3FHKA

Crystal structure of apc1446, b.subtilis yphp disulfide isomerase
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
147
structure length
147
Chain Sequence
SNAMSMAYEEYMRQLVVPMRRELTGAGFEELTTAEEVENFMEKAEGTTLVVVNSVCGCAAGLARPAATQAVLQNDKTPDNTVTVFAGQDKEATAKMREYFTGAAPSSPSMALLKGKEVVHFIPRHEIEGHDMEEIMKNLTAAFDAHC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0403 protein yphP
publication title Structure and function of Bacillus subtilis YphP, a prokaryotic disulfide isomerase with a CXC catalytic motif .
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 58
structure length 147
sequence length 147
chains with identical sequence D, E, F
ec nomenclature
pdb deposition date 2008-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06491 Disulph_isomer Disulphide isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3fhkA02
1XFLA 1QGVA 2WS2A 5G31A 1S3AA 2H75A 4XRDA 1AQWA 3Q19A 2H70A 2QKEA 4POMA 3HXSA 2HT9A 4QQ7A 1TDIA 4F0CA 1OC8A 2H1DA 3IPZA 4KDUA 3UVHA 3G7YA 1V98A 2XBIA 4JE1A 4Q5RA 2RIIA 2TRXA 5IOXA 1K3OA 2KHPA 2LTKA 4J56E 2DJ0A 1JLWA 1GH2A 2OACA 1FHEA 2IMDA 3TJJA 1C72A 1LU4A 2JSZA 3MNGA 5JWOB 3LEFA 4KNDA 1GSDA 2OA7A 1SKWB 2MYGA 1M2DA 1S3CA 3BOAA 1Y25A 4L0UA 1HQOA 1A0FA 2C0GA 4I5QA 3GSTA 2AYTA 3RHCA 3WYWA 3CXGA 1TI3A 1XPVA 3DEXA 1BG5A 2ALBA 2FHEA 2R3XA 2RLIA 4EDYA 4KE3A 4PUFC 3ZFLA 3EURA 1V57A 2FA8A 2VO4A 3C8EA 1OVNA 1YY7A 1SJ6A 1SL0B 1WJKA 1U87A 1GL8A 2PN8A 3GNJA 3RPPA 4K8MA 3A2VA 1X0RA 2WJUA 1M7TA 3HVXA 5HFKA 4KCAA 11GSA 1O7UA 3VPTA 1PQNA 4K6XA 5C04A 4HEA2 4MLYA 4WR4A 4NHWA 4X0XA 3NIVA 5J4UA 1AUCA 4MZCA 1U6TA 2HRNA 4MH3A 2ZUPA 2P5RA 2MMAA 4G10A 1N2AA 2K6VA 5GZZB 3DVXA 2IL3A 1XWBA 4Q5FA 2L5LA 4MMMA 4ULXA 4HJMA 5HR1A 3UOMA 3M0FA 1V2AA 22GSA 4TN8A 3UBLA 5FHIA 3NZNA 3A2WA 2DJ3A 4YAVA 1AQXA 1Z6MA 3U5RE 4F82A 1XBSA 1K0OA 3GH9A 1A8LA 2HSHA 3GX8A 4FYCA 4AJ8A 2AHEA 1F6MC 4AJ6A 2YWNA 4RI6A 4LMWA 5J41A 1A8YA 2CVBA 1ZOFA 1O8XA 4JR4A 1MTCA 5EL8A 5KEJA 4V1Ag 2ES7A 2B5XA 5F05A 3C1RA 3I6AA 1R7HA 2O85A 1AIUA 5LNKe 2M46A 2H72A 4YQMA 2AJQB 4F03A 4N0ZA 3AY8A 2XC2A 1B4PA 9GSSA 2LV3A 2A2RA 2K8SA 5A4VA 4ISDA 2V2GA 3GN3A 4V2MA 1HNBA 1FVKA 5IIZA 1BYEA 4CW9A 1ML6A 3BJ5A 3GIXA 4TXOB 3QAWA 3TOUA 2L6DA 3ZITA 1F3BA 2E7PA 18GSA 1F2EA 3KH7A 3A2XA 4CDOA 3FR6A 1TRSA 3FYGA 3H4KA 4ML6A 3TJFA 2H74A 5DDLA 5COHA 2LS5A 1K0DA 4IKHA 2P5QA 3ERWA 3ISOA 2LJKA 3ZRDA 5GSTA 4DSQA 4F0BA 4GF0A 2IMEA 3ZTLA 2ON7A 2X64A 4ZBDA 2CX3A 2VLVA 2H71A 1GTUA 1XOBA 2JZSA 4ILFA 3GFKA 1GUMA 3QFBC 3FEUA 1OC9B 2V41A 1B8XA 1YF0A 5ECRB 1WWJA 1XCCA 5C00A 3GSSA 4IP6A 1G7EA 2DMLA 4K0NA 1URMA 1ON4A 5ECLB 3IDVA 2LJRA 3FK8A 2GDRA 3UMAA 4D73A 4FIWA 3M1GA 4OFTA 5G2ZA 2VOCA 1TK8B 3F4TA 4POLA 4AGSA 4PQIA 2WULA 3FW2A 2YOIA 5HQPA 4XS4A 2PU9C 1TW9A 3TJKA 1SJIA 1ZL9A 3ZIVA 5ECMB 1O81A 2H19A 1TJDA 4TW5A 3EWLA 4MK3A 4O92A 1TKDB 3ZMLA 2GQKA 1X5DA 4P3YB 4XTSA 1XWAA 3ME7A 1XZOA 1SYRA 2VL2C 1YZXA 3KCMA 1GUKA 2AAWA 5D9XA 4TXVA 17GSA 1M0UA 5IO2A 1Z3EA 2JU5A 5HFIA 2YV9A 3F63A 1SK1A 4K0GA 4KH7A 8GSSA 3ZYWA 3KMNA 2L6CA 1TU7A 5H5RA 1SJZA 1Y6EA 2PGTA 3LFLA 3UJ1A 3EU4A 4TR0A 5D73A 2IFQA 3UBKA 2QGVA 4HQZA 1JFUA 3BCIA 2HSYA 1U3AA 4AF2A 4Z7XA 4EXJA 3G7JA 1QQ2A 2B7JA 3L78A 4KA0A 1GSYA 3MDKA 5CP1A 5CRHA 2I81A 2DLXA 3IR4A 4ACSA 3RPNA 2DJKA 1K0AA 2VLTA 2VM1A 4NXIA 1J0FA 1O8WA 4J57E 2ZCTA 2FWEA 3TKPA 2BMXA 3H8QA 5G1KA 4ZIJA 2KOKA 1EEMA 4TXOA 5DAKB 2GQMA 1H4OA 1JZDA 1HD2A 3S9FA 4TRXA 5IMZA 16GSA 5CAXA 4MZWA 4MP4A 4IJ3A 1TK0B 4PNGA 2CAIA 4TR4A 5CNWA 5D93A 3L0HA 3WGDA 2PVOC 3HZ8A 3LXZA 2GSSA 3VWVA 5L71A 3W8JA 2X99A 3VWWA 2P0GA 2NVLA 3G9BA 4MJEA 6GSYA 2GZPA 1T8EB 1UA5A 1NSWA 2LJAA 5IQYA 4XIHA 3RBTA 2MBTA 1T7PB 3GTUA 1M9AA 3V1WA 2IMKA 4MF7A 1THOA 1B48A 2F3MA 4V2NA 1GNWA 3VWXA 1PX7A 3KIJA 5F8BA 3WT2A 4BVYA 4CHSA 1X9WB 1T1VA 1YQ1A 2GVPA 4G2EA 4DSRA 1SKRB 5CREA 2N5AA 1QXHA 6GSSA 1X9MB 2VIMA 5AIXA 2VM2A 2FWHA 5KN2A 5J9CA 4GSTA 2REMA 3H79A 1TOFA 4TOPA 3SBCA 1TP9A 2VD0A 2TRCP 2XHFA 5HR3A 4HI7A 3VK9A 5ECKB 1ZMAA 1X5EA 2PUKC 1M2AA 5DCGA 4BL7A 5ABRA 1WRYA 3JCML 1NHOA 1VF1A 1GNEA 3GH6A 4ECBA 3IC4A 4KGIA 5GAND 2MMZA 5INYA 1OE7A 3W8SA 2NPBA 2L4QA 2KUCA 4O7HA 3GKMA 1DE1A 4OO4A 3WGXA 4XS6A 4HJ2A 4ZXGA 1XWKA 3QCPA 4ZB9A 1SD9A 4KCEA 1WP0A 2CAQA 5IO0A 1UN2A 2PWJA 4F2IA 1K0CA 2B1LA 1GSQA 1GUHA 3WD6A 4IBPA 1B4QA 4LA1A 4MABA 1BQ7A 2E0QA 1O85A 3P8WA 4JR6A 4HZ2A 4LMVA 1XOAA 5IMFA 3FR9A 2HNLA 4I97A 4OD7A 2DIYA 2C0DA 4RQXA 2YNXA 1MD3A 1SK0A 1XW9A 3LSZA 4I2TA 4I8BA 5JWQB 2PMTA 1QMVA 3GYKA 5CRDA 1OKTA 5ELGA 2OE1A 2FCHA 2FD3A 4EDZA 3F6DA 5DVBA 4OCEA 2M80A 2HYXA 1WOUA 3PH9A 4TKYA 4JBBA 5IMVA 1ERUA 1WE0A 2R5GA 3UEMA 1FW1A 4X1UA 2QSIA 3IE3A 1A0RP 2B6MA 3KP8A 3L9SA 4PGTA 1OYJA 3ZLPA 4IELA 3F9UA 4ECCA 4KDYA 1ERWA 4EVMA 2OE3A 4N10A 4HS1A 3EINA 2H73A 2LNSA 2I1UA 1EV9A 5IMDA 4HU9A 2C0FA 5J5NA 4RQRA 4GRFA 4YH2A 4MJAA 3GRXA 1G6YA 3P2AA 3CSIA 4NPBA 5G1LA 2J23A 1Z7PA 3FKFA 4DSSB 1MDJA 2K9FA 2X8GA 3HCZA 3O3TA 1TXXA 2HI7A 2DBCA 3LORA 2IN3A 1I5GA 2JZRA 4IQAA 3DVWA 4L0WA 5EPFA 1TU8A 2V32A 1MDKA 2LRCA 1F9MA 2G0FA 1F3AA 1SU9A 2TIRA 2VL9A 1XW5A 2OBIA 1R26A 3D5JA 3IAM2 2RUEA 4FYUA 1JHBA 1YKCA 3TB2A 3C73A 5DALA 3J7Yb 5DCHA 5KN1A 2I4AA 3C71A 2DC5A 2H1GA 4O5RA 2EC4A 2O89A 4GCIA 1EZKA 1DE2A 2YP6A 3DMLA 2GZZA 4E8HA 1G6WA 2GS3A 5IMCA 2YWOA 1ERTA 5JCWA 3IBHA 4EE0A 1VF4A 1RQMA 2WB9A 4K2DA 2QC7A 3KXOA 1GSFA 2IPAA 3HHVA 4KAEA 4PQHA 1ZGNA 1S3DA 3H93A 1EP7A 1XVWA 4MJCA 1K3LA 1SYXA 4EF0A 4WKWA 2RM6A 3KJYA 3TJGA 3GKNA 1CQGA 1CQHA 5ECQB 4MF5A 3GURA 5CRWA 2F51A 2VCTA 4ZL9A 2FY6A 5ID2B 2R37A 3ZREA 1W89A 3O76A 1XWCA 3EU3A 4WF5A 2O8VB 1TK5B 1GTIA 3D22A 3M9KA 3QMXA 3TKSC 2VLUA 1SK2A 2JADA 1TRWA 4PXOA 5B8AA 3MSZA 1BEDA 3VI5A 1JZWA 1G7OA 5IPHA 1QFNA 4HQSA 4ID0A 1K0NA 19GSA 1SL1B 4F9ZA 4JU5A 3KMOA 4OFMA 1F37A 2H1BA 4QL7A 4EC0A 2H30A 4EKZA 3APSA 1RK4A 2EIOA 3IK9A 1EWXA 4ZILA 1ACVA 3CSHA 3P7XA 2I9HA 2CV4A 3HDCA 3D6IA 2GLRA 1X9SB 1XXUA 3D21A 1GRXA 4MCUA 3DGQA 4NHZA 2OBKA 3DRNA 1ABAA 4EUYA 3LYKA 4ZBAA 5J3RA 3DYRA 1FG4A 4N11A 1PGTA 1ZCPA 3GX0A 2XPDA 4E8EA 2HE3A 4DEJA 1GTAA 5H5QA 2LNTA 1BJXA 2HZEB 3ZIJA 2LEGA 5ECOB 3TKRA 3ZVJD 5D9TA 1V9WA 2BTOT 4ZL8A 4ZL7A 2CZ2A 4PURA 3BD2A 4WF4A 4IN0A 5J9BA 4RI7A 4BVXA 2AUVA 1PD21 3EC3A 4ZBBA 1OE8A 1ZZYA 1GLQA 1AW9A 4KX4A 2R2JA 1M2BA 1XVQA 3QPMA 4PQ1A 6GSTA 1OC3A 2OADA 3ZL5A 3N5OA 4K9ZA 3MAKA 3FY7A 1KEBA 5ECPB 1PSQA 3EVIA 2MMOA 1PKZA 1J9BA 1PA3A 7GSSA 3QOUA 3LXTA 2FGXA 2GZYA 2L5OA 2DJ2A 1K0BA 2G2QA 4V2LA 4ML1A 1GP1A 5FWGA 2GT6A 3HY2A 3DXBA 3DD3A 1B9XC 3C7MA 2A4VA 4WETA 2CVKA 1O73A 1I9DA 3FR3A 4XCSA 1GWCA 2YWMA 3KEBA 4MDCA 2YZUA 3ZMKA 3GV1A 1TRVA 3RDWA 3QAGA 5IM9A 5KN0A 4KUNA 2AB6A 2HLSA 2NBSA 5AIVA 1YEXA 2IIYA 2VAFA 1JLVA 12GSA 1FB0A 1HNCA 3Q18A 5HFGA 2RM5A 2H6YA 4K1FA 1O6JA 4JRRA 2YANA 3J7Yk 1TI1A 4WR5A 1IYHA 1OC9A 4BA7A 2A2SA 2LKUA 3UL3A 4WBJA 1PN9A 2N5BA 3FZ5A 5IPGA 3QR6A 2VUPA 4IP1A 3TDGA 1EEJA 3ZFBA 4IQ1A 4IHUA 4V1Ap 3HVVA 1KNGA 20GSA 3ERGA 2L59A 1A2MA 5ECHB 1FOVA 2B7KA 3UIWA 1USBA 2H01A 4OFNA 2EIRA 1SD8A 4I2UA 5CO3A 1NM3A 1T4ZA 3GHAA 5G5FA 2CQ9A 2WZ9A 4X43A 3ERFA 3PR8A 4EL1A 4LL1B 4OMVA 1EOGA 3H1NA 1A2JA 1TRUA 1K0MA 2H66A 5HR0A 2GSQA 4HU7A 2X8HA 2E2MA 2H0HA 1Q4JA 14GSA 2XPEA 2D2ZA 13GSA 1VF2A 3HJOA 3TOTA 4MH2A 2C3TA 1NW2A 1YDKA 3VI7A 4MA9A 3HYPA 3GMFA 1YKAA 3GL3A 1MEKA 1XW6A 1A23A 3KP9A 1PMTA 4IW9A 4GSNA 3FZ4A 2VD1A 3ZVJA 4KB3A 1V40A 2VCQA 4BPYA 2V6OA 2VCWA 2CT6A 2IJYA 4TR1B 3D4TA 2C3NA 1Q98A 5JCUA 3CRTA 3PGTA 5DAKA 3LG6A 4GXZA 3IA1A 3UAPA 2HFDA 3GKKA 1Z5YE 2C80A 4J2FA 2O7KA 3CMIA 4MJBA 1GSEA 4KW6A 3LJRA 2LQOA 2KP2A 4DVCA 2IMIA 2C8UA 1JZRA 1ILOA 2J9HA 4PUAA 5E4WA 2YPMA 4ZB8A 2K8VA 3IK7A 4ECJA 4K7OA 2O87A 5DJLA 2BJXA 1PX6A 2GT5A 1THXA 3GL5A 2EIQA 1OAZA 4N0VA 4OO5A 4WBRD 4NWYA 2WDUA 4L5LA 3VURA 1AC1A 4O32A 3E3EA 5B6NA 2XBQA 2HXKA 2CZ3A 3TRPA 5ECNB 2OKAA 1Z7RA 2VCVA 1U3IA 5ECSA 3KTBA 4PX1A 1K3YA 3EE2A 1B9YC 4YQUA 2H0GA 3W6GA 2MMNA 3IAS2 3M3MA 2H76A 1KTEA 2K18A 6GSWA 3F8UA 5EVOA 1ST9A 2V6KA 3TKQA 1SKSB 2B5EA 1DBYA 2YJHA 3CSJA 3FZ9A 3OR5A 4HOJA 10GSA 4D73B 3TUEA 3SWLA 2DSAA 3G7IA 2B1KA 2YWIA 3TRQA 3APQA 5G30A 1PKWA 3L9VA 5B7CA 4YQVA 5A4WA 4XS4B 1YEPA 5IOWA 3F0IA 1NHYA 3FHKA 4G9HA 3IXRA 1TTZA 1LBKA 1PRXA 1T3BA 2LRNA 5DQSA 1R5PA 3L4NA 1ERVA 3Q6OA 3CTGA 2HRFA 3DWVA 2MBSA 3GUSA 1FB6A 2GSRA 5DQYA 4EO3A 5AISA 4KDXA 3BBYA 2OJLA 2WRTA 4TR1A 4TVEA 5F0GA 4MF6A 1M99A 4GQCA 3I43A 4AJ7A 3CTFA 6GSUA 2FUG2 2OE0A 4FYBA 1QUWA 1VGLA 2PERA 3IRAA 4N30A 1PL2A 2WFCA 2JACA 2IFQB 1GSUA 4FO5A 4HDEA 1OKDA 1T4YA 4IJIA 2AV4A 4TR3A 1GSSA 1R5AA 4ZB6A 5JCGA 4WXTA 4NMUA 1AXDA 3IV4A 5AN1A 4IS0A 1EP8A 3R2QA 2YJ7A 1T00A 3F6FA 5HR2A 3C1SA 1ZYEA 3IOSA 3PINA 5GAPD 4XS1A 5JWRB 2GTUA 4NV2A 1WPIA 4RUVA 3A3TA 3TKSA 5E59A 2R4VA 2NTOA 3L9UA 3VFIA 3GKXA 3O6TA 4GQFA 2ZNMA 4QL9A 1DSBA 4HZ4A 4L8EA 1EV4A 4LL4B 5A4UA 5G5EA 4Q5QA 3E9JB 1W4VA 4MPGA 3FZAA 1LJRA 5D9WA 5D8IA 1GTBA 3US3A 1HNAA 4Q5NA 3DKSA 2JSYA 3MWHA 3RHBA 2WGRA 3HKRA 2DIZA 4DSSA 3HZ4A 1BAYA 1N8JA 2H8LA 1YF1A 3WGEA 3GTUB 2H0IA 4ECIA 4PNFA 1FAAA 2P31A 1WIKA 2MZCA 6GSXA 3U6VA 1WMJA 1UVZA 3A5WA 2C4JA 1R4WA 3K8NA 2CX4A 4K7IA 4MPFA 5H5SA 5AGYA 2FWGA 3VPQA 3D4MA 4XRAA 5B6MA 4BWSA 2FLSA 5CYYA 2FNOA 5A5KA 2VCZA 4NAXA 1E6BA 1AQVA 2E2GA 3E0UA 4WEYA 3QFAC 4G19A 1AAZA 4LLRA 5DJMA 2I3YA 1H75A 2CA8A 3Q74A 4YAPA 3KZQA 2V1MA 2IWTA 1VF3A 5ELAA 3KD0A 5ENUA 1BX9A 1SL2B 3HJPA 5LD0A 2LSTA 3HJMA 3UVTA 3ME8A 1KBNA 4GSSA 5D96A 2FWFA 4POKA 5F07A 4H86A 3BCKA 2VL3A 1EOHA 3GA4A 2X8CA 2VL2A 4FH8A 3UARA 2GSTA 1UC7A 3WT1A 2R6KA 1G0TA 1SENA 3HVSA 2B5YA 4KSOA 3EMXA 3M8NA 3TJBA 2VCXA 1MDIA 1EGOA 1X5CA 1E2YA 3VLNA 4K7NA 4GTUA 2F8AA 3F4SA 3QD9A 5ID2A 1RW1A 2GQLA 5KN3A 3LWAA 3TGZA 3ED3A 3NOFA 5B8BA 4NV5A 3D0ZA 4IGJA 3QDNA 6GSVA 5F06A 2JZTA 1FO5A 1M9BA 3F3QA 4OCFA 2L4CA 2NDOA 3KGKA 3I69A 5CRGA 3CRUA 3CBUA 1V58A 2IMFA 2DJJA 3LGCA 1YJ6A 4JEDA 3TKSE 2DJ1A 3F3RA 4GLTA 2C1YA 3LQ7A 4I6XA 2H6XA 1DUGA 3TCOA 2YZHA 1IYIA 2L57A 3HD5A 2C3QA 2M72A 2YV7A 5D9VA 1FVJA 3EYTA 3IHQA 3N9JA 4HUAA 1Z6NA 3EMPA 3HA9A 3M9JA 2YCDA 1GLPA 5ECIB 2ON5A 4L5OA 4XHMA 2C0EA 1J08A 2KLXA 3QAVA 2GGTA 5IMAA 3APOA 2HZEA 4KSMA 1ZYQB 2PBJA 1PL1A 1GULA 5FT3A 4OWYA 1A2LA 2PVQA 4POBA 2H6ZA 1U88A 2N5FA 1EGRA 2FA4A 4IVFA 1VRSD 2LUSA 5DBQA 3KH9A 2F8FA 3RAZA 2LRTA 1JZOA 2CVDA 3VWUA 2HZFA 1QK8A 3CYNA 1XIYA 2Z9SA 3F4RA 3DIEA 5LCZA 2YN1A 1HYUA 4GWRA 4JZQA 3TRXA 5EY6A 2H1AA 2LQQA 1MD4A 1Z9HA 1A24A 3KTLA 3ZZXA 2F9SA 1XWGA 3FRCA 4BWQA 5DALB 2JL4A 5GSSA 2WCIA 3I9V2 3LYPA 2RUFA 2DMMA 2PPTA 2KP1A 3KM6A 4MZBA 2B3SA 3P90A
