q27A 1H1AA 1RGSA 4CEYA 3CDZB 2C1FA 3B9IA 1JZ3A 1MACA 2ORXA 3CKHA 5FJKA 2MNGA 3HQXA 4CXYA 5A7PA 4RS5B 2E7TA 4Y1XA 3AL5A 4NIIA 2NMOA 4BHPA 4IV3A 2LW8A 2O8OA 4UFLA 2H6CA 1GZWB 1L7LA 4S2DA 1YQ6A 1K3IA 1QXPA 3M8LA 4RR3C 2WDBA 5FXXA 5GLVA 2LM3A 2VZUA 3W9AA 4JZRA 4FTBA 1LGNA 4O9GA 4YLZA 2Y0IA 4DRVA 2V5DA 4OLLA 1YLLA 2IXIA 2ZJCA 3D8CA 2Q8OA 1YFXA 2Y33A 5J96B 2YC4A 1RUC3 1V70A 3RPQA 3U14A 2DDUA 1DHKB 5BNNB 3SKVA 2YYOA 2WKKA 4LBKA 4TZDA 2ARXA 4HVQA 5C3OA 1LRHA 1SLAA 4AF9A 3D6EA 3MUY1 1ZVFA 4QGLA 5L9RA 5L36A 1OFSA 1IQDC 1H8TC 1YQ2A 3EB7A 4QGNA 5H9PA 3THDA 4F83A 1ZRIA 4FP3A 2ZMLA 3CF6E 5LW9A 3N9MA 3VBRB 3O1OA 1US2A 1NAEA 1WWYA 2Y0OA 4NWVA 1R1A2 2VW2A 3ZSEA 3DEMA 3N7LA 1F35A 5I8TA 4COZA 2RS32 2PAMA 2R1BA 3WHUA 2QNKA 3U1XA 2WQ8A 1QXRA 4GH4B 2YDEA 4YYOA 2FZ2A 2YGMA 5SV5A 4O9EA 1XXNA 1OA3A 1W9TA 1QJZA 2JDPA 4Y5Z0 4FCAA 4GWMA 4UF0B 1POV1 5KWRA 1AYM3 3RWKX 2VOWA 1ULPA 2RDQA 2HBTA 2UWCA 1WBLA 3BALA 3FLRA 4AFAA 4Y20B 5FY9A 5EYXA 1ND3A 2VOXA 4MGQA 4FBFA 4AHXA 1N1TA 2DVDA 3C3VA 1Y9MA 5FZMA 3VBFA 2H0VA 1UY4A 3O0XA 1Q8VA 1RUI3 1YUDA 4RHV2 5FKCA 3RZHA 2KM2A 1W90A 3ITQA 2PAEA 4JGZA 5FLJA 2X5IB 1HV1A 2VUDA 2VW0A 4YGEA 5FP7A 2ZHNA 1SBFA 2IC1A 4HN0A 2RS52 4W6XA 3N35A 3KZ4C 2AH2A 4E4SA 1MZ6A 4LHSA 3PU3A 5EQUA 2DUOA 2VTXJ 1R1A1 3ZFEB 1KXGA 1ZRRA 3BTZA 3WQBA 4H2AA 4FT8A 3D0JA 2EAAA 3WUCA 1SPPB 3AP7A 4PBPA 2HWD3 4UFJA 4Y4RA 3WF0A 2NN8A 1LU1A 4OUSA 4RSUA 3O1UA 1ZM1A 5IW0A 5ABJA 1OLRA 2A6ZA 3EJKA 1IZ3A 5FMOL 1NXD1 4L92A 2EIEA 4ITCA 5FZOA 4AI0A 2WO2A 1D0HA 4CDUA 4BQWA 4BDVB 2GN3A 1X50A 1ND2B 1SLLA 1YNAA 2WN3A 3R0RA 4LITA 1ZNPA 4XACA 3NKTA 4PIYA 4X6QB 3HT1A 1H2NA 2Q4SA 4XFBA 3KT1A 3V56A 4ZY9A 3NSTA 5LZ6A 5CG9A 2WZR3 2E33A 1XBFA 3WF3A 3SCHA 3WEZA 2HWB1 2BNNA 3DYOA 1V6LA 4I09A 1JI6A 2WS92 5ISLA 4FFFA 5A32A 4N8MA 2A6XA 1T6BX 5C70A 2R072 2XQRA 4UFHA 3ZIWA 1XC6A 3GZEA 5KXDA 4LXLA 5FYSA 4XBQA 3N9QA 5EHDA 4TLGA 2WNUA 2B4KA 4P9IA 2W1QA 2WQZC 2HWE3 2C4XA 2IXHA 3KF5A 4A3ZA 2VNOA 4Y22A 1RUJ1 4BMBA 1W6PA 2GC1A 5JOYA 2VG9A 4JGYB 4AQTA 3NRUA 1QOSA 4NPRA 3UGGA 5F32A 4QXCA 2CYFA 5F2WA 3WF2A 4Z1VA 1UL9A 1H9PA 3VBOB 5FYIA 1RC6A 3GCXA 1C1FA 2D3SA 5IVYA 5FZCA 2PLV3 2EXHA 3B94A 5I0TA 2CY6A 3PUIA 4RL7A 3H7YA 1WA6X 2DUQA 2W2IA 3HNBM 4HZFA 5I8SA 4PJYA 5DXDA 2D98A 4TWTA 1LHWA 1YHFA 2VGDA 3OYWA 3DGTA 2W87A 3LEMA 4BZ4A 2FDHA 1JZ4A 4UFKA 3PNAA 4LQRA 5T55A 4Q4W2 1XU2A 4V2WA 3H8RA 3AXEA 3WOGA 3VBOA 2BJSA 1RUD2 1GNYA 3RYPA 1DYKA 1MS3A 1H4GA 5FZ3A 2OS2A 5GJ6A 1GKBA 2RS12 2QQIA 4KQ7A 4ATFA 5FZ9A 1SLTA 3LF7A 1HQNA 5J48A 1QF3A 3MO4A 4BQYA 2R071 4MX3A 3ILFA 4ASKA 4S2HA 4XUOA 3H9AA 4KH9A 1VBE3 1ULFA 4Q4V1 5APAA 2OZJA 4YVSA 2VCCA 2R043 1AR83 4D0QA 1AL22 2LTNA 2XL9A 4QM9A 4DIQA 1EV12 5K9YA 3OGRA 2AYHA 2ZGSA 3THPA 4AFMA 3WNLA 2E6VA 2RV9A 3T1LA 1ZRFA 3HJRA 1XYPA 4OZXA 2DCKA 4Q0PA 3VBSA 1CGPA 1X82A 3JB4C 3LEGA 3GGLA 4A3XA 2Y34A 2HEYF 1D7PM 1PK6B 1BCXA 2GC3A 4RQPA 3WR0A 3ZX7A 3WHTA 1B35B 4QM8A 3ZPYA 2ZOEB 2BOIA 4XF1A 2OIIA 3OBTA 4FPYA 4NROA 4INDA 1RUG3 2RMU1 4CEWC 2VL4A 3NVCA 5CBLA 2YB7A 4E2GA 1WLDA 2W91A 3CJIA 4UW6A 2A73B 2GH2A 2P6HA 4QPIC 4WM8A 4LOTA 5EYYA 4GALA 3VBHA 1UY2A 2RS11 2ZHKA 4AGGA 1HDKA 2VZQA 3IKWA 3MV11 2PTMA 3K3OA 5AC91 2JG8A 1BJQA 1Y7BA 4K9SA 3AB0A 4HFSA 3U4XA 2HLEA 5C33A 4YW6A 1W0PA 3CZUA 3ZDVA 1PNGA 1SBDA 3ETPA 3VZOA 3JBG3 1AL21 1EV11 1XJAA 1NCRC 1GUIA 2Y8KA 2MHFA 3GJAA 2J1AA 1VMHA 3N7KA 2VZPA 3VL9A 1O8SA 1JZ6A 3AKTA 4M4PA 1R64A 1C8NA 2EIGA 1FPN3 3BTYA 4JVAA 3MIFA 5DDJ3 1VRBA 2VM9A 1O3TA 1CWPA 4W50A 5CFCB 3DXUA 4LO7A 5B4NA 5FBJA 2D93A 2B9UA 4N43C 4K7JA 1NLSA 2CGPA 4XTPA 3WNOA 4QKNA 4QU2A 4CP0A 4XIKA 3VGIA 2WT1A 3VHOA 2RDSA 1AR62 3N36A 4LHKA 4Q5OA 5L7OA 2ET1A 2WT0A 5FZKA 1K5MA 2YBKA 1PVC3 1ZX5A 3NQHA 3WDVA 2WRAA 1N3QA 4HN1A 4YG6A 3HPNA 2R1DA 4CUCA 1W99A 3WQ0A 3MHZA 5FOJB 2JJ6A 1JN2P 3CO2A 3ZYBA 3FBYA 1IPJA 1ZYBA 4M3CF 2WR9A 3VBFC 4LLFA 5E8AA 1LESA 1OH3A 4JAAA 4URTA 5DUWA 5IUQA 2XJRA 2PMWB 2RR12 1OKOA 1GANA 3J9SA 4I02A 1COV3 4ZU5A 1IS4A 1NZIA 3OGGA 2ZGMA 1QJY1 5E16A 2YMZA 4Y5TA 3I2HA 4FQZA 4CVUA 