3FHIB

Crystal structure of a complex between the catalytic and regulatory (ri{alpha}) subunits of pka
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
150
structure length
150
Chain Sequence
RRRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Crystal structure of a complex between the catalytic and regulatory (RIalpha) subunits of PKA.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 36
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3fhiB01
5FLHA 5LRSA 2Z69A 2KXLA 1IPKA 4UBGA 4O9GA 1J3QA 2XGXA 4I3PA 4K8FA 3WW2A 1YFUA 1CX4A 3KGLA 4QGMA 1ZZ9A 5D1IA 3E97A 1LRHA 4I02A 2UYBA 3ES4A 3MPBA 4HMZA 2BNOA 4KU8A 4KWJA 1O3SA 4BHPA 2XKOA 5BPXA 1CAVB 2B9UA 2ZCWA 4HVOA 4MGKE 2EAAA 2Q4SA 5I8SA 3M70A 1FI2A 4X6RB 4LEJA 4YYOA 1DZRA 3DN7A 1LR5A 4J1WA 4HN0A 4AVCA 2BYVE 3OD0A 4LULA 5I93A 5BUVA 2Y0OA 1UCXA 4PJYA 4GULA 4D7TA 1SQ4A 2OZ6A 4QM9A 2VPVA 4KL1A 3DKWA 4QGLA 1J58A 2IXHA 2QNKA 3OF1A 4E2QA 2GC2A 4Q0VA 3PVBB 5FQ0A 1RC6A 2IXJA 1UW8A 5LEKA 4H7LA 2PQQA 3KGZA 1ZZ6A 2EVXA 4IEVA 4BIFA 3OTFA 5I8YA 1EY2A 2E9QA 3HT2A 4AXOA 5JSPA 4LUMA 1VR3A 2UY9A 3FHIB 5I8TA 2OPKA 5EFUA 2H0VA 3LAGA 3LA3A 5JR7B 1L3JA 5CADA 3LA2A 4XF1A 1RL3A 4AVAA 1GQHA 3U11A 3FX3A 2C0ZA 1ZREA 3H3ZA 5I0TA 1CAXA 4MH0E 4META 1Y3TA 4F8AA 2Q0AA 2PAEA 2K9ZA 2F4PA 1UD1A 4IETA 4P9GA 1FXZA 3E6CC 4FAGA 3MYXA 3RYPA 4J1XA 4XF3A 5T3NA 1GQGA 1LB2A 4EWDA 3O14A 4LTAA 2GAUA 2PYTA 1WGPA 3LWCA 2UY8A 3RYRA 4IERA 3PNAA 1OMIA 3E6DA 4HBNA 1O4TA 3E5QA 3KSCA 4QXKA 1QY4A 3FJSA 3ETQA 3NJZA 4EV0A 5FQ0B 2XLGA 4XFHA 5EZWA 4KU7A 3UKVA 5BXXA 1WLTA 3HT1A 2VQAA 1DGWA 1FT9A 4HSJA 2Z2SB 3ACLA 3BU7A 4FBFA 2ET7A 3USSA 1SFNA 4IEPA 3ROUA 2XLFA 3KCCA 4N9IA 3KMHA 3FFQA 3JZVA 4I2OA 3C3VA 1XE8A 2XKPA 5I0SA 3N4MA 3FWEA 3LOIA 2OYZA 3CL1A 2ATFA 4AQ2A 4FAHA 4KWKA 3UKNA 4FT8A 5FCCA 1X82A 5BV6A 1HW5A 2XLAA 4XF4A 5JSRA 5CVRA 4EROA 3D82A 4ZU5A 1CGPA 4R8HA 2HJIA 4N9HA 3E5XA 1CAXB 3FE5A 1VJ2A 1Q3EA 5AVPA 2GC3A 4YSFA 5JAXA 4AQ6A 3EJKA 1YWKA 4L11A 2PHDA 2Q30A 2V09A 5KHGA 2MHFA 4Z07A 1Q43A 3L2HA 3DL3A 4HVQA 5LEJA 3TNQA 4LUKA 3I7DA 4F7ZA 2QVSB 2P17A 4XFFA 5I91A 1PMIA 3BPZA 4XEZA 2QCSB 1ZNPA 2ZKLA 1CAUB 4IEOA 5C6CA 1O5UA 3RYKA 3U0ZA 2HKXA 1J3PA 2GU9A 3CEWA 1J3RA 3SHRA 3CO2A 3LZZA 3SCHA 2CAVA 4XF0A 3MZHA 1QXRA 4HN1A 3EO6A 4BYYA 1OFNA 2PA7A 3GYDA 4E2SA 3E6BA 4TLFA 1SEFA 1VP6A 2GH2A 4XFBA 2OA2A 2H6CA 1EP0A 4ORFA 3IIAA 4QMAA 1ZZCA 1OD5A 2O8QA 4X6QB 1CAWA 1UIJA 1QWRA 2MPFA 3RZZA 5KHHA 4O9EA 4EWAA 4UBHA 1Y9QA 1EPZA 3D0SA 3IDCB 5HI0A 5C8WA 4WZCA 4BH9A 1XE7A 2XHKA 3SXWA 5E1RA 5F1RA 1H1MA 4MX3A 4E2GA 4WVZA 5FDBA 4QM8A 3ELNA 3G7DA 1ZRRA 4QX5A 4DINB 1RUNA 3H8UA 5BY5A 2PAKA 3SMHA 1YLLA 2ETEA 1O7FA 2ET1A 3IWZA 2D5HA 4IEYA 5LRRA 3D0JA 2OZJA 5J7MA 1ZRCA 2CV6A 2PAMA 2WFPA 1X8MA 4XFGA 1NYWA 1ZZ8A 3QACA 2BEOA 3WW4A 2CGPA 3H9AA 3OCPA 4Z82A 3WW1A 3IDBB 2WC2A 3H1WA 3H7JA 4MV2A 1JUHA 2FQPA 4LA3A 5JSOA 3UKTA 1J1LA 1ZRFA 4Q0UA 4JTNA 1NXMA 3H1YA 3CJXA 5JCTA 4A2UA 1Q5OA 3MDPA 2O1QA 4Q0SA 3GBFA 1DGRA 3VHRA 1LKNA 4CYDA 4PIYA 2D5FA 1X8EA 3FZ3A 1RTVA 3EBRA 1CAWB 1OI6A 1O3RA 2QDRA 4QGNA 3TNPB 1PM7A 2GC1A 1UPIA 3H1MA 4JVAA 1O3TA 3S7IA 3NSTA 3H7YA 4YNIA 2K0GA 1YFXA 4XETA 4Q29A 1YFYA 4ONUA 4HVRA 2XL9A 4IEWA 4IESA 3NVCA 5KHIA 1O3QA 1IPJA 1NZCA 2VECA 3R6SA 4B29A 4XFCA 2GC0A 2BGCA 1YHFA 3QOPA 1NE4A 4L2NA 3BALA 2D40A 4Q0QA 3PLQA 2IXKA 4MGZE 2I45A 3DV8A 4YRDA 1ZZBA 4ZU7A 2MNGA 1I5ZA 1X7NA 4R52A 4XF9A 4IEXA 2BNMA 2PFWA 4MGIE 2EA7A 3CF6E 5FPZA 1O5LA 3EHKA 4MGYE 4NVPA 4RD7A 3NL1A 4XFIA 1TQ5A 3EQEA 3I59A 1EYBA 1YFWA 3M3IA 3H50A 3HIFA 5KBFA 4EWEA 3I54A 2GZWA 3CLPA 4I09A 3LA7A 1H1IA 4YARA 2H6BA 5FPXA 2IXCA 4LLOA 2B8MA 3OGJA 2BNNA 4MZUA 5CU1A 4Q0PA 5KHKA 4ZU4A 4JV4A 2IXLA 2PTMA 3RNSA 1ZRDA 2FMYA 3ES1A 3IBMA 4PIZA 4I01A 1ZZ7A 4I0BA 2PHLA 4AVBA 2XL7A 1WA4A 3E5UA 4HSLA 1ZVFA 4HLTA 5FLIA 1CAVA 1G6NA 2IXIA 5J48A 3NKTA 1ZX5A 3NW4A 1J59A 1RUOA 2UYAA 3S0MA 3SCFA 1NE6A 2CAUA 2IC1A 5I0UA 1XRUA 3RDIA 3ST7A 3U10A 3WW3A 3RPQA 5I0RA 3SCGA 2N7GA 2DCTA 5J3UA 4I0AA 1DZTA 4IEUA 4XFAA 4JTOA 1YUDA 3S7EA 4KWLA 3HQXA 3H3UA 1RGSA 1UIKA 4D7SA 3BCWA 2Q1ZB 2D93A 3BB6A 4WBBA 4MUVA 5K8SA 1U12A 1V70A 3B02A 2QJVA 4HZFA 3I59B 5E16A 4UXAA 4LA2A 1CAUA 1I6XA 4PIXA 4OFGA 4IEQA 4IEZA 3ZDSA 5KHJA 1QXJA 4OLLA 2B5HA 5FLJA
chains in the Genus database with same CATH superfamily
1Q8OA 1UPSA 2RDSA 2KXLA 3AMPA 1W6MA 5JMCA 4UFMA 4IDZA 3ZR5A 4I3PA 1V9U1 1AX2A 3WUDA 4K8FA 5A32A 1YXWA 3WW2A 3ZX7A 2ZGOA 3LEGA 3HR9A 4QGMA 4MXVA 1E5HA 2WBKA 2VUAA 1POV1 1GZTA 2W5FA 3NNMA 4QQ2A 4RS5C 5D1IA 4NOTA 1LRHA 5E8AA 5FIXA 4B4RA 2JG8C 4G3YC 2UYBA 5HPOA 1LEMA 4NPLA 3VBRC 2BNOA 1MS5A 4NR1A 2BZDA 4E4ZA 1V6KA 1SZBA 2ZGKA 1ACCA 5A6ZA 3ZXLA 4H55A 4UFJA 2VVEA 4ZY9A 1YCIA 4DO0A 5A7QA 3EMRA 4D3WA 4HVOA 1R64A 2W95A 4MGKE 4CVUA 2Q4SA 5FZIA 5I8SA 5AC92 1JYIA 1GFF2 5DUWA 4N7UA 1ND2C 1W2TA 2XJVA 3VZOA 5JI7A 2CYFA 3VKMA 4DPNA 2JECA 1AYM1 3WNMA 1F8VA 2LW8A 4O65A 3POWA 5J36A 5H9PA 1XNKA 4WM7C 5IK7A 5JI9A 2BYVE 5D8AA 4H14A 1AF9A 3J4UH 3ZXDA 3AJYA 2JDUA 5I93A 5IVCA 4RS5B 4O61A 4XDPA 3LD8A 3CJIA 2VMDA 2QZ2A 3VBRB 1Y7BA 3OY8B 4GULA 4D7TA 1PZ8A 1SQ4A 1N1TA 