chains in the Genus database with same CATH superfamily
1XFLA 1QGVA 2WS2A 5G31A 1S3AA 2H75A 4XRDA 5KOXA 1AQWA 3Q19A 2H70A 2QKEA 4POMA 3HXSA 2HT9A 4QQ7A 1TDIA 4F0CA 1OC8A 2H1DA 3IPZA 4KDUA 3UVHA 3G7YA 1V98A 2XBIA 4JE1A 4Q5RA 2RIIA 2TRXA 5IOXA 1K3OA 2KHPA 2LTKA 4J56E 2DJ0A 1JLWA 1GH2A 2OACA 1FHEA 2IMDA 3TJJA 1C72A 1LU4A 2JSZA 3MNGA 5JWOB 3LEFA 4KNDA 4G0KA 1GSDA 2OA7A 1SKWB 2MYGA 1M2DA 1S3CA 3BOAA 1Y25A 4L0UA 1HQOA 1A0FA 2C0GA 4I5QA 3GSTA 2AYTA 3RHCA 3WYWA 2A2PA 3CXGA 1TI3A 1XPVA 3DEXA 1BG5A 2ALBA 2FHEA 2R3XA 2RLIA 4EDYA 4KE3A 4PUFC 3ZFLA 3EURA 1V57A 2FA8A 2VO4A 3C8EA 1OVNA 1YY7A 1SJ6A 1SL0B 1WJKA 1U87A 1GL8A 2PN8A 3GNJA 3RPPA 4K8MA 3A2VA 1X0RA 2WJUA 1M7TA 3HVXA 5HFKA 4KCAA 11GSA 2HRAA 1O7UA 3VPTA 1PQNA 4K6XA 5C04A 4HEA2 4MLYA 4WR4A 4YKFA 4NHWA 4X0XA 3NIVA 5J4UA 1AUCA 4MZCA 1U6TA 2HRNA 4MH3A 2ZUPA 2P5RA 2MMAA 4G10A 1N2AA 2K6VA 5GZZB 3DVXA 2IL3A 1XWBA 4Q5FA 2L5LA 4MMMA 4ULXA 4HJMA 5HR1A 3UOMA 3M0FA 1V2AA 22GSA 4TN8A 3UBLA 5FHIA 3NZNA 3A2WA 2DJ3A 4YAVA 1AQXA 1Z6MA 3U5RE 4F82A 4BVXB 1XBSA 1K0OA 3GH9A 1A8LA 2HSHA 3GX8A 4FYCA 4AJ8A 2AHEA 1F6MC 4AJ6A 2YWNA 4RI6A 4LMWA 5J41A 1A8YA 2CVBA 1ZOFA 1O8XA 4JR4A 1MTCA 5EL8A 5KEJA 4V1Ag 2ES7A 2B5XA 4K2XA 5F05A 3C1RA 3I6AA 1R7HA 2O85A 1AIUA 5LNKe 2M46A 2H72A 4YQMA 2AJQB 4F03A 4N0ZA 3AY8A 2XC2A 1B4PA 9GSSA 2LV3A 2A2RA 2K8SA 5A4VA 4ISDA 2V2GA 3GN3A 4EIPA 4V2MA 1HNBA 1FVKA 5IIZA 1BYEA 4CW9A 1ML6A 3BJ5A 3GIXA 4TXOB 3QAWA 3TOUA 2L6DA 3ZITA 1F3BA 4KF9A 2E7PA 18GSA 1F2EA 3KH7A 3A2XA 4CDOA 3A5IA 2HRKA 3FR6A 1TRSA 3FYGA 3H4KA 4ML6A 3TJFA 2H74A 5DDLA 5COHA 2LS5A 1K0DA 4IKHA 2P5QA 3ERWA 3ISOA 2LJKA 3ZRDA 5GSTA 4DSQA 4F0BA 4GF0A 2IMEA 3ZTLA 2ON7A 2X64A 4ZBDA 2CX3A 2VLVA 2H71A 1GTUA 1XOBA 2JZSA 4ILFA 3GFKA 1GUMA 3QFBC 3FEUA 1OC9B 2V41A 1B8XA 1YF0A 5ECRB 1WWJA 1XCCA 5C00A 3GSSA 4IP6A 4YKGA 1G7EA 2DMLA 4K0NA 1URMA 1ON4A 5ECLB 3IDVA 2LJRA 3FK8A 2GDRA 3UMAA 4D73A 4FIWA 3M1GA 4OFTA 5G2ZA 2VOCA 1TK8B 3F4TA 4POLA 4AGSA 4PQIA 2WULA 3FW2A 2YOIA 5HQPA 4XS4A 2PU9C 1TW9A 3TJKA 1SJIA 1ZL9A 3ZIVA 3R3EA 5ECMB 1O81A 2H19A 1TJDA 4TW5A 3EWLA 4MK3A 4O92A 1TKDB 3ZMLA 2GQKA 1X5DA 4P3YB 4XTSA 1XWAA 3ME7A 4BL7B 1XZOA 1SYRA 2VL2C 1YZXA 3KCMA 1GUKA 2AAWA 5D9XA 4TXVA 1PFOA 17GSA 1M0UA 5IO2A 1Z3EA 2JU5A 5HFIA 2YV9A 3F63A 1SK1A 4K0GA 4KH7A 8GSSA 3ZYWA 3KMNA 2L6CA 1TU7A 5H5RA 5KOWA 1SJZA 1Y6EA 2PGTA 3LFLA 3UJ1A 3EU4A 4TR0A 5D73A 2IFQA 3UBKA 2QGVA 4HQZA 1JFUA 3BCIA 2HSYA 1U3AA 4AF2A 4Z7XA 4O5UA 4EXJA 4USSA 3G7JA 1QQ2A 2B7JA 3L78A 4KA0A 1GSYA 3MDKA 5CP1A 5CRHA 2I81A 2DLXA 3IR4A 4ACSA 3RPNA 2DJKA 1K0AA 2VLTA 2VM1A 4NXIA 1J0FA 1O8WA 4J57E 2ZCTA 2FWEA 3TKPA 2BMXA 3H8QA 5G1KA 4ZIJA 2KOKA 1EEMA 4TXOA 5DAKB 2GQMA 1H4OA 1JZDA 1HD2A 3S9FA 4TRXA 5IMZA 16GSA 5CAXA 4MZWA 4MP4A 4IJ3A 1TK0B 4PNGA 2CAIA 4TR4A 5CNWA 5D93A 3L0HA 3WGDA 2PVOC 3HZ8A 3LXZA 2DKHA 2GSSA 3VWVA 5L71A 3W8JA 2X99A 3VWWA 2P0GA 4K5SA 2NVLA 3G9BA 4MJEA 6GSYA 2GZPA 1T8EB 1UA5A 1FOHA 1NSWA 2LJAA 5IQYA 2A4HA 4XIHA 1M3JA 3RBTA 2MBTA 1T7PB 3GTUA 1M9AA 3V1WA 2IMKA 4MF7A 1THOA 1B48A 2F3MA 4V2NA 1GNWA 3VWXA 1PX7A 4FQUA 3KIJA 5F8BA 3WT2A 4BVYA 4CHSA 1X9WB 1T1VA 1YQ1A 2GVPA 4G2EA 4DSRA 1SKRB 5CREA 2N5AA 1QXHA 6GSSA 1X9MB 2VIMA 5AIXA 2VM2A 2FWHA 5KN2A 5J9CA 4GSTA 2REMA 3H79A 1TOFA 1ZYNA 4TOPA 3SBCA 1TP9A 2VD0A 2TRCP 2XHFA 5HR3A 4HI7A 1PN0A 5ECKB 3VK9A 1ZMAA 1X5EA 2PUKC 1M2AA 5DCGA 4BL7A 5ABRA 1WRYA 3JCML 1NHOA 1VF1A 1GNEA 3GH6A 4ECBA 3IC4A 1S3RA 4KGIA 4CY6A 5GAND 2MMZA 5INYA 1OE7A 3W8SA 4A5PA 2NPBA 2L4QA 2KUCA 4O7HA 3GKMA 1DE1A 4OO4A 3WGXA 4XS6A 4HJ2A 4ZXGA 1XWKA 3QCPA 4ZB9A 1SD9A 4MNNA 4KCEA 1WP0A 2CAQA 5IO0A 1UN2A 2PWJA 4F2IA 1K0CA 2B1LA 1GSQA 1GUHA 3WD6A 4IBPA 1B4QA 4LA1A 4MABA 1BQ7A 2E0QA 1O85A 3P8WA 4JR6A 4HZ2A 4LMVA 1XOAA 5IMFA 3FR9A 2HNLA 4I97A 4OD7A 2DIYA 2C0DA 4RQXA 2YNXA 1MD3A 1SK0A 1XW9A 3LSZA 4I2TA 4I8BA 5JWQB 2PMTA 1QMVA 2UZ8A 3GYKA 5CRDA 1OKTA 5ELGA 2OE1A 2FCHA 1ZYPA 2FD3A 4EDZA 3F6DA 5DVBA 4OCEA 2M80A 2HYXA 1WOUA 3PH9A 4TKYA 4JBBA 5IMVA 1ERUA 1WE0A 2R5GA 3UEMA 1FW1A 4X1UA 2QSIA 3IE3A 1A0RP 2B6MA 3KP8A 3L9SA 4PGTA 1OYJA 3ZLPA 4IELA 3F9UA 4ECCA 4KDYA 1ERWA 4EVMA 2OE3A 4N10A 4HS1A 3EINA 2H73A 2LNSA 2I1UA 1EV9A 5IMDA 4HU9A 2C0FA 5J5NA 4RQRA 4GRFA 4YH2A 4MJAA 3GRXA 1G6YA 2DKIA 3P2AA 3CSIA 4NPBA 5G1LA 2J23A 4Z2TA 1Z7PA 3FKFA 4DSSB 1MDJA 2K9FA 2X8GA 3HCZA 3O3TA 1TXXA 2HI7A 2DBCA 3LORA 2IN3A 4PTSA 1I5GA 2JZRA 4IQAA 3DVWA 4L0WA 4CY8A 5EPFA 1TU8A 2V32A 1MDKA 2LRCA 1F9MA 2G0FA 1F3AA 1SU9A 2TIRA 2VL9A 1XW5A 2OBIA 1R26A 3D5JA 3IAM2 2RUEA 4FYUA 1JHBA 1YKCA 3TB2A 3C73A 5DALA 3J7Yb 5DCHA 5KN1A 2I4AA 3C71A 2DC5A 2H1GA 4O5RA 2EC4A 2O89A 4GCIA 1EZKA 1DE2A 2YP6A 3DMLA 2GZZA 4E8HA 1G6WA 2GS3A 5IMCA 2YWOA 1ERTA 5JCWA 3IBHA 4EE0A 1VF4A 1RQMA 2WB9A 4K2DA 2QC7A 3KXOA 1GSFA 2IPAA 3HHVA 4KAEA 4PQHA 1ZGNA 1S3DA 3H93A 1EP7A 1XVWA 4MJCA 1K3LA 1SYXA 4EF0A 4WKWA 2RM6A 3KJYA 3TJGA 3GKNA 1CQGA 1CQHA 5ECQB 4MF5A 3GURA 5CRWA 2F51A 2VCTA 4ZL9A 2FY6A 5ID2B 2R37A 3ZREA 1W89A 3O76A 1XWCA 3EU3A 4WF5A 2O8VB 1TK5B 1GTIA 3FMWA 3D22A 3M9KA 3QMXA 3TKSC 2VLUA 1SK2A 2JADA 1TRWA 3MIXA 4PXOA 5B8AA 3MSZA 1BEDA 3VI5A 1JZWA 1G7OA 5IPHA 1QFNA 4HQSA 4ID0A 1K0NA 19GSA 1SL1B 4HSCX 4F9ZA 4JU5A 3KMOA 4OFMA 1F37A 2H1BA 4QL7A 4EC0A 2H30A 4EKZA 3APSA 1RK4A 2EIOA 3IK9A 1EWXA 4ZILA 1ACVA 3CSHA 3P7XA 2I9HA 2CV4A 3HDCA 3D6IA 2GLRA 1X9SB 1XXUA 4Z2UA 3D21A 1GRXA 4MCUA 3DGQA 4NHZA 2OBKA 3DRNA 1ABAA 4EUYA 3LYKA 4ZBAA 5J3RA 3DYRA 1FG4A 4N11A 1PGTA 1ZCPA 3GX0A 2XPDA 4E8EA 2HE3A 4DEJA 4G0LA 1GTAA 5H5QA 2LNTA 1BJXA 2HZEB 3ZIJA 2LEGA 5ECOB 3TKRA 3ZVJD 5D9TA 1V9WA 2BTOT 4ZL8A 4G0IA 2CZ2A 4ZL7A 4PURA 3BD2A 4WF4A 4IN0A 4O5QA 5J9BA 4RI7A 4BVXA 2AUVA 1PD21 3EC3A 4ZBBA 1OE8A 1ZZYA 1GLQA 1AW9A 4KX4A 2R2JA 1M2BA 1XVQA 3QPMA 4PQ1A 6GSTA 1OC3A 2OADA 4EIQA 3ZL5A 3N5OA 4K9ZA 3MAKA 3FY7A 1KEBA 5ECPB 1PSQA 3EVIA 2MMOA 1PKZA 1J9BA 1PA3A 7GSSA 3QOUA 3LXTA 2FGXA 2GZYA 2L5OA 2DJ2A 1K0BA 2G2QA 4V2LA 4ML1A 1GP1A 5FWGA 2GT6A 3HY2A 3DXBA 3DD3A 1B9XC 3C7MA 2A4VA 4WETA 2CVKA 1O73A 1I9DA 3FR3A 4XCSA 3IC8A 1GWCA 2YWMA 3KEBA 4MDCA 4K5RA 2YZUA 3ZMKA 3GV1A 1TRVA 3RDWA 3QAGA 5IM9A 5KN0A 4KUNA 2R0CA 3CQFA 2AB6A 2HLSA 2NBSA 5AIVA 1YEXA 2IIYA 2VAFA 1JLVA 12GSA 1FB0A 4BIKA 1HNCA 3Q18A 5HFGA 2RM5A 4ICYA 2H6YA 4K1FA 1O6JA 4JRRA 2YANA 3J7Yk 1TI1A 4WR5A 1IYHA 3PPUA 1OC9A 4BA7A 2A2SA 2LKUA 3UL3A 4WBJA 1PN9A 2N5BA 3FZ5A 5IPGA 3QR6A 2VUPA 4IP1A 3TDGA 1EEJA 3ZFBA 4IQ1A 4IHUA 4V1Ap 3HVVA 1KNGA 20GSA 3ERGA 2L59A 1A2MA 5ECHB 1FOVA 2B7KA 3UIWA 1USBA 2H01A 4OFNA 2EIRA 1SD8A 4I2UA 5CO3A 1NM3A 1T4ZA 3GHAA 5G5FA 2CQ9A 2WZ9A 4X43A 3ERFA 3PR8A 4EL1A 4LL1B 4OMVA 1EOGA 3H1NA 1A2JA 1TRUA 1K0MA 2H66A 5HR0A 2GSQA 4HU7A 2X8HA 2E2MA 2H0HA 1Q4JA 14GSA 2XPEA 2D2ZA 13GSA 1VF2A 3HJOA 3TOTA 4MH2A 2C3TA 2X49A 1NW2A 1YDKA 3VI7A 4MA9A 3HYPA 3GMFA 1YKAA 3GL3A 1MEKA 1XW6A 1A23A 3KP9A 1XG8A 1PMTA 4IW9A 4GSNA 3FZ4A 2QA1A 2VD1A 3ZVJA 4KB3A 1V40A 2R0GA 2VCQA 4BPYA 2V6OA 2VCWA 2CT6A 3LW9A 2IJYA 4TR1B 3D4TA 2C3NA 1Q98A 5JCUA 3CRTA 3PGTA 5DAKA 3LG6A 4GXZA 3IA1A 3UAPA 2HFDA 3GKKA 1Z5YE 2C80A 4J2FA 2O7KA 3CMIA 4MJBA 1GSEA 4KW6A 3LJRA 2LQOA 2KP2A 4DVCA 2IMIA 2C8UA 1JZRA 1ILOA 2J9HA 4PUAA 5E4WA 2YPMA 4ZB8A 2K8VA 3IK7A 4ECJA 4K7OA 2O87A 5DJLA 2BJXA 1PX6A 2GT5A 1THXA 3GL5A 2EIQA 1OAZA 4N0VA 4OO5A 4WBRD 4NWYA 2WDUA 4L5LA 3VURA 1AC1A 4O32A 3E3EA 5B6NA 2XBQA 2HXKA 2QA2A 2CZ3A 3TRPA 5ECNB 2OKAA 1Z7RA 2VCVA 1U3IA 5ECSA 3KTBA 4PX1A 1K3YA 3EE2A 1B9YC 4YQUA 2H0GA 3W6GA 2MMNA 3IAS2 3M3MA 2H76A 1KTEA 2K18A 6GSWA 3F8UA 5EVOA 1ST9A 2V6KA 3TKQA 1SKSB 2B5EA 1DBYA 2YJHA 4X4JA 3CSJA 3FZ9A 3OR5A 4HOJA 10GSA 4D73B 3TUEA 3SWLA 2DSAA 3G7IA 2B1KA 2YWIA 5BRTA 3TRQA 3APQA 5G30A 1PKWA 3L9VA 5B7CA 4YQVA 5A4WA 4XS4B 1YEPA 5IOWA 3F0IA 1NHYA 3FHKA 3MYDA 3IXRA 4G9HA 1TTZA 1LBKA 1PRXA 1T3BA 2LRNA 5DQSA 1R5PA 3L4NA 1ERVA 3Q6OA 3CTGA 2HRFA 3DWVA 2MBSA 3GUSA 3EPTA 1FB6A 2R0PA 2GSRA 5DQYA 4EO3A 5AISA 4KDXA 3BBYA 2OJLA 2WRTA 4TR1A 4TVEA 5F0GA 4MF6A 1M99A 4GQCA 3I43A 4AJ7A 3CTFA 6GSUA 2FUG2 2OE0A 4FYBA 1QUWA 1VGLA 2PERA 3IRAA 4N30A 1PL2A 2WFCA 2JACA 2IFQB 1GSUA 4FO5A 4HDEA 1OKDA 1T4YA 4IJIA 2AV4A 4TR3A 1GSSA 1R5AA 4ZB6A 3IHGA 5JCGA 4WXTA 4NMUA 1AXDA 3IV4A 5AN1A 4IS0A 1EP8A 3R2QA 2YJ7A 1T00A 3F6FA 5HR2A 3C1SA 3HVNA 1ZYEA 3IOSA 3PINA 5GAPD 4XS1A 5JWRB 2GTUA 4NV2A 1WPIA 4RUVA 3A3TA 3TKSA 5E59A 2R4VA 2NTOA 3L9UA 3VFIA 3GKXA 3O6TA 1M3IA 4GQFA 2ZNMA 4QL9A 