3J8F1 3WP3A 5BNNA 2VULA 1NLRA 1HB2A 3OUJA 2VBPA 4AHWA 4D6RA 1CD3G 2VVFA 2RM23 4HLTA 3UV9A 1IS5A 4FOVA 3NO8A 4IEYA 2JIGA 1O3RA 2E9QA 1NCQB 3HR9A 1DIWA 3MGUA 5DUVA 2JEMA 4PIZA 1G9AA 2K9ZA 2WQ4A 2I45A 2XL7A 3FX3A 1W2OA 3B7MA 4MXWB 1VRH2 2Z5WA 2CL2A 3DKQA 1N1SA 4LKDA 3W5MA 2Q8CA 3GHMA 2JG9B 2WNOA 5FAXA 5FPLA 1YYNA 4AI2A 4GH4A 4CDUC 2PHUA 4LBNA 4QPGA 5EFUA 5C8CC 2XOMA 5FY4A 3I3EA 5FO8B 4OHWA 5CFDA 3DPRA 4D7YA 1FOD2 2EAKA 4WBBA 3A0KA 2Q0AA 2HYXA 5ACA3 4PDWB 3FUQA 4BPZA 2WINB 3J7LA 4Y20A 5DN2A 1W04A 5FZFA 2XBO1 1KDKA 2RR11 3H50A 5IATA 3ZXFA 5KXCA 5LEKA 4EWAA 1OOPC 1NA1B 3ILNA 2LRPA 5FZEA 1QJU3 3MUZ1 1W8NA 4OI2A 4XQ4A 2BERA 1BMV2 3C2UA 2C6SA 5C4WC 4YW7A 3AMNA 2VNRA 2CHHA 4IGOA 4QQLA 2ZGUA 3E6CC 3FC0A 1MS1A 2ARBA 1PO23 4M3CE 4BIOA 2JE7A 1S0JA 4Y1ZA 1IPKA 3VKMA 4DNYA 2FHRA 3M3EA 3RZJA 4YRDA 1W6NB 1OUXA 1J3PA 1DQ2A 3N7JA 1OKQA 4CA9A 1UXXX 3BODA 2IUWA 1WLTA 3HN3A 1HQWA 4FPGA 5DABA 4GWNA 4QXHA 1JU4A 1QQP3 2WNVA 3NAPC 3HMYA 1VBB2 5ERLA 1CZVA 1O4YA 3AX4A 3ZFGB 5C9AC 5TSWA 1D2SA 3MI8A 1ZRCA 3WXPA 2QUOA 1CAXB 1XE0A 4WVVA 2EF6A 1VMJA 1MEC3 3FN9A 5KXEA 4NAOA 1E5IA 3MLKA 1RXFA 4FVVA 4MXVA 1DQ4A 5FKBA 3RMXA 1DGLA 5JSPA 1UZYA 1JBCA 2ENRA 2B46X 2JDYA 4NR1A 4XFCA 4IEOA 4AEKA 1JH5A 1YFYA 3BB6A 1WBFA 3Q8BA 2BQPA 3M3CA 2YROA 4AL9A 5LRSA 3BTXA 2P34A 1FYUA 1UIKA 2MPFA 4LHNA 2X8KA 1W9SA 3KF3A 4CEYB 1GV9A 1LCLA 3GZUC 3IM0A 1UPSA 2GZWA 1YO8A 5G04L 1BQPA 3K3NA 2ZKNA 4OHXA 3SH5A 3GYDA 4HK8A 4LO8A 3WCSA 4DY3A 5FYVA 4YVSC 2CV6A 4IV3B 1K5JA 4PQQA 3AK0A 4DS0A 4AHYA 1TG7A 5FY7A 1XSQA 3B93A 4W4ZA 1LECA 4MADA 1MQTC 1EY2A 1SLCA 2JDHA 2VW1A 1W3XA 1OURA 3C7OA 4LE4A 5BV6A 2C26A 4DFSA 1H1IA 1QDCA 4UT5A 4AWDA 4Q26A 2A70A 4IE7A 1TNFA 4YW2A 1PGL1 5A1LA 3HQRA 4GZ9A 2N7GA 5KC5A 2XJQA 4IGPA 2VMGA 4M3CA 3VD5A 1ALYA 5FV3A 2I2SA 4R9BA 1OHFA 2VUJA 1BEV1 2E7AA 3TEYA 3SCFA 2FD8A 5LA9A 1WLCA 1C57A 3UYJA 2WLPA 3ZFFA 2RE9A 1NT0A 1DLCA 4GMP1 5BPXA 4DZGA 1H4HA 4QKDA 4DB5A 3R6SA 1E57A 1OSGA 4NVPA 1NLQA 3OD0A 3S5QA 5AFEA 1YIFA 5EWSA 3KV6A 2GNDA 2DUPA 4NWWA 4ZU7A 1W03A 3WW1A 2WZ8A 2ZX2A 3PIGA 4QX1A 4CP9B 1DP0A 3B9CA 3IIAA 5FYCA 2J1TA 4LR4A 5CYYA 1IHMA 4RD7A 4XEZA 3LSDA 2QCSB 4AI3A 1ASJ2 5LA1A 1UYYA 3WW4A 4P9XA 5JXGA 4NHKA 2DCTA 5IAVA 1LEDA 3D3AA 2YBPA 4ES9A 1LOBA 1POV3 1Q43A 4J1XA 1LKNA 2CSGA 3RRDA 1ND3B 1V6MA 1XYNA 5ANNA 2JB4A 2YY1A 4YWAA 3S0MA 3LE0A 2G19A 1G9CA 1PK6A 3OSDA 1MS0A 2KXLA 4JGZB 1B35A 1H9WA 4RS5C 2Y64A 1BVP1 4HPKB 3U11A 3WP6A 3T09A 4D6QA 1ZBA2 4CP2A 2ZGRA 2UWBA 5E6HA 5BNPB 1Q3EA 1UWWA 1KFXL 1AR92 1CQ9A 1XNKA 2XWBB 3E6DA 4ISQA 1CAUA 3RG0A 3E5QA 2VOTA 3ETQA 5ANQA 5F37A 5CB7A 2OT7A 2WYSA 1T2XA 2JD4A 2Y6JA 2VC9A 1LOAA 2G9FA 4HSLA 5EPAA 4COVA 2RHPA 3A23A 2CU5A 3AKRA 1SDDB 2ZBJA 2JDMA 1HRV2 4CCCA 2JB8A 3U37A 5ABJB 2D6NA 4N53B 3FLTA 2MEV2 4BIFA 4P9GA 5BNNC 1ASJ1 2WO1A 4QMAA 4RGGA 4UW4A 2ID4A 4AI9A 2W0XA 3RYKA 4YM0A 4BK5A 1QXJA 3D0SA 4M01A 3UKTA 1LJ7A 2UURA 3KT4A 1J84A 5JSRA 3A7QA 3AM2A 3K4DA 4XUNA 4BQ4A 5LATA 3VBRC 5FZ7A 1S1AA 3LIGA 4Q4X2 5CFCA 4CP1A 5JXJA 3AZVA 3SCGA 3I3BA 5DQ0A 1CAWB 1V6OA 5A32B 3S30A 3JB8A 3VDDA 1ZBA1 2HWB3 3MZHA 3OCPA 4K40A 4XUQA 5A6XA 5DAXA 1TVGA 1YQ8A 5FQ0A 3BPZA 1JHNA 3S7IA 4COYA 2WNUB 3KCCA 2ZCWA 4A2UA 5JZGB 3KT7A 1XNBA 2WFF1 4TSVA 5BNQA 1RMU2 2XJUA 4Y22B 1TME1 1JOPA 1W8HA 2P5BA 4XFFA 3Q8AA 3ZM8A 4EJRA 4DUXA 3ZR5A 1YQ5A 1RUJ3 4QHBA 1OXCA 4GB32 5F3IA 2VPVA 4G4FA 3TN91 3U78A 2ET7A 3KQRA 5HCBA 5F9TA 1UCXA 5F1RA 5IVBA 4S2FA 1V6IA 3WQ1A 1GBGA 1WA4A 2X5IC 3POSA 1GWMA 1FV2A 2HEVF 5FY5A 5FYMA 1QJX2 2ZX3A 5A33A 4D8MA 3BKZA 1W8TA 4CPBA 5HCHA 3KVBA 2BVBA 1UZVA 3VD7A 3RZKA 3ZXJA 1YQCA 3SLIA 1BK1A 3CIHA 4Q4X1 2VXRA 3ZFEC 2QQJA 3OD4A 4MLOA 2L9LA 3LA3A 5B2GB 4LORA 2ZXQA 3ZVXA 4QDRA 5FZLA 1DGWX 5JCTA 4LPLA 4IV1A 1LOFA 2VVDA 3FBMA 1OC1A 3PUAA 4MXWA 5LA0A 2W1WA 1UKGA 4B29A 2QQUA 1UY0A 2DU1A 1RXGA 2XQXA 4UW3A 1RVF2 4XJ9A 2B45X 4D3WA 3K48A 1VAVA 2AREA 1RJ8A 2BRTA 4Q8KA 2J1UA 2EIBA 5CVRA 1RMU1 3RZLA 4Q4V3 2GMPA 1ND2C 4R52A 4MZUA 3VUOA 1UYZA 3JUUA 2BGPA 1RUE2 2Y38A 5A7QA 3FE5A 2ZGTA 1N3OA 