1PK6C 4W6XA 2E7TA 4CUGA 1OC1A 4XPVA 4KL1A 4AR2A 1QJY3 1AYN2 2P3IA 4I30A 3DKWA 4QGLA 1J58A 5BYNA 4UF0A 4Y5SA 1C5IA 1F5JA 5A7SA 3FUOA 2IZWA 3O0WA 3OBAA 1LESA 5FQ0A 3UK9A 3MGUA 3LSEA 4QU1A 4TTGA 5ACA2 1ND2B 5LEKA 3N7JA 4Y24A 4CU9A 3I4IA 5JOZA 1K3IA 1W9SA 3B7MA 3HVDA 4IEVA 1JU3A 4NRQA 4UAPA 5GJ6A 3T4HB 5JPMB 4WM7B 1OF4A 4DIQA 1W6NB 3KD4A 4UFLA 4AG4A 3T30A 1VR3A 4LKEA 1UYYA 1JZ6A 3MIEA 4RR3B 3HNYM 5DUXA 5IK4A 1Z7S3 5GLUA 3IPVB 1FMD1 2ARBA 2D6OX 4BE3A 1ONAA 5CADA 2YY1A 2RG4A 3AYAA 1OA3A 1NOVA 1PIV3 4GWJA 3LA2A 2XUEA 2WUHA 4K1ZA 4C91A 4PF1A 1VLNA 1FNZA 1RJ8A 2JB4A 4URTA 1CZTA 1OOPB 2HWF3 2ES3A 1GU3A 2G19A 1GQHA 3H42B 5HXMA 3H3ZA 1JYWA 3D6EA 4AVVA 4XBQA 1CAXA 2JDNA 5K0UA 3AYCA 1COV3 4PT6A 1QIQA 1JZ7A 3BPSA 4CDWC 2E7QA 5FOJB 1BZWA 2PAEA 4AZZA 1UY1A 3HWJA 3SH4A 1W8TA 4P9GA 3MLKA 1HN1A 1LGCA 2XJSA 2Z5WA 5JUVA 1ODMA 1QDCA 3AP5A 4ES8A 3MYXA 3I2GA 3VL9A 2EIBA 4J1XA 4XF3A 2G4IA 4FOQA 1I1EA 3VBFB 3UESA 4LK6A 1NCQA 2PYTA 1WGPA 4XJ8A 2PLV3 3WF0A 2OQ7A 2JDZA 4MYEA 4CA9A 4BQ2A 4GWMA 1CD3G 1QH7A 3PNAA 4QXCA 2E63A 3E6DA 4HBNA 4CXYA 2WT1A 1N1YA 4W4ZA 2EIEA 3NV4A 5AFEA 2CSGA 5JZGC 5DMYA 4J6GA 3LEMA 3POGA 4JGYA 3AYDA 5KR7A 1W6OB 4XQ4A 3N7KA 4K7JA 5IVBA 1WMEA 2ZMKA 3ZYPA 1VPHA 4XMIA 2Y6GA 5BXXA 1WLTA 2WFF3 2W92A 3BTZA 3NMBA 5FY9A 1QJU1 2E6VA 3AP6A 4ISRA 4P08A 5L19A 4K3UA 4XMAA 3USSA 4BQYA 2CWMA 4IEPA 3R4SA 2XLFA 3T2OA 3JD73 4HKWA 3DYOA 3FFQA 1DG6A 4WM8B 3C3VA 5EPAA 5A7WB 4I2OA 4L97A 5JOXA 2VQTA 3PTYA 4BXSV 1S2BA 1W6QB 2ATFA 4AQ2A 4KWKA 2VMHA 2QQLA 1QJY2 4IL7A 1QJY1 2XLAA 3AMMA 4G9SB 4XILA 3BGAA 4XF4A 5CBLA 3POJA 3BYWA 3WXPA 2G1MA 2D6MA 5A70A 4C1WA 1CGPA 3WHUA 2QUOA 2W3JA 3WSOA 4PLNA 3KHCA 2VH9A 3TN91 3ZFEC 2JDHA 4CPBA 5ABJC 1LEDA 2WJSA 1BHGA 2W87A 2WZR1 2XJQA 4YG3A 4RN5A 2D3SA 1ULDA 4FOYA 4YSFA 3EJKA 3WP6A 2ZAHA 4L11A 2R30A 3WG4A 4FTBA 1Z7S2 1HLCA 2AACA 3W59A 4HONA 1MS1A 4BJ0A 1CVNA 3MW3A 3B00A 2DVBA 2CHHA 5KHGA 3KB5A 1PIV2 2WR9A 3L9JT 1PO21 1PIV1 1QOSA 3JBG3 3WD5A 3ETPA 3L2HA 2AEYA 4YGCA 4Z2AA 2HWF2 2KR2A 3ZYFA 1DQ1A 3I7DA 4R9AA 4BIOA 4XCAA 2DU1A 5FK8A 5T5PA 4XEZA 5I91A 1TME1 2QCSB 5F2SA 1X9TA 5H9RA 3ZFEB 1JYVA 2BV4A 3VGIA 4ZPIA 1COV2 4Y26A 5ABJB 1PGL2 1UX7A 2H0BA 3B3QE 1J3PA 5LATA 2GU9A 2UWCA 4XUPA 4CDQB 2WKKA 2A6YA 1I5PA 3SEPA 2HWB1 3SHRA 3VD7A 1UN1A 4LBKA 4GD4A 3CO2A 4GXLA 2JD4A 1G9CA 4F83A 4XF0A 3MZHA 1F9KA 4Y4YA 4Q4X2 4R4XA 3EO6A 5A3WA 1JODA 3IAQA 4BYYA 1PM4A 3N9OA 2JXAA 4PDWA 2RJLA 3ON7A 3POSA 2RM21 1TNRA 3GYDA 2XWJB 2ZAAA 3U1XA 4B7KA 3KM5A 2PLV2 2ORZA 1BBT3 2PLV1 4TLFA 2WNEA 2WIIB 5FZGA 1VP6A 4XFBA 4LBNA 5CZKA 3USUA 1V6OA 2WN2A 2YUEA 1B09A 4GH4A 1EP0A 3N9PA 4LT5A 2X8KA 2VG9A 1XU2A 4L0PA 4WV8A 3IM0A 5CKNA 5FPVA 3MW4A 5A33A 2I07B 3VDCA 2O8QA 3RMXA 2P37A 3ZN4A 2E7AA 4X6QB 1UIJA 3FBMA 1QWRA 1WZXA 3UGHA 3MIBA 3VBOC 4EYUA 3POYA 2EXIA 3NAPB 3W20A 2R073 4LBJA 1OFSA 5CG8A 5IUQA 2PN5A 2DCYA 2WFF2 2QZ3A 4YGDA 3ZXKA 1W06A 2JDAA 1HRI1 1F35A 4XUQA 5HI0A 4CU7A 2OUJA 5F5AA 1UYZA 3OEAA 3BIWE 1XE7A 2YC2A 1L7RA 3JD72 1H1MA 4OMCA 2B42B 3JD71 3ZYRA 4E2GA 3T0DA 1XE0A 3ZN6A 1T6BX 4AI1A 3GXUA 5C8CA 5SV8A 5L7OA 1ZRRA 2ZX3A 3VBSA 3BTYA 2HBTA 3H8XA 5EYXA 2PAKA 1CPMA 1YLLA 1WMDA 2KD7A 3T09A 2LM3A 1O7FA 2G9GA 3IWZA 4BQ4A 3I2OA 2DCZA 5LRRA 3VBOB 1ZBA1 2D97A 1ZRCA 2PAMA 2VAUA 2WFPA 4DMIA 4CXWA 1MEC3 1ZZ8A 5A7PA 3AJZA 4XJWA 4W65A 1AL0G 5FO9B 5FMBA 3VBUB 1SBEA 3H9AA 4Z82A 1OUXA 3IDBB 4A41A 1HN0A 2ZHKA 4XIOA 1JHJA 1QOOA 4S2GA 5A3MA 1MZFA 2FQPA 2JG8A 3MO4A 4LA3A 4XHXA 5FP4A 1J1LA 1ZRFA 3NV1A 2FDHA 3DECA 3W5NA 2PHFA 1JBCA 4UYBA 3H1YA 2ZA9A 3CJXA 3JBG2 3D8CA 3WDWA 4XOGA 5FKCA 3LDRA 1V6NA 2ARAA 1HV0A 3MDPA 4Q0SA 4QHOA 1O4ZA 1UXXX 1ALYA 3NV2A 1Z78A 4CYDA 2EIGA 3VUOA 5IYYA 2WT2A 2R6QA 3B93A 4IE6A 3ZR6A 1O3RA 3D4KA 1MACA 3MV01 4WM7A 1UPIA 4JVAA 4PQ9A 4YVWC 3B9CA 4QQOA 3NV3A 3NSTA 4DY3A 2K0GA 1NY72 1OQEA 4XETA 1ENQA 2VUDA 2D98A 1KJLA 2VMCA 4AVTA 4I3GA 2ZX4A 2YG0A 5IVJA 5KHIA 2X53S 5FY8A 1NZCA 1PK6A 4A3XA 3VHPA 2VECA 3R6SA 1WLDA 1F15A 4B29A 1UX6A 1BBT2 1YHFA 2BBAA 3QOPA 4IV1C 1FV3A 1RUG1 4L2NA 1OLQA 1RB8G 4FOWA 3VD5A 1SMVA 4M0NA 1WCUA 4XUOA 1O8PA 4Q0QA 4HK9A 2O8OA 4MGZE 2E26A 1W8OA 4GMP0 1WW6A 5CG9A 3PUSA 3K4ZA 1AR61 1LCLA 2R072 2VMFA 1D4VB 1ZZBA 1UO9A 1R1A3 4CU6A 1C3HA 3VZMA 1AJKA 4QHZA 4R52A 1S0EA 3ABZA 3ME2A 1BKZA 1V6LA 3F95A 4FXGB 3J8F3 3R4DB 2EIDA 4AL9A 5K7PA 5KWRA 5FXZA 1CX1A 5G04L 3AKSA 2Z42A 2EXHA 5FPZA 3WF1A 1PNFA 3IB3A 1H8VA 2ZEXA 2JDPA 4JGZC 1SCSA 4MGYE 4QPYA 4QX0A 2DURA 3ZYHA 4LORA 5DG2A 4JC1A 1KS5A 1PZ9A 3M3IA 3PJQA 4FQZA 3J7NA 4EN8B 1R081 1C8M1 1O8SA 2ZTNA 3CZUA 3W58A 5CYYA 2EALA 1MS3A 1RUI3 4CDWA 5FUPA 3ZKYA 5FMOL 5T55A 4AFMA 4ARYA 1MEC2 2YBSA 3CLPA 5EIYB 4V2WA 1H1IA 1HKDA 2H6BA 4MVTA 1RIRA 3OUIA 4EN6B 3M3OA 4AYUA 4YARA 4E8DA 1DGRN 1SG3A 4AEDC 2JIGA 4ATEA 2HH9A 3U75A 4Q0PA 5DAQA 2FZ1A 2A70A 3BI3A 2IXLA 2LROA 2YV8A 4XJ9A 5LK7B 2QFEA 4AF9A 4XHBA 1YIPA 1HB3A 2VJXA 4JGZB 4L8QA 3U37A 2BUKA 4NUBA 4ASKA 2A6VA 2ADEA 1H2LA 2W47A 4B4QA 5A3LA 3KHBA 2VOKA 3WG2A 2J1SA 4I0BA 2PHLA 4YVSC 3WF2A 4PHZA 1UF2C 3MW2A 2YHJA 5JZGA 3TEYA 1HJGA 1LHVA 2FDFA 2ZX2A 1XNDA 4FFHA 2Z79A 3ZKUA 4H3WA 1CAVA 