1DSBA 4HZ4A 4L8EA 1EV4A 4LL4B 5A4UA 5G5EA 4Q5QA 3E9JB 1W4VA 4MPGA 3FZAA 1LJRA 5D9WA 5D8IA 1GTBA 3US3A 1HNAA 4Q5NA 3DKSA 2JSYA 3MWHA 3RHBA 2WGRA 3HKRA 2DIZA 4DSSA 3HZ4A 1BAYA 1N8JA 2H8LA 1YF1A 3WGEA 3GTUB 2H0IA 4ECIA 4PNFA 1FAAA 2P31A 1WIKA 2MZCA 6GSXA 3U6VA 1WMJA 1UVZA 3A5WA 2C4JA 1R4WA 3K8NA 2CX4A 4K7IA 4MPFA 5H5SA 5AGYA 2FWGA 3VPQA 3D4MA 4XRAA 5B6MA 4BWSA 2FLSA 5CYYA 2FNOA 5A5KA 2VCZA 4NAXA 4BVYB 1E6BA 1AQVA 2E2GA 3E0UA 4WEYA 3QFAC 4G19A 1AAZA 4LLRA 5DJMA 2I3YA 1H75A 2CA8A 3Q74A 4YAPA 3KZQA 2V1MA 2IWTA 1VF3A 5ELAA 3KD0A 5ENUA 1BX9A 1SL2B 3HJPA 5LD0A 2LSTA 3HJMA 3UVTA 3ME8A 1KBNA 4GSSA 5D96A 2FWFA 4POKA 5F07A 4H86A 3BCKA 2VL3A 1EOHA 3GA4A 2X8CA 2VL2A 4FH8A 3UARA 2GSTA 1UC7A 3WT1A 2R6KA 1G0TA 1SENA 3HVSA 2B5YA 4KSOA 3EMXA 3M8NA 3TJBA 2VCXA 1MDIA 2HSMA 1EGOA 1X5CA 1E2YA 3VLNA 4K7NA 4GTUA 2F8AA 3F4SA 3QD9A 5ID2A 1RW1A 2GQLA 5KN3A 3LWAA 3TGZA 3ED3A 3NOFA 5B8BA 4NV5A 3D0ZA 4IGJA 3QDNA 6GSVA 5F06A 2JZTA 1FO5A 1M9BA 3F3QA 4OCFA 2L4CA 2NDOA 3KGKA 3I69A 5CRGA 3CRUA 3CBUA 1V58A 2IMFA 2DJJA 3LGCA 1YJ6A 4JEDA 3TKSE 2DJ1A 3F3RA 4GLTA 2C1YA 3LQ7A 4I6XA 2H6XA 1DUGA 3TCOA 2YZHA 1IYIA 2L57A 3HD5A 2C3QA 2M72A 2YV7A 5D9VA 1FVJA 3EYTA 3IHQA 3N9JA 4HUAA 1Z6NA 3EMPA 3HA9A 3M9JA 2YCDA 1GLPA 5ECIB 2ON5A 4L5OA 4XHMA 2C0EA 1J08A 2KLXA 3QAVA 2GGTA 5IMAA 3APOA 2HZEA 4KSMA 1ZYQB 2PBJA 1PL1A 1GULA 5FT3A 4OWYA 1A2LA 2PVQA 4POBA 2H6ZA 1U88A 2N5FA 1EGRA 2FA4A 4IVFA 2X4AA 1VRSD 2LUSA 5DBQA 3KH9A 2F8FA 3RAZA 2LRTA 1JZOA 2CVDA 3VWUA 2HZFA 4Z2RA 1QK8A 3CYNA 1XIYA 2Z9SA 3F4RA 3DIEA 5LCZA 2YN1A 1HYUA 4GWRA 4JZQA 3TRXA 5EY6A 2H1AA 2LQQA 1MD4A 1Z9HA 1A24A 5BMUA 3KTLA 3ZZXA 2F9SA 1XWGA 3FRCA 4BWQA 5DALB 2JL4A 5GSSA 2WCIA 3I9V2 3LYPA 2RUFA 2DMMA 2PPTA 2KP1A 3KM6A 4MZBA 2B3SA 3P90A
chains in the Genus database with same CATH topology
1XFLA 1QGVA 2WS2A 5G31A 1S3AA 2H75A 4XRDA 5KOXA 1AQWA 3Q19A 2H70A 2QKEA 4POMA 3HXSA 2HT9A 4QQ7A 1TDIA 4F0CA 1OC8A 2H1DA 3IPZA 4KDUA 3UVHA 3G7YA 1V98A 2XBIA 4JE1A 4Q5RA 2RIIA 2TRXA 5IOXA 1K3OA 2KHPA 2LTKA 4J56E 2DJ0A 1JLWA 1GH2A 2OACA 1FHEA 2IMDA 3TJJA 1C72A 1LU4A 2JSZA 3MNGA 5JWOB 3LEFA 4KNDA 4G0KA 1GSDA 2OA7A 1SKWB 2MYGA 1M2DA 1S3CA 3BOAA 1Y25A 4L0UA 1HQOA 1A0FA 2C0GA 4I5QA 3GSTA 2AYTA 3RHCA 3WYWA 2A2PA 3CXGA 1TI3A 1XPVA 3DEXA 1BG5A 2ALBA 2FHEA 2R3XA 2RLIA 4EDYA 4KE3A 4PUFC 3ZFLA 3EURA 1V57A 2FA8A 2VO4A 3C8EA 1OVNA 1YY7A 1SJ6A 1SL0B 1WJKA 1U87A 1GL8A 2PN8A 3GNJA 3RPPA 4K8MA 3A2VA 1X0RA 2WJUA 1M7TA 3HVXA 5HFKA 4KCAA 11GSA 2HRAA 1O7UA 3VPTA 1PQNA 4K6XA 5C04A 4HEA2 4MLYA 4WR4A 4YKFA 4NHWA 4X0XA 3NIVA 5J4UA 1AUCA 4MZCA 1U6TA 2HRNA 4MH3A 2ZUPA 2P5RA 2MMAA 4G10A 1N2AA 2K6VA 5GZZB 3DVXA 2IL3A 1XWBA 4Q5FA 2L5LA 4MMMA 4ULXA 4HJMA 5HR1A 3UOMA 3M0FA 1V2AA 22GSA 4TN8A 3UBLA 5FHIA 3NZNA 3A2WA 2DJ3A 4YAVA 1AQXA 1Z6MA 3U5RE 4F82A 4BVXB 1XBSA 1K0OA 3GH9A 1A8LA 2HSHA 3GX8A 4FYCA 4AJ8A 2AHEA 1F6MC 4AJ6A 2YWNA 4RI6A 4LMWA 5J41A 1A8YA 2CVBA 1ZOFA 1O8XA 4JR4A 1MTCA 5EL8A 5KEJA 4V1Ag 2ES7A 2B5XA 4K2XA 5F05A 3C1RA 3I6AA 1R7HA 2O85A 1AIUA 5LNKe 2M46A 2H72A 4YQMA 2AJQB 4F03A 4N0ZA 3AY8A 2XC2A 1B4PA 9GSSA 2LV3A 2A2RA 2K8SA 5A4VA 4ISDA 2V2GA 3GN3A 4EIPA 4V2MA 1HNBA 1FVKA 5IIZA 1BYEA 4CW9A 1ML6A 3BJ5A 3GIXA 4TXOB 3QAWA 3TOUA 2L6DA 3ZITA 1F3BA 4KF9A 2E7PA 18GSA 1F2EA 3KH7A 3A2XA 4CDOA 3A5IA 2HRKA 3FR6A 1TRSA 3FYGA 3H4KA 4ML6A 3TJFA 2H74A 5DDLA 5COHA 2LS5A 1K0DA 4IKHA 2P5QA 3ERWA 3ISOA 2LJKA 3ZRDA 5GSTA 4DSQA 4F0BA 4GF0A 2IMEA 3ZTLA 2ON7A 2X64A 4ZBDA 2CX3A 2VLVA 2H71A 1GTUA 1XOBA 2JZSA 4ILFA 3GFKA 1GUMA 3QFBC 3FEUA 1OC9B 2V41A 1B8XA 1YF0A 5ECRB 1WWJA 1XCCA 5C00A 3GSSA 4IP6A 4YKGA 1G7EA 2DMLA 4K0NA 1URMA 1ON4A 5ECLB 3IDVA 2LJRA 3FK8A 2GDRA 3UMAA 4D73A 4FIWA 3M1GA 4OFTA 5G2ZA 2VOCA 1TK8B 3F4TA 4POLA 4AGSA 4PQIA 2WULA 3FW2A 2YOIA 5HQPA 4XS4A 2PU9C 1TW9A 3TJKA 1SJIA 1ZL9A 3ZIVA 3R3EA 5ECMB 1O81A 2H19A 1TJDA 4TW5A 3EWLA 4MK3A 4O92A 1TKDB 3ZMLA 2GQKA 1X5DA 4P3YB 4XTSA 1XWAA 3ME7A 4BL7B 1XZOA 1SYRA 2VL2C 1YZXA 3KCMA 1GUKA 2AAWA 5D9XA 4TXVA 17GSA 1M0UA 5IO2A 1Z3EA 2JU5A 5HFIA 2YV9A 3F63A 1SK1A 4K0GA 4KH7A 8GSSA 3ZYWA 3KMNA 2L6CA 1TU7A 5H5RA 5KOWA 1SJZA 1Y6EA 2PGTA 3LFLA 3UJ1A 3EU4A 4TR0A 5D73A 2IFQA 3UBKA 2QGVA 4HQZA 1JFUA 3BCIA 2HSYA 1U3AA 4AF2A 4Z7XA 4O5UA 4EXJA 4USSA 3G7JA 1QQ2A 2B7JA 3L78A 4KA0A 1GSYA 3MDKA 5CP1A 5CRHA 2I81A 2DLXA 3IR4A 4ACSA 3RPNA 2DJKA 1K0AA 2VLTA 2VM1A 4NXIA 1J0FA 1O8WA 4J57E 2ZCTA 2FWEA 3TKPA 2BMXA 3H8QA 5G1KA 4ZIJA 2KOKA 1EEMA 4TXOA 5DAKB 2GQMA 1H4OA 1JZDA 1HD2A 3S9FA 4TRXA 5IMZA 16GSA 5CAXA 4MZWA 4MP4A 4IJ3A 1TK0B 4PNGA 2CAIA 4TR4A 5CNWA 5D93A 3L0HA 3WGDA 2PVOC 3HZ8A 3LXZA 2DKHA 2GSSA 3VWVA 5L71A 3W8JA 2X99A 3VWWA 2P0GA 4K5SA 2NVLA 3G9BA 4MJEA 6GSYA 2GZPA 1T8EB 1UA5A 1FOHA 1NSWA 2LJAA 5IQYA 2A4HA 4XIHA 3RBTA 2MBTA 1T7PB 3GTUA 1M9AA 3V1WA 2IMKA 4MF7A 1THOA 1B48A 2F3MA 4V2NA 1GNWA 3VWXA 1PX7A 4FQUA 3KIJA 5F8BA 3WT2A 4BVYA 4CHSA 1X9WB 1T1VA 1YQ1A 2GVPA 4G2EA 4DSRA 1SKRB 5CREA 2N5AA 1QXHA 6GSSA 1X9MB 2VIMA 5AIXA 2VM2A 2FWHA 5KN2A 5J9CA 4GSTA 2REMA 3H79A 1TOFA 1ZYNA 4TOPA 3SBCA 1TP9A 2VD0A 2TRCP 2XHFA 5HR3A 4HI7A 1PN0A 5ECKB 3VK9A 1ZMAA 1X5EA 2PUKC 1M2AA 5DCGA 4BL7A 5ABRA 1WRYA 3JCML 1NHOA 1VF1A 1GNEA 3GH6A 4ECBA 3IC4A 4KGIA 4CY6A 5GAND 2MMZA 5INYA 1OE7A 3W8SA 4A5PA 2NPBA 2L4QA 2KUCA 4O7HA 3GKMA 1DE1A 4OO4A 3WGXA 4XS6A 4HJ2A 4ZXGA 1XWKA 3QCPA 4ZB9A 1SD9A 4MNNA 4KCEA 1WP0A 2CAQA 5IO0A 1UN2A 2PWJA 4F2IA 1K0CA 2B1LA 1GSQA 1GUHA 3WD6A 4IBPA 1B4QA 4LA1A 4MABA 1BQ7A 2E0QA 1O85A 3P8WA 4JR6A 4HZ2A 4LMVA 1XOAA 5IMFA 3FR9A 2HNLA 4I97A 4OD7A 2DIYA 2C0DA 4RQXA 2YNXA 1MD3A 1SK0A 1XW9A 3LSZA 4I2TA 4I8BA 5JWQB 2PMTA 1QMVA 2UZ8A 3GYKA 5CRDA 1OKTA 5ELGA 2OE1A 2FCHA 1ZYPA 2FD3A 4EDZA 3F6DA 5DVBA 4OCEA 2M80A 2HYXA 1WOUA 3PH9A 4TKYA 4JBBA 5IMVA 1ERUA 1WE0A 2R5GA 3UEMA 1FW1A 4X1UA 2QSIA 3IE3A 1A0RP 2B6MA 3KP8A 3L9SA 4PGTA 1OYJA 3ZLPA 4IELA 3F9UA 4ECCA 4KDYA 1ERWA 4EVMA 2OE3A 4N10A 4HS1A 3EINA 2H73A 2LNSA 2I1UA 1EV9A 5IMDA 4HU9A 2C0FA 5J5NA 4RQRA 4GRFA 4YH2A 4MJAA 3GRXA 1G6YA 2DKIA 3P2AA 3CSIA 4NPBA 5G1LA 2J23A 4Z2TA 1Z7PA 3FKFA 4DSSB 1MDJA 2K9FA 2X8GA 3HCZA 3O3TA 1TXXA 2HI7A 2DBCA 3LORA 2IN3A 4PTSA 1I5GA 2JZRA 4IQAA 3DVWA 4L0WA 4CY8A 5EPFA 1TU8A 2V32A 1MDKA 2LRCA 1F9MA 2G0FA 1F3AA 1SU9A 2TIRA 2VL9A 1XW5A 2OBIA 1R26A 3D5JA 3IAM2 2RUEA 4FYUA 1JHBA 1YKCA 3TB2A 3C73A 5DALA 3J7Yb 5DCHA 5KN1A 2I4AA 3C71A 2DC5A 2H1GA 4O5RA 2EC4A 2O89A 4GCIA 1EZKA 1DE2A 2YP6A 3DMLA 2GZZA 4E8HA 1G6WA 2GS3A 5IMCA 2YWOA 1ERTA 5JCWA 3IBHA 4EE0A 1VF4A 1RQMA 2WB9A 4K2DA 2QC7A 3KXOA 1GSFA 2IPAA 3HHVA 4KAEA 4PQHA 1ZGNA 1S3DA 3H93A 1EP7A 1XVWA 4MJCA 1K3LA 1SYXA 4EF0A 4WKWA 2RM6A 3KJYA 3TJGA 3GKNA 1CQGA 1CQHA 5ECQB 4MF5A 3GURA 5CRWA 2F51A 2VCTA 4ZL9A 2FY6A 5ID2B 2R37A 3ZREA 1W89A 3O76A 1XWCA 3EU3A 4WF5A 2O8VB 1TK5B 1GTIA 3FMWA 3D22A 3M9KA 3QMXA 3TKSC 2VLUA 1SK2A 2JADA 1TRWA 3MIXA 4PXOA 5B8AA 3MSZA 1BEDA 3VI5A 1JZWA 1G7OA 5IPHA 1QFNA 4HQSA 4ID0A 1K0NA 19GSA 1SL1B 4F9ZA 4JU5A 3KMOA 4OFMA 1F37A 2H1BA 4QL7A 4EC0A 2H30A 4EKZA 3APSA 1RK4A 2EIOA 3IK9A 1EWXA 4ZILA 1ACVA 3CSHA 3P7XA 2I9HA 2CV4A 3HDCA 3D6IA 2GLRA 1X9SB 1XXUA 4Z2UA 3D21A 1GRXA 4MCUA 3DGQA 4NHZA 2OBKA 3DRNA 1ABAA 4EUYA 3LYKA 4ZBAA 5J3RA 3DYRA 1FG4A 4N11A 1PGTA 1ZCPA 3GX0A 2XPDA 4E8EA 2HE3A 4DEJA 4G0LA 1GTAA 5H5QA 2LNTA 1BJXA 2HZEB 3ZIJA 2LEGA 5ECOB 3TKRA 3ZVJD 5D9TA 1V9WA 2BTOT 4ZL8A 4G0IA 2CZ2A 4ZL7A 4PURA 3BD2A 4WF4A 4IN0A 4O5QA 5J9BA 4RI7A 4BVXA 2AUVA 1PD21 3EC3A 4ZBBA 1OE8A 1ZZYA 1GLQA 1AW9A 4KX4A 2R2JA 1M2BA 1XVQA 3QPMA 4PQ1A 6GSTA 1OC3A 2OADA 4EIQA 3ZL5A 3N5OA 4K9ZA 3MAKA 3FY7A 1KEBA 5ECPB 1PSQA 3EVIA 2MMOA 1PKZA 1J9BA 1PA3A 7GSSA 3QOUA 3LXTA 2FGXA 2GZYA 2L5OA 2DJ2A 1K0BA 2G2QA 4V2LA 4ML1A 1GP1A 5FWGA 2GT6A 3HY2A 3DXBA 3DD3A 1B9XC 3C7MA 2A4VA 4WETA 2CVKA 1O73A 1I9DA 3FR3A 4XCSA 3IC8A 1GWCA 2YWMA 3KEBA 4MDCA 4K5RA 2YZUA 3ZMKA 3GV1A 1TRVA 3RDWA 3QAGA 5IM9A 5KN0A 4KUNA 2R0CA 2AB6A 2HLSA 2NBSA 5AIVA 1YEXA 2IIYA 2VAFA 1JLVA 12GSA 1FB0A 1HNCA 3Q18A 5HFGA 2RM5A 4ICYA 2H6YA 4K1FA 1O6JA 4JRRA 2YANA 3J7Yk 1TI1A 4WR5A 1IYHA 3PPUA 1OC9A 4BA7A 2A2SA 2LKUA 3UL3A 4WBJA 1PN9A 2N5BA 3FZ5A 5IPGA 3QR6A 2VUPA 4IP1A 3TDGA 1EEJA 3ZFBA 4IQ1A 4IHUA 4V1Ap 3HVVA 1KNGA 20GSA 3ERGA 2L59A 1A2MA 5ECHB 1FOVA 2B7KA 3UIWA 1USBA 2H01A 4OFNA 2EIRA 1SD8A 4I2UA 5CO3A 1NM3A 1T4ZA 3GHAA 5G5FA 2CQ9A 2WZ9A 4X43A 3ERFA 3PR8A 4EL1A 4LL1B 4OMVA 1EOGA 3H1NA 1A2JA 1TRUA 1K0MA 2H66A 5HR0A 2GSQA 4HU7A 2X8HA 2E2MA 2H0HA 1Q4JA 14GSA 2XPEA 2D2ZA 13GSA 1VF2A 3HJOA 3TOTA 4MH2A 2C3TA 2X49A 1NW2A 1YDKA 3VI7A 4MA9A 3HYPA 3GMFA 1YKAA 3GL3A 1MEKA 1XW6A 1A23A 3KP9A 1PMTA 4IW9A 4GSNA 3FZ4A 2QA1A 2VD1A 3ZVJA 4KB3A 1V40A 2R0GA 2VCQA 4BPYA 2V6OA 2VCWA 2CT6A 3LW9A 2IJYA 4TR1B 3D4TA 2C3NA 1Q98A 5JCUA 3CRTA 3PGTA 5DAKA 3LG6A 4GXZA 3IA1A 3UAPA 2HFDA 3GKKA 1Z5YE 2C80A 4J2FA 2O7KA 3CMIA 4MJBA 1GSEA 4KW6A 3LJRA 2LQOA 2KP2A 4DVCA 2IMIA 2C8UA 1JZRA 1ILOA 2J9HA 4PUAA 5E4WA 2YPMA 4ZB8A 2K8VA 3IK7A 4ECJA 4K7OA 2O87A 5DJLA 2BJXA 1PX6A 2GT5A 1THXA 3GL5A 2EIQA 1OAZA 4N0VA 4OO5A 4WBRD 4NWYA 2WDUA 4L5LA 3VURA 1AC1A 4O32A 3E3EA 5B6NA 2XBQA 2HXKA 2QA2A 2CZ3A 3TRPA 5ECNB 2OKAA 1Z7RA 2VCVA 1U3IA 5ECSA 3KTBA 4PX1A 1K3YA 3EE2A 1B9YC 4YQUA 2H0GA 3W6GA 2MMNA 3IAS2 3M3MA 2H76A 1KTEA 2K18A 6GSWA 3F8UA 5EVOA 1ST9A 2V6KA 3TKQA 1SKSB 2B5EA 1DBYA 2YJHA 4X4JA 3CSJA 3FZ9A 3OR5A 4HOJA 10GSA 4D73B 3TUEA 3SWLA 2DSAA 3G7IA 2B1KA 2YWIA 5BRTA 3TRQA 3APQA 5G30A 1PKWA 3L9VA 5B7CA 4YQVA 5A4WA 4XS4B 1YEPA 5IOWA 3F0IA 1NHYA 3FHKA 