3B3QE 3HD8B 4WM7A 1LTEA 1YRZA 3TAYA 3VKFC 1HJGA 4GB31 4UFMA 1UQXA 3VBSB 5JMOA 3ACIA 4XC9A 1NG0A 3EBRA 3ZIXA 5AFBA 1DQ6A 3VZJA 5F6KA 5BXXA 3X29B 4AI1A 4CRQA 2E32A 5FIXA 1F4HA 2PHRA 2XXZA 4RQPB 1WCDJ 4QX8A 2P6CA 5FUNA 2P37A 1XE7A 1YJLA 3W58A 3HEIA 1FT9A 1S2KA 5DAVA 3NJZA 4OCTA 3RGBA 2VR4A 2ZEYA 1AX2A 3NMBA 2C9AA 3DYPA 1DGRN 2O14A 3PTYA 4C1XA 4DXSA 4FOYA 4D94A 4QKFA 2RMU3 3B02A 3CJIB 3H1MA 4WM8B 4CTEA 4DPNA 1HXS2 4CDQA 4C91A 4JGYC 4LO4B 3VBHB 1J83A 1D4M3 4L0PA 2R7EB 4A6SA 1YJKA 2A6YA 1F8VA 1CIWA 2JG8B 5LBBA 2RS13 4NO4A 1V9U2 4QHZA 1W0OA 1BBT2 1ENSA 4TLFA 5AC93 5FZ6A 2RDRA 1IQAA 1H6YA 2QQNA 4UYBA 1ST8A 4AQ2A 4BCUA 5A1FA 4FTEA 5I93A 2GSYA 4LBJA 4KMQA 4FPJA 4MGIE 1F15A 5JXIA 1DGWA 1G86A 1GSLA 3LFMA 4UBHA 4F8AA 1G9BA 1STMA 3OOXA 1I9RA 4XDPA 3IIIA 1OVPA 4YARA 1WW6A 5A6YA 3VBUA 2OQ7A 2ZMNA 1EPZA 1APNA 1LHUA 3WNMA 2YV8A 1OD3A 5FYHA 5LBFA 1FXZA 3WDXA 5L7OB 1QNWA 1K5MB 4ET7A 4ARXA 4UFIA 2VQAA 3POWA 2XJTA 3AXDA 1JU3A 2HWF2 3RZMA 1O5LA 1PVXA 3EMRA 3JZVA 3QACA 3AFKA 4P02B 3PMSA 3MIEA 3R4SA 4UI9L 5FMDA 2JDZA 1AVBA 2W68A 2Z79A 3H3ZA 5LB6A 2VZRA 3OBZA 1V9U1 4KU7A 5A3WA 1HRI1 1NOVA 1PK6C 4QXKA 4BQ1A 3NJXA 1AYN2 3AP9A 2Z4FA 3OEAA 3M4FA 2ZACA 2Y6HA 4QXBA 2OUJA 1VBC2 3U75A 1QJY3 1YIPA 5D2AA 4NIAA 1UYPA 4QPWA 3J8F3 1OI6A 1OFNA 2A3YA 4KI5M 2HWC1 1AUYA 2G9GA 1SFNA 5I0DA 1YFWA 4HVRA 3D82A 4Z92B 2W94A 4CUAA 2BU9A 4IETA 4N90A 4I0WB 5IK5A 2BZDA 1W9FA 2XMLA 4GIQA 1W8ZA 2CDPA 3FJSA 2VJXA 3KLSA 1OD5A 4PHZA 4ZZ5A 2G9ZA 3T1MA 4CP9A 4E2SA 3KHCA 1NQDA 4QPGB 3OPWA 1AXKA 2R063 2V4VA 1S2EA 5CFDB 3DPRB 1WKYA 3AFGA 5FCCA 1GWKA 4GWIA 1OA4A 4UOJA 2WJSA 1C8M2 1FI2A 3OTFA 5GZEA 4XIOA 1NX9A 5T50A 5CFCC 1F5JA 1W06A 3UK9A 5IVJA 4XURA 5L9BA 3ZXLA 3LGRA 4IXLA 3C7GA 1WW5A 2XBO3 2RR13 4JHZA 1GOFA 1WUVA 3G6JB 4W8JA 5C5UA 3RYRA 1ACCA 1UMHA 3AMMA 3DL3A 3CZJA 4NJ4A 4R9DA 2B9VA 4HPKA 3NV3A 2UU8A 3LDKA 1PM7A 4AEDA 5A3LA 5BNPA 1R092 4N7UA 2R16A 1O7FA 3ORJA 4N9IA 4YW3A 1EYBA 5K0UB 1LU2A 3L2YA 5KC6A 1RUH3 4XFAA 1RINA 4ES8A 4YSFA 3K75B 4Q0VA 5JPMB 3SITA 4BM8A 4NIDA 1JYWA 4XBLA 2WNVB 4AE2A 3H8UA 4HETA 5FY8A 3MIHA 2RS31 4UAPA 1X36A 1WCUA 2EIDA 1XRUA 1E5SA 2FCTA 1FNZA 1W8FA 4H7MA 4ASLA 5FZGA 2GP3A 3I97A 3K46A 4N53A 3RJ2X 3ZXAC 5IT6A 3OPZA 2RJKA 2CDOA 5F2SA 3W21A 2ARAA 3MIBA 4NMIA 5FLIA 5BYNA 3RDIA 1TEIA 2A71A 4BA6A 5CKMA 4BB3A 2HH9A 3EO6A 1UD1A 4L99A 2LUWA 5A3MA 2JXAA 2EALA 4XAAA 1NCQC 2OPWA 4P9JA 1S0GA 4TYSA 2ORZA 4IE5A 3M70A 5A1AA 1C28A 2ZKLA 1FAYA 4RHV1 1S4CA 5F3GA 1UPIA 2ZMKA 3RVHA 2DYCA 3VZNA 5J7MA 2PHWA 1QKQA 1RYYA 4A42A 4AR2A 1CAWA 4U2AA 1FMD2 1HX6A 2GC2A 2JG9C 3SQOA 2D6KA 2AZ5A 2RS51 1IKPA 1W6OA 1R091 2RJ2A 4NPLA 1FATA 2EXIA 3TEWA 3DN7A 1VALA 5JZGA 1QU0A 3PUQA 4FXGB 4W65A 4JDOA 5E1RA 4LO6B 5A3PA 1YI9A 2QVSB 4CPBD 4LKFA 1JYNA 1YI7A 2XUEA 2X53S 5I8YA 2XPJA 1O6UA 2WSUA 4PDWC 1ODNA 5EJZB 3SXWA 3S7EA 4LKSA 4XDOA 3VKNA 2WIIB 3IB3A 5B4XA 1WCQA 2K46A 3JCIA 3WNNA 1NA1C 2YPDA 2JIJA 3NV1A 4K3UA 4FAGA 3WV6A 5T5LA 4FOQA 4M3CB 5FR3A 1V6KA 1VBA2 1VBD2 2C0ZA 3FWEA 2C9KA 2J1VA 4LBLA 3WCRA 3WD5A 4AVSA 4D7SA 1D4VB 1ZBE2 2ZHMA 5HV0A 3Q8FA 5E88A 1AX1A 2NLRA 5FP3A 4Z2AA 3ZFFB 3WDWA 3ZOIA 2D3PA 1BEV3 2ZGKA 4DRRA 1AXZA 3VKOA 3ZFGC 1EAH2 1PGSA 3RS6A 4A4AA 4I2OA 1GP5A 1GMMA 2EXJA 2WS91 1GICA 4DXTA 1DDLA 1JXNA 3I3MA 1W2AX 4QX0A 1LHOA 4CDXA 2WWSA 3UESA 3DKWA 5HXVA 1A34A 4BWOA 2Z42A 4LBQA 1Q8QA 1P8JA 5K7PA 3UJOA 2W9XA 1DZTA 1SMVA 2WA3A 5KBFA 1I3HA 3CHXA 1NYWA 2ZA9A 4JRLA 1GZ9A 4OI0A 2PFWA 2QTWB 2VMCA 2EXKA 2ZPXA 2GU9A 2YU2A 3QBQA 4QQHA 3GCWA 5GLZA 4CEYC 5FO9B 4YW1A 4CCDA 5EIYB 5BNOA 3OGSA 3I2JA 2H0BA 1REDA 1ZBE1 4AW7A 1ZZ7A 2ADEA 2YU1A 4LO5B 3RJRA 1GQPA 3RZGA 2XHNA 2UYAA 4IV3C 1LEMA 4XQWA 1N1VA 3HOBA 3WNXA 1MVEA 4Q4W1 3WG3A 2VZOA 4SBVA 4P5HA 4AQ6A 3I2GA 3T0DA 2ZABA 4B7KA 1CAUB 1Z78A 1RUD1 2ZGQA 2BUKA 1JZ8A 4RGAA 3MPBA 3KGZA 4MGZE 4MH0E 3FHIB 4LOSA 2VBBA 1QJEA 3LB9A 4JTOA 1C5HA 2Q8EA 4DUWA 3ASIA 4XOGA 1KGYA 2FMDA 3R05A 5HBAA 5LWBA 4R4ZA 2WN2A 3QD6A 2JECA 1QDOA 2BEOA 4Y33A 3S6PA 3S57A 2P3IA 3GM8A 2ADDA 1IS6A 3RZZA 4DXZA 