3CHXA 5EJZB 2BOJA 5FY1A 5J48A 4FTSA 1RUOA 4LKFA 3S0MA 3C7GA 4KH9A 4LHLA 2VM9A 1AR83 1A78A 4J25A 1SBDA 2HWC3 5FP3A 4DUWA 5EHDA 4AEDB 2VR4A 1LULA 4BMEA 2XONA 5I0RA 3DPRB 3I49A 3DEMA 1PVC1 1WLWA 2N7GA 1U5ZA 1W9YA 3GBGA 1YO8A 1J83A 5IVVA 4FFIA 3VD4A 5CEHA 5FFOC 2WWJA 2RMU1 4JTOA 1YUDA 4BMBA 1UU6A 5CFDC 2ZGTA 5J37A 3H3UA 3ZYGA 1UIKA 4N43C 3RFRA 4W6YA 4MGTA 1RHI3 2Q1ZB 3BKZA 3DF0A 2YBKA 4MUVA 1DLCA 1U12A 1ZYBA 4XUNA 3B02A 3TWIA 1XBFA 2PHTA 5E16A 4IE0A 1H6XA 4LO5B 5F6KA 1NA1A 4MLOA 5GALA 3ZXAC 1Q8QA 2IWGB 4RGKA 3T4VA 5J96B 1QXJA 4OLLA 3UJOA 4EN0A 5LWBA 1R1A2 1CN1A 5FLJA 3WT3A 3I2KA 1YC61 3OBTA 2ID4A 5IVFA 2E31A 1S0GA 3U4SA 3J8F2 1EPWA 1VRH1 4HANA 4NWVA 4QKNA 5E88A 1IPKA 4UBGA 5JIAA 2ZMLA 4O9GA 1J3QA 4BK4A 1OUSA 3NWKA 4YM3A 1JOBA 4Q2FA 5CFDB 5BNNB 2MEV1 4N43B 3PVNA 1I9RA 1QEXA 3S57A 4HL0A 4XQDA 4KBBA 5EV7A 1REEA 1ENXA 3QBQA 3Q8EA 1QJX1 1LHNA 3PVEA 1N3PA 3MHZA 4CU8A 4I02A 3ES4A 2VMIA 1APNA 2W52A 5A7NA 5LY1A 3GALA 4KWJA 1RUI2 4BHPA 1GNYA 4CEWC 2XBO3 4QPGA 3ZFGC 5FKBA 3TAYA 2WNUA 5BPXA 2YFZA 5DXDA 5FP7A 3JU9A 3PU8A 5B4NA 2BP6A 2Q8OA 2B4KA 4AHZA 2C5DA 4XJUA 5FBJA 2XJPA 1H1AA 3AC0A 3POEA 5LBBA 1QF3A 4KMQA 5C3SA 4X6RB 3S5QA 4CZSA 3VN4A 1FOD1 3C7EA 3PL0A 2AUYA 3WP4A 5C7GA 3UGFA 4GJZA 1JZ8A 4AVCA 2VL4A 5JVVA 2VZRA 4DEVA 2Y0OA 2VCCA 1SPPA 2V5YA 1UCXA 1G86A 4NHYA 5FTTC 2ZGMA 3UV9A 2VZ3A 3O1VA 4JQRA 3PMSA 4SLIA 1ASJ3 1OKOA 1HV1A 2JB8A 4FPYA 2O14A 2VO5A 5FZOB 1JYTA 1QQP3 5C9AC 1AR82 5L73A 5T5OA 1Y4WA 1VBE1 2HWC2 4OI2A 1XSQA 2CWSA 4Y5Z0 2PQQA 3LFIA 2XDVA 1ZZ6A 1QXPA 2VZVA 3KGZA 1H9PA 3SC7X 1C1LA 1W0PA 1PX3A 5GZDA 3LFMA 3HT2A 4AXOA 3VDDC 4OHWA 2QTWB 1IOAA 1E5IA 2UY9A 2WNVC 4AI8A 5LA9A 4BLJA 2YYOA 2ZGNA 3VZJA 1RHI2 1HB4A 2B45X 4YM2A 3O1PA 1RHI1 1WA6X 2QBXA 3B01A 3GM8A 3LAGA 4QPWA 4XQWA 1IKPA 1C8NA 4A3ZA 4ZXKA 4XW3A 5FZ1A 2WA3A 3KV9A 2FCVA 1VAVA 2TEPA 4Y1ZA 3WVJA 1B35B 4XF1A 2YB7A 1RL3A 3WQ0A 4AQSA 5C9AB 3V0AA 3NKGA 4OHYA 2QE3A 5C3RA 2VY0A 2R16A 2C1FA 5FMDA 3ALQA 3HN1A 2IUWA 3AB0A 4CDXC 3SEEA 3GNEA 3OSDA 2CNAA 4F8AA 2ZGLA 4AEJA 4K40A 1ULOA 5FYMA 4LXLA 2Q0AA 4NPRA 4OCTA 4XBLA 1W03A 2F4PA 3JUUA 2DDUA 4IETA 4ZZ8A 5C5TA 1FXZA 3E6CC 2VNRA 1WBFA 4HETA 3HN3A 1RUF3 3VKFC 1UYPA 4LR4A 3RYPA 4QX7A 2DVFA 5GLVA 1EUUA 1JUIA 3N7LA 2V72A 3ZYJB 5LBEA 2VZPA 4LTAA 2FDIA 4BXFA 3K75B 4FCAA 1GOFA 3T3YA 4DXZA 2X5IC 4YZ4A 4AI0A 4QDQA 2XBO2 2A3WA 2ZKNA 4YVWA 3KV6A 1XNAA 4CDXB 3WG1A 3NJZA 3ETQA 5JXGA 4QU2A 1W8UA 1LNSA 4GJYA 3WHTA 5LA2A 4BISA 2XLGA 3AMHA 4CUAA 5BNPB 3JQXA 1DQ0A 1LECA 1JZ5A 4TXWA 1DLLA 1JYNA 2XUMA 1REDA 4BU2A 1YYNA 4HSJA 1FT9A 3UYJA 3QD6A 1UKGA 1GNHA 2B39A 1OH4A 4LJHA 3VL8A 3BU7A 4MSVA 2VZQA 2ILMA 5ERLA 3OYWB 4IV1A 1SFNA 4LO4B 1GBGA 4N9IA 4TZDA 3MIDA 4Q8KA 3IDAA 2XKPA 2ZPXA 1AHSA 5I0SA 4QHBA 1MVQA 2X5IB 3FLPA 1LU1A 3ILRA 4OYUA 4AFCA 5FPLA 1LGNA 1RUC3 4FAHA 2G9ZA 1BVVA 1MQTA 1ASJ2 4UT5A 4QXHA 3LQCA 4AFBA 1X9PA 5F3GA 5IHRA 4BPZA 1WBLA 5FZ3A 1QQP2 2ZHLA 3ITQA 5GZCA 2X10A 2F4LA 4ZU5A 5KXCA 4LOSA 4R8HA 2HJIA 3LIGA 2AC1A 1R1ZA 4XJZA 3E5XA 3MIFA 3KT4A 2AR6A 1VJ2A 1Q3EA 2Y33A 5A3TA 3NJVA 1S55A 5AC91 1US3A 2ZXQA 4AFDA 5JAXA 2PHDA 4CP1A 2Q30A 3UL2A 5FZ9A 2QQJA 3O1TA 4B1LA 2A3XA 3V64A 2WAAA 2D7FA 5FZAA 1W6PB 5H9SA 3V0BA 1W2OA 2VCMA 3M4FA 4GZ9A 1C4RA 4RR3C 4RQPB 4QDRA 1G9FA 3ACGA 4R9BA 3DL3A 5C33A 3TEWA 5FYZA 1PZ7A 1EV13 3WNLA 4CUCA 2J1RA 4XFFA 1GYKA 3HAGA 5FZEA 2P3JA 4DXRA 1XYPA 4LBMA 2OPWA 1AYN1 2YC0A 2FBEA 1GWMA 1KJRA 1OOPC 1VMHA 3FLRA 2W08A 5EWSA 3RZGA 2GN7A 2Q1MA 2VCBA 1W0NA 3CEWA 1V0AA 3WDTA 5ACA1 1UZWA 3X29B 2SBAA 2XPJA 2PHWA 3WX5A 1QXRA 4HN1A 4YVSA 1RUF2 3APBA 3CQOA 4CDUA 1RUF1 3PMEA 1PMHX 5FZBA 1W9WA 4EN9B 1PO13 3INAA 1BEV3 3E6BA 4ASMB 2WO7A 2LRPA 1BK1A 2VXJA 5T50A 3D5OA 3WINE 5LW9A 4CCNA 2BW8A 2H6CA 2VE1A 3VBFC 3OJBA 3VD3A 4CEYC 5I0DA 3T08A 4ORFA 4V1PA 3IIAA 5FZFA 1S1AA 4FP3A 1OD5A 2BJSA 5LASA 1X36A 3UNPA 3LEKA 3NNJA 2MPFA 3A21A 3M3EA 1WW5A 1D2QA 2ZEZA 4YM1A 4EWAA 2J7MA 1RUH3 1Q8PA 3AYEA 4D6QA 5C8WA 4NROA 2XMLA 4Y20A 5HCFA 4OULA 1KDMA 3SXWA 4JHTA 4MADA 4Y1XA 5A1FA 5F1RA 1UY4A 4OUEA 4QB2A 4MX3A 4BWOA 4WVZA 5FDBA 3J26N 4Q4X3 4NMIA 4DNYA 3G7DA 4QX5A 1RUC2 5FYIA 4AAPA 2FD8A 2VQUA 3HEIA 3R4UA 5EJ1B 4CEYB 1RUNA 4WM8C 3VZNA 1PX4A 3AP9A 3S6PA 1BMV2 1OHFA 2EXKA 1GKBA 4LKDA 2XVKA 5LZ6A 2ET1A 1VBD3 4XBNA 2D5HA 4IV3C 1RUE3 3H0OA 4PQQA 3KQRA 4Y5TA 3WOGA 5C71A 2D6LX 1R093 3QACA 4N90A 4NAOA 4CRQA 5KXBA 5D2AA 4N7IA 2W46A 1J1TA 3OCPA 5IVEA 5L9VA 1AX0A 5DQ0A 3VBHC 3SKJE 5F3CA 1DP0A 4OHZA 1D4M3 2GMMA 1D0HA 3H1WA 1UU5A 1AXYA 4BDVB 3KWVA 5FREA 3UKTA 1SLBA 5CFCB 3PDQA 2BGOA 3H8OA 4Q0UA 1G8WA 4CEWA 3Q9OA 3ZFGA 3UJQA 2GP5A 2P6CA 4MO3M 3WNXA 1Q5OA 2ENRA 4QB6A 5FZOA 2R1DA 1W0OA 2VNVA 1SFYA 3AKQA 1EV12 2RR13 4R9CA 1HB2A 5F8PA 3VKLA 3GBFA 1EV11 4IV3B 4Q27A 1DGRA 1OKQA 3U78A 1LKNA 1FPN3 3O1UA 1RYYA 5DZEA 3C8XA 4PIYA 4Y4RA 1NKGA 2D5FA 1X8EA 3K2OA 1LODA 1KFUL 3FZ3A 1RTVA 1CAWB 2QDRA 2SLIA 4QGNA 1E5RA 2GC1A 1XNCA 3OBRA 3DYMA 4FPKA 1RUD3 2XG3A 1E57A 3VBHB 1DCSA 1T6GC 4LBOA 2QQKA 4YFZA 3ILFA 3I2HA 4YG6A 1QKQA 3WQ1A 4CDQC 1NG0A 1XPWA 3VKOA 3IMMA 1JTZX 2XJUA 4CP9B 5JSPA 4YW1A 1O3QA 2JWPA 1UXZA 