3MYDA 3IXRA 4G9HA 1TTZA 1LBKA 1PRXA 1T3BA 2LRNA 5DQSA 1R5PA 3L4NA 1ERVA 3Q6OA 3CTGA 2HRFA 3DWVA 2MBSA 3GUSA 3EPTA 1FB6A 2R0PA 2GSRA 5DQYA 4EO3A 5AISA 4KDXA 3BBYA 2OJLA 2WRTA 4TR1A 4TVEA 5F0GA 4MF6A 1M99A 4GQCA 3I43A 4AJ7A 3CTFA 6GSUA 2FUG2 2OE0A 4FYBA 1QUWA 1VGLA 2PERA 3IRAA 4N30A 1PL2A 2WFCA 2JACA 2IFQB 1GSUA 4FO5A 4HDEA 1OKDA 1T4YA 4IJIA 2AV4A 4TR3A 1GSSA 1R5AA 4ZB6A 3IHGA 5JCGA 4WXTA 4NMUA 1AXDA 3IV4A 5AN1A 4IS0A 1EP8A 3R2QA 2YJ7A 1T00A 3F6FA 5HR2A 3C1SA 1ZYEA 3IOSA 3PINA 5GAPD 4XS1A 5JWRB 2GTUA 4NV2A 1WPIA 4RUVA 3A3TA 3TKSA 5E59A 2R4VA 2NTOA 3L9UA 3VFIA 3GKXA 3O6TA 4GQFA 2ZNMA 4QL9A 1DSBA 4HZ4A 4L8EA 1EV4A 4LL4B 5A4UA 5G5EA 4Q5QA 3E9JB 1W4VA 4MPGA 3FZAA 1LJRA 5D9WA 5D8IA 1GTBA 3US3A 1HNAA 4Q5NA 3DKSA 2JSYA 3MWHA 3RHBA 2WGRA 3HKRA 2DIZA 4DSSA 3HZ4A 1BAYA 1N8JA 2H8LA 1YF1A 3WGEA 3GTUB 2H0IA 4ECIA 4PNFA 1FAAA 2P31A 1WIKA 2MZCA 6GSXA 3U6VA 1WMJA 1UVZA 3A5WA 2C4JA 1R4WA 3K8NA 2CX4A 4K7IA 4MPFA 5H5SA 5AGYA 2FWGA 3VPQA 3D4MA 4XRAA 5B6MA 4BWSA 2FLSA 5CYYA 2FNOA 5A5KA 2VCZA 4NAXA 4BVYB 1E6BA 1AQVA 2E2GA 3E0UA 4WEYA 3QFAC 4G19A 1AAZA 4LLRA 5DJMA 2I3YA 1H75A 2CA8A 3Q74A 4YAPA 3KZQA 2V1MA 2IWTA 1VF3A 5ELAA 3KD0A 5ENUA 1BX9A 1SL2B 3HJPA 5LD0A 2LSTA 3HJMA 3UVTA 3ME8A 1KBNA 4GSSA 5D96A 2FWFA 4POKA 5F07A 4H86A 3BCKA 2VL3A 1EOHA 3GA4A 2X8CA 2VL2A 4FH8A 3UARA 2GSTA 1UC7A 3WT1A 2R6KA 1G0TA 1SENA 3HVSA 2B5YA 4KSOA 3EMXA 3M8NA 3TJBA 2VCXA 1MDIA 2HSMA 1EGOA 1X5CA 1E2YA 3VLNA 4K7NA 4GTUA 2F8AA 3F4SA 3QD9A 5ID2A 1RW1A 2GQLA 5KN3A 3LWAA 3TGZA 3ED3A 3NOFA 5B8BA 4NV5A 3D0ZA 4IGJA 3QDNA 6GSVA 5F06A 2JZTA 1FO5A 1M9BA 3F3QA 4OCFA 2L4CA 2NDOA 3KGKA 3I69A 5CRGA 3CRUA 3CBUA 1V58A 2IMFA 2DJJA 3LGCA 1YJ6A 4JEDA 3TKSE 2DJ1A 3F3RA 4GLTA 2C1YA 3LQ7A 4I6XA 2H6XA 1DUGA 3TCOA 2YZHA 1IYIA 2L57A 3HD5A 2C3QA 2M72A 2YV7A 5D9VA 1FVJA 3EYTA 3IHQA 3N9JA 4HUAA 1Z6NA 3EMPA 3HA9A 3M9JA 2YCDA 1GLPA 5ECIB 2ON5A 4L5OA 4XHMA 2C0EA 1J08A 2KLXA 3QAVA 2GGTA 5IMAA 3APOA 2HZEA 4KSMA 1ZYQB 2PBJA 1PL1A 1GULA 5FT3A 4OWYA 1A2LA 2PVQA 4POBA 2H6ZA 1U88A 2N5FA 1EGRA 2FA4A 4IVFA 2X4AA 1VRSD 2LUSA 5DBQA 3KH9A 2F8FA 3RAZA 2LRTA 1JZOA 2CVDA 3VWUA 2HZFA 4Z2RA 1QK8A 3CYNA 1XIYA 2Z9SA 3F4RA 3DIEA 5LCZA 2YN1A 1HYUA 4GWRA 4JZQA 3TRXA 5EY6A 2H1AA 2LQQA 1MD4A 1Z9HA 1A24A 5BMUA 3KTLA 3ZZXA 2F9SA 1XWGA 3FRCA 4BWQA 5DALB 2JL4A 5GSSA 2WCIA 3I9V2 3LYPA 2RUFA 2DMMA 2PPTA 2KP1A 3KM6A 4MZBA 2B3SA 3P90A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XFL A;  1QGV A;  2WS2 A;  5G31 A;  1S3A A;  2H75 A;  4XRD A;  1AQW A;  3Q19 A;  2H70 A;  2QKE A;  4POM A;  3HXS A;  2HT9 A;  4QQ7 A;  1TDI A;  4F0C A;  1OC8 A;  2H1D A;  3IPZ A;  4KDU A;  3UVH A;  3G7Y A;  1V98 A;  2XBI A;  4JE1 A;  4Q5R A;  2RII A;  2TRX A;  5IOX A;  1K3O A;  2KHP A;  2LTK A;  4J56 E;  2DJ0 A;  1JLW A;  1GH2 A;  2OAC A;  1FHE A;  2IMD A;  3TJJ A;  1C72 A;  1LU4 A;  2JSZ A;  3MNG A;  5JWO B;  3LEF A;  4KND A;  1GSD A;  2OA7 A;  1SKW B;  2MYG A;  1M2D A;  1S3C A;  3BOA A;  1Y25 A;  4L0U A;  1HQO A;  1A0F A;  2C0G A;  4I5Q A;  3GST A;  2AYT A;  3RHC A;  3WYW A;  3CXG A;  1TI3 A;  1XPV A;  3DEX A;  1BG5 A;  2ALB A;  2FHE A;  2R3X A;  2RLI A;  4EDY A;  4KE3 A;  4PUF C;  3ZFL A;  3EUR A;  1V57 A;  2FA8 A;  2VO4 A;  3C8E A;  1OVN A;  1YY7 A;  1SJ6 A;  1SL0 B;  1WJK A;  1U87 A;  1GL8 A;  2PN8 A;  3GNJ A;  3RPP A;  4K8M A;  3A2V A;  1X0R A;  2WJU A;  1M7T A;  3HVX A;  5HFK A;  4KCA A;  11GS A;  1O7U A;  3VPT A;  1PQN A;  4K6X A;  5C04 A;  4HEA 2;  4MLY A;  4WR4 A;  4NHW A;  4X0X A;  3NIV A;  5J4U A;  1AUC A;  4MZC A;  1U6T A;  2HRN A;  4MH3 A;  2ZUP A;  2P5R A;  2MMA A;  4G10 A;  1N2A A;  2K6V A;  5GZZ B;  3DVX A;  2IL3 A;  1XWB A;  4Q5F A;  2L5L A;  4MMM A;  4ULX A;  4HJM A;  5HR1 A;  3UOM A;  3M0F A;  1V2A A;  22GS A;  4TN8 A;  3UBL A;  5FHI A;  3NZN A;  3A2W A;  2DJ3 A;  4YAV A;  1AQX A;  1Z6M A;  3U5R E;  4F82 A;  1XBS A;  1K0O A;  3GH9 A;  1A8L A;  2HSH A;  3GX8 A;  4FYC A;  4AJ8 A;  2AHE A;  1F6M C;  4AJ6 A;  2YWN A;  4RI6 A;  4LMW A;  5J41 A;  1A8Y A;  2CVB A;  1ZOF A;  1O8X A;  4JR4 A;  1MTC A;  5EL8 A;  5KEJ A;  4V1A g;  2ES7 A;  2B5X A;  5F05 A;  3C1R A;  3I6A A;  1R7H A;  2O85 A;  1AIU A;  5LNK e;  2M46 A;  2H72 A;  4YQM A;  2AJQ B;  4F03 A;  4N0Z A;  3AY8 A;  2XC2 A;  1B4P A;  9GSS A;  2LV3 A;  2A2R A;  2K8S A;  5A4V A;  4ISD A;  2V2G A;  3GN3 A;  4V2M A;  1HNB A;  1FVK A;  5IIZ A;  1BYE A;  4CW9 A;  1ML6 A;  3BJ5 A;  3GIX A;  4TXO B;  3QAW A;  3TOU A;  2L6D A;  3ZIT A;  1F3B A;  2E7P A;  18GS A;  1F2E A;  3KH7 A;  3A2X A;  4CDO A;  3FR6 A;  1TRS A;  3FYG A;  3H4K A;  4ML6 A;  3TJF A;  2H74 A;  5DDL A;  5COH A;  2LS5 A;  1K0D A;  4IKH A;  2P5Q A;  3ERW A;  3ISO A;  2LJK A;  3ZRD A;  5GST A;  4DSQ A;  4F0B A;  4GF0 A;  2IME A;  3ZTL A;  2ON7 A;  2X64 A;  4ZBD A;  2CX3 A;  2VLV A;  2H71 A;  1GTU A;  1XOB A;  2JZS A;  4ILF A;  3GFK A;  1GUM A;  3QFB C;  3FEU A;  1OC9 B;  2V41 A;  1B8X A;  1YF0 A;  5ECR B;  1WWJ A;  1XCC A;  5C00 A;  3GSS A;  4IP6 A;  1G7E A;  2DML A;  4K0N A;  1URM A;  1ON4 A;  5ECL B;  3IDV A;  2LJR A;  3FK8 A;  2GDR A;  3UMA A;  4D73 A;  4FIW A;  3M1G A;  4OFT A;  5G2Z A;  2VOC A;  1TK8 B;  3F4T A;  4POL A;  4AGS A;  4PQI A;  2WUL A;  3FW2 A;  2YOI A;  5HQP A;  4XS4 A;  2PU9 C;  1TW9 A;  3TJK A;  1SJI A;  1ZL9 A;  3ZIV A;  5ECM B;  1O81 A;  2H19 A;  1TJD A;  4TW5 A;  3EWL A;  4MK3 A;  4O92 A;  1TKD B;  3ZML A;  2GQK A;  1X5D A;  4P3Y B;  4XTS A;  1XWA A;  3ME7 A;  1XZO A;  1SYR A;  2VL2 C;  1YZX A;  3KCM A;  1GUK A;  2AAW A;  5D9X A;  4TXV A;  17GS A;  1M0U A;  5IO2 A;  1Z3E A;  2JU5 A;  5HFI A;  2YV9 A;  3F63 A;  1SK1 A;  4K0G A;  4KH7 A;  8GSS A;  3ZYW A;  3KMN A;  2L6C A;  1TU7 A;  5H5R A;  1SJZ A;  1Y6E A;  2PGT A;  3LFL A;  3UJ1 A;  3EU4 A;  4TR0 A;  5D73 A;  2IFQ A;  3UBK A;  2QGV A;  4HQZ A;  1JFU A;  3BCI A;  2HSY A;  1U3A A;  4AF2 A;  4Z7X A;  4EXJ A;  3G7J A;  1QQ2 A;  2B7J A;  3L78 A;  4KA0 A;  1GSY A;  3MDK A;  5CP1 A;  5CRH A;  2I81 A;  2DLX A;  3IR4 A;  4ACS A;  3RPN A;  2DJK A;  1K0A A;  2VLT A;  2VM1 A;  4NXI A;  1J0F A;  1O8W A;  4J57 E;  2ZCT A;  2FWE A;  3TKP A;  2BMX A;  3H8Q A;  5G1K A;  4ZIJ A;  2KOK A;  1EEM A;  4TXO A;  5DAK B;  2GQM A;  1H4O A;  1JZD A;  1HD2 A;  3S9F A;  4TRX A;  5IMZ A;  16GS A;  5CAX A;  4MZW A;  4MP4 A;  4IJ3 A;  1TK0 B;  4PNG A;  2CAI A;  4TR4 A;  5CNW A;  5D93 A;  3L0H A;  3WGD A;  2PVO C;  3HZ8 A;  3LXZ A;  2GSS A;  3VWV A;  5L71 A;  3W8J A;  2X99 A;  3VWW A;  2P0G A;  2NVL A;  3G9B A;  4MJE A;  6GSY A;  2GZP A;  1T8E B;  1UA5 A;  1NSW A;  2LJA A;  5IQY A;  4XIH A;  3RBT A;  2MBT A;  1T7P B;  3GTU A;  1M9A A;  3V1W A;  2IMK A;  4MF7 A;  1THO A;  1B48 A;  2F3M A;  4V2N A;  1GNW A;  3VWX A;  1PX7 A;  3KIJ A;  5F8B A;  3WT2 A;  4BVY A;  4CHS A;  1X9W B;  1T1V A;  1YQ1 A;  2GVP A;  4G2E A;  4DSR A;  1SKR B;  5CRE A;  2N5A A;  1QXH A;  6GSS A;  1X9M B;  2VIM A;  5AIX A;  2VM2 A;  2FWH A;  5KN2 A;  5J9C A;  4GST A;  2REM A;  3H79 A;  1TOF A;  4TOP A;  3SBC A;  1TP9 A;  2VD0 A;  2TRC P;  2XHF A;  5HR3 A;  4HI7 A;  3VK9 A;  5ECK B;  1ZMA A;  1X5E A;  2PUK C;  1M2A A;  5DCG A;  4BL7 A;  5ABR A;  1WRY A;  3JCM L;  1NHO A;  1VF1 A;  1GNE A;  3GH6 A;  4ECB A;  3IC4 A;  4KGI A;  5GAN D;  2MMZ A;  5INY A;  1OE7 A;  3W8S A;  2NPB A;  2L4Q A;  2KUC A;  4O7H A;  3GKM A;  1DE1 A;  4OO4 A;  3WGX A;  4XS6 A;  4HJ2 A;  4ZXG A;  1XWK A;  3QCP A;  4ZB9 A;  1SD9 A;  4KCE A;  1WP0 A;  2CAQ A;  5IO0 A;  1UN2 A;  2PWJ A;  4F2I A;  1K0C A;  2B1L A;  1GSQ A;  1GUH A;  3WD6 A;  4IBP A;  1B4Q A;  4LA1 A;  4MAB A;  1BQ7 A;  2E0Q A;  1O85 A;  3P8W A;  4JR6 A;  4HZ2 A;  4LMV A;  1XOA A;  5IMF A;  3FR9 A;  2HNL A;  4I97 A;  4OD7 A;  2DIY A;  2C0D A;  4RQX A;  2YNX A;  1MD3 A;  1SK0 A;  1XW9 A;  3LSZ A;  4I2T A;  4I8B A;  5JWQ B;  2PMT A;  1QMV A;  3GYK A;  5CRD A;  1OKT A;  5ELG A;  2OE1 A;  2FCH A;  2FD3 A;  4EDZ A;  3F6D A;  5DVB A;  4OCE A;  2M80 A;  2HYX A;  1WOU A;  3PH9 A;  4TKY A;  4JBB A;  5IMV A;  1ERU A;  1WE0 A;  2R5G A;  3UEM A;  1FW1 A;  4X1U A;  2QSI A;  3IE3 A;  1A0R P;  2B6M A;  3KP8 A;  3L9S A;  4PGT A;  1OYJ A;  3ZLP A;  4IEL A;  3F9U A;  4ECC A;  4KDY A;  1ERW A;  4EVM A;  2OE3 A;  4N10 A;  4HS1 A;  3EIN A;  2H73 A;  2LNS A;  2I1U A;  1EV9 A;  5IMD A;  4HU9 A;  2C0F A;  5J5N A;  4RQR A;  4GRF A;  4YH2 A;  4MJA A;  3GRX A;  1G6Y A;  3P2A A;  3CSI A;  4NPB A;  5G1L A;  2J23 A;  1Z7P A;  3FKF A;  4DSS B;  1MDJ A;  2K9F A;  2X8G A;  3HCZ A;  3O3T A;  1TXX A;  2HI7 A;  2DBC A;  3LOR A;  2IN3 A;  1I5G A;  2JZR A;  4IQA A;  3DVW A;  4L0W A;  5EPF A;  1TU8 A;  2V32 A;  1MDK A;  2LRC A;  1F9M A;  2G0F A;  1F3A A;  1SU9 A;  2TIR A;  2VL9 A;  1XW5 A;  2OBI A;  1R26 A;  3D5J A;  3IAM 2;  2RUE A;  4FYU A;  1JHB A;  1YKC A;  3TB2 A;  3C73 A;  5DAL A;  3J7Y b;  5DCH A;  5KN1 A;  2I4A A;  3C71 A;  2DC5 A;  2H1G A;  4O5R A;  2EC4 A;  2O89 A;  4GCI A;  1EZK A;  1DE2 A;  2YP6 A;  3DML A;  2GZZ A;  4E8H A;  1G6W A;  2GS3 A;  5IMC A;  2YWO A;  1ERT A;  5JCW A;  3IBH A;  4EE0 A;  1VF4 A;  1RQM A;  2WB9 A;  4K2D A;  2QC7 A;  3KXO A;  1GSF A;  2IPA A;  3HHV A;  4KAE A;  4PQH A;  1ZGN A;  1S3D A;  3H93 A;  1EP7 A;  1XVW A;  4MJC A;  1K3L A;  1SYX A;  4EF0 A;  4WKW A;  2RM6 A;  3KJY A;  3TJG A;  3GKN A;  1CQG A;  1CQH A;  5ECQ B;  4MF5 A;  3GUR A;  5CRW A;  2F51 A;  2VCT A;  4ZL9 A;  2FY6 A;  