1OQ1A 3VL8A 5DPNA 3MDPA 3OY8A 5JI7A 1H8TB 1JW6A 1OVSA 1KQRA 2VECA 3IDBB 1JOBA 2UY8A 3ABZA 3GF6A 1GWLA 1QOTA 3N9OA 3O14A 1TMF3 4XCBA 1GQHA 1OF3A 3LWCA 5DAWA 1U5XA 1S0EA 4AOCA 1F2NA 4XFHA 4PQ9A 1RUC2 3ZR6A 2XG3A 2W1UA 4XHBA 1POV0 3D4KA 3VDDB 1UF2C 5CG8A 5FZ8A 4O65A 3K4ZA 4HOOA 4RFRB 2FDIA 2B39A 2A5ZA 5FQ0B 1V6JA 4L2NA 1KJLA 2ZEZA 1W6MA 4AAPA 4JC1A 1HIXA 1J1LA 1JZ7A 3U0ZA 3VD9A 4XZPA 3NJYA 1OLME 4YZ4A 1TE1B 1DU3D 2VNGA 1Y9GA 2WFF3 2VZTA 2A3XA 1W0NA 4AYUA 5C8WA 3HIFA 4QDQA 3VV1A 1ND3C 4Y1UA 1TME3 4YM3A 4LKEA 1DQ0A 2AC1A 2YZ4A 4HT1T 1K12A 4XHXA 3TYJA 3WUDA 1W39A 2V4AA 2XONA 1RUF3 2Y26A 3KGLA 1DG6A 4QU1A 1NKGA 4YW5A 5FZIA 4JGZC 4TTGA 2VZSA 3TN93 1AZDA 4WVMA 5FMBA 5HV4A 3E1F1 4NRPA 5CAZA 5A33B 3IAQA 5BNPC 1PO13 4HVOA 5DAPA 1SFPA 1AYM2 2KR2A 1GZCA 1OH4A 5E89A 3UJQA 4AXOA 3H42B 3EHKA 3AYCA 3A22A 1VIWB 1HLCA 3R4DB 5EV7A 4B4QA 4CU9A 3EQEA 4ZXEA 4IV1B 5FPUA 3JD73 2VMFA 4MGTA 2AGSA 1RUI2 5IAXA 5ABJC 1AR61 1A78A 5JUVA 2WWJA 4M0HA 1UMIA 2LROA 4KBBA 5DG1A 3AMHA 3KV9A 3IMMA 2FDKA 3APBA 1O5UA 2JD9A 4OQ8A 3I2DA 1UW8A 1GNHA 1Z7S2 2QFEA 4O61A 5CNAA 4WM7B 1UOBA 4ZONA 4WVZA 3ZXEA 5H9QA 1ULCA 4IGQA 5FY0A 1Q8PA 3BGAA 3ZYHA 2HWD2 4AZZA 2R32A 3M2MA 4CUGA 1O3SA 4YFWA 1AF9A 2NZ9A 4KWJA 5FP9A 1H30A 2Y6FA 4E8DA 1PMIA 2VNVA 2V73A 3N9NA 4P14A 5L19A 1AYM1 3CL1A 3WDUA 1OLMA 5JZGC 2FDJA 2WNUC 2WT2A 4OVEA 1JS9A 1US3A 3GZTB 4BH9A 3O1PA 4BK4A 1N47A 4CDQB 1G7YA 5K0UA 2BWCA 3WG1A 1PIV2 1W28A 4FPOB 2JICA 2CTVA 2IZWA 2WZR2 1MS8A 1DYOA 2VQTA 1VRH1 3KQ4B 2W3JA 2D40A 2EA7A 4LE3A 2YHJA 4FFHA 2FDFA 3LOBA 4FFIA 4C0BA 5HXMA 1GYKA 1GZTA 1ENRA 4XF4A 2F4LA 2DVGA 3I3QA 1AL0G 3TEXA 4B1MA 2SLIA 1FOD1 4Q0QA 5FZ4A 1Z7S1 3OBRA 2HWE2 3WVJA 5GZFA 3ZXDA 1JYXA 3ES4A 2XH6A 2D97A 5FYZA 1QWRA 1CJDA 2W08A 2D5HA 3RNSA 4B7EA 4BOWA 3VBOC 5L9VA 4JQTA 3N4MA 2HWD1 3UL2A 3W20A 3UKVA 5FXWA 4IE6A 1S0BA 1O3QA 3VBUB 5JAXA 2D6LX 2PLV2 3I2FA 3KB5A 1BMV1 2JDNA 3CLPA 5GLWA 4HANA 4R8HA 3ACGA 4ZPIA 5JWPA 2YC2A 4MYEA 1X8MA 2VVEA 5D8AA 4B8EA 2A6WA 4XETA 1XNTA 1OF4A 1RIRA 1QMJA 4IEQA 1EUTA 2VOKA 4Q2FA 2Q1FA 1PIV1 3VKLA 1OUSA 5FO7B 4LA2A 1UU6A 1I5ZA 3AKQA 3HT2A 4GJZA 1VBB1 3VBSC 3N9LA 1WMEA 3K2OA 1OLQA 5LK7B 3ACFA 1PMHX 4QPYA 4V2VA 3THCA 2WAOA 4RQPC 5C3SA 5CISA 2K0GA 4ZU4A 3Q8EA 1G9DA 4M00A 4YVWA 3ZO0B 1HRI3 4CXXA 3AJYA 5FP8A 1VBE2 5A3OA 3CU7A 2VU9A 3HWJA 2R042 1AR82 3H1YA 1PX4A 1XU1A 3ZKUA 1W05A 2E53A 1UIJA 3FMGA 4LBQD 1RL3A 5A3NA 2XHKA 3CJIC 4JDMA 1PHMA 2GN7A 2GALA 2IXJA 4WM8C 3RQ0A 2PHFA 4XUPA 3ZKYA 1ENQA 3VBHC 2P3KA 3LPGA 2HWC3 1S0IA 3T08A 1X7NA 5H9SA 2JG8C 1IKQA 2DWRA 2KD7A 2PHDA 2PYTA 3QLQA 1CN1A 2BYVE 4NHLA 2HEWF 4KWLA 4LHLA 1DLLA 1U5ZA 2WA4A 1ODMA 5F8PA 1JYIA 1KRIA 3WW3A 1RUG2 2GMEA 3H1WA 3ZSJA 5KHKA 1QH6A 2WO3A 2XUMA 4I3PA 2BFUL 2HBUA 1BKZA 3PVEA 4PI0A 3O1MA 3VHNA 2X05A 2F4PA 1QGLA 4QGMA 4CCMA 1XQNA 5FYTA 5HCFA 4DO0A 3ME2A 3NNFA 2WNEA 4IL7A 3V0AA 3J7NA 5FZBA 2YFUA 1QJFA 4CU8A 2FBEA 1DZRA 4GULA 4YG3A 2XLAA 2EVXA 1QOOA 4FXKB 1SG3A 4RA0A 3WSOA 2OVUA 1L7RA 1PGW2 3HBZA 4HKOA 5EJ1B 2R041 1CZSA 1X8EA 3JBG2 5L7OC 1JZ2A 1Y4WA 4BJ0A 1K5MC 3SMHA 4AEDB 2FQPA 1BVVA 2I74A 2K2SA 4AI8A 3ZPOA 1I5PA 2NYYA 4KWUA 4ZXKA 2XJSA 2OPKA 1XOYA 5A7NA 3LCPA 1FPN2 3HVDA 5LBEA 4Q4Y2 4RR3A 3RWNA 5DDJ2 1A8DA 1F31A 4AG4A 3HAGA 4BQ5A 5JLVA 5L73A 3POIA 2FMYA 2PHXA 3B01A 5KHHA 5A7OA 2Q1MA 5DAQA 5LRRA 4LLOA 3KV5A 5KR7A 1R1A3 5FZHA 3PIJA 3VD4A 3M3OA 5T5PA 3LPFA 2VMEA 3IBMA 5FWEA 3VD3A 2QQKA 2RS33 4FI9A 5FLHA 3V0BA 2QQVA 3AP6A 2PXJA 5FPBA 1K45A 3ZMNA 1J1TA 1PVC2 4Q0UA 3U10A 2OA2A 2BPA2 3AL6A 2ZAAA 1H8TA 3UNPA 5AVPA 3MF6A 1SZBA 3LEKA 1V6NA 3KCYA 2CWMA 3O5SA 2J1SA 4A6OA 5JOZA 4PIXA 2VO5A 1C4RA 1SCRA 3NNLA 4PT6A 3CQOA 4RYDA 4JKLA 4UWDA 3IDEA 2EICA 1V0AA 4RHV3 1FX5A 5GLTA 5LEJA 4GH4C 4GKYA 5J37A 2AUYA 1W6OB 4HKWA 4QPGC 2E26A 1AR91 3KD4A 5CFDC 2XJVA 3DPRC 3I2OA 2RM22 2RS53 3AYEA 1HW5A 1R093 4Q4Y1 3I54A 4Z2WA 5DDJ1 2NP0A 2VOVA 4Y4YA 5A6QA 1KJRA 3VZKA 3B5LB 3QOPA 3T4VA 2XB6C 2QQLA 1R082 4D6SA 2TEPA 3S5AA 1HRV1 4MSVA 3OG2A 3PU8A 4XMAA 2MEV1 2CWSA 2AENA 4FP2A 