2WS93 1SLIA 1PO12 1W9TA 1BEV2 1A8MA 4JQTA 3SH3A 4CCOA 1WMXA 5G05L 1BEV1 4XFCA 2VOWA 3V56A 5FP8A 4F3JA 1Z7S1 2BGCA 1WCSA 2LALA 4UI9L 1EAH3 1V6IA 4JHZA 4AGRA 1WCDJ 3W5MA 3MEPA 5HXVA 1F31A 2BWAA 2HWF1 3DV8A 1U0AA 2V4AA 1YRZA 3S5AA 4YRDA 1DGLA 3F2ZA 1K5MB 1TEIA 3VDDA 1RUH2 1WLCA 2X05A 1RUH1 4FFGA 2WNVA 4D7YA 4M3CA 1KRIA 1X7NA 2EICA 2ZBJA 4Y22B 1COV1 2NMOA 3SQOA 1PGW2 1PGL1 4LKSA 3T2QA 4Y33A 2KA3A 2RE9A 2FCUA 3NAPC 4IQPA 3OGGA 2F6BA 2PFWA 2VTXA 2RVAA 3AP7A 4WVMB 1KDKA 4XE9A 4NPMA 3SH5A 4NO4A 4P00B 2D6NA 1O5LA 4K1YA 5FXWA 1BYHA 3ZXGA 2C26A 4FPCA 4Q4X1 3ZMNA 4D8MA 3WQ7A 2TNFA 4RD7A 3NL1A 4CSWA 4XFIA 1LOCA 3EQEA 5A3PA 5IW0A 3I59A 1SDWA 2JKBA 3ACIA 4CDXA 5BNOC 1ND3A 1VBD2 1O59A 4QT6A 4AFAA 5GZGA 2WLQA 1RUE2 3K4DA 4RHV3 5FUIA 3RWNA 1RUE1 3A7QA 3WEZA 1Y9GA 1R092 5FZDA 3LA7A 3IDEA 1UOJA 4XYXA 4COYA 1SFPA 4DZGA 1ZA7A 1DIWA 1TMF3 2BVVA 2OS2A 1GP4A 1W3XA 3LSDA 4A6SA 3WQBA 1D4M2 4FOVA 4Q4W3 2WFF1 4JV4A 4KNCA 1UOBA 2PTMA 2WSUA 5FY4A 1ZRDA 3VBUC 1C57A 2P3YA 2K2SA 3WP5A 2LS6A 3A0KA 1HB1A 1KS4A 1XQNA 3IBMA 2LUWA 4I01A 1LHUA 2AENA 3BTXA 4AI9A 1GZWB 3VHNA 3NRUA 3W21A 5BNOB 3FL7A 5ANNA 2RR12 4LIUA 2RR11 1BK0A 1XU1A 1WA4A 4COZA 3ZMOA 1JZ2A 1GP6A 1ZVFA 1FPN2 4HLTA 4MHUA 4Y3OA 5FZ7A 1G6NA 1H2MA 3I8TA 1HRV3 2A6ZA 4M00A 4U2AA 1VB2A 3PHMA 4GWNA 5C4WB 1LOFC 4MXWB 2R043 3ZXFA 2D3PA 2QQMA 3ZPOA 2CAUA 1MS0A 2VXRA 4EQVA 1RUD2 5A6XA 3ACHA 4DXSA 3RDIA 4YW3A 2CU5A 2W39A 4UFKA 2ZGQA 3WW3A 5A6YA 3RZKA 4QX2A 3MI8A 4HPKB 2OKXA 1W99A 5HV0A 1DZTA 5IK5A 5FYBA 5FZMA 2WS92 3H3LA 2BDRA 2WS91 5DZGA 1K42A 4EN7B 4XXPA 4JAAA 2CDPA 3HQXA 4RS5A 1RGSA 5J1XA 2VZTA 4ZZ5A 3BCWA 2BVBA 3VBRA 5B2GB 3OY8A 1EAH2 1KGYA 2RS33 3BB6A 4A42A 1HDKA 5K8SA 1EAH1 3URFA 4Z8BA 2BFUS 1XNBA 3DUIA 4N53B 3ZN5A 5JWPA 3VDBA 3JBG1 1I6XA 4OFGA 5F39A 1QNWA 3KQ4B 4YLZA 2AGSA 3I3QA 3MFCA 1ZM1A 2B5HA 1ND2A 2C9KA 5M0TA 2PMWB 1UY3A 3BOWA 3MLJA 5FLHA 4NRMA 1VMJA 2D6PA 1C1FA 2Z69A 5F9TA 3WNNA 4Q4V3 3RI8A 1W6NA 1HIXA 2QDNA 2QKDA 1H8TC 3AK0A 3WG3A 1OXCA 2WO3A 1GICA 5L36A 1JOPA 2XGXA 4NHLA 1NY71 5EJ3A 4IGOA 3ZVXA 5A3NA 3I2IA 4FPFA 1CZSA 4RR3A 5A1AA 2AREA 3N3HA 1EUTA 4LHKA 1RVF3 5EXOA 1CX4A 3IPVA 1AX1A 1QJEA 3O1OA 2D43A 4AE2A 1G7YA 3PUQA 3KVAA 1ZRIA 2DVGA 1VBB3 4YZ2A 2TBVA 3SLIA 3E97A 2W9XA 5FZCA 3VB9A 1BBT1 4E4SA 4HMZA 1OVPA 1LOGA 1OOPA 1DGWX 1ST8A 1XC6A 3KF5A 4RHV2 1O3SA 2YROA 1JOJA 1CIWA 3PUAA 1HJFA 1A8DA 2HEWF 4FPJA 2ZCWA 1GR3A 3AZYA 1OLMA 2BERA 2EAAA 3KF3A 1TMF2 2W94A 4QPIC 4LITA 3CZJA 2WL1A 3M70A 5A3UA 4KG0A 1H8TB 2R071 3NNLA 4Q1PA 1QU0A 3P3PA 2CGOA 4Q4W2 1MZ5A 1XSRA 5DUUA 5GLWA 4Q4W1 4YYOA 1DZRA 1JU4A 1LR5A 2Y6LA 5LA0A 4HN0A 1CONA 1QGLA 2X29A 4LULA 3LIHA 4B7EA 5JXIA 3VBFA 3RZJA 5BUVA 4E4DX 4CEYA 4M4RA 3EYPA 3M3QA 2FMDA 4PJYA 1VE0A 1S0JA 1IHMA 2XJTA 2YPJA 4LBQB 2OZ6A 3LKJA 4QM9A 3WR0A 2ZEYA 2VPVA 3A0NA 3MF9A 3J9SA 4OVEA 3AP4A 1HRV2 5LBFA 5FYCA 3AMQA 4E2QA 2QNKA 2R042 2DBIA 4GB33 4QX1A 3KT1A 5EYYA 2R041 1W6OA 4QPIB 2IXJA 1UW8A 3ZO0B 1NCRB 2VOVA 4H7LA 1MEC1 2R063 2VBPA 4YZ3A 2EVXA 1G9DA 3PIGA 4HFSA 4BIFA 4FFFA 1RUJ3 3N9MA 2DU0A 3AZXA 4S2DA 3LEIA 1QJZA 3J7LA 4DUXA 5DN2A 1W6MB 3ZOIA 4NIAA 1W2UA 3DPRC 4WM8A 2J1TA 5A7WA 4B3NA 1UMHA 1NLRA 4CCLA 5A32B 5I8TA 5EFUA 2H0VA 2RS32 5HCAA 1W6QA 1AR73 3LA3A 1JS9A 5ANQA 5DDJ3 5J98B 4AI3A 2FDJA 1L3JA 2VVFA 4ES9A 3HQRA 4IGQA 4RYDA 3CJIC 1QMJA 3VZLA 4ZS3A 5GLZA 3THTA 4AVAA 5FJKA 4LLFA 5DAXA 2Y6JA 2Q8EA 1PMJX 3FX3A 2C0ZA 4GMP3 4UW6A 4W50A 2JDMA 5I0TA 5FBZA 2VQ0A 2ZX0A 4P02B 4META 4CCDA 1U5YA 1Y3TA 2P5BA 2ZMNA 4Q4V2 4A6OA 3WLUA 2RHPA 4YW2A 1SACA 1WWYA 2WWUA 1AR93 1WD4A 4HKOA 4QQPA 4D69A 1H6YA 1CR7A 1RVF2 3KT7A 2VMGA 2JX9A 5T3NA 1GQGA 4COWA 4EWDA 5D8AB 1LB2A 2PQSA 3JB4C 1VBB2 2GAUA 2WAOA 5BNNC 1VBB1 1GLHA 3A4UA 4AGGA 3M8LA 3KCXA 5EQUA 3LWCA 4JDMA 5FYVA 3CJIB 3IIIA 1LAJA 2UY8A 4KI5M 3GJAA 5LA1A 2E33A 1OMIA 1CIYA 4Q5OA 3ZIWA 3E5QA 3KSCA 4UW5A 4UOJA 2ORXA 3ZFEA 4JZRA 1QY4A 3UT0A 2YC4A 3PVOA 2ARXA 2DUOA 4M01A 5DABA 1W04A 4C0BA 4UF0B 2WA4A 3N9QA 4JRAA 4EV0A 5ABJA 3O1RA 1KD7A 3CIHA 2WO2A 3MUY1 4TYSA 1X33A 5CVRA 1NAEA 5FQ0B 3Q8CA 3ZFFC 4CDQA 3OB8A 2W2IA 2UURA 4XFHA 1DQ4A 3MICA 4KU7A 1R1A1 3UKVA 4P5HA 2VQAA 2XJRA 1BLZA 1DGWA 1S0IA 2Z2SB 1OQDA 4FBFA 5CB7A 4OHXA 2ET7A 1N47A 1UYXA 3J8F1 5E6HA 2NPIA 4AEKA 4ATFA 2NZ9A 1IKQA 1LENA 3KCCA 1D7PM 3KMHA 4ZHNA 3JZVA 4W6WA 4YGEA 1XE8A 4BQWA 1YNAA 3N4MA 1POV0 1ULEA 3LOIA 1XXNA 3CL1A 4FQ4A 2OYZA 3WCRA 4CCEA 1YQCA 4X8NA 4YFWA 3AKPA 4FT8A 5F5IA 5FCCA 1OF3A 1X82A 2F17A 4S2FA 1NCQC 1OH3A 2Y34A 1SLTA 3AVRA 3HBKA 4CUBA 5JSRA 4GB32 2NP0A 4KGGA 1F5FA 1PGSA 2RS53 1UZZA 3D82A 1S0CA 3AFGA 2A7AA 3OBZA 3P6BA 1RUI1 3ZFFB 3NAPA 2R062 5FP9A 4DQAA 5FYTA 1CAXB 3FE5A 4JX0A 5CKMA 4JGYC 2XB6C 5F2WA 2J42A 1RUJ2 1ULFA 2B7YA 3RJRA 2GNTA 2HWD3 2FZ2A 3OUHA 5KXDA 2AEZA 2GDFA 4XAEA 2NM1A 2VGDA 3JXSA 3PURA 2QQOA 2GN3A 2P2KA 4FO9A 4OI4A 1AR72 4QQHA 5BNOA 5LK5A 3ZYIB 1AR71 2VZOA 5DDJ2 2A3YA 4D94A 4EJRA 4ASLA 4OZOA 2WT0A 3GGLA 1XB9A 1NCQB 3AZVA 2MHFA 3MIHA 4Z07A 5C70A 1Q43A 5HV4A 1HQLA 1ZBE3 2A6WA 1S0DA 3B9IA 5FJHA 5T5JA 3WNKA 4P9IA 3TNQA 5LEJA 4LUKA 2P17A 1W2NA 3VBOA 3PU3A 5FPBA 4PF5A 1ZNPA 