5ID2 B;  2R37 A;  3ZRE A;  1W89 A;  3O76 A;  1XWC A;  3EU3 A;  4WF5 A;  2O8V B;  1TK5 B;  1GTI A;  3D22 A;  3M9K A;  3QMX A;  3TKS C;  2VLU A;  1SK2 A;  2JAD A;  1TRW A;  4PXO A;  5B8A A;  3MSZ A;  1BED A;  3VI5 A;  1JZW A;  1G7O A;  5IPH A;  1QFN A;  4HQS A;  4ID0 A;  1K0N A;  19GS A;  1SL1 B;  4F9Z A;  4JU5 A;  3KMO A;  4OFM A;  1F37 A;  2H1B A;  4QL7 A;  4EC0 A;  2H30 A;  4EKZ A;  3APS A;  1RK4 A;  2EIO A;  3IK9 A;  1EWX A;  4ZIL A;  1ACV A;  3CSH A;  3P7X A;  2I9H A;  2CV4 A;  3HDC A;  3D6I A;  2GLR A;  1X9S B;  1XXU A;  3D21 A;  1GRX A;  4MCU A;  3DGQ A;  4NHZ A;  2OBK A;  3DRN A;  1ABA A;  4EUY A;  3LYK A;  4ZBA A;  5J3R A;  3DYR A;  1FG4 A;  4N11 A;  1PGT A;  1ZCP A;  3GX0 A;  2XPD A;  4E8E A;  2HE3 A;  4DEJ A;  1GTA A;  5H5Q A;  2LNT A;  1BJX A;  2HZE B;  3ZIJ A;  2LEG A;  5ECO B;  3TKR A;  3ZVJ D;  5D9T A;  1V9W A;  2BTO T;  4ZL8 A;  4ZL7 A;  2CZ2 A;  4PUR A;  3BD2 A;  4WF4 A;  4IN0 A;  5J9B A;  4RI7 A;  4BVX A;  2AUV A;  1PD2 1;  3EC3 A;  4ZBB A;  1OE8 A;  1ZZY A;  1GLQ A;  1AW9 A;  4KX4 A;  2R2J A;  1M2B A;  1XVQ A;  3QPM A;  4PQ1 A;  6GST A;  1OC3 A;  2OAD A;  3ZL5 A;  3N5O A;  4K9Z A;  3MAK A;  3FY7 A;  1KEB A;  5ECP B;  1PSQ A;  3EVI A;  2MMO A;  1PKZ A;  1J9B A;  1PA3 A;  7GSS A;  3QOU A;  3LXT A;  2FGX A;  2GZY A;  2L5O A;  2DJ2 A;  1K0B A;  2G2Q A;  4V2L A;  4ML1 A;  1GP1 A;  5FWG A;  2GT6 A;  3HY2 A;  3DXB A;  3DD3 A;  1B9X C;  3C7M A;  2A4V A;  4WET A;  2CVK A;  1O73 A;  1I9D A;  3FR3 A;  4XCS A;  1GWC A;  2YWM A;  3KEB A;  4MDC A;  2YZU A;  3ZMK A;  3GV1 A;  1TRV A;  3RDW A;  3QAG A;  5IM9 A;  5KN0 A;  4KUN A;  2AB6 A;  2HLS A;  2NBS A;  5AIV A;  1YEX A;  2IIY A;  2VAF A;  1JLV A;  12GS A;  1FB0 A;  1HNC A;  3Q18 A;  5HFG A;  2RM5 A;  2H6Y A;  4K1F A;  1O6J A;  4JRR A;  2YAN A;  3J7Y k;  1TI1 A;  4WR5 A;  1IYH A;  1OC9 A;  4BA7 A;  2A2S A;  2LKU A;  3UL3 A;  4WBJ A;  1PN9 A;  2N5B A;  3FZ5 A;  5IPG A;  3QR6 A;  2VUP A;  4IP1 A;  3TDG A;  1EEJ A;  3ZFB A;  4IQ1 A;  4IHU A;  4V1A p;  3HVV A;  1KNG A;  20GS A;  3ERG A;  2L59 A;  1A2M A;  5ECH B;  1FOV A;  2B7K A;  3UIW A;  1USB A;  2H01 A;  4OFN A;  2EIR A;  1SD8 A;  4I2U A;  5CO3 A;  1NM3 A;  1T4Z A;  3GHA A;  5G5F A;  2CQ9 A;  2WZ9 A;  4X43 A;  3ERF A;  3PR8 A;  4EL1 A;  4LL1 B;  4OMV A;  1EOG A;  3H1N A;  1A2J A;  1TRU A;  1K0M A;  2H66 A;  5HR0 A;  2GSQ A;  4HU7 A;  2X8H A;  2E2M A;  2H0H A;  1Q4J A;  14GS A;  2XPE A;  2D2Z A;  13GS A;  1VF2 A;  3HJO A;  3TOT A;  4MH2 A;  2C3T A;  1NW2 A;  1YDK A;  3VI7 A;  4MA9 A;  3HYP A;  3GMF A;  1YKA A;  3GL3 A;  1MEK A;  1XW6 A;  1A23 A;  3KP9 A;  1PMT A;  4IW9 A;  4GSN A;  3FZ4 A;  2VD1 A;  3ZVJ A;  4KB3 A;  1V40 A;  2VCQ A;  4BPY A;  2V6O A;  2VCW A;  2CT6 A;  2IJY A;  4TR1 B;  3D4T A;  2C3N A;  1Q98 A;  5JCU A;  3CRT A;  3PGT A;  5DAK A;  3LG6 A;  4GXZ A;  3IA1 A;  3UAP A;  2HFD A;  3GKK A;  1Z5Y E;  2C80 A;  4J2F A;  2O7K A;  3CMI A;  4MJB A;  1GSE A;  4KW6 A;  3LJR A;  2LQO A;  2KP2 A;  4DVC A;  2IMI A;  2C8U A;  1JZR A;  1ILO A;  2J9H A;  4PUA A;  5E4W A;  2YPM A;  4ZB8 A;  2K8V A;  3IK7 A;  4ECJ A;  4K7O A;  2O87 A;  5DJL A;  2BJX A;  1PX6 A;  2GT5 A;  1THX A;  3GL5 A;  2EIQ A;  1OAZ A;  4N0V A;  4OO5 A;  4WBR D;  4NWY A;  2WDU A;  4L5L A;  3VUR A;  1AC1 A;  4O32 A;  3E3E A;  5B6N A;  2XBQ A;  2HXK A;  2CZ3 A;  3TRP A;  5ECN B;  2OKA A;  1Z7R A;  2VCV A;  1U3I A;  5ECS A;  3KTB A;  4PX1 A;  1K3Y A;  3EE2 A;  1B9Y C;  4YQU A;  2H0G A;  3W6G A;  2MMN A;  3IAS 2;  3M3M A;  2H76 A;  1KTE A;  2K18 A;  6GSW A;  3F8U A;  5EVO A;  1ST9 A;  2V6K A;  3TKQ A;  1SKS B;  2B5E A;  1DBY A;  2YJH A;  3CSJ A;  3FZ9 A;  3OR5 A;  4HOJ A;  10GS A;  4D73 B;  3TUE A;  3SWL A;  2DSA A;  3G7I A;  2B1K A;  2YWI A;  3TRQ A;  3APQ A;  5G30 A;  1PKW A;  3L9V A;  5B7C A;  4YQV A;  5A4W A;  4XS4 B;  1YEP A;  5IOW A;  3F0I A;  1NHY A;  3FHK A;  4G9H A;  3IXR A;  1TTZ A;  1LBK A;  1PRX A;  1T3B A;  2LRN A;  5DQS A;  1R5P A;  3L4N A;  1ERV A;  3Q6O A;  3CTG A;  2HRF A;  3DWV A;  2MBS A;  3GUS A;  1FB6 A;  2GSR A;  5DQY A;  4EO3 A;  5AIS A;  4KDX A;  3BBY A;  2OJL A;  2WRT A;  4TR1 A;  4TVE A;  5F0G A;  4MF6 A;  1M99 A;  4GQC A;  3I43 A;  4AJ7 A;  3CTF A;  6GSU A;  2FUG 2;  2OE0 A;  4FYB A;  1QUW A;  1VGL A;  2PER A;  3IRA A;  4N30 A;  1PL2 A;  2WFC A;  2JAC A;  2IFQ B;  1GSU A;  4FO5 A;  4HDE A;  1OKD A;  1T4Y A;  4IJI A;  2AV4 A;  4TR3 A;  1GSS A;  1R5A A;  4ZB6 A;  5JCG A;  4WXT A;  4NMU A;  1AXD A;  3IV4 A;  5AN1 A;  4IS0 A;  1EP8 A;  3R2Q A;  2YJ7 A;  1T00 A;  3F6F A;  5HR2 A;  3C1S A;  1ZYE A;  3IOS A;  3PIN A;  5GAP D;  4XS1 A;  5JWR B;  2GTU A;  4NV2 A;  1WPI A;  4RUV A;  3A3T A;  3TKS A;  5E59 A;  2R4V A;  2NTO A;  3L9U A;  3VFI A;  3GKX A;  3O6T A;  4GQF A;  2ZNM A;  4QL9 A;  1DSB A;  4HZ4 A;  4L8E A;  1EV4 A;  4LL4 B;  5A4U A;  5G5E A;  4Q5Q A;  3E9J B;  1W4V A;  4MPG A;  3FZA A;  1LJR A;  5D9W A;  5D8I A;  1GTB A;  3US3 A;  1HNA A;  4Q5N A;  3DKS A;  2JSY A;  3MWH A;  3RHB A;  2WGR A;  3HKR A;  2DIZ A;  4DSS A;  3HZ4 A;  1BAY A;  1N8J A;  2H8L A;  1YF1 A;  3WGE A;  3GTU B;  2H0I A;  4ECI A;  4PNF A;  1FAA A;  2P31 A;  1WIK A;  2MZC A;  6GSX A;  3U6V A;  1WMJ A;  1UVZ A;  3A5W A;  2C4J A;  1R4W A;  3K8N A;  2CX4 A;  4K7I A;  4MPF A;  5H5S A;  5AGY A;  2FWG A;  3VPQ A;  3D4M A;  4XRA A;  5B6M A;  4BWS A;  2FLS A;  5CYY A;  2FNO A;  5A5K A;  2VCZ A;  4NAX A;  1E6B A;  1AQV A;  2E2G A;  3E0U A;  4WEY A;  3QFA C;  4G19 A;  1AAZ A;  4LLR A;  5DJM A;  2I3Y A;  1H75 A;  2CA8 A;  3Q74 A;  4YAP A;  3KZQ A;  2V1M A;  2IWT A;  1VF3 A;  5ELA A;  3KD0 A;  5ENU A;  1BX9 A;  1SL2 B;  3HJP A;  5LD0 A;  2LST A;  3HJM A;  3UVT A;  3ME8 A;  1KBN A;  4GSS A;  5D96 A;  2FWF A;  4POK A;  5F07 A;  4H86 A;  3BCK A;  2VL3 A;  1EOH A;  3GA4 A;  2X8C A;  2VL2 A;  4FH8 A;  3UAR A;  2GST A;  1UC7 A;  3WT1 A;  2R6K A;  1G0T A;  1SEN A;  3HVS A;  2B5Y A;  4KSO A;  3EMX A;  3M8N A;  3TJB A;  2VCX A;  1MDI A;  1EGO A;  1X5C A;  1E2Y A;  3VLN A;  4K7N A;  4GTU A;  2F8A A;  3F4S A;  3QD9 A;  5ID2 A;  1RW1 A;  2GQL A;  5KN3 A;  3LWA A;  3TGZ A;  3ED3 A;  3NOF A;  5B8B A;  4NV5 A;  3D0Z A;  4IGJ A;  3QDN A;  6GSV A;  5F06 A;  2JZT A;  1FO5 A;  1M9B A;  3F3Q A;  4OCF A;  2L4C A;  2NDO A;  3KGK A;  3I69 A;  5CRG A;  3CRU A;  3CBU A;  1V58 A;  2IMF A;  2DJJ A;  3LGC A;  1YJ6 A;  4JED A;  3TKS E;  2DJ1 A;  3F3R A;  4GLT A;  2C1Y A;  3LQ7 A;  4I6X A;  2H6X A;  1DUG A;  3TCO A;  2YZH A;  1IYI A;  2L57 A;  3HD5 A;  2C3Q A;  2M72 A;  2YV7 A;  5D9V A;  1FVJ A;  3EYT A;  3IHQ A;  3N9J A;  4HUA A;  1Z6N A;  3EMP A;  3HA9 A;  3M9J A;  2YCD A;  1GLP A;  5ECI B;  2ON5 A;  4L5O A;  4XHM A;  2C0E A;  1J08 A;  2KLX A;  3QAV A;  2GGT A;  5IMA A;  3APO A;  2HZE A;  4KSM A;  1ZYQ B;  2PBJ A;  1PL1 A;  1GUL A;  5FT3 A;  4OWY A;  1A2L A;  2PVQ A;  4POB A;  2H6Z A;  1U88 A;  2N5F A;  1EGR A;  2FA4 A;  4IVF A;  1VRS D;  2LUS A;  5DBQ A;  3KH9 A;  2F8F A;  3RAZ A;  2LRT A;  1JZO A;  2CVD A;  3VWU A;  2HZF A;  1QK8 A;  3CYN A;  1XIY A;  2Z9S A;  3F4R A;  3DIE A;  5LCZ A;  2YN1 A;  1HYU A;  4GWR A;  4JZQ A;  3TRX A;  5EY6 A;  2H1A A;  2LQQ A;  1MD4 A;  1Z9H A;  1A24 A;  3KTL A;  3ZZX A;  2F9S A;  1XWG A;  3FRC A;  4BWQ A;  5DAL B;  2JL4 A;  5GSS A;  2WCI A;  3I9V 2;  3LYP A;  2RUF A;  2DMM A;  2PPT A;  2KP1 A;  3KM6 A;  4MZB A;  2B3S A;  3P90 A; 
#chains in the Genus database with same CATH topology
 1XFL A;  1QGV A;  2WS2 A;  5G31 A;  1S3A A;  2H75 A;  4XRD A;  5KOX A;  1AQW A;  3Q19 A;  2H70 A;  2QKE A;  4POM A;  3HXS A;  2HT9 A;  4QQ7 A;  1TDI A;  4F0C A;  1OC8 A;  2H1D A;  3IPZ A;  4KDU A;  3UVH A;  3G7Y A;  1V98 A;  2XBI A;  4JE1 A;  4Q5R A;  2RII A;  2TRX A;  5IOX A;  1K3O A;  2KHP A;  2LTK A;  4J56 E;  2DJ0 A;  1JLW A;  1GH2 A;  2OAC A;  1FHE A;  2IMD A;  3TJJ A;  1C72 A;  1LU4 A;  2JSZ A;  3MNG A;  5JWO B;  3LEF A;  4KND A;  4G0K A;  1GSD A;  2OA7 A;  1SKW B;  2MYG A;  1M2D A;  1S3C A;  3BOA A;  1Y25 A;  4L0U A;  1HQO A;  1A0F A;  2C0G A;  4I5Q A;  3GST A;  2AYT A;  3RHC A;  3WYW A;  2A2P A;  3CXG A;  1TI3 A;  1XPV A;  3DEX A;  1BG5 A;  2ALB A;  2FHE A;  2R3X A;  2RLI A;  4EDY A;  4KE3 A;  4PUF C;  3ZFL A;  3EUR A;  1V57 A;  2FA8 A;  2VO4 A;  3C8E A;  1OVN A;  1YY7 A;  1SJ6 A;  1SL0 B;  1WJK A;  1U87 A;  1GL8 A;  2PN8 A;  3GNJ A;  3RPP A;  4K8M A;  3A2V A;  1X0R A;  2WJU A;  1M7T A;  3HVX A;  5HFK A;  4KCA A;  11GS A;  2HRA A;  1O7U A;  3VPT A;  1PQN A;  4K6X A;  5C04 A;  4HEA 2;  4MLY A;  4WR4 A;  4YKF A;  4NHW A;  4X0X A;  3NIV A;  5J4U A;  1AUC A;  4MZC A;  1U6T A;  2HRN A;  4MH3 A;  2ZUP A;  2P5R A;  2MMA A;  4G10 A;  1N2A A;  2K6V A;  5GZZ B;  3DVX A;  2IL3 A;  1XWB A;  4Q5F A;  2L5L A;  4MMM A;  4ULX A;  4HJM A;  5HR1 A;  3UOM A;  3M0F A;  1V2A A;  22GS A;  4TN8 A;  3UBL A;  5FHI A;  3NZN A;  3A2W A;  2DJ3 A;  4YAV A;  1AQX A;  1Z6M A;  3U5R E;  4F82 A;  4BVX B;  1XBS A;  1K0O A;  3GH9 A;  1A8L A;  2HSH A;  3GX8 A;  4FYC A;  4AJ8 A;  2AHE A;  1F6M C;  4AJ6 A;  2YWN A;  4RI6 A;  4LMW A;  5J41 A;  1A8Y A;  2CVB A;  1ZOF A;  1O8X A;  4JR4 A;  1MTC A;  5EL8 A;  5KEJ A;  4V1A g;  2ES7 A;  2B5X A;  4K2X A;  5F05 A;  3C1R A;  3I6A A;  1R7H A;  2O85 A;  1AIU A;  5LNK e;  2M46 A;  2H72 A;  4YQM A;  2AJQ B;  4F03 A;  4N0Z A;  3AY8 A;  2XC2 A;  1B4P A;  9GSS A;  2LV3 A;  