2VTXA 2DURA 3PUSA 5JOWA 1U0AA 4DXRA 2D6OX 4HXCA 3POFA 3AYAA 4XPVA 1JODA 4XTMA 5GKAC 5AVAA 2Q8DA 3NV4A 3K4AA 1XE8A 1UY3A 3T4HB 5ACA2 5K0UC 5C6CA 1WMDA 3BCWA 1Q56A 5FXZA 1OT5A 2WNVC 4EYUA 3NAPB 4DINB 1KITA 2BGOA 5T52A 4BISA 3DUIA 1QJU2 3ZN5A 2D6MA 4JRAA 3VDAA 4CDXB 1ULGA 3LD8A 3W5NA 2WS93 1QH7A 1SLIA 3JU9A 4LBQB 1D2QA 1AJKA 4OI4A 3T2OA 1PO22 2R073 3ZXKA 5FMOS 3VZMA 3BU0A 1VB4A 2O0OA 2ATFA 5F3CA 2DBIA 3MYXA 3UT0A 4AGRA 3E97A 2OUHA 1R081 3TRSB 4A7YA 2ZS6B 2DBNA 4XYXA 4Q0SA 5GZGA 1QQP2 1DCSA 3LOIA 5FXVA 4DEVA 5LCWL 4H7LA 4KG0A 3KS7A 1JUHA 5CIRA 1ZA4A 3ZN6A 1QIQA 1MEC2 5BNOB 5C3QA 1KD7A 3M3IA 4HONA 4FQ4A 3KMHA 2VTFA 3OEBA 1QJX1 3O1RA 1W2UA 3MFCA 3P3PA 4QQPA 2DU0A 4K1ZA 4A41A 5F7UA 1ZBE3 4CCKA 3BI3A 4EN0A 3TNPB 2JDUA 2GP5A 4U36A 3DYMA 1JHJA 4CDWB 2E7QA 4JKKA 4N7IA 1UKRA 1OPMA 4Q4W3 4K21A 4AAXA 2YGLA 3AMQA 2D6PA 1RUD3 2GNBA 1LNSA 4Y3OA 4AQSA 4EZHA 4OUEA 2RG4A 5LY1A 2VUAA 4QD2A 2X10A 4TXWA 3BIEA 1DGRA 1PZ7A 1RVF1 3I4IA 1WMFA 4GMP0 5JR7B 3I59A 4Q1RA 1AR72 2P2KA 5T3NA 3SEEA 1L7QA 3OY8B 5I0SA 4WV8A 3LKJA 1RUE1 2UY9A 3WT3A 3ZFFC 4MOAA 4BU2A 1AL23 2VZ3A 1EV13 1GFF2 2XR4A 5C3PA 4G3YC 1MS5A 2BNMA 2C5DA 2OQ6A 1AX0A 3ES1A 5EXOA 2DCZA 4MGSA 1W6QA 1VAMA 2AACA 2ZGNA 3HQUA 4PI2A 5LASA 1O91A 4IESA 3LAGA 1XSRA 2W52A 4P9LA 2PA7A 1K42A 3FL7A 1JOJA 3CNAA 4P08A 3GBFA 2ILMA 4MGKE 1DYPA 1DQ1A 1SBEA 2YUEA 3IPVB 4B4PA 2WWUA 1N1YA 4OZOA 2RDNA 4IE0A 3P5BA 1D0GA 1W6MB 3PVOA 4DY5A 4YZ1A 1HXS1 3BN6A 4WZFA 2DTWA 3USUA 2O8QA 3FHQA 4LUKA 2IXCA 1XPWA 1OQEA 5GALA 2W39A 3VN4A 4LT5A 4CCOA 4ONUA 4IQPA 4YZ3A 1F9KA 1BBT1 4XJUA 1MZFA 1S2BA 5FK8A 4FAHA 3RI9A 2E63A 5DUUA 3ALQA 4MUVA 5J1XA 1B35C 1N3PA 2D43A 4WVMB 1MZEA 2OXBA 1AR71 1MS9A 2WSVA 4OQ9A 1GQGA 2RVAA 1JYCA 2WABA 4BXFA 1MR5A 2VE1A 5FP4A 2Y6LA 5FPZA 4CEWA 4QAWA 3BOWA 2QDRA 2TBVA 4Y5SA 5BY5A 4LUMA 4YPJA 3ZYGA 4XF9A 4N9HA 5C71A 1AHSA 4QPIA 3AVRA 5I0RA 5FREA 4FPCA 1ZRDA 1CX4A 4OYUA 3ZSKA 2V09A 1Y43B 1Y9QA 5C7GA 5IK8A 1H0BA 1HN1A 3I8TA 1AR63 3C7EA 5LA2A 1JYVA 2OX0A 2JWPA 5JDBA 5JOXA 3QH6A 2HWF1 1MVQA 1NCRA 1IGOA 5KHJA 1U5YA 1VLNA 2R6QA 2PELA 4K20A 1YFUA 3ENRA 1ENXA 5JIUA 3BTAA 4YG0A 4Q1PA 3J7HA 3LQCA 2DCYA 2YBSA 3D5OA 4MV2A 3UKNA 1WW4A 4P00B 1X33A 1PM4A 1F5FA 2PHTA 4N43A 2IVIB 1LHNA 1AYN1 1UMZA 1O4ZA 1ONAA 3M7AA 3HN1A 2IXKA 4NHMA 2A75A 3NL1A 4UXAA 3VDDC 1VBC1 4CU6A 2BTVC 2GNTA 4UBGA 4YZ5A 4JCKA 1Y3TA 5DMYA 1B09A 3PTRB 5K4LA 1J58A 2W47A 1NXMA 2R0FA 2ZTNA 3OGJA 1W2TA 5JR2A 4XFIA 2Y60A 3PHMA 1UO9A 1URXA 4OHZA 4XFGA 2GDFA 1RB8G 4QB1A 3IMNA 3KVAA 1VRH3 2HWB2 4NHXA 4XVHA 5GZDA 3ON7A 4ZHNA 2R49A 3LIHA 4CU7A 4COWA 2JKXA 4IEUA 5C3RA 4PF1A 4Q8LA 4WVWA 3ZYFA 4QX2A 2JENA 3FHAA 1C8M1 2D5FA 5A7WA 3W59A 4A44A 4ASMB 1FOD3 1J3RA 4RGKA 1NE4A 2WFPA 4DUVA 5A6ZA 1Z7S3 2RJLA 1VB2A 3F2ZA 1RUJ2 2Q30A 1Q8SA 1W2NA 2H6BA 1IG0A 4FPFA 4IV1C 4K1YA 4XJZA 4CCNA 1QY4A 1LOFC 5FY1A 4BMEA 1W8WA 4LK6A 4BQXA 2XGXA 5A80A 2IWGB 1FNYA 3H0OA 2YPJA 4LBMA 4YM2A 4AVTA 4CCEA 3A0NA 1ZREA 3AZWA 5FZAA 3JXSA 2DFBA 2YFZA 5F6LB 1LB2A 4QQOA 1X9PA 5D8AB 1CAVA 4NOTA 2D3RA 1ULDA 3GNEA 5C8CA 3GXUA 1NE6A 3AKPA 1U5IA 4WM7C 1DF0A 3NKGA 3ILRA 3I3DA 4XAEA 4FPHA 2ZX0A 4META 1PIV3 2DV9A 4NPMA 4BE3A 5IVEA 3KCXA 2VQ0A 2XJPA 1VBB3 1LODA 3L2HA 1DBNA 3M1HA 1OOPA 2WUHA 4LBOA 3ZYIB 2JX9A 1ZZ6A 4LEJA 4YVWB 4OI1A 1MZ5A 1RJ7A 1YXWA 4G9SB 3IDAA 1DQ5A 5C4WA 1WMXA 3IZOA 4HK9A 5I0UA 4EV0A 3AMPA 5J3UA 1ZA7A 4Q4V2 5T54A 4LTAA 4E4HA 3WP4A 4D7TA 3AVSA 3GDBA 1H2KA 2DVAA 3NNJA 1ULEA 3BUCA 4CDQC 1SCSA 4C1WA 2B5HA 4GMP3 4EN7B 4L9BA 2WBKA 1ZZCA 4AFCA 4A7KA 3NAPA 3MLJA 5C9AA 3DCQA 1CPMA 3ZYPA 3NW4A 1FMD1 3H8OA 3WNKA 3OPTA 1WD4A 5EP9A 2DVBA 1CESA 1GP4A 4GJYA 4V1PA 1W3VA 1C3HA 1SDWA 5BUVA 3RSJA 3IAPA 4KBZA 5F39A 1T6GC 3PUHA 2GMMA 3K77A 5LY2A 2RMU2 2TNFA 4QQ2A 1V00A 3I2KA 3WG2A 5JVVA 1VPHA 3BU7A 3FZ3A 4XDQA 1D4M2 2YXSA 2B8MA 2W46A 4AHZA 1CONA 3SH4A 3V0AB 3MPPG 1C5IA 1RHI2 3BVCA 3BYWA 3O7OA 3VBUC 3POJA 1GLHA 1I1EA 2F6BA 1UAIA 3NWKA 1R1ZA 1VBA1 1VBD1 3FUOA 3TWIA 5AC92 3T0BA 2XKPA 1LHVA 1SLBA 4XE9A 4Z8BA 4LULA 2BBAA 1UOFA 