1BVP1 2ZKLA 2DWRA 1IPSA 4GKXA 3UETA 1B35C 1O5UA 4QXBA 1DFQA 5FYUA 4JGYB 3RYKA 3U0ZA 1AR81 1V6JA 3TRSB 3VBUA 1CJDA 1YIFA 2HWC1 1AR92 1AR91 1DF0A 1NX9A 2VZ1A 1AL23 3GZAA 3CMGA 4GA9A 3SCHA 1C5HA 1ENSA 2WDBA 5FPAA 2DUQA 1V9U3 3AX4A 1US2A 5LBCA 4PI2A 3T2PA 3HPNA 1Q56A 1OFNA 2A6XA 4DRVA 2PXJA 2PA7A 4E2SA 4B1MA 1LGBA 3PUIA 1UOGA 2JICA 2Z4FA 3CNAA 4XURA 4W8JA 5DG1A 1D0GA 3FHAA 1LOFA 1LHWA 4E9KA 1S2KA 4M3CF 1QNYA 5H9QA 4K20A 4QMAA 1UMZA 1CJPA 1ZZCA 5C3OA 5FO8B 4FPEA 5DZFA 4KBZA 5F5CA 1G9BA 4AI2A 1OURA 1J84A 2IFRA 2X09A 3WDYA 2DFCA 4DB5A 4RGGA 3NNFA 1NZIA 4S2HA 2CL2A 2WZEA 3RZZA 4NWWA 1K5JA 4O9EA 4RFT0 3RVHA 4D6RA 3GZUC 4KWUA 1Y9QA 5F6LB 1EPZA 1ULPA 5FAXA 5FXVA 1S0FA 1W28A 5BNPC 2XHKA 4QD2A 3AKTA 3IMNA 5E1RA 4K9SA 2YU2A 2GNMA 1QOTA 1DYKA 2DFBA 1IG3A 4AW7A 2WLPA 4NIDA 4M4PA 3W9AA 3N35A 4D0QA 2FDKA 4L92A 3H8UA 3P1IA 2VUJA 5BY5A 1S2EA 3SMHA 3OEBA 3I3BA 3LDBA 5A3OA 1AJOA 1TG7A 2RS52 3P3NA 1H30A 2XBO1 4GH4C 2OZJA 5F3IA 1H8TA 3LDKA 1NYWA 1GMMA 4A7KA 3I97A 2V5DA 3DYPA 3HOBA 2BEOA 2NYYA 4P9XA 4PCRA 1WD3A 2HWD2 3I2FA 4IW3A 3WW4A 2CGPA 2HWD1 2PELA 2PHRA 2RS13 3ZSKA 3BN6A 3EXUA 3WW1A 1LOEA 2WWSA 2WC2A 5JLVA 2GALA 1H9WA 1SLLA 2UU8A 4IGPA 1JUHA 4UW4A 4A45A 5JSOA 1GP5A 4JDOA 3JQWA 4AHWA 1FMD3 2UWBA 1AZDA 2FHRA 2J1UA 4PDWB 5A7OA 1NXMA 4SBVA 2Y60A 3OPWA 1ZBE2 2A73B 4R9DA 5FK7A 5IWFA 5FR3A 5C8CC 3MFAA 2O1QA 5L7OC 5F32A 3VBSC 4GH4B 4H2AA 4RQPC 2NQYA 3DGTA 4I0WB 1ASJ1 5A33B 3LGRA 1UZYA 2RDRA 5KC5A 1QQP1 4MOAA 3THCA 2QQIA 3C7FA 1MR5A 1UWWA 4NE9A 3H1MA 1O3TA 2OX0A 2CDOA 4IUGA 4Z92B 2QQWA 3AL5A 3O1MA 4P5YA 1AL22 2Q1FA 1AL21 3K46A 1YI9A 1V9U2 2C6SA 4IE5A 4QX8A 3BUCA 4BM8A 4ONUA 4HVRA 4JGZA 1W8ZA 2XL9A 4IEWA 4EZ4A 3NVCA 3I3EA 1IPJA 2ZGUA 5IVYA 2YU1A 3RZMA 4YZ5A 3Q8BA 2PHUA 1XNTA 3ZN6B 2ZHMA 4V2VA 3SISA 3HBZA 2CY6A 3ZLIA 5C8CB 5L7OB 3VBSB 3VLBB 1NE4A 3MBWA 5KC6A 1QH6A 3ZIXA 4RFRB 5CISA 2OIIA 3PLQA 3A22A 3O0VA 1OBNA 4BK5A 2I45A 3BVCA 1MS4A 1T2XA 2BTVC 2WINB 4ZKTB 4AEDA 5IFPA 4ZU7A 2MNGA 1AYM2 5K4LA 2QQNA 1NLQA 3DPRA 2WZ8A 1QJU3 5FZ6A 2Q8DA 4XF9A 3U4XA 2GP3A 3Q8FA 4QKFA 4IEXA 1SBFA 2BNMA 5IJRA 3U07A 1YQ5A 4ITCA 2O0OA 3ZXJA 3VD9A 4NIHA 1MZEA 4MGIE 2EA7A 3CF6E 4LHSA 4FTEA 1F2NA 1WUVA 2JG8B 4WVVA 1K45A 4NVPA 1OPMA 4LK7A 3WZ1A 5FY7A 3WY6A 4DXTA 1TQ5A 3PTRB 1YFWA 5DAWA 1CWPA 4A7ZA 1W39A 2W1SA 3TYJA 1SHWB 3HIFA 4FPGA 5KBFA 3FBYA 3SKVA 2GH8A 4P9JA 4XCBA 4R4ZA 3TN93 5CNAA 3WF4A 3L2YA 2GZWA 1DYPA 2A71A 2HEVF 2WZR3 1FAYA 5JOWA 4LLOA 3FLTA 3CKHA 2RS12 2QQUA 4Z2WA 1AVBA 1UNBA 2RS11 5CU1A 4E27A 3C7OA 4AK3A 4ZU4A 5CFDA 2OQ6A 5BNNA 4IXLA 4ZXEA 1CESA 1N1VA 2UWAA 4N43A 1FMD2 4BQXA 2RJKA 3ES1A 3TEZA 5DPNA 4CP2A 1PK6B 3QH6A 1OA2A 2P1BA 3P5BA 4PIZA 1PO23 4P14A 1DQ5A 3ZYBA 1GNZA 5CFCC 1M06G 3ZDVA 4OZXA 1STMA 2RDNA 4YPJA 5JIUA 1RUC1 3ZFFA 3E5UA 2VBBA 4HSLA 5FYYA 3HMYA 4X8PA 5FLIA 1TME3 3GZEA 4AOCA 1RITA 3NKTA 1BMV1 4DUVA 1WCKA 1J59A 1ULCA 2UYAA 2ZHNA 4CCJA 1VRBA 3GHMA 4OUMA 5D21A 3SCFA 1NE6A 1JYCA 4K8RB 2HWB3 2ZGRA 3OGSA 3U10A 5FMOS 2WN3A 3SCGA 5JXHA 2E32A 2DCTA 5J3UA 4I0AA 4IEUA 1VAMA 1MVEA 1W2AX 4GAZA 1LHOA 1CPNA 2DUPA 1GOGA 4HT1T 5K9YA 3S7EA 1PVXA 2RM23 4CP0A 3AZWA 4D7SA 2I2SA 3WNPA 2VTXJ 5AVAA 4O7XA 3HNMA 2D93A 5FPUA 4WBBA 3GDBA 3OOXA 3T0AA 3TBDA 5CAZA 1RJ7A 2DTYA 4OQ8A 1I3HA 2HYKA 2ZOEB 2CGNA 3M7AA 1VB4A 4LA2A 2NLRA 3TB0A 1N1SA 1QJFA 2JDKA 4XC9A 1VMFA 5TSWA 3RRDA 1AUYA 3O1SA 1JHNA 3ZDSA 2ZACA 4CDWB 3FFZA 1Y43B 4GWIA 3I3MA 1SDDB 4RSUA 2AH2A 3T0BA 3M3CA 1W8HA 2XWBB 3K3OA 5LRSA 1HRI3 1QJU2 2VNOA 2R1BA 1K5MC 1IZ3A 4HKLA 3BODA 2HBUA 3MIGA 4LMFA 2ERFA 2W91A 1YJLA 4GKYA 4BCUA 4QB1A 1UKRA 1YFUA 2JKXA 2GNBA 3WCSA 3O0XA 3KGLA 4XTPA 4FPLA 1AXZA 2BGPA 1ZZ9A 1PO11 2B9VA 5JR2A 4BA6A 1KEXA 2JJ6A 5JZGB 3MPBA 1B35A 1GV9A 2K46A 1RXFA 4KU8A 5C9AA 1MS9A 2OT7A 4ZS2A 2XKOA 1OD3A 1ZBA3 2YXSA 3TN92 3MLLA 4G4FA 1CAVB 1NXD1 1NA1C 2JE8A 1K12A 5FY5A 2B9UA 4UFHA 2WZR2 4P9WA 3RJ2X 2Y6KA 3PUHA 3VV1A 3T1MA 4MG2A 2VUCA 3K48A 5FWEA 4HG6B 2NN8A 3N9NA 5IFTA 1FI2A 2VZSA 2J22A 3BOPA 4Y1VA 5GLTA 2FDGA 4BQ3A 4LEJA 2IVJA 4BZ4A 3QH7A 4OQ9A 3DN7A 3S30A 1PGW1 1CQ9A 1W8FA 4J1WA 4NHXA 2A1XA 4NHKA 3WDXA 1W05A 4Q8LA 1SCRA 3GJBA 3OD0A 5IATA 4U36A 2P4EA 3H8RA 1PO22 2W1UA 4BQ1A 5T5LA 1MPXA 2LTNA 2GMPA 5IAVA 2BRTA 2XVGA 2D3RA 4XDQA 1TME2 3DCQA 4PBOA 1NA1B 5DAPA 1A6CA 5IT6A 2IXHA 1L7QA 3FUQA 3OF1A 1UL9A 2GC2A 1O4YA 2Y6FA 2Y8KA 4Q0VA 3PVBB 4LNVA 1VBD1 3M1HA 3RSJA 2Y0IA 1RC6A 2ZZQA 3E1F1 2HWB2 4QPGC 4RGAA 3RI9A 3SITA 5BNPA 2WNUC 3POIA 2VULA 2CTVA 2XH6A 1UU4A 2DVDA 2YFUA 2YGLA 5C4WC 1R091 4XZPA 3OTFA 3RGBA 1JW6A 5I8YA 1A3KA 2AZ5A 1EY2A 2E9QA 2VBDA 3GCXA 3B69A 3AVSA 1V6MA 1RXGA 3OYWA 4LUMA 5LB6A 4LHNA 2RM22 3ZSEA 2ZJCA 5L9RA 1D4M1 3FHIB 4D6SA 1W8WA 4QKDA 4PBPA 2X5IA 2OPKA 1FX5A 1NQDA 1LU2A 3B5LB 4P9LA 5LY2A 4NRPA 4AEMA 1DQ2A 5JR7B 1RUG3 1UZVA 2OXBA 2Y38A 3LCPA 4GALA 1BQPA 3G6JB 3RG0A 3C7HA 2OUHA 1V00A 2JG9C 4K6BA 2D6KA 4OHVA 5FZKA 4ZONA 1DYOA 3K4AA 3U11A 4N53C 1BJQA 4QPGB 5KXEA 1AR63 1HX6A 2WNUB 1ZREA 2YDEA 1FPN1 2ZGPA 3KS7A 2XQXA 5JXJA 1HRI2 2BOIA 4MH0E 1FATA 3EB7A 3LF7A 1GWLA 5ISLA 3PIJA 2AYHA 4YW6A 5C3PA 5C5UA 1RUD1 2DVAA 5BNQA 1JI6A 