2A2R A;  2K8S A;  5A4V A;  4ISD A;  2V2G A;  3GN3 A;  4EIP A;  4V2M A;  1HNB A;  1FVK A;  5IIZ A;  1BYE A;  4CW9 A;  1ML6 A;  3BJ5 A;  3GIX A;  4TXO B;  3QAW A;  3TOU A;  2L6D A;  3ZIT A;  1F3B A;  4KF9 A;  2E7P A;  18GS A;  1F2E A;  3KH7 A;  3A2X A;  4CDO A;  3A5I A;  2HRK A;  3FR6 A;  1TRS A;  3FYG A;  3H4K A;  4ML6 A;  3TJF A;  2H74 A;  5DDL A;  5COH A;  2LS5 A;  1K0D A;  4IKH A;  2P5Q A;  3ERW A;  3ISO A;  2LJK A;  3ZRD A;  5GST A;  4DSQ A;  4F0B A;  4GF0 A;  2IME A;  3ZTL A;  2ON7 A;  2X64 A;  4ZBD A;  2CX3 A;  2VLV A;  2H71 A;  1GTU A;  1XOB A;  2JZS A;  4ILF A;  3GFK A;  1GUM A;  3QFB C;  3FEU A;  1OC9 B;  2V41 A;  1B8X A;  1YF0 A;  5ECR B;  1WWJ A;  1XCC A;  5C00 A;  3GSS A;  4IP6 A;  4YKG A;  1G7E A;  2DML A;  4K0N A;  1URM A;  1ON4 A;  5ECL B;  3IDV A;  2LJR A;  3FK8 A;  2GDR A;  3UMA A;  4D73 A;  4FIW A;  3M1G A;  4OFT A;  5G2Z A;  2VOC A;  1TK8 B;  3F4T A;  4POL A;  4AGS A;  4PQI A;  2WUL A;  3FW2 A;  2YOI A;  5HQP A;  4XS4 A;  2PU9 C;  1TW9 A;  3TJK A;  1SJI A;  1ZL9 A;  3ZIV A;  3R3E A;  5ECM B;  1O81 A;  2H19 A;  1TJD A;  4TW5 A;  3EWL A;  4MK3 A;  4O92 A;  1TKD B;  3ZML A;  2GQK A;  1X5D A;  4P3Y B;  4XTS A;  1XWA A;  3ME7 A;  4BL7 B;  1XZO A;  1SYR A;  2VL2 C;  1YZX A;  3KCM A;  1GUK A;  2AAW A;  5D9X A;  4TXV A;  1PFO A;  17GS A;  1M0U A;  5IO2 A;  1Z3E A;  2JU5 A;  5HFI A;  2YV9 A;  3F63 A;  1SK1 A;  4K0G A;  4KH7 A;  8GSS A;  3ZYW A;  3KMN A;  2L6C A;  1TU7 A;  5H5R A;  5KOW A;  1SJZ A;  1Y6E A;  2PGT A;  3LFL A;  3UJ1 A;  3EU4 A;  4TR0 A;  5D73 A;  2IFQ A;  3UBK A;  2QGV A;  4HQZ A;  1JFU A;  3BCI A;  2HSY A;  1U3A A;  4AF2 A;  4Z7X A;  4O5U A;  4EXJ A;  4USS A;  3G7J A;  1QQ2 A;  2B7J A;  3L78 A;  4KA0 A;  1GSY A;  3MDK A;  5CP1 A;  5CRH A;  2I81 A;  2DLX A;  3IR4 A;  4ACS A;  3RPN A;  2DJK A;  1K0A A;  2VLT A;  2VM1 A;  4NXI A;  1J0F A;  1O8W A;  4J57 E;  2ZCT A;  2FWE A;  3TKP A;  2BMX A;  3H8Q A;  5G1K A;  4ZIJ A;  2KOK A;  1EEM A;  4TXO A;  5DAK B;  2GQM A;  1H4O A;  1JZD A;  1HD2 A;  3S9F A;  4TRX A;  5IMZ A;  16GS A;  5CAX A;  4MZW A;  4MP4 A;  4IJ3 A;  1TK0 B;  4PNG A;  2CAI A;  4TR4 A;  5CNW A;  5D93 A;  3L0H A;  3WGD A;  2PVO C;  3HZ8 A;  3LXZ A;  2DKH A;  2GSS A;  3VWV A;  5L71 A;  3W8J A;  2X99 A;  3VWW A;  2P0G A;  4K5S A;  2NVL A;  3G9B A;  4MJE A;  6GSY A;  2GZP A;  1T8E B;  1UA5 A;  1FOH A;  1NSW A;  2LJA A;  5IQY A;  2A4H A;  4XIH A;  1M3J A;  3RBT A;  2MBT A;  1T7P B;  3GTU A;  1M9A A;  3V1W A;  2IMK A;  4MF7 A;  1THO A;  1B48 A;  2F3M A;  4V2N A;  1GNW A;  3VWX A;  1PX7 A;  4FQU A;  3KIJ A;  5F8B A;  3WT2 A;  4BVY A;  4CHS A;  1X9W B;  1T1V A;  1YQ1 A;  2GVP A;  4G2E A;  4DSR A;  1SKR B;  5CRE A;  2N5A A;  1QXH A;  6GSS A;  1X9M B;  2VIM A;  5AIX A;  2VM2 A;  2FWH A;  5KN2 A;  5J9C A;  4GST A;  2REM A;  3H79 A;  1TOF A;  1ZYN A;  4TOP A;  3SBC A;  1TP9 A;  2VD0 A;  2TRC P;  2XHF A;  5HR3 A;  4HI7 A;  1PN0 A;  5ECK B;  3VK9 A;  1ZMA A;  1X5E A;  2PUK C;  1M2A A;  5DCG A;  4BL7 A;  5ABR A;  1WRY A;  3JCM L;  1NHO A;  1VF1 A;  1GNE A;  3GH6 A;  4ECB A;  3IC4 A;  1S3R A;  4KGI A;  4CY6 A;  5GAN D;  2MMZ A;  5INY A;  1OE7 A;  3W8S A;  4A5P A;  2NPB A;  2L4Q A;  2KUC A;  4O7H A;  3GKM A;  1DE1 A;  4OO4 A;  3WGX A;  4XS6 A;  4HJ2 A;  4ZXG A;  1XWK A;  3QCP A;  4ZB9 A;  1SD9 A;  4MNN A;  4KCE A;  1WP0 A;  2CAQ A;  5IO0 A;  1UN2 A;  2PWJ A;  4F2I A;  1K0C A;  2B1L A;  1GSQ A;  1GUH A;  3WD6 A;  4IBP A;  1B4Q A;  4LA1 A;  4MAB A;  1BQ7 A;  2E0Q A;  1O85 A;  3P8W A;  4JR6 A;  4HZ2 A;  4LMV A;  1XOA A;  5IMF A;  3FR9 A;  2HNL A;  4I97 A;  4OD7 A;  2DIY A;  2C0D A;  4RQX A;  2YNX A;  1MD3 A;  1SK0 A;  1XW9 A;  3LSZ A;  4I2T A;  4I8B A;  5JWQ B;  2PMT A;  1QMV A;  2UZ8 A;  3GYK A;  5CRD A;  1OKT A;  5ELG A;  2OE1 A;  2FCH A;  1ZYP A;  2FD3 A;  4EDZ A;  3F6D A;  5DVB A;  4OCE A;  2M80 A;  2HYX A;  1WOU A;  3PH9 A;  4TKY A;  4JBB A;  5IMV A;  1ERU A;  1WE0 A;  2R5G A;  3UEM A;  1FW1 A;  4X1U A;  2QSI A;  3IE3 A;  1A0R P;  2B6M A;  3KP8 A;  3L9S A;  4PGT A;  1OYJ A;  3ZLP A;  4IEL A;  3F9U A;  4ECC A;  4KDY A;  1ERW A;  4EVM A;  2OE3 A;  4N10 A;  4HS1 A;  3EIN A;  2H73 A;  2LNS A;  2I1U A;  1EV9 A;  5IMD A;  4HU9 A;  2C0F A;  5J5N A;  4RQR A;  4GRF A;  4YH2 A;  4MJA A;  3GRX A;  1G6Y A;  2DKI A;  3P2A A;  3CSI A;  4NPB A;  5G1L A;  2J23 A;  4Z2T A;  1Z7P A;  3FKF A;  4DSS B;  1MDJ A;  2K9F A;  2X8G A;  3HCZ A;  3O3T A;  1TXX A;  2HI7 A;  2DBC A;  3LOR A;  2IN3 A;  4PTS A;  1I5G A;  2JZR A;  4IQA A;  3DVW A;  4L0W A;  4CY8 A;  5EPF A;  1TU8 A;  2V32 A;  1MDK A;  2LRC A;  1F9M A;  2G0F A;  1F3A A;  1SU9 A;  2TIR A;  2VL9 A;  1XW5 A;  2OBI A;  1R26 A;  3D5J A;  3IAM 2;  2RUE A;  4FYU A;  1JHB A;  1YKC A;  3TB2 A;  3C73 A;  5DAL A;  3J7Y b;  5DCH A;  5KN1 A;  2I4A A;  3C71 A;  2DC5 A;  2H1G A;  4O5R A;  2EC4 A;  2O89 A;  4GCI A;  1EZK A;  1DE2 A;  2YP6 A;  3DML A;  2GZZ A;  4E8H A;  1G6W A;  2GS3 A;  5IMC A;  2YWO A;  1ERT A;  5JCW A;  3IBH A;  4EE0 A;  1VF4 A;  1RQM A;  2WB9 A;  4K2D A;  2QC7 A;  3KXO A;  1GSF A;  2IPA A;  3HHV A;  4KAE A;  4PQH A;  1ZGN A;  1S3D A;  3H93 A;  1EP7 A;  1XVW A;  4MJC A;  1K3L A;  1SYX A;  4EF0 A;  4WKW A;  2RM6 A;  3KJY A;  3TJG A;  3GKN A;  1CQG A;  1CQH A;  5ECQ B;  4MF5 A;  3GUR A;  5CRW A;  2F51 A;  2VCT A;  4ZL9 A;  2FY6 A;  5ID2 B;  2R37 A;  3ZRE A;  1W89 A;  3O76 A;  1XWC A;  3EU3 A;  4WF5 A;  2O8V B;  1TK5 B;  1GTI A;  3FMW A;  3D22 A;  3M9K A;  3QMX A;  3TKS C;  2VLU A;  1SK2 A;  2JAD A;  1TRW A;  3MIX A;  4PXO A;  5B8A A;  3MSZ A;  1BED A;  3VI5 A;  1JZW A;  1G7O A;  5IPH A;  1QFN A;  4HQS A;  4ID0 A;  1K0N A;  19GS A;  1SL1 B;  4HSC X;  4F9Z A;  4JU5 A;  3KMO A;  4OFM A;  1F37 A;  2H1B A;  4QL7 A;  4EC0 A;  2H30 A;  4EKZ A;  3APS A;  1RK4 A;  2EIO A;  3IK9 A;  1EWX A;  4ZIL A;  1ACV A;  3CSH A;  3P7X A;  2I9H A;  2CV4 A;  3HDC A;  3D6I A;  2GLR A;  1X9S B;  1XXU A;  4Z2U A;  3D21 A;  1GRX A;  4MCU A;  3DGQ A;  4NHZ A;  2OBK A;  3DRN A;  1ABA A;  4EUY A;  3LYK A;  4ZBA A;  5J3R A;  3DYR A;  1FG4 A;  4N11 A;  1PGT A;  1ZCP A;  3GX0 A;  2XPD A;  4E8E A;  2HE3 A;  4DEJ A;  4G0L A;  1GTA A;  5H5Q A;  2LNT A;  1BJX A;  2HZE B;  3ZIJ A;  2LEG A;  5ECO B;  3TKR A;  3ZVJ D;  5D9T A;  1V9W A;  2BTO T;  4ZL8 A;  4G0I A;  2CZ2 A;  4ZL7 A;  4PUR A;  3BD2 A;  4WF4 A;  4IN0 A;  4O5Q A;  5J9B A;  4RI7 A;  4BVX A;  2AUV A;  1PD2 1;  3EC3 A;  4ZBB A;  1OE8 A;  1ZZY A;  1GLQ A;  1AW9 A;  4KX4 A;  2R2J A;  1M2B A;  1XVQ A;  3QPM A;  4PQ1 A;  6GST A;  1OC3 A;  2OAD A;  4EIQ A;  3ZL5 A;  3N5O A;  4K9Z A;  3MAK A;  3FY7 A;  1KEB A;  5ECP B;  1PSQ A;  3EVI A;  2MMO A;  1PKZ A;  1J9B A;  1PA3 A;  7GSS A;  3QOU A;  3LXT A;  2FGX A;  2GZY A;  2L5O A;  2DJ2 A;  1K0B A;  2G2Q A;  4V2L A;  4ML1 A;  1GP1 A;  5FWG A;  2GT6 A;  3HY2 A;  3DXB A;  3DD3 A;  1B9X C;  3C7M A;  2A4V A;  4WET A;  2CVK A;  1O73 A;  1I9D A;  3FR3 A;  4XCS A;  3IC8 A;  1GWC A;  2YWM A;  3KEB A;  4MDC A;  4K5R A;  2YZU A;  3ZMK A;  3GV1 A;  1TRV A;  3RDW A;  3QAG A;  5IM9 A;  5KN0 A;  4KUN A;  2R0C A;  3CQF A;  2AB6 A;  2HLS A;  2NBS A;  5AIV A;  1YEX A;  2IIY A;  2VAF A;  1JLV A;  12GS A;  1FB0 A;  4BIK A;  1HNC A;  3Q18 A;  5HFG A;  2RM5 A;  4ICY A;  2H6Y A;  4K1F A;  1O6J A;  4JRR A;  2YAN A;  3J7Y k;  1TI1 A;  4WR5 A;  1IYH A;  3PPU A;  1OC9 A;  4BA7 A;  2A2S A;  2LKU A;  3UL3 A;  4WBJ A;  1PN9 A;  2N5B A;  3FZ5 A;  5IPG A;  3QR6 A;  2VUP A;  4IP1 A;  3TDG A;  1EEJ A;  3ZFB A;  4IQ1 A;  4IHU A;  4V1A p;  3HVV A;  1KNG A;  20GS A;  3ERG A;  2L59 A;  1A2M A;  5ECH B;  1FOV A;  2B7K A;  3UIW A;  1USB A;  2H01 A;  4OFN A;  2EIR A;  1SD8 A;  4I2U A;  5CO3 A;  1NM3 A;  1T4Z A;  3GHA A;  5G5F A;  2CQ9 A;  2WZ9 A;  4X43 A;  3ERF A;  3PR8 A;  4EL1 A;  4LL1 B;  4OMV A;  1EOG A;  3H1N A;  1A2J A;  1TRU A;  1K0M A;  2H66 A;  5HR0 A;  2GSQ A;  4HU7 A;  2X8H A;  2E2M A;  2H0H A;  1Q4J A;  14GS A;  2XPE A;  2D2Z A;  13GS A;  1VF2 A;  3HJO A;  3TOT A;  4MH2 A;  2C3T A;  2X49 A;  1NW2 A;  1YDK A;  3VI7 A;  4MA9 A;  3HYP A;  3GMF A;  1YKA A;  3GL3 A;  1MEK A;  1XW6 A;  1A23 A;  3KP9 A;  1XG8 A;  1PMT A;  4IW9 A;  4GSN A;  3FZ4 A;  2QA1 A;  2VD1 A;  3ZVJ A;  4KB3 A;  1V40 A;  2R0G A;  2VCQ A;  4BPY A;  2V6O A;  2VCW A;  2CT6 A;  3LW9 A;  2IJY A;  4TR1 B;  3D4T A;  2C3N A;  1Q98 A;  5JCU A;  3CRT A;  3PGT A;  5DAK A;  3LG6 A;  4GXZ A;  3IA1 A;  3UAP A;  2HFD A;  3GKK A;  1Z5Y E;  2C80 A;  4J2F A;  2O7K A;  3CMI A;  4MJB A;  1GSE A;  4KW6 A;  3LJR A;  2LQO A;  2KP2 A;  4DVC A;  2IMI A;  2C8U A;  1JZR A;  1ILO A;  2J9H A;  4PUA A;  5E4W A;  2YPM A;  4ZB8 A;  2K8V A;  3IK7 A;  4ECJ A;  4K7O A;  2O87 A;  5DJL A;  2BJX A;  1PX6 A;  2GT5 A;  1THX A;  3GL5 A;  2EIQ A;  1OAZ A;  4N0V A;  4OO5 A;  4WBR D;  4NWY A;  2WDU A;  4L5L A;  3VUR A;  1AC1 A;  4O32 A;  3E3E A;  5B6N A;  2XBQ A;  2HXK A;  2QA2 A;  2CZ3 A;  3TRP A;  5ECN B;  2OKA A;  1Z7R A;  2VCV A;  1U3I A;  5ECS A;  3KTB A;  4PX1 A;  1K3Y A;  3EE2 A;  1B9Y C;  4YQU A;  2H0G A;  3W6G A;  2MMN A;  3IAS 2;  3M3M A;  2H76 A;  1KTE A;  2K18 A;  6GSW A;  3F8U A;  5EVO A;  1ST9 A;  2V6K A;  3TKQ A;  1SKS B;  2B5E A;  1DBY A;  2YJH A;  4X4J A;  3CSJ A;  3FZ9 A;  3OR5 A;  4HOJ A;  10GS A;  4D73 B;  3TUE A;  3SWL A;  2DSA A;  3G7I A;  2B1K A;  2YWI A;  5BRT A;  3TRQ A;  3APQ A;  