1CX1A 3P3NA 3UGFA 2PQSA 1FV3A 4B4RA 3OUIA 3SNMA 5IFPA 4E4DX 2FDGA 3EYPA 4E9KA 4CDWA 4OULA 2HJIA 5FMCA 3BPSA 1WLWA 3C8XA 4ISRA 1MQTA 2ZAHA 4RR3B 2VZ1A 2OW4A 4MVTA 1RUNA 1QHDA 4I3GA 2WAAA 1EUUA 1EAH1 4XUTA 4AVVA 3I7DA 4E27A 2FCVA 5CU1A 2ZX4A 4ZKTB 2IFRA 2VMIA 4JQRA 4XQDA 1KEXA 4W6WA 3V0BB 1O4TA 1GOGA 1UNBA 2V5YA 3MFAA 3H8XA 1UU5A 2J7MA 4Z82A 4UW5A 1IOAA 4NHYA 3KHBA 1ASJ3 4BYYA 1CIYA 3T2QA 1IS3A 4QDSA 5A3TA 2FZ1A 3T3YA 1LGCA 4EN6B 1D4M1 2BWAA 2VAUA 4OHVA 3MW4A 4HL0A 4HMZA 1RHI1 5D1IA 4FSJA 3FFQA 2DF7A 5GZCA 2PHLA 1VAKA 1YWKA 5J36A 3TEZA 5HCAA 4HKLA 2VY0A 1ULOA 4A45A 3J26N 3ZYJB 1LENA 3LA7A 2C24A 2KA3A 3N3HA 4Y26A 3WDYA 4KNCA 3GBGA 3SC7X 5FZ1A 5FPAA 3ZLIA 3PLQA 3WZ1A 1JZ5A 1QNYA 1QJY2 4EN8B 3IPVA 1ZBA3 3N9PA 2VD7A 3J8F2 4XJAA 5EZWA 5FZDA 4IW3A 3NV2A 2HYKA 3KSCA 1AR93 3UGHA 2P17A 3GALA 2BFUS 4PF5A 4Q4Y3 3TOJA 5DUXA 2YC0A 4AEJA 4AGVA 4LIVA 1REFA 1KS4A 2QZ3A 3WQ7A 1ZZ8A 2PN5A 4GXLA 3OF1A 1HRV3 1M4WA 3O1VA 3G7DA 4GAZA 2MEV3 4MHRA 4XW3A 3V65A 4RS5A 4FOWA 4LJHA 4RN5A 5M0TA 4KL1A 4I0AA 1CR7A 2B7YA 3EXUA 4AEDC 2R062 4Y24A 1SFYA 4FPKA 5LBCA 4R9AA 3E6BA 1UZWA 3WF1A 1GZWA 5A7SA 5IK7A 2ZEXA 3OB8A 2E31A 4I01A 3MIGA 4AVBA 1OMIA 4IEZA 1SHWB 2XVKA 4RFT0 4QX5A 4AK3A 3SKJE 3J7MA 4Q4X3 1RUC1 3KWVA 3OGVA 5J09A 1AJOA 4KG8A 2XBO2 1WCKA 5KHIA 1O8PA 4HSJA 4N53C 1G8WA 4KGQA 4ZS3A 3WF4A 4DMIA 1JUIA 4E4ZA 3DF0A 3ACHA 4XILA 2ZX1A 5FK7A 5G05L 4Q29A 5DG2A 1JMUB 1VE0A 3WX5A 1OBNA 1DZQA 1W9YA 2BVVA 5JPNB 1UOJA 5KHGA 1ZZBA 3MICA 3AYDA 3Q9OA 3VZLA 1LAJA 2CNAA 2ZHLA 3B00A 3DV8A 1GU3A 1EPWA 1LR5A 4XXPA 1CVNA 1RUH2 4YNIA 2VQUA 5IK4A 1OPOA 1RMU3 1UOGA 4MHUA 4XBNA 3O1SA 3P6BA 1H2LA 1E5HA 2ZEWA 3VBRA 1R083 1W9WA 4XABA 1HB1A 3TB0A 3H3LA 3V64A 5HPOA 5IVCA 5T5JA 1UN1A 2ERFA 4GB33 1SQ4A 2BV4A 3ZN6B 4C90A 1NY72 3AJZA 3CBNA 4LIUA 3MIDA 4Y1VA 4A7ZA 5FOBB 4B3NA 4JKMA 2R061 2GC0A 3POEA
chains in the Genus database with same CATH topology
2GNMA 4XJ8A 1QJX3 3BOPA 3N7MA 4EWDA 2ZZQA 4Y1YA 4F3JA 3MW2A 5JMCA 4AFBA 1A6CA 3GHNA 4PLNA 4DQAA 3URFA 2QE3A 4XF0A 5GM0A 2XVLA 4WZCA 4ATEA 1RUI1 2XVGA 1VR3A 4KWKA 2D44A 4PBOA 3VLBB 4AEMA 4D69A 1BXHA 4IEVA 3I59B 2X5IA 1H2MA 1RVF3 4YGDA 3OJBA 1TNRA 4L8QA 1RUH1 1ZZ9A 1PNFA 1RUE3 1OA2A 5JI9A 1XYOA 3ZFEA 1W6QB 2Q1ZB 3GBWA 1UZZA 3LSEA 1NY71 3POYA 2WC2A 2IXLA 2NMNA 1BYHA 5SV8A 3A4UA 3AP5A 4CDXC 3GZAA 1PGL2 4YGBA 3ZYRA 4BLJA 1S0CA 1BEV2 3VHRA 1ND2A 3ZSLA 2DTYA 3USUB 2NQYA 3E5XA 3ZDSA 4AVCA 5JSOA 1M06G 2WZR1 1HXS3 1PZ9A 2CAUA 3PMEA 3H3UA 4P9YA 3AZYA 2GAUA 1GNZA 5HI0A 3CEWA 5BNOC 2PAKA 2G4IA 1PZ8A 1V9U3 1BBT3 5DZGA 4R4XA 2R0HA 3CJXA 1H1MA 4R9CA 1WD3A 2HWE1 3PVNA 4K8FA 5CA6A 1AR73 3ZN4A 4CEWB 4OFGA 4F7ZA 4CDWC 1XNDA 4YW4A 1HV0A 2QZ2A 3T2TA 4SLIA 4QPIB 4JGYA 1YCIA 3BIWE 5JIAA 1SACA 2QDNA 2HKXA 2PLV1 3E5UA 3THTA 4LA3A 4K6BA 2UWAA 1L3JA 3AZXA 4FPLA 1J59A 5FDBA 1OQDA 4L11A 3ROUA 1NCRB 2CGOA 2P3JA 2CAVA 1LOCA 3MLLA 3TBDA 3LZZA 4KU8A 1UU4A 1WW7A 2ETEA 1CPNA 3ATGA 1Q5OA 2HWF3 5FTTC 3N4MA 3AKSA 2A7AA 1BZWA 3SHRA 2ZGLA 2Z69A 3VHPA 2I07B 4JV4A 4N43B 1VBE1 3R4UA 1AR81 1AYN3 3USSA 2D7FA 3ELNA 1VBC3 1RITA 3FLPA 4P9WA 4IEXA 3PVBB 4IERA 3KM5A 4J6GA 5K8SA 4FPEA 1KS5A 3AP4A 1TMF2 1Q8OA 3VBFB 4C0HA 4JDNA 2XLGA 2NM1A 4COUA 4IEWA 1RUG1 2WZPP 3INAA 1NZCA 3PJYA 5GLUA 4PLOA 2B42B 4OHYA 1UX6A 1HQLA 2XKOA 3H7JA 3QH7A 2WFF2 2NPIA 1LOEA 1C8M3 1A3KA 1XNCA 1TME2 4ORFA 5KXBA 1I6XA 5DZEA 5EJ3A 2O1QA 2VH9A 4W6YA 4YFZA 3J4UH 1RUF2 1PGW1 4X8PA 4XMIA 4I30A 1COV2 2ZGPA 4BLIA 3TN92 3JBG1 4X6RB 2DFCA 1LULA 5LK5A 4CDUB 2DCJA 1CAVB 3U07A 1PO12 5C8CB 1A8MA 2GH8A 5FBZA 4PLMA 1FPN1 2SBAA 3WP5A 3SISA 1U12A 3ACLA 4GQ7A 2Q5TA 1TMF1 2PQQA 3AZZA 3TNQA 2LALA 5DZFA 3JD72 4NN0A 3WDTA 1OOPB 2CGNA 1AXYA 5F5QA 1Z0HA 3ZSMA 1RTVA 1PVC1 2DVFA 3IN9A 4S2GA 5C4WB 4QT6A 1NQJA 2BGCA 4X8NA 4MGYE 5FRAA 1REEA 3IWZA 3M3QA 3ZMOA 3JQXA 1W6PB 1H8VA 1MS4A 5FPXA 3K51A 1J3QA 1RUF1 5C9AB 1COV1 1SEFA 2WLQA 3MF9A 2WL1A 4YM1A 2A3WA 3O0WA 2JE9A 1LGBA 4J1WA 2XLFA 4XXAA 4OUMA 1S55A 2X29A 1FMD3 1PO11 3LA2A 5H9RA 2OYZA 2QJVA 2RM21 3OYWB 4AFDA 4EN9B 