2K9ZA 1UD1A 3V65A 3GZTB 1H2KA 5DAVA 1NUKA 3I2JA 2WQ8A 4LIVA 3I2DA 4KG8A 4YG0A 4FAGA 2YZ4A 1TVGA 4LO7A 1IS6A 1WCQA 3O14A 1W6PA 5C3QA 4PI0A 1DBNA 4RQPA 4OI0A 1SPPB 1R083 1JN2P 1VIWB 1C8M3 2HEYF 1GQPA 2JG9B 2DCKA 4TWTA 5FMCA 2XR4A 4IERA 3RYRA 2FCTA 4EE2A 1S4CA 1ZBA2 1OQ1A 3OUJA 5F5QA 3BIEA 3MUZ1 1O4TA 5GZEA 3GF6A 4QXKA 4QKBA 4XIKA 1OLRA 3JCIA 4JDNA 1HQNA 1GOHA 3FJSA 4AAXA 5F7UA 2RDQA 2OW4A 3FN9A 2BBVA 1VBC3 1KITA 5EZWA 3BU0A 3A23A 2W0XA 2R49A 3KCYA 3HT1A 3M2MA 4XTMA 4COVA 5CIRA 3DKQA 2NMNA 2YBPA 5FZ0A 4XJAA 2VNGA 1CZVA 3ACLA 1OVSA 1WW7A 5HCBA 1MS8A 4LBQD 3WF3A 5GZFA 3ROUA 2R0FA 3HNBM 1IQAA 2WRAA 3OPTA 2C24A 1U5IA 5F3EA 2WYFA 3FWEA 3I3DA 2J1EA 4GIQA 3RZHA 1WMFA 3UKNA 2VU9A 3IN9A 4YW5A 1IQDC 1UY0A 5BV6A 4B4PA 2VOXA 1HW5A 1L7LA 2WNOA 3Q8AA 2YPDA 4EROA 4LBLA 4MGSA 4NJ4A 3V0AB 3CBNA 1BXHA 4YW4A 4RHV1 3RMYA 1QHDA 1REFA 1KQRA 4N9HA 3HQUA 4KGQA 5T54A 4NHMA 1XYNA 3N7MA 4XZUG 3KVBA 3ZSMA 1IGOA 1PVC3 3K51A 1N3OA 2P34A 2WQ4A 4QWNA 1DHKB 1TMF1 3QLQA 2HWE3 5AVPA 3ZSLA 2A5ZA 4YWAA 2DCJA 1LOAA 1NCRC 2GC3A 5FXXA 4AQ6A 1POQA 2RMU3 3ZPYA 5JDBA 2Y26A 1YWKA 4RA0A 3VDAA 1E5SA 4XVHA 3TOJA 1U5XA 4AVSA 2V09A 5FRAA 3AL6A 4CCMA 1RUG2 2EF6A 4CXXA 4Z1VA 1XJAA 1UAIA 2RV9A 2VC9A 4OUSA 1O91A 1RMU3 1W90A 3ZM8A 4HK8A 3GBWA 4FSJA 1GSLA 4HVQA 4M3CE 1Z0HA 4CTEA 4F7ZA 2QVSB 1AR62 1MQTC 2W68A 1PMIA 3BPZA 3JB8A 3NNGA 4YVWB 2ZABA 5HCHA 5FY0A 1HRV1 1CAUB 3THPA 3POBA 4IEOA 5A6QA 5C6CA 2XHNA 4DFSA 3AXDA 4JKKA 2HKXA 2DTWA 4XXAA 3POFA 1VRH3 3KV4A 1J3RA 3UGGA 4JKLA 3LZZA 1JZ3A 4Y1YA 2CAVA 3PJYA 2MEV3 2JE7A 1W8NA 1UQXA 2R7EB 2P6HA 3NJXA 4HXCA 2EAKA 4JKMA 5J09A 5CFCA 1A34A 4IV1B 4P9YA 3C2UA 1H0BA 2VMEA 3ILNA 1QJX3 4K21A 4QX3A 4XUTA 1PHMA 1R082 1C8M2 3CDZB 2G9FA 1JYXA 5FO7B 1SEFA 2JEMA 2GH2A 2RS31 1BCXA 2OA2A 3N9LA 4UWDA 5D8AC 4IV3A 3RS6A 2VZUA 2BPA2 1MQTB 1KXGA 2JENA 1O6UA 4OI1A 4CCCA 1VAKA 4NIGA 1C28A 5FV3A 1Q8VA 2PHXA 2ZGSA 1CAWA 3FMGA 5L9BA 1DU3D 4AQTA 1FNYA 1VBC2 4A4AA 5KHHA 3T2TA 1VBC1 2JIJA 2YGMA 3VBHA 4EZHA 2QQVA 1X50A 4LOTA 4UBHA 1FOD3 3LE0A 4PLOA 3D0SA 2ADDA 4CP9A 3IDCB 4H7MA 4Q4V1 4WZCA 4BH9A 1YJKA 1HXS3 2ZEWA 4YM0A 5EP9A 1VBA3 1LTEA 3R05A 2VTFA 1D2SA 3FC0A 2BQPA 4QM8A 4DY5A 3ELNA 1AXKA 1RVF1 2YMZA 3LPGA 4QQLA 1NQJA 1HQWA 2W1WA 4LO6B 4CDUC 4E8CA 4FVVA 1IS3A 4DINB 3THDA 3LPFA 4DS0A 2XQRA 3V0BB 1JH5A 2TUNA 2ETEA 1IG0A 4TN7A 5GKAC 2JDYA 4BB3A 2VW2A 4IEYA 3FHQA 1VBE3 3ENRA 2VD7A 3D0JA 5J7MA 1OA4A 2CV6A 1K5MA 4YZ1A 3RZLA 3OGVA 1X8MA 4XFGA 1W9FA 4XABA 4C1XA 4DRRA 3T1LA 4Y22A 2VVDA 1PVC2 5IK8A 1ODNA 4NIIA 2HWE2 1F4AA 4LE3A 4LE4A 3AMNA 4LQRA 4QAWA 2HWE1 5DUVA 1GUIA 1YQ8A 1Q8SA 5APAA 1JMUB 2RMU2 4FP2A 4WVMA 5K0UC 1H2NA 2DYCA 4UFIA 3WNOA 2A75A 4Q4Y3 5A1LA 3H7JA 4MV2A 2GNDA 3WP3A 4YVSB 2HYXA 2GMEA 3IAPA 4CDUB 4BQ5A 4PLMA 5HBAA 1JZ4A 4JTNA 5LCWL 1RMU2 1NLSA 2Q5TA 5JCTA 1DDLA 3OG2A 1RMU1 1XOYA 3O12A 4A2UA 3VKNA 4ISQA 4HOOA 3O5SA 1DQ6A 1OSGA 1YQ2A 2VW0A 3HD8B 4ARXA 3VHRA 5JPNB 1UZ0A 5FUNA 1Y9MA 2I74A 3GCWA 4YGBA 2WZPP 3MF6A 2C4XA 1DZQA 4GB31 3EBRA 1OI6A 2ZZJA 3D3AA 3IT8A 3TNPB 1VRH2 1PM7A 2R0HA 1UY2A 2V73A 3S7IA 2WSVA 1M4WA 3H7YA 1F4HA 4YNIA 3ZXEA 2J1AA 2R061 2DBNA 5K0UB 1WW4A 4A7YA 1YFXA 2MEV2 2DF7A 5E89A 2RJ2A 4Q29A 1YFYA 1RUJ1 3KV5A 2L9LA 4IESA 3DXUA 4Y20B 1YI7A 2HLEA 1QJX2 5JMOA 4ET7A 5IAXA 4QDSA 1GZWA 2DV9A 2GC0A 3AM2A 4XDOA 4UW3A 3OPZA 1OLME 4TLGA 5DDJ1 3BALA 4COUA 3AXEA 2D40A 3VHOA 4CPBD 4L9BA 1KFXL 3RQ0A 2IXKA 5C4WA 3RWKX 2P3KA 4WZFA 4C0HA 4MXWA 3J7MA 2Y64A 4IE7A 4C90A 2JE9A 2BU9A 5FZ8A 3HJRA 4GMP1 2EXJA 3K77A 5FYHA 3IKWA 5FWJA 2QQPA 1FOD2 1NT0A 4IE4A 1I5ZA 4B8EA 3KZ4C 4MHRA 2W1QA 1H4HA 4HPKA 1HXS2 4FPOB 4M0HA 1OT5A 1IS4A 1VBA2 1HXS1 1OPOA 1RINA 1GZ9A 3NJYA 3ASIA 1VBA1 3KLSA 4NAMA 3ZSJA 4CCKA 4XAAA 3EHKA 1WKYA 2WABA 2V4VA 3WUCA 1H4GA 4FI9A 4E4HA 2JG9A 1ULGA 3TEXA 2WYSA 2IFWA 4CEWB 4N53A 1POV3 3ZFGB 1EYBA 3LOBA 3H50A 5F37A 1YEWA 1MZ6A 2ARCA 2XXZA 4JRLA 1VBE2 3WDUA 4JCKA 4EWEA 1PNGA 3I54A 2R32A 4C8DA 2D44A 1UMIA 4I09A 1YQ6A 5FPXA 1QDOA 2XOMA 3AKRA 2IXCA 2Y6HA 1N3QA 1TE1B 2IVIB 2C9AA 2B8MA 2WQZC 5AC93 1FYUA 3OGJA 3NO8A 3OD4A 1UOFA 2BNNA 4MZUA 5KHKA 3AZZA 1GANA 2WO1A 1AYM3 3LB9A 3O7OA 4Q4Y2 3VZKA 4BOWA 3NQHA 4Q4Y1 3RNSA 5T52A 2BFUL 2BWCA 2FMYA 4KQ7A 3WDVA 3B94A 2ZS6B 3WV6A 4Q1RA 3MV11 1LJ7A 4TSVA 3SNMA 1ZZ7A 2JD9A 4L99A 4AVBA 2E53A 3N36A 3OGRA 4RL7A 2XL7A 4INDA 3GHNA 4XACA 4OMDA 3QCWA 5SV5A 1S0BA 4PDWC 4FXKB 5B4XA 1VALA 2IXIA 1XYOA 3K3NA 5CKQA 3ATGA 1AYN3 1ZX5A 3BTAA 3NW4A 4MGQA 1ND3C 2KM2A 3CU7A 2RS51 4Q26A 3R0RA 4A44A 2IC1A 5I0UA 1SLAA 1XRUA 1ENRA 1TNFA 2B46X 3VDDB 5ACA3 2E51A 3AFKA 2WNVB 5FZHA 2VCAA 4M3CB 3ST7A 1FV2A 2VOTA 3RPQA 3J7HA 4CE8A 4AHXA 2GSYA 1P8JA 1G9AA 1TZOA 4LPLA 1ZA4A 4Y1UA 4XFAA 2Q8CA 1LOBA 5JOYA 4FPHA 3DXTA 2ZX1A 4KWLA 1GWKA 4NN0A 4YW7A 2J1VA 3ORJA 5FZ4A 4DEQA 1JXNA 3IZOA 4GQ7A 4AHYA 4LBQA 5FZLA 2VW1A 5FOBB 3MPPG 1V70A 4HZFA 2QJVA 3ECQA 4LO8A 3I59B 4BLIA 5A80A 4UXAA 1IS5A 5FYSA 4DOUA 1CAUA 1GZCA 4N8MA 1URXA 1ZBE1 4PIXA 1ND3B 4WVWA 4AWDA 5CA6A 5GM0A 3USUB 5AFBA 1W3VA 4IEQA 4IEZA 4QPIA 4URAA 5KHJA 3ACFA 2XVLA 3U14A 1SLCA 4AGVA 1NCRA 2OVUA