5G30 A;  1PKW A;  3L9V A;  5B7C A;  4YQV A;  5A4W A;  4XS4 B;  1YEP A;  5IOW A;  3F0I A;  1NHY A;  3FHK A;  3MYD A;  3IXR A;  4G9H A;  1TTZ A;  1LBK A;  1PRX A;  1T3B A;  2LRN A;  5DQS A;  1R5P A;  3L4N A;  1ERV A;  3Q6O A;  3CTG A;  2HRF A;  3DWV A;  2MBS A;  3GUS A;  3EPT A;  1FB6 A;  2R0P A;  2GSR A;  5DQY A;  4EO3 A;  5AIS A;  4KDX A;  3BBY A;  2OJL A;  2WRT A;  4TR1 A;  4TVE A;  5F0G A;  4MF6 A;  1M99 A;  4GQC A;  3I43 A;  4AJ7 A;  3CTF A;  6GSU A;  2FUG 2;  2OE0 A;  4FYB A;  1QUW A;  1VGL A;  2PER A;  3IRA A;  4N30 A;  1PL2 A;  2WFC A;  2JAC A;  2IFQ B;  1GSU A;  4FO5 A;  4HDE A;  1OKD A;  1T4Y A;  4IJI A;  2AV4 A;  4TR3 A;  1GSS A;  1R5A A;  4ZB6 A;  3IHG A;  5JCG A;  4WXT A;  4NMU A;  1AXD A;  3IV4 A;  5AN1 A;  4IS0 A;  1EP8 A;  3R2Q A;  2YJ7 A;  1T00 A;  3F6F A;  5HR2 A;  3C1S A;  3HVN A;  1ZYE A;  3IOS A;  3PIN A;  5GAP D;  4XS1 A;  5JWR B;  2GTU A;  4NV2 A;  1WPI A;  4RUV A;  3A3T A;  3TKS A;  5E59 A;  2R4V A;  2NTO A;  3L9U A;  3VFI A;  3GKX A;  3O6T A;  1M3I A;  4GQF A;  2ZNM A;  4QL9 A;  1DSB A;  4HZ4 A;  4L8E A;  1EV4 A;  4LL4 B;  5A4U A;  5G5E A;  4Q5Q A;  3E9J B;  1W4V A;  4MPG A;  3FZA A;  1LJR A;  5D9W A;  5D8I A;  1GTB A;  3US3 A;  1HNA A;  4Q5N A;  3DKS A;  2JSY A;  3MWH A;  3RHB A;  2WGR A;  3HKR A;  2DIZ A;  4DSS A;  3HZ4 A;  1BAY A;  1N8J A;  2H8L A;  1YF1 A;  3WGE A;  3GTU B;  2H0I A;  4ECI A;  4PNF A;  1FAA A;  2P31 A;  1WIK A;  2MZC A;  6GSX A;  3U6V A;  1WMJ A;  1UVZ A;  3A5W A;  2C4J A;  1R4W A;  3K8N A;  2CX4 A;  4K7I A;  4MPF A;  5H5S A;  5AGY A;  2FWG A;  3VPQ A;  3D4M A;  4XRA A;  5B6M A;  4BWS A;  2FLS A;  5CYY A;  2FNO A;  5A5K A;  2VCZ A;  4NAX A;  4BVY B;  1E6B A;  1AQV A;  2E2G A;  3E0U A;  4WEY A;  3QFA C;  4G19 A;  1AAZ A;  4LLR A;  5DJM A;  2I3Y A;  1H75 A;  2CA8 A;  3Q74 A;  4YAP A;  3KZQ A;  2V1M A;  2IWT A;  1VF3 A;  5ELA A;  3KD0 A;  5ENU A;  1BX9 A;  1SL2 B;  3HJP A;  5LD0 A;  2LST A;  3HJM A;  3UVT A;  3ME8 A;  1KBN A;  4GSS A;  5D96 A;  2FWF A;  4POK A;  5F07 A;  4H86 A;  3BCK A;  2VL3 A;  1EOH A;  3GA4 A;  2X8C A;  2VL2 A;  4FH8 A;  3UAR A;  2GST A;  1UC7 A;  3WT1 A;  2R6K A;  1G0T A;  1SEN A;  3HVS A;  2B5Y A;  4KSO A;  3EMX A;  3M8N A;  3TJB A;  2VCX A;  1MDI A;  2HSM A;  1EGO A;  1X5C A;  1E2Y A;  3VLN A;  4K7N A;  4GTU A;  2F8A A;  3F4S A;  3QD9 A;  5ID2 A;  1RW1 A;  2GQL A;  5KN3 A;  3LWA A;  3TGZ A;  3ED3 A;  3NOF A;  5B8B A;  4NV5 A;  3D0Z A;  4IGJ A;  3QDN A;  6GSV A;  5F06 A;  2JZT A;  1FO5 A;  1M9B A;  3F3Q A;  4OCF A;  2L4C A;  2NDO A;  3KGK A;  3I69 A;  5CRG A;  3CRU A;  3CBU A;  1V58 A;  2IMF A;  2DJJ A;  3LGC A;  1YJ6 A;  4JED A;  3TKS E;  2DJ1 A;  3F3R A;  4GLT A;  2C1Y A;  3LQ7 A;  4I6X A;  2H6X A;  1DUG A;  3TCO A;  2YZH A;  1IYI A;  2L57 A;  3HD5 A;  2C3Q A;  2M72 A;  2YV7 A;  5D9V A;  1FVJ A;  3EYT A;  3IHQ A;  3N9J A;  4HUA A;  1Z6N A;  3EMP A;  3HA9 A;  3M9J A;  2YCD A;  1GLP A;  5ECI B;  2ON5 A;  4L5O A;  4XHM A;  2C0E A;  1J08 A;  2KLX A;  3QAV A;  2GGT A;  5IMA A;  3APO A;  2HZE A;  4KSM A;  1ZYQ B;  2PBJ A;  1PL1 A;  1GUL A;  5FT3 A;  4OWY A;  1A2L A;  2PVQ A;  4POB A;  2H6Z A;  1U88 A;  2N5F A;  1EGR A;  2FA4 A;  4IVF A;  2X4A A;  1VRS D;  2LUS A;  5DBQ A;  3KH9 A;  2F8F A;  3RAZ A;  2LRT A;  1JZO A;  2CVD A;  3VWU A;  2HZF A;  4Z2R A;  1QK8 A;  3CYN A;  1XIY A;  2Z9S A;  3F4R A;  3DIE A;  5LCZ A;  2YN1 A;  1HYU A;  4GWR A;  4JZQ A;  3TRX A;  5EY6 A;  2H1A A;  2LQQ A;  1MD4 A;  1Z9H A;  1A24 A;  5BMU A;  3KTL A;  3ZZX A;  2F9S A;  1XWG A;  3FRC A;  4BWQ A;  5DAL B;  2JL4 A;  5GSS A;  2WCI A;  3I9V 2;  3LYP A;  2RUF A;  2DMM A;  2PPT A;  2KP1 A;  3KM6 A;  4MZB A;  2B3S A;  3P90 A; 
#chains in the Genus database with same CATH homology
 1XFL A;  1QGV A;  2WS2 A;  5G31 A;  1S3A A;  2H75 A;  4XRD A;  5KOX A;  1AQW A;  3Q19 A;  2H70 A;  2QKE A;  4POM A;  3HXS A;  2HT9 A;  4QQ7 A;  1TDI A;  4F0C A;  1OC8 A;  2H1D A;  3IPZ A;  4KDU A;  3UVH A;  3G7Y A;  1V98 A;  2XBI A;  4JE1 A;  4Q5R A;  2RII A;  2TRX A;  5IOX A;  1K3O A;  2KHP A;  2LTK A;  4J56 E;  2DJ0 A;  1JLW A;  1GH2 A;  2OAC A;  1FHE A;  2IMD A;  3TJJ A;  1C72 A;  1LU4 A;  2JSZ A;  3MNG A;  5JWO B;  3LEF A;  4KND A;  4G0K A;  1GSD A;  2OA7 A;  1SKW B;  2MYG A;  1M2D A;  1S3C A;  3BOA A;  1Y25 A;  4L0U A;  1HQO A;  1A0F A;  2C0G A;  4I5Q A;  3GST A;  2AYT A;  3RHC A;  3WYW A;  2A2P A;  3CXG A;  1TI3 A;  1XPV A;  3DEX A;  1BG5 A;  2ALB A;  2FHE A;  2R3X A;  2RLI A;  4EDY A;  4KE3 A;  4PUF C;  3ZFL A;  3EUR A;  1V57 A;  2FA8 A;  2VO4 A;  3C8E A;  1OVN A;  1YY7 A;  1SJ6 A;  1SL0 B;  1WJK A;  1U87 A;  1GL8 A;  2PN8 A;  3GNJ A;  3RPP A;  4K8M A;  3A2V A;  1X0R A;  2WJU A;  1M7T A;  3HVX A;  5HFK A;  4KCA A;  11GS A;  2HRA A;  1O7U A;  3VPT A;  1PQN A;  4K6X A;  5C04 A;  4HEA 2;  4MLY A;  4WR4 A;  4YKF A;  4NHW A;  4X0X A;  3NIV A;  5J4U A;  1AUC A;  4MZC A;  1U6T A;  2HRN A;  4MH3 A;  2ZUP A;  2P5R A;  2MMA A;  4G10 A;  1N2A A;  2K6V A;  5GZZ B;  3DVX A;  2IL3 A;  1XWB A;  4Q5F A;  2L5L A;  4MMM A;  4ULX A;  4HJM A;  5HR1 A;  3UOM A;  3M0F A;  1V2A A;  22GS A;  4TN8 A;  3UBL A;  5FHI A;  3NZN A;  3A2W A;  2DJ3 A;  4YAV A;  1AQX A;  1Z6M A;  3U5R E;  4F82 A;  4BVX B;  1XBS A;  1K0O A;  3GH9 A;  1A8L A;  2HSH A;  3GX8 A;  4FYC A;  4AJ8 A;  2AHE A;  1F6M C;  4AJ6 A;  2YWN A;  4RI6 A;  4LMW A;  5J41 A;  1A8Y A;  2CVB A;  1ZOF A;  1O8X A;  4JR4 A;  1MTC A;  5EL8 A;  5KEJ A;  4V1A g;  2ES7 A;  2B5X A;  4K2X A;  5F05 A;  3C1R A;  3I6A A;  1R7H A;  2O85 A;  1AIU A;  5LNK e;  2M46 A;  2H72 A;  4YQM A;  2AJQ B;  4F03 A;  4N0Z A;  3AY8 A;  2XC2 A;  1B4P A;  9GSS A;  2LV3 A;  2A2R A;  2K8S A;  5A4V A;  4ISD A;  2V2G A;  3GN3 A;  4EIP A;  4V2M A;  1HNB A;  1FVK A;  5IIZ A;  1BYE A;  4CW9 A;  1ML6 A;  3BJ5 A;  3GIX A;  4TXO B;  3QAW A;  3TOU A;  2L6D A;  3ZIT A;  1F3B A;  4KF9 A;  2E7P A;  18GS A;  1F2E A;  3KH7 A;  3A2X A;  4CDO A;  3A5I A;  2HRK A;  3FR6 A;  1TRS A;  3FYG A;  3H4K A;  4ML6 A;  3TJF A;  2H74 A;  5DDL A;  5COH A;  2LS5 A;  1K0D A;  4IKH A;  2P5Q A;  3ERW A;  3ISO A;  2LJK A;  3ZRD A;  5GST A;  4DSQ A;  4F0B A;  4GF0 A;  2IME A;  3ZTL A;  2ON7 A;  2X64 A;  4ZBD A;  2CX3 A;  2VLV A;  2H71 A;  1GTU A;  1XOB A;  2JZS A;  4ILF A;  3GFK A;  1GUM A;  3QFB C;  3FEU A;  1OC9 B;  2V41 A;  1B8X A;  1YF0 A;  5ECR B;  1WWJ A;  1XCC A;  5C00 A;  3GSS A;  4IP6 A;  4YKG A;  1G7E A;  2DML A;  4K0N A;  1URM A;  1ON4 A;  5ECL B;  3IDV A;  2LJR A;  3FK8 A;  2GDR A;  3UMA A;  4D73 A;  4FIW A;  3M1G A;  4OFT A;  5G2Z A;  2VOC A;  1TK8 B;  3F4T A;  4POL A;  4AGS A;  4PQI A;  2WUL A;  3FW2 A;  2YOI A;  5HQP A;  4XS4 A;  2PU9 C;  1TW9 A;  3TJK A;  1SJI A;  1ZL9 A;  3ZIV A;  3R3E A;  5ECM B;  1O81 A;  2H19 A;  1TJD A;  4TW5 A;  3EWL A;  4MK3 A;  4O92 A;  1TKD B;  3ZML A;  2GQK A;  1X5D A;  4P3Y B;  4XTS A;  1XWA A;  3ME7 A;  4BL7 B;  1XZO A;  1SYR A;  2VL2 C;  1YZX A;  3KCM A;  1GUK A;  2AAW A;  5D9X A;  4TXV A;  17GS A;  1M0U A;  5IO2 A;  1Z3E A;  2JU5 A;  5HFI A;  2YV9 A;  3F63 A;  1SK1 A;  4K0G A;  4KH7 A;  8GSS A;  3ZYW A;  3KMN A;  2L6C A;  1TU7 A;  5H5R A;  5KOW A;  1SJZ A;  1Y6E A;  2PGT A;  3LFL A;  3UJ1 A;  3EU4 A;  4TR0 A;  5D73 A;  2IFQ A;  3UBK A;  2QGV A;  4HQZ A;  1JFU A;  3BCI A;  2HSY A;  1U3A A;  4AF2 A;  4Z7X A;  4O5U A;  4EXJ A;  4USS A;  3G7J A;  1QQ2 A;  2B7J A;  3L78 A;  4KA0 A;  1GSY A;  3MDK A;  5CP1 A;  5CRH A;  2I81 A;  2DLX A;  3IR4 A;  4ACS A;  3RPN A;  2DJK A;  1K0A A;  2VLT A;  2VM1 A;  4NXI A;  1J0F A;  1O8W A;  4J57 E;  2ZCT A;  2FWE A;  3TKP A;  2BMX A;  3H8Q A;  5G1K A;  4ZIJ A;  2KOK A;  1EEM A;  4TXO A;  5DAK B;  2GQM A;  1H4O A;  1JZD A;  1HD2 A;  3S9F A;  4TRX A;  5IMZ A;  16GS A;  5CAX A;  4MZW A;  4MP4 A;  4IJ3 A;  1TK0 B;  4PNG A;  2CAI A;  4TR4 A;  5CNW A;  5D93 A;  3L0H A;  3WGD A;  2PVO C;  3HZ8 A;  3LXZ A;  2DKH A;  2GSS A;  3VWV A;  5L71 A;  3W8J A;  2X99 A;  3VWW A;  2P0G A;  4K5S A;  2NVL A;  3G9B A;  4MJE A;  6GSY A;  2GZP A;  1T8E B;  1UA5 A;  1FOH A;  1NSW A;  2LJA A;  5IQY A;  2A4H A;  4XIH A;  3RBT A;  2MBT A;  1T7P B;  3GTU A;  1M9A A;  3V1W A;  2IMK A;  4MF7 A;  1THO A;  1B48 A;  2F3M A;  4V2N A;  1GNW A;  3VWX A;  1PX7 A;  4FQU A;  3KIJ A;  5F8B A;  3WT2 A;  4BVY A;  4CHS A;  1X9W B;  1T1V A;  1YQ1 A;  2GVP A;  4G2E A;  4DSR A;  1SKR B;  5CRE A;  2N5A A;  1QXH A;  6GSS A;  1X9M B;  2VIM A;  5AIX A;  2VM2 A;  2FWH A;  5KN2 A;  5J9C A;  4GST A;  2REM A;  3H79 A;  1TOF A;  1ZYN A;  4TOP A;  3SBC A;  1TP9 A;  2VD0 A;  2TRC P;  2XHF A;  5HR3 A;  4HI7 A;  1PN0 A;  5ECK B;  3VK9 A;  1ZMA A;  1X5E A;  2PUK C;  1M2A A;  5DCG A;  4BL7 A;  5ABR A;  1WRY A;  3JCM L;  1NHO A;  1VF1 A;  1GNE A;  3GH6 A;  4ECB A;  3IC4 A;  4KGI A;  4CY6 A;  5GAN D;  2MMZ A;  5INY A;  1OE7 A;  3W8S A;  4A5P A;  2NPB A;  2L4Q A;  2KUC A;  4O7H A;  3GKM A;  1DE1 A;  4OO4 A;  3WGX A;  4XS6 A;  4HJ2 A;  4ZXG A;  1XWK A;  3QCP A;  4ZB9 A;  1SD9 A;  4MNN A;  4KCE A;  1WP0 A;  2CAQ A;  5IO0 A;  1UN2 A;  2PWJ A;  4F2I A;  1K0C A;  2B1L A;  1GSQ A;  1GUH A;  3WD6 A;  4IBP A;  1B4Q A;  4LA1 A;  4MAB A;  1BQ7 A;  2E0Q A;  1O85 A;  3P8W A;  4JR6 A;  4HZ2 A;  4LMV A;  1XOA A;  5IMF A;  3FR9 A;  2HNL A;  4I97 A;  4OD7 A;  2DIY A;  2C0D A;  4RQX A;  2YNX A;  1MD3 A;  1SK0 A;  1XW9 A;  3LSZ A;  4I2T A;  