3ST7A 3RMYA 2UYBA 3ECQA 2ES3A 4LNVA 3JD71 3VBOB 4H14A 1NCQA 4E2QA 4Z07A 4H3WA 1S0DA 3L9JT 3B69A 1VJ2A 1VP6A 1WGPA 2ZGOA 1TQ5A 2BW8A 5T5OA 4YGCA 2JG9A 1VBA3 1VBD3 3FFZA 5D8AC 4YVSB 1CJPA 1GR3A 1RUOA 3WINE 3MW3A 3WY6A 5ACA1 1KFUL 3RI8A 3MEPA 1MQTB 1KDMA 3WW2A 3ZXGA 2A6VA 4PDWA 4FTSA 4FO9A 4I0BA 1QJU1 3O12A 4EROA 1EAH3 1WCSA 1S0FA 4CZSA 4CYDA 2OZ6A 4DOUA 2TUNA 1NA1A 4KGGA 1G6NA 4YVWC 1PO21 1DFQA 4IEPA 2BNOA 3SH3A 2AR6A 2QKDA 2VMHA 2BBVA 3IT8A 1W6NA 3PJQA 1QQP1 1JTZX 4EWEA 2QQPA 4PCRA 5FFOC 2R30A 4L97A 3ZFGA 1RHI3 3JQWA 1C1LA 1MEC1 3WLUA 1CAXA 4JTNA 1HRI2 2XWJB 2Z2SB 4GKXA 5I91A 1G9FA 4GA9A 3O0VA 3QCWA 3IDCB 4H55A 5J98B 3WG4A 2E51A 4AVAA 4XJWA 1HKDA 4XF3A 2JKBA 4HBNA 1LOGA 2IFWA 2HWC2 4M0NA 1EP0A 2ZZJA 4YZ2A 4Q27A 1H1AA 1RGSA 4CEYA 2C1FA 3B9IA 1MACA 2MNGA 3HQXA 4RS5B 2E7TA 4Y1XA 2NMOA 4BHPA 4IV3A 2O8OA 2H6CA 1GZWB 4S2DA 1QXPA 3M8LA 4RR3C 5GLVA 2LM3A 3W9AA 4FTBA 1LGNA 4O9GA 4YLZA 2Y0IA 4DRVA 4OLLA 1YLLA 2IXIA 2ZJCA 3D8CA 2Q8OA 1YFXA 5J96B 1RUC3 1V70A 3RPQA 1DHKB 5BNNB 2YYOA 2WKKA 4LBKA 4TZDA 2ARXA 4HVQA 1LRHA 1SLAA 4AF9A 3D6EA 4QGLA 1ZVFA 5L36A 1OFSA 1H8TC 4QGNA 5H9PA 4F83A 4FP3A 2ZMLA 3CF6E 3VBRB 2Y0OA 4NWVA 1R1A2 2VW2A 3ZSEA 3N7LA 5I8TA 4COZA 2RS32 2PAMA 2R1BA 3WHUA 2QNKA 1QXRA 4GH4B 2YDEA 4YYOA 2FZ2A 2YGMA 5SV5A 4O9EA 1XXNA 1OA3A 1QJZA 4Y5Z0 4FCAA 4GWMA 1POV1 5KWRA 1AYM3 2VOWA 2UWCA 1WBLA 3BALA 3FLRA 4AFAA 4Y20B 5EYXA 1ND3A 2VOXA 4FBFA 4AHXA 1N1TA 2DVDA 3C3VA 3VBFA 2H0VA 3O0XA 1Q8VA 1RUI3 1YUDA 4RHV2 2KM2A 2PAEA 4JGZA 5FLJA 2X5IB 1HV1A 2VW0A 4YGEA 2ZHNA 1SBFA 2IC1A 4HN0A 2RS52 4W6XA 3N35A 3KZ4C 2AH2A 4E4SA 1MZ6A 2DUOA 1R1A1 3ZFEB 1KXGA 1ZRRA 4FT8A 3D0JA 2EAAA 3WUCA 3AP7A 4PBPA 2HWD3 2NN8A 1LU1A 4OUSA 4RSUA 1ZM1A 5ABJA 1OLRA 2A6ZA 3EJKA 1IZ3A 5FMOL 1NXD1 4L92A 4ITCA 4AI0A 1D0HA 4CDUA 2GN3A 1X50A 1ND2B 1SLLA 1YNAA 3R0RA 1ZNPA 3NKTA 4PIYA 4X6QB 3HT1A 1H2NA 2Q4SA 4XFBA 3KT1A 3V56A 3NSTA 5CG9A 2WZR3 3SCHA 2HWB1 2BNNA 1V6LA 4I09A 2WS92 5A32A 2A6XA 2R072 3ZIWA 5KXDA 4XBQA 2WNUA 4P9IA 2WQZC 2HWE3 2IXHA 2VNOA 4Y22A 1RUJ1 4BMBA 1W6PA 2GC1A 5JOYA 2VG9A 4JGYB 4AQTA 4NPRA 1QOSA 2CYFA 4Z1VA 1UL9A 1H9PA 1RC6A 1C1FA 2D3SA 2PLV3 2EXHA 3B94A 5I0TA 2CY6A 4RL7A 3H7YA 2DUQA 4HZFA 5I8SA 4PJYA 5DXDA 2D98A 4TWTA 1LHWA 1YHFA 2VGDA 3OYWA 3DGTA 4BZ4A 3PNAA 5T55A 4Q4W2 1XU2A 3AXEA 3WOGA 3VBOA 1RUD2 3RYPA 1DYKA 1MS3A 1H4GA 5GJ6A 1GKBA 2RS12 4KQ7A 4ATFA 1SLTA 1HQNA 5J48A 1QF3A 2R071 4MX3A 3ILFA 4S2HA 3H9AA 4KH9A 1VBE3 1ULFA 4Q4V1 2OZJA 4YVSA 2R043 1AR83 1AL22 2LTNA 2XL9A 4QM9A 1EV12 5K9YA 2AYHA 2ZGSA 3THPA 4AFMA 2E6VA 3T1LA 1ZRFA 1XYPA 4OZXA 2DCKA 4Q0PA 3VBSA 1CGPA 1X82A 3JB4C 4A3XA 2HEYF 1PK6B 1BCXA 2GC3A 4RQPA 3WR0A 3ZX7A 3WHTA 1B35B 4QM8A 3ZPYA 2ZOEB 4XF1A 2OIIA 3OBTA 4FPYA 4INDA 1RUG3 2RMU1 4CEWC 3NVCA 5CBLA 4E2GA 1WLDA 3CJIA 4UW6A 2A73B 2GH2A 4QPIC 4WM8A 5EYYA 4GALA 3VBHA 2RS11 2ZHKA 4AGGA 1HDKA 3IKWA 2PTMA 5AC91 2JG8A 1BJQA 1Y7BA 4K9SA 3AB0A 4HFSA 5C33A 1W0PA 1PNGA 1SBDA 3VZOA 3JBG3 1AL21 1EV11 1NCRC 2MHFA 3N7KA 3VL9A 3AKTA 1C8NA 2EIGA 1FPN3 4JVAA 3MIFA 5DDJ3 1O3TA 5CFCB 4LO7A 2D93A 2B9UA 4N43C 4K7JA 1NLSA 2CGPA 4XTPA 4QU2A 4CP0A 4XIKA 3VGIA 2WT1A 3VHOA 1AR62 3N36A 4LHKA 5L7OA 2ET1A 2WT0A 1K5MA 1PVC3 1ZX5A 3WDVA 1N3QA 4HN1A 4YG6A 2R1DA 3WQ0A 5FOJB 2JJ6A 1JN2P 3CO2A 3FBYA 1IPJA 1ZYBA 4M3CF 3VBFC 4LLFA 5E8AA 1LESA 4JAAA 4URTA 5IUQA 5DUWA 2XJRA 2RR12 1GANA 3J9SA 4I02A 1COV3 4ZU5A 1IS4A 3OGGA 2ZGMA 1QJY1 5E16A 2YMZA 5BNNA 4FQZA 3J8F1 3WP3A 2VULA 1NLRA 4AHWA 1CD3G 2VVFA 2RM23 4HLTA 3UV9A 1IS5A 4FOVA 3NO8A 4IEYA 1O3RA 2E9QA 1NCQB 3HR9A 1DIWA 3MGUA 5DUVA 2JEMA 4PIZA 1G9AA 2K9ZA 2WQ4A 2I45A 2XL7A 3FX3A 3B7MA 4MXWB 1VRH2 2Z5WA 2CL2A 1N1SA 3GHMA 2JG9B 5FAXA 1YYNA 4AI2A 4GH4A 4CDUC 2PHUA 4LBNA 4QPGA 5EFUA 5C8CC 5FO8B 4OHWA 5CFDA 3DPRA 4D7YA 1FOD2 2EAKA 4WBBA 3A0KA 2Q0AA 5ACA3 4PDWB 3FUQA 4BPZA 2WINB 4Y20A 5LEKA 2XBO1 1KDKA 2RR11 3H50A 5KXCA 3ZXFA 4EWAA 1OOPC 1NA1B 3ILNA 1QJU3 4OI2A 4XQ4A 1BMV2 3C2UA 5C4WC 3AMNA 2VNRA 4QQLA 2ZGUA 3E6CC 3FC0A 1MS1A 2ARBA 1PO23 4M3CE 4BIOA 