chains in the Genus database with same CATH topology
1Q8OA 1UPSA 2KXLA 3AMPA 1W6MA 5JMCA 4I3PA 1V9U1 1AX2A 3WUDA 4K8FA 5A32A 1YXWA 3WW2A 3ZX7A 2ZGOA 3HR9A 4QGMA 4MXVA 5D1IA 2VUAA 1POV1 4RS5C 4QQ2A 4NOTA 1LRHA 5E8AA 4B4RA 2JG8C 4G3YC 2UYBA 1LEMA 3VBRC 2BNOA 1MS5A 4NR1A 4E4ZA 1V6KA 2ZGKA 3ZXLA 4H55A 2VVEA 1YCIA 4D3WA 4HVOA 4MGKE 2Q4SA 5I8SA 5AC92 1JYIA 1GFF2 5DUWA 4N7UA 1ND2C 2XJVA 3VZOA 5JI7A 2CYFA 3VKMA 4DPNA 2JECA 1AYM1 1F8VA 3POWA 5J36A 5H9PA 1XNKA 4WM7C 5IK7A 5JI9A 2BYVE 5D8AA 4H14A 1AF9A 3J4UH 3ZXDA 3AJYA 5I93A 4RS5B 3CJIA 2QZ2A 3VBRB 1Y7BA 3OY8B 4GULA 4D7TA 1PZ8A 1SQ4A 1N1TA 1PK6C 4W6XA 2E7TA 4XPVA 4KL1A 1QJY3 1AYN2 2P3IA 4I30A 3DKWA 4QGLA 1J58A 5BYNA 1C5IA 1F5JA 3FUOA 2IZWA 3O0WA 5FQ0A 1LESA 3UK9A 3MGUA 3LSEA 5ACA2 1ND2B 5LEKA 3N7JA 4Y24A 3I4IA 5JOZA 3B7MA 5GJ6A 4IEVA 5JPMB 4WM7B 1W6NB 3KD4A 4AG4A 1VR3A 3MIEA 4RR3B 5DUXA 5IK4A 1Z7S3 5GLUA 3IPVB 1FMD1 2ARBA 2D6OX 4BE3A 1ONAA 5CADA 2YY1A 3AYAA 1OA3A 1NOVA 1PIV3 3LA2A 4K1ZA 4C91A 1VLNA 1FNZA 1RJ8A 4URTA 1OOPB 2HWF3 2ES3A 1GQHA 3H3ZA 3D6EA 4AVVA 4XBQA 1CAXA 5K0UA 3AYCA 1COV3 4CDWC 2E7QA 5FOJB 1BZWA 2PAEA 3SH4A 3HWJA 4P9GA 3MLKA 1LGCA 2XJSA 2Z5WA 1QDCA 3AP5A 4ES8A 3MYXA 3VL9A 4J1XA 4XF3A 2G4IA 4FOQA 1I1EA 3VBFB 1NCQA 2PYTA 1WGPA 4XJ8A 2PLV3 2JDZA 4MYEA 4GWMA 1CD3G 1QH7A 3PNAA 2E63A 3E6DA 4HBNA 2WT1A 1N1YA 3NV4A 5AFEA 5JZGC 4J6GA 4JGYA 3AYDA 1W6OB 4XQ4A 3N7KA 4K7JA 1WMEA 2ZMKA 3ZYPA 4XMIA 5BXXA 1WLTA 2WFF3 1QJU1 2E6VA 3AP6A 4ISRA 5L19A 4K3UA 4XMAA 3USSA 2CWMA 4IEPA 3R4SA 2XLFA 3JD73 4HKWA 3FFQA 1DG6A 4WM8B 3C3VA 4I2OA 4L97A 5JOXA 3PTYA 1S2BA 1W6QB 2ATFA 4AQ2A 4KWKA 2VMHA 1QJY2 4IL7A 1QJY1 2XLAA 3AMMA 4G9SB 4XILA 4XF4A 5CBLA 3WXPA 2D6MA 4C1WA 1CGPA 3WHUA 2QUOA 4PLNA 2VH9A 3TN91 3ZFEC 5ABJC 1LEDA 2WJSA 2WZR1 2XJQA 4YG3A 2D3SA 1ULDA 4FOYA 4YSFA 3EJKA 3WP6A 2ZAHA 4L11A 2R30A 3WG4A 4FTBA 1Z7S2 1HLCA 3W59A 1MS1A 1CVNA 3MW3A 3B00A 2DVBA 5KHGA 3KB5A 1PIV2 3L9JT 1PO21 1PIV1 1QOSA 3JBG3 3WD5A 3L2HA 4YGCA 2HWF2 1DQ1A 3I7DA 4R9AA 4BIOA 2DU1A 5T5PA 5I91A 4XEZA 1TME1 2QCSB 5H9RA 3ZFEB 3VGIA 1COV2 4Y26A 5ABJB 1PGL2 2H0BA 3B3QE 1J3PA 2GU9A 2UWCA 4CDQB 2WKKA 2A6YA 2HWB1 3SHRA 1UN1A 4LBKA 1G9CA 3CO2A 4GXLA 2JD4A 4F83A 4XF0A 3MZHA 1F9KA 4Y4YA 4Q4X2 4R4XA 3EO6A 4BYYA 2JXAA 4PDWA 2RJLA 3POSA 2RM21 1TNRA 3GYDA 2XWJB 2ZAAA 4B7KA 3KM5A 2PLV2 1BBT3 2PLV1 4TLFA 2WNEA 2WIIB 1VP6A 4XFBA 4LBNA 3USUA 2YUEA 1V6OA 1B09A 4GH4A 1EP0A 4LT5A 2X8KA 2VG9A 1XU2A 4WV8A 3IM0A 5A33A 3MW4A 2I07B 2O8QA 3RMXA 2P37A 3ZN4A 2E7AA 4X6QB 1UIJA 3FBMA 1QWRA 3MIBA 3VBOC 3POYA 2EXIA 3NAPB 2R073 4LBJA 1OFSA 5CG8A 5IUQA 2PN5A 2DCYA 2WFF2 2QZ3A 4YGDA 3ZXKA 1HRI1 5HI0A 2OUJA 3BIWE 1XE7A 3JD72 1H1MA 2B42B 3JD71 3ZYRA 4E2GA 3ZN6A 4AI1A 5C8CA 5SV8A 5L7OA 1ZRRA 2ZX3A 3VBSA 5EYXA 2PAKA 1CPMA 1YLLA 1WMDA 2LM3A 1O7FA 2G9GA 3IWZA 2DCZA 5LRRA 3VBOB 1ZBA1 2D97A 1ZRCA 2PAMA 2WFPA 4DMIA 1MEC3 1ZZ8A 3AJZA 4XJWA 4W65A 1AL0G 5FO9B 3VBUB 1SBEA 3H9AA 4Z82A 3IDBB 2ZHKA 4XIOA 1QOOA 4S2GA 5A3MA 1MZFA 2FQPA 2JG8A 4LA3A 4XHXA 1J1LA 1ZRFA 3NV1A 2PHFA 1JBCA 3WDWA 3H1YA 2ZA9A 3CJXA 3JBG2 3D8CA 4XOGA 1V6NA 1HV0A 3MDPA 4Q0SA 1O4ZA 1ALYA 3NV2A 1Z78A 4CYDA 2EIGA 3VUOA 2WT2A 2R6QA 3B93A 1O3RA 3D4KA 1MACA 4WM7A 1UPIA 4JVAA 4PQ9A 4YVWC 3B9CA 4QQOA 3NV3A 3NSTA 4DY3A 2K0GA 1NY72 1OQEA 4XETA 1ENQA 2D98A 1KJLA 4AVTA 4I3GA 2ZX4A 5KHIA 2X53S 1NZCA 1PK6A 4A3XA 3VHPA 2VECA 3R6SA 1WLDA 4B29A 1UX6A 1BBT2 1YHFA 3QOPA 4IV1C 1FV3A 1RUG1 4L2NA 1OLQA 1RB8G 4FOWA 1SMVA 4M0NA 4Q0QA 4HK9A 2O8OA 4MGZE 4GMP0 1WW6A 5CG9A 2R072 1AR61 1LCLA 1D4VB 1ZZBA 1R1A3 1C3HA 3VZMA 1AJKA 4R52A 1S0EA 3ME2A 1BKZA 1V6LA 4FXGB 3J8F3 3R4DB 5K7PA 5KWRA 3AKSA 2Z42A 2EXHA 5FPZA 1PNFA 1H8VA 4JGZC 1SCSA 4MGYE 4QPYA 2DURA 5DG2A 4JC1A 1KS5A 1PZ9A 3M3IA 3PJQA 4FQZA 4EN8B 1R081 1C8M1 2ZTNA 3W58A 2EALA 1MS3A 1RUI3 4CDWA 5FMOL 5T55A 4AFMA 1MEC2 3CLPA 1H1IA 1HKDA 2H6BA 4MVTA 1RIRA 4EN6B 4YARA 3M3OA 4AYUA 1DGRN 4AEDC 4ATEA 4Q0PA 2FZ1A 2A70A 2IXLA 4XJ9A 2YV8A 5LK7B 2QFEA 4AF9A 4XHBA 1YIPA 4JGZB 4L8QA 2BUKA 2A6VA 1H2LA 4B4QA 5A3LA 2VOKA 3WG2A 4I0BA 2PHLA 4YVSC 1UF2C 3MW2A 2YHJA 5JZGA 1LHVA 2ZX2A 1XNDA 2Z79A 4H3WA 1CAVA 5J48A 4FTSA 1RUOA 3S0MA 4KH9A 4LHLA 1AR83 1A78A 1SBDA 2HWC3 4AEDB 4BMEA 1LULA 5I0RA 3DPRB 1PVC1 1WLWA 2N7GA 1U5ZA 3GBGA 1YO8A 5FFOC 2RMU1 4JTOA 1YUDA 4BMBA 1UU6A 5CFDC 2ZGTA 5J37A 3H3UA 3ZYGA 1UIKA 4N43C 4W6YA 1RHI3 2Q1ZB 3DF0A 4MUVA 1U12A 1ZYBA 3B02A 3TWIA 2PHTA 5E16A 4LO5B 5F6KA 1NA1A 4MLOA 5GALA 3ZXAC 1Q8QA 2IWGB 5J96B 1QXJA 4OLLA 3UJOA 4EN0A 1R1A2 1CN1A 5FLJA 3WT3A 3OBTA 1S0GA 3J8F2 1EPWA 1VRH1 4HANA 4NWVA 5E88A 1IPKA 4UBGA 5JIAA 2ZMLA 4O9GA 1J3QA 3NWKA 5CFDB 4YM3A 4Q2FA 5BNNB 2MEV1 4N43B 3PVNA 1I9RA 4HL0A 4XQDA 4KBBA 5EV7A 1REEA 1ENXA 3QBQA 1QJX1 1LHNA 3PVEA 1N3PA 4I02A 3ES4A 2VMIA 1APNA 2W52A 3GALA 4KWJA 1RUI2 4BHPA 4CEWC 2XBO3 4QPGA 3ZFGC 3TAYA 2WNUA 5BPXA 5DXDA 3JU9A 2Q8OA 4AHZA 2C5DA 4XJUA 2XJPA 1H1AA 1QF3A 4X6RB 4CZSA 3VN4A 1FOD1 2AUYA 3WP4A 4AVCA 5JVVA 2Y0OA 2V5YA 1UCXA 1G86A 5FTTC 2ZGMA 3UV9A 4JQRA 3PMSA 4SLIA 1ASJ3 1HV1A 4FPYA 1QQP3 5C9AC 1AR82 5L73A 5T5OA 1VBE1 2HWC2 4OI2A 2CWSA 4Y5Z0 2PQQA 3KGZA 1ZZ6A 1QXPA 