4I8B A;  5JWQ B;  2PMT A;  1QMV A;  2UZ8 A;  3GYK A;  5CRD A;  1OKT A;  5ELG A;  2OE1 A;  2FCH A;  1ZYP A;  2FD3 A;  4EDZ A;  3F6D A;  5DVB A;  4OCE A;  2M80 A;  2HYX A;  1WOU A;  3PH9 A;  4TKY A;  4JBB A;  5IMV A;  1ERU A;  1WE0 A;  2R5G A;  3UEM A;  1FW1 A;  4X1U A;  2QSI A;  3IE3 A;  1A0R P;  2B6M A;  3KP8 A;  3L9S A;  4PGT A;  1OYJ A;  3ZLP A;  4IEL A;  3F9U A;  4ECC A;  4KDY A;  1ERW A;  4EVM A;  2OE3 A;  4N10 A;  4HS1 A;  3EIN A;  2H73 A;  2LNS A;  2I1U A;  1EV9 A;  5IMD A;  4HU9 A;  2C0F A;  5J5N A;  4RQR A;  4GRF A;  4YH2 A;  4MJA A;  3GRX A;  1G6Y A;  2DKI A;  3P2A A;  3CSI A;  4NPB A;  5G1L A;  2J23 A;  4Z2T A;  1Z7P A;  3FKF A;  4DSS B;  1MDJ A;  2K9F A;  2X8G A;  3HCZ A;  3O3T A;  1TXX A;  2HI7 A;  2DBC A;  3LOR A;  2IN3 A;  4PTS A;  1I5G A;  2JZR A;  4IQA A;  3DVW A;  4L0W A;  4CY8 A;  5EPF A;  1TU8 A;  2V32 A;  1MDK A;  2LRC A;  1F9M A;  2G0F A;  1F3A A;  1SU9 A;  2TIR A;  2VL9 A;  1XW5 A;  2OBI A;  1R26 A;  3D5J A;  3IAM 2;  2RUE A;  4FYU A;  1JHB A;  1YKC A;  3TB2 A;  3C73 A;  5DAL A;  3J7Y b;  5DCH A;  5KN1 A;  2I4A A;  3C71 A;  2DC5 A;  2H1G A;  4O5R A;  2EC4 A;  2O89 A;  4GCI A;  1EZK A;  1DE2 A;  2YP6 A;  3DML A;  2GZZ A;  4E8H A;  1G6W A;  2GS3 A;  5IMC A;  2YWO A;  1ERT A;  5JCW A;  3IBH A;  4EE0 A;  1VF4 A;  1RQM A;  2WB9 A;  4K2D A;  2QC7 A;  3KXO A;  1GSF A;  2IPA A;  3HHV A;  4KAE A;  4PQH A;  1ZGN A;  1S3D A;  3H93 A;  1EP7 A;  1XVW A;  4MJC A;  1K3L A;  1SYX A;  4EF0 A;  4WKW A;  2RM6 A;  3KJY A;  3TJG A;  3GKN A;  1CQG A;  1CQH A;  5ECQ B;  4MF5 A;  3GUR A;  5CRW A;  2F51 A;  2VCT A;  4ZL9 A;  2FY6 A;  5ID2 B;  2R37 A;  3ZRE A;  1W89 A;  3O76 A;  1XWC A;  3EU3 A;  4WF5 A;  2O8V B;  1TK5 B;  1GTI A;  3FMW A;  3D22 A;  3M9K A;  3QMX A;  3TKS C;  2VLU A;  1SK2 A;  2JAD A;  1TRW A;  3MIX A;  4PXO A;  5B8A A;  3MSZ A;  1BED A;  3VI5 A;  1JZW A;  1G7O A;  5IPH A;  1QFN A;  4HQS A;  4ID0 A;  1K0N A;  19GS A;  1SL1 B;  4F9Z A;  4JU5 A;  3KMO A;  4OFM A;  1F37 A;  2H1B A;  4QL7 A;  4EC0 A;  2H30 A;  4EKZ A;  3APS A;  1RK4 A;  2EIO A;  3IK9 A;  1EWX A;  4ZIL A;  1ACV A;  3CSH A;  3P7X A;  2I9H A;  2CV4 A;  3HDC A;  3D6I A;  2GLR A;  1X9S B;  1XXU A;  4Z2U A;  3D21 A;  1GRX A;  4MCU A;  3DGQ A;  4NHZ A;  2OBK A;  3DRN A;  1ABA A;  4EUY A;  3LYK A;  4ZBA A;  5J3R A;  3DYR A;  1FG4 A;  4N11 A;  1PGT A;  1ZCP A;  3GX0 A;  2XPD A;  4E8E A;  2HE3 A;  4DEJ A;  4G0L A;  1GTA A;  5H5Q A;  2LNT A;  1BJX A;  2HZE B;  3ZIJ A;  2LEG A;  5ECO B;  3TKR A;  3ZVJ D;  5D9T A;  1V9W A;  2BTO T;  4ZL8 A;  4G0I A;  2CZ2 A;  4ZL7 A;  4PUR A;  3BD2 A;  4WF4 A;  4IN0 A;  4O5Q A;  5J9B A;  4RI7 A;  4BVX A;  2AUV A;  1PD2 1;  3EC3 A;  4ZBB A;  1OE8 A;  1ZZY A;  1GLQ A;  1AW9 A;  4KX4 A;  2R2J A;  1M2B A;  1XVQ A;  3QPM A;  4PQ1 A;  6GST A;  1OC3 A;  2OAD A;  4EIQ A;  3ZL5 A;  3N5O A;  4K9Z A;  3MAK A;  3FY7 A;  1KEB A;  5ECP B;  1PSQ A;  3EVI A;  2MMO A;  1PKZ A;  1J9B A;  1PA3 A;  7GSS A;  3QOU A;  3LXT A;  2FGX A;  2GZY A;  2L5O A;  2DJ2 A;  1K0B A;  2G2Q A;  4V2L A;  4ML1 A;  1GP1 A;  5FWG A;  2GT6 A;  3HY2 A;  3DXB A;  3DD3 A;  1B9X C;  3C7M A;  2A4V A;  4WET A;  2CVK A;  1O73 A;  1I9D A;  3FR3 A;  4XCS A;  3IC8 A;  1GWC A;  2YWM A;  3KEB A;  4MDC A;  4K5R A;  2YZU A;  3ZMK A;  3GV1 A;  1TRV A;  3RDW A;  3QAG A;  5IM9 A;  5KN0 A;  4KUN A;  2R0C A;  2AB6 A;  2HLS A;  2NBS A;  5AIV A;  1YEX A;  2IIY A;  2VAF A;  1JLV A;  12GS A;  1FB0 A;  1HNC A;  3Q18 A;  5HFG A;  2RM5 A;  4ICY A;  2H6Y A;  4K1F A;  1O6J A;  4JRR A;  2YAN A;  3J7Y k;  1TI1 A;  4WR5 A;  1IYH A;  3PPU A;  1OC9 A;  4BA7 A;  2A2S A;  2LKU A;  3UL3 A;  4WBJ A;  1PN9 A;  2N5B A;  3FZ5 A;  5IPG A;  3QR6 A;  2VUP A;  4IP1 A;  3TDG A;  1EEJ A;  3ZFB A;  4IQ1 A;  4IHU A;  4V1A p;  3HVV A;  1KNG A;  20GS A;  3ERG A;  2L59 A;  1A2M A;  5ECH B;  1FOV A;  2B7K A;  3UIW A;  1USB A;  2H01 A;  4OFN A;  2EIR A;  1SD8 A;  4I2U A;  5CO3 A;  1NM3 A;  1T4Z A;  3GHA A;  5G5F A;  2CQ9 A;  2WZ9 A;  4X43 A;  3ERF A;  3PR8 A;  4EL1 A;  4LL1 B;  4OMV A;  1EOG A;  3H1N A;  1A2J A;  1TRU A;  1K0M A;  2H66 A;  5HR0 A;  2GSQ A;  4HU7 A;  2X8H A;  2E2M A;  2H0H A;  1Q4J A;  14GS A;  2XPE A;  2D2Z A;  13GS A;  1VF2 A;  3HJO A;  3TOT A;  4MH2 A;  2C3T A;  2X49 A;  1NW2 A;  1YDK A;  3VI7 A;  4MA9 A;  3HYP A;  3GMF A;  1YKA A;  3GL3 A;  1MEK A;  1XW6 A;  1A23 A;  3KP9 A;  1PMT A;  4IW9 A;  4GSN A;  3FZ4 A;  2QA1 A;  2VD1 A;  3ZVJ A;  4KB3 A;  1V40 A;  2R0G A;  2VCQ A;  4BPY A;  2V6O A;  2VCW A;  2CT6 A;  3LW9 A;  2IJY A;  4TR1 B;  3D4T A;  2C3N A;  1Q98 A;  5JCU A;  3CRT A;  3PGT A;  5DAK A;  3LG6 A;  4GXZ A;  3IA1 A;  3UAP A;  2HFD A;  3GKK A;  1Z5Y E;  2C80 A;  4J2F A;  2O7K A;  3CMI A;  4MJB A;  1GSE A;  4KW6 A;  3LJR A;  2LQO A;  2KP2 A;  4DVC A;  2IMI A;  2C8U A;  1JZR A;  1ILO A;  2J9H A;  4PUA A;  5E4W A;  2YPM A;  4ZB8 A;  2K8V A;  3IK7 A;  4ECJ A;  4K7O A;  2O87 A;  5DJL A;  2BJX A;  1PX6 A;  2GT5 A;  1THX A;  3GL5 A;  2EIQ A;  1OAZ A;  4N0V A;  4OO5 A;  4WBR D;  4NWY A;  2WDU A;  4L5L A;  3VUR A;  1AC1 A;  4O32 A;  3E3E A;  5B6N A;  2XBQ A;  2HXK A;  2QA2 A;  2CZ3 A;  3TRP A;  5ECN B;  2OKA A;  1Z7R A;  2VCV A;  1U3I A;  5ECS A;  3KTB A;  4PX1 A;  1K3Y A;  3EE2 A;  1B9Y C;  4YQU A;  2H0G A;  3W6G A;  2MMN A;  3IAS 2;  3M3M A;  2H76 A;  1KTE A;  2K18 A;  6GSW A;  3F8U A;  5EVO A;  1ST9 A;  2V6K A;  3TKQ A;  1SKS B;  2B5E A;  1DBY A;  2YJH A;  4X4J A;  3CSJ A;  3FZ9 A;  3OR5 A;  4HOJ A;  10GS A;  4D73 B;  3TUE A;  3SWL A;  2DSA A;  3G7I A;  2B1K A;  2YWI A;  5BRT A;  3TRQ A;  3APQ A;  5G30 A;  1PKW A;  3L9V A;  5B7C A;  4YQV A;  5A4W A;  4XS4 B;  1YEP A;  5IOW A;  3F0I A;  1NHY A;  3FHK A;  3MYD A;  3IXR A;  4G9H A;  1TTZ A;  1LBK A;  1PRX A;  1T3B A;  2LRN A;  5DQS A;  1R5P A;  3L4N A;  1ERV A;  3Q6O A;  3CTG A;  2HRF A;  3DWV A;  2MBS A;  3GUS A;  3EPT A;  1FB6 A;  2R0P A;  2GSR A;  5DQY A;  4EO3 A;  5AIS A;  4KDX A;  3BBY A;  2OJL A;  2WRT A;  4TR1 A;  4TVE A;  5F0G A;  4MF6 A;  1M99 A;  4GQC A;  3I43 A;  4AJ7 A;  3CTF A;  6GSU A;  2FUG 2;  2OE0 A;  4FYB A;  1QUW A;  1VGL A;  2PER A;  3IRA A;  4N30 A;  1PL2 A;  2WFC A;  2JAC A;  2IFQ B;  1GSU A;  4FO5 A;  4HDE A;  1OKD A;  1T4Y A;  4IJI A;  2AV4 A;  4TR3 A;  1GSS A;  1R5A A;  4ZB6 A;  3IHG A;  5JCG A;  4WXT A;  4NMU A;  1AXD A;  3IV4 A;  5AN1 A;  4IS0 A;  1EP8 A;  3R2Q A;  2YJ7 A;  1T00 A;  3F6F A;  5HR2 A;  3C1S A;  1ZYE A;  3IOS A;  3PIN A;  5GAP D;  4XS1 A;  5JWR B;  2GTU A;  4NV2 A;  1WPI A;  4RUV A;  3A3T A;  3TKS A;  5E59 A;  2R4V A;  2NTO A;  3L9U A;  3VFI A;  3GKX A;  3O6T A;  4GQF A;  2ZNM A;  4QL9 A;  1DSB A;  4HZ4 A;  4L8E A;  1EV4 A;  4LL4 B;  5A4U A;  5G5E A;  4Q5Q A;  3E9J B;  1W4V A;  4MPG A;  3FZA A;  1LJR A;  5D9W A;  5D8I A;  1GTB A;  3US3 A;  1HNA A;  4Q5N A;  3DKS A;  2JSY A;  3MWH A;  3RHB A;  2WGR A;  3HKR A;  2DIZ A;  4DSS A;  3HZ4 A;  1BAY A;  1N8J A;  2H8L A;  1YF1 A;  3WGE A;  3GTU B;  2H0I A;  4ECI A;  4PNF A;  1FAA A;  2P31 A;  1WIK A;  2MZC A;  6GSX A;  3U6V A;  1WMJ A;  1UVZ A;  3A5W A;  2C4J A;  1R4W A;  3K8N A;  2CX4 A;  4K7I A;  4MPF A;  5H5S A;  5AGY A;  2FWG A;  3VPQ A;  3D4M A;  4XRA A;  5B6M A;  4BWS A;  2FLS A;  5CYY A;  2FNO A;  5A5K A;  2VCZ A;  4NAX A;  4BVY B;  1E6B A;  1AQV A;  2E2G A;  3E0U A;  4WEY A;  3QFA C;  4G19 A;  1AAZ A;  4LLR A;  5DJM A;  2I3Y A;  1H75 A;  2CA8 A;  3Q74 A;  4YAP A;  3KZQ A;  2V1M A;  2IWT A;  1VF3 A;  5ELA A;  3KD0 A;  5ENU A;  1BX9 A;  1SL2 B;  3HJP A;  5LD0 A;  2LST A;  3HJM A;  3UVT A;  3ME8 A;  1KBN A;  4GSS A;  5D96 A;  2FWF A;  4POK A;  5F07 A;  4H86 A;  3BCK A;  2VL3 A;  1EOH A;  3GA4 A;  2X8C A;  2VL2 A;  4FH8 A;  3UAR A;  2GST A;  1UC7 A;  3WT1 A;  2R6K A;  1G0T A;  1SEN A;  3HVS A;  2B5Y A;  4KSO A;  3EMX A;  3M8N A;  3TJB A;  2VCX A;  1MDI A;  2HSM A;  1EGO A;  1X5C A;  1E2Y A;  3VLN A;  4K7N A;  4GTU A;  2F8A A;  3F4S A;  3QD9 A;  5ID2 A;  1RW1 A;  2GQL A;  5KN3 A;  3LWA A;  3TGZ A;  3ED3 A;  3NOF A;  5B8B A;  4NV5 A;  3D0Z A;  4IGJ A;  3QDN A;  6GSV A;  5F06 A;  2JZT A;  1FO5 A;  1M9B A;  3F3Q A;  4OCF A;  2L4C A;  2NDO A;  3KGK A;  3I69 A;  5CRG A;  3CRU A;  3CBU A;  1V58 A;  2IMF A;  2DJJ A;  3LGC A;  1YJ6 A;  4JED A;  3TKS E;  2DJ1 A;  3F3R A;  4GLT A;  2C1Y A;  3LQ7 A;  4I6X A;  2H6X A;  1DUG A;  3TCO A;  2YZH A;  1IYI A;  2L57 A;  3HD5 A;  2C3Q A;  2M72 A;  2YV7 A;  5D9V A;  1FVJ A;  3EYT A;  3IHQ A;  3N9J A;  4HUA A;  1Z6N A;  3EMP A;  3HA9 A;  3M9J A;  2YCD A;  1GLP A;  5ECI B;  2ON5 A;  4L5O A;  4XHM A;  2C0E A;  1J08 A;  2KLX A;  3QAV A;  2GGT A;  5IMA A;  3APO A;  2HZE A;  4KSM A;  1ZYQ B;  2PBJ A;  1PL1 A;  1GUL A;  5FT3 A;  4OWY A;  1A2L A;  2PVQ A;  4POB A;  2H6Z A;  1U88 A;  2N5F A;  1EGR A;  2FA4 A;  4IVF A;  2X4A A;  1VRS D;  2LUS A;  5DBQ A;  3KH9 A;  2F8F A;  3RAZ A;  2LRT A;  1JZO A;  2CVD A;  3VWU A;  2HZF A;  4Z2R A;  1QK8 A;  3CYN A;  1XIY A;  2Z9S A;  3F4R A;  3DIE A;  5LCZ A;  2YN1 A;  1HYU A;  4GWR A;  4JZQ A;  3TRX A;  5EY6 A;  2H1A A;  2LQQ A;  1MD4 A;  1Z9H A;  1A24 A;  5BMU A;  3KTL A;  3ZZX A;  2F9S A;  1XWG A;  3FRC A;  4BWQ A;  5DAL B;  2JL4 A;  5GSS A;  2WCI A;  3I9V 2;  3LYP A;  2RUF A;  2DMM A;  2PPT A;  2KP1 A;  3KM6 A;  4MZB A;  2B3S A;  3P90 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...