2JE7A 1S0JA 4Y1ZA 1IPKA 3VKMA 4DNYA 2FHRA 3M3EA 4YRDA 1W6NB 1J3PA 1DQ2A 3N7JA 1OKQA 3BODA 1WLTA 1HQWA 4FPGA 4GWNA 5I0SA 3U4XA 1QQP3 2WNVA 3NAPC 3HMYA 1VBB2 3ZFGB 5C9AC 1O4YA 3AX4A 5TSWA 1D2SA 3MI8A 1ZRCA 3WXPA 2QUOA 1CAXB 4WVVA 2EF6A 1MEC3 5KXEA 3MLKA 4MXVA 3RMXA 4FVVA 5JSPA 1DQ4A 1DGLA 1UZYA 1JBCA 2ENRA 2B46X 4XFCA 4NR1A 4IEOA 4AEKA 1JH5A 1YFYA 3BB6A 1WBFA 2BQPA 3M3CA 2YROA 5LRSA 2P34A 1FYUA 1UIKA 2MPFA 4LHNA 2X8KA 4CEYB 1GV9A 1LCLA 3GZUC 3IM0A 1UPSA 2GZWA 1YO8A 1BQPA 2ZKNA 4OHXA 3SH5A 3GYDA 4HK8A 4LO8A 3WCSA 4DY3A 4YVSC 2CV6A 4IV3B 4DS0A 3AK0A 4AHYA 3B93A 1LECA 1MQTC 1EY2A 1SLCA 2VW1A 4LE4A 5BV6A 4DFSA 1H1IA 1QDCA 4AWDA 4Q26A 2A70A 1TNFA 4YW2A 1PGL1 2N7GA 5KC5A 2XJQA 2VMGA 4M3CA 1ALYA 2I2SA 4R9BA 1OHFA 2VUJA 1BEV1 2E7AA 3SCFA 1WLCA 1C57A 2WLPA 3ZFFA 2RE9A 4GMP1 5BPXA 4DZGA 1H4HA 4DB5A 3R6SA 1E57A 1OSGA 4NVPA 5AFEA 3OD0A 1YIFA 5EWSA 2GNDA 2DUPA 4NWWA 4ZU7A 3WW1A 2ZX2A 3B9CA 3IIAA 4LR4A 1IHMA 4RD7A 4XEZA 3LSDA 2QCSB 4AI3A 1ASJ2 3WW4A 4P9XA 4NHKA 2DCTA 1LEDA 4ES9A 1LOBA 1POV3 1Q43A 4J1XA 1LKNA 3RRDA 1ND3B 1V6MA 1XYNA 2YY1A 3S0MA 1G9CA 1PK6A 1MS0A 2KXLA 4JGZB 1B35A 1H9WA 4RS5C 1BVP1 4HPKB 3U11A 3WP6A 1ZBA2 4CP2A 2ZGRA 2UWBA 5BNPB 1Q3EA 1KFXL 1AR92 1CQ9A 1XNKA 2XWBB 3E6DA 4ISQA 1CAUA 3RG0A 3E5QA 3ETQA 5CB7A 2JD4A 4COVA 1LOAA 2G9FA 4HSLA 2RHPA 3AKRA 2ZBJA 1HRV2 5ABJB 2D6NA 4N53B 3FLTA 2MEV2 4BIFA 4P9GA 5BNNC 1ASJ1 4RGGA 4QMAA 4UW4A 2W0XA 3RYKA 4YM0A 1QXJA 3D0SA 4M01A 3UKTA 1LJ7A 2UURA 3KT4A 5JSRA 3AM2A 3VBRC 1S1AA 4Q4X2 5CFCA 4CP1A 3AZVA 3SCGA 1CAWB 1V6OA 5A32B 3S30A 3JB8A 3VDDA 1ZBA1 2HWB3 3MZHA 3OCPA 4K40A 5FQ0A 3BPZA 1JHNA 3S7IA 4COYA 2WNUB 3KCCA 2ZCWA 4A2UA 5JZGB 3KT7A 1XNBA 2WFF1 4TSVA 5BNQA 2XJUA 1RMU2 4Y22B 1TME1 4XFFA 4EJRA 1RUJ3 4QHBA 4GB32 2VPVA 4G4FA 3TN91 2ET7A 3KQRA 5HCBA 5F9TA 1UCXA 5F1RA 4S2FA 1V6IA 3WQ1A 1GBGA 1WA4A 2X5IC 3POSA 1FV2A 2HEVF 1QJX2 2ZX3A 5A33A 2BVBA 3ZXJA 3SLIA 1BK1A 4Q4X1 2VXRA 3ZFEC 3OD4A 4MLOA 3LA3A 5B2GB 3ZVXA 1DGWX 5JCTA 4IV1A 1LOFA 2VVDA 3FBMA 4MXWA 4B29A 1UKGA 2DU1A 4UW3A 4XJ9A 1RVF2 2B45X 4D3WA 3K48A 1VAVA 2AREA 1RJ8A 4Q8KA 5CVRA 1RMU1 4Q4V3 2GMPA 1ND2C 4R52A 4MZUA 3VUOA 3JUUA 2Y38A 1RUE2 3FE5A 2ZGTA 1N3OA 3B3QE 3HD8B 4WM7A 1LTEA 1YRZA 3TAYA 3VKFC 4GB31 3VBSB 1NG0A 3EBRA 3ZIXA 5AFBA 1DQ6A 3VZJA 5F6KA 5BXXA 3X29B 4AI1A 4CRQA 2PHRA 4RQPB 1WCDJ 2P37A 1XE7A 1YJLA 3W58A 1FT9A 1S2KA 3NJZA 1AX2A 2C9AA 4C1XA 1DGRN 3PTYA 4D94A 4FOYA 2RMU3 3B02A 3CJIB 3H1MA 4WM8B 4CTEA 4DPNA 1HXS2 4CDQA 4C91A 4JGYC 4LO4B 3VBHB 1D4M3 1YJKA 2A6YA 1F8VA 1CIWA 2JG8B 2RS13 4NO4A 1V9U2 1W0OA 1BBT2 1ENSA 4TLFA 5AC93 1IQAA 4AQ2A 4BCUA 4FTEA 5I93A 2GSYA 4LBJA 4FPJA 4MGIE 1DGWA 1G86A 1GSLA 4UBHA 4F8AA 1G9BA 1I9RA 4YARA 1WW6A 3VBUA 2ZMNA 1EPZA 1APNA 1LHUA 2YV8A 5L7OB 1FXZA 3WDXA 1QNWA 1K5MB 2VQAA 3POWA 2XJTA 3AXDA 2HWF2 1O5LA 1PVXA 3QACA 3JZVA 3AFKA 3PMSA 3MIEA 3R4SA 2JDZA 1AVBA 2W68A 2Z79A 3H3ZA 1V9U1 4KU7A 1HRI1 1NOVA 1PK6C 4QXKA 4BQ1A 1AYN2 3AP9A 3M4FA 2ZACA 2OUJA 1VBC2 1QJY3 1YIPA 3J8F3 1OI6A 1OFNA 2A3YA 2HWC1 1AUYA 2G9GA 1SFNA 1YFWA 4HVRA 3D82A 4Z92B 4IETA 4N90A 4I0WB 5IK5A 4GIQA 3FJSA 3KLSA 1OD5A 3T1MA 4E2SA 1NQDA 4QPGB 1AXKA 2R063 5CFDB 3DPRB 5FCCA 3AFGA 1OA4A 2WJSA 1C8M2 1FI2A 3OTFA 5GZEA 4XIOA 5T50A 5CFCC 1F5JA 3UK9A 3ZXLA 3LGRA 4IXLA 1WW5A 2XBO3 2RR13 1WUVA 3G6JB 3RYRA 3AMMA 3DL3A 4R9DA 4HPKA 3NV3A 2UU8A 4AEDA 1PM7A 5A3LA 5BNPA 1R092 4N7UA 2R16A 1O7FA 4N9IA 4YW3A 1EYBA 5K0UB 1LU2A 3L2YA 5KC6A 1RUH3 4XFAA 1RINA 4ES8A 4YSFA 4Q0VA 5JPMB 3SITA 4BM8A 4XBLA 2WNVB 4AE2A 3H8UA 4HETA 3MIHA 2RS31 1X36A 1XRUA 1FNZA 4H7MA 4ASLA 4N53A 3RJ2X 3ZXAC 5IT6A 3OPZA 2RJKA 3MIBA 5FLIA 5BYNA 3RDIA 1TEIA 2A71A 4BA6A 3EO6A 1UD1A 4L99A 2LUWA 5A3MA 2JXAA 2EALA 1NCQC 4P9JA 1S0GA 4TYSA 3M70A 1C28A 2ZKLA 1FAYA 4RHV1 3VZNA 1UPIA 2ZMKA 2DYCA 5J7MA 2PHWA 1QKQA 1CAWA 4U2AA 1FMD2 1HX6A 2GC2A 2JG9C 2D6KA 2AZ5A 2RS51 1IKPA 1W6OA 1R091 1FATA 2EXIA 3DN7A 1VALA 5JZGA 1QU0A 4FXGB 4W65A 4JDOA 5E1RA 4LO6B 1YI9A 2QVSB 1YI7A 5I8YA 2X53S 2XPJA 2WSUA 4PDWC 3SXWA 3S7EA 3VKNA