1H9PA 1C1LA 1W0PA 5GZDA 3HT2A 4AXOA 3VDDC 4OHWA 1IOAA 2UY9A 4AI8A 2WNVC 4BLJA 2YYOA 2ZGNA 3VZJA 1RHI2 2B45X 4YM2A 1RHI1 3LAGA 3B01A 4XQWA 1IKPA 1C8NA 4ZXKA 4XW3A 2WA3A 1VAVA 2TEPA 4Y1ZA 3WVJA 1B35B 4XF1A 3WQ0A 1RL3A 4AQSA 4OHYA 5C9AB 3V0AA 3NKGA 2QE3A 2VY0A 2R16A 2C1FA 3ALQA 3HN1A 3AB0A 4CDXC 3GNEA 2CNAA 4F8AA 2ZGLA 4AEJA 4K40A 2Q0AA 4NPRA 4XBLA 2F4PA 3JUUA 4IETA 1FXZA 3E6CC 2VNRA 1WBFA 4HETA 1RUF3 3VKFC 3RYPA 4LR4A 2DVFA 5GLVA 1JUIA 3N7LA 3ZYJB 4LTAA 4FCAA 4DXZA 2X5IC 4YZ4A 4AI0A 2XBO2 2A3WA 2ZKNA 4YVWA 4CDXB 3WG1A 3NJZA 3ETQA 4QU2A 3WHTA 2XLGA 3AMHA 5BNPB 3JQXA 1DQ0A 1LECA 1DLLA 2XUMA 1REDA 1YYNA 4HSJA 1FT9A 3QD6A 1UKGA 1GNHA 2B39A 3VL8A 3BU7A 4MSVA 2ILMA 3OYWB 4IV1A 1SFNA 4LO4B 1GBGA 4N9IA 4TZDA 3MIDA 4Q8KA 2XKPA 2ZPXA 1AHSA 5I0SA 4QHBA 1MVQA 2X5IB 3FLPA 1LU1A 3ILRA 4AFCA 1LGNA 1RUC3 4FAHA 1BVVA 1MQTA 1ASJ2 4AFBA 4BPZA 1WBLA 1QQP2 2ZHLA 5GZCA 4ZU5A 5KXCA 4R8HA 2HJIA 1R1ZA 4XJZA 3E5XA 3MIFA 3KT4A 2AR6A 1VJ2A 1Q3EA 1S55A 5AC91 4AFDA 5JAXA 2PHDA 4CP1A 2Q30A 3UL2A 2A3XA 3V64A 2D7FA 5H9SA 1W6PB 3V0BA 3M4FA 4RQPB 1C4RA 4RR3C 1G9FA 4R9BA 3DL3A 5C33A 1PZ7A 1EV13 4XFFA 1GYKA 3HAGA 2P3JA 1XYPA 4LBMA 1AYN1 2YC0A 2FBEA 1KJRA 1OOPC 3FLRA 5EWSA 2W08A 2GN7A 2Q1MA 3CEWA 3WDTA 5ACA1 3X29B 2SBAA 2XPJA 2PHWA 3WX5A 1QXRA 4HN1A 4YVSA 1RUF2 3APBA 4CDUA 1RUF1 3PMEA 4EN9B 1PO13 3INAA 1BEV3 3E6BA 4ASMB 1BK1A 5T50A 3D5OA 3WINE 2BW8A 2H6CA 3VBFC 3OJBA 4CEYC 4ORFA 4V1PA 3IIAA 1S1AA 4FP3A 1OD5A 1X36A 2MPFA 3M3EA 1WW5A 1D2QA 4YM1A 4EWAA 1RUH3 1Q8PA 3AYEA 5C8WA 4Y20A 5HCFA 4OULA 1KDMA 3SXWA 4Y1XA 5F1RA 4MX3A 4BWOA 4WVZA 5FDBA 3J26N 4Q4X3 4DNYA 3G7DA 4QX5A 1RUC2 1RUNA 3R4UA 4CEYB 4WM8C 3VZNA 3AP9A 3S6PA 1BMV2 1OHFA 2EXKA 1GKBA 2XVKA 2ET1A 1VBD3 4XBNA 2D5HA 4IV3C 1RUE3 3H0OA 3KQRA 3WOGA 2D6LX 1R093 3QACA 4N90A 4CRQA 5KXBA 4N7IA 1J1TA 3OCPA 1AX0A 3VBHC 4OHZA 1D4M3 2GMMA 1D0HA 3H1WA 1UU5A 1AXYA 5FREA 3UKTA 5CFCB 1SLBA 4Q0UA 1G8WA 4CEWA 3Q9OA 3ZFGA 3UJQA 3WNXA 1Q5OA 2ENRA 2R1DA 1W0OA 1SFYA 3AKQA 1EV12 2RR13 4R9CA 3VKLA 3GBFA 1EV11 4IV3B 4Q27A 1DGRA 1OKQA 1LKNA 1FPN3 5DZEA 4PIYA 2D5FA 1X8EA 1LODA 1KFUL 3FZ3A 1RTVA 1CAWB 2QDRA 2SLIA 4QGNA 3OBRA 2GC1A 1XNCA 4FPKA 1RUD3 2XG3A 1E57A 3VBHB 1T6GC 4LBOA 4YFZA 3ILFA 4YG6A 1QKQA 4CDQC 1NG0A 3VKOA 1JTZX 2XJUA 4YW1A 1O3QA 2WS93 1SLIA 1PO12 1BEV2 1A8MA 3SH3A 1BEV1 4XFCA 2VOWA 3V56A 4F3JA 1Z7S1 2BGCA 1WCSA 2LALA 1EAH3 1V6IA 4AGRA 1WCDJ 3MEPA 5HXVA 1F31A 2BWAA 2HWF1 3DV8A 1U0AA 1YRZA 4YRDA 1DGLA 1K5MB 1TEIA 3VDDA 1RUH2 1WLCA 1RUH1 2WNVA 4D7YA 4M3CA 1KRIA 1X7NA 2ZBJA 4Y22B 1COV1 2NMOA 1PGW2 1PGL1 2KA3A 2RE9A 3NAPC 4IQPA 3OGGA 2F6BA 2PFWA 3AP7A 4WVMB 1KDKA 4XE9A 3SH5A 4NO4A 2D6NA 1O5LA 4K1YA 1BYHA 3ZXGA 4FPCA 4Q4X1 3ZMNA 3WQ7A 2TNFA 4RD7A 3NL1A 4XFIA 1LOCA 3EQEA 3I59A 1SDWA 2JKBA 4CDXA 5BNOC 1ND3A 1VBD2 4QT6A 4AFAA 5GZGA 2WLQA 1RUE2 4RHV3 3RWNA 1RUE1 1R092 3LA7A 3IDEA 4XYXA 4COYA 4DZGA 1DIWA 1TMF3 2BVVA 3LSDA 1D4M2 4FOVA 4Q4W3 2WFF1 4JV4A 4KNCA 2WSUA 2PTMA 1ZRDA 3VBUC 1C57A 2K2SA 3WP5A 3A0KA 1KS4A 1XQNA 3IBMA 2LUWA 4I01A 1LHUA 2AENA 1GZWB 3VHNA 5BNOB 2RR12 2RR11 1XU1A 4COZA 1WA4A 3ZMOA 1ZVFA 1FPN2 4HLTA 3WQ1A 1G6NA 1H2MA 3I8TA 1HRV3 2A6ZA 4M00A 4U2AA 1VB2A 3PHMA 4GWNA 5C4WB 1LOFC 4MXWB 2R043 3ZXFA 2D3PA 2VXRA 1MS0A 2CAUA 1RUD2 3RDIA 4YW3A 2W39A 2ZGQA 3WW3A 3MI8A 4HPKB 1DZTA 5IK5A 2WS92 2WS91 5DZGA 4EN7B 4XXPA 4JAAA 4RS5A 3HQXA 1RGSA 3BCWA 2BVBA 3VBRA 5B2GB 3OY8A 1EAH2 2RS33 3BB6A 5K8SA 1HDKA 1EAH1 3URFA 4Z8BA 2BFUS 1XNBA 3DUIA 4N53B 3ZN5A 5JWPA 3JBG1 1I6XA 4OFGA 1QNWA 4YLZA 2AGSA 3MFCA 1ZM1A 2B5HA 1ND2A 3BOWA 3MLJA 5FLHA 2D6PA 1C1FA 2Z69A 5F9TA 4Q4V3 3RI8A 1W6NA 1HIXA 2QDNA 2QKDA 1H8TC 3AK0A 3WG3A 1GICA 5L36A 2XGXA 4NHLA 1NY71 5EJ3A 3ZVXA 4FPFA 4RR3A 2AREA 3N3HA 4LHKA 1RVF3 5EXOA 1CX4A 3IPVA 1AX1A 2D43A 4AE2A 1G7YA 2DVGA 1VBB3 4YZ2A 2TBVA 3SLIA 3E97A 1BBT1 4E4SA 4HMZA 1LOGA 1OOPA 1DGWX 1O3SA 4RHV2 2YROA 1JOJA 1CIWA 1A8DA 2HEWF 4FPJA 2ZCWA 1GR3A 3AZYA 2EAAA 1TMF2 4QPIC 2WL1A 3M70A 4KG0A 1H8TB 2R071 4Q1PA 5DUUA 1QU0A 3P3PA 2CGOA 4Q4W2 1MZ5A 5GLWA 4Q4W1 4YYOA 1DZRA 1LR5A 4HN0A 1CONA 1QGLA 2X29A 4LULA 4B7EA 3VBFA 5BUVA 4E4DX 4CEYA 3M3QA 2FMDA 4PJYA 1S0JA 1IHMA 2XJTA 2YPJA 4LBQB 2OZ6A 3LKJA 4QM9A 3WR0A 2VPVA 3A0NA 3MF9A 3J9SA 4OVEA 3AP4A 1HRV2 3AMQA 4E2QA 2QNKA 2R042 5EYYA 4GB33 3KT1A 2R041 1W6OA 4QPIB 2IXJA 1UW8A 3ZO0B 1NCRB 2VOVA 4H7LA 1MEC1 2R063 4YZ3A 2EVXA 1G9DA 4HFSA 4BIFA 1RUJ3 2DU0A 3AZXA 4S2DA 1QJZA 1W6MB 1W2UA 3DPRC 4WM8A 4B3NA 1NLRA 5A32B 5I8TA 5EFUA 2H0VA 2RS32 5HCAA 1W6QA 1AR73 3LA3A 5DDJ3 5J98B 4AI3A 1L3JA 2VVFA 4ES9A 3CJIC 1QMJA 3VZLA 5GLZA 3THTA 4AVAA 4LLFA 4UW6A 3FX3A 2C0ZA 4GMP3 5I0TA 5FBZA 2VQ0A 2ZX0A 4META 1U5YA 1Y3TA 2ZMNA 4Q4V2 3WLUA 2RHPA 4YW2A 1SACA 1AR93 1WD4A 4HKOA 4QQPA 4D69A 1CR7A 1RVF2 3KT7A 2VMGA 2JX9A 5T3NA 1GQGA 4COWA 4EWDA 5D8AB 1LB2A 3JB4C 1VBB2 2GAUA 5BNNC 1VBB1 1GLHA 3A4UA 4AGGA 3M8LA 3KCXA 3LWCA 4JDMA 3CJIB 2UY8A 1OMIA 3ZIWA 3E5QA 3KSCA 4UW5A 3ZFEA 1QY4A 3PVOA 2ARXA 2DUOA 4M01A 4C0BA 5ABJA 2WA4A 4JRAA 4EV0A 1KD7A 4TYSA 5FQ0B 4CDQA 3ZFFC 1X33A 4XFHA 2UURA 1DQ4A 3MICA 4KU7A 1R1A1 3UKVA 4P5HA 2VQAA