3FHTA

Crystal structure of human dbp5 in complex with amppnp and rna
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
392
structure length
392
Chain Sequence
NQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mRNA export protein DBP5 binds RNA and the cytoplasmic nucleoporin NUP214 in a mutually exclusive manner
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna
molecule keywords ATP-dependent RNA helicase DDX19B
total genus 137
structure length 392
sequence length 392
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fhtA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fhtA01
4M2LA 1E4YA 2FWRA 821PA 4IDOA 4BECA 4Z54A 5L3QB 2VSFA 3QXJA 4JBYA 1GKIA 5JWRA 3PITA 4WXRA 5TVKA 4A2WA 1E1QD 2BEKA 3C4JA 1S1MA 3REGA 4Q4AB 4NCNA 1NSTA 4FXPA 4CDGA 2JLZA 4JYBA 2NPFA 1GL6A 1YZUA 4OJQA 1W36D 1Q21A 5HZKA 1CKEA 3F5FA 1CR0A 4LYHA 3AVXA 2CXXA 3Q5EA 4FN5A 1JXOA 3KKNA 4XSHA 4D0LB 4G5QA 4TT3A 1H8HD 1IXRC 1KI9A 1NN3A 2ZE5A 3TAHA 1AZTA 4A6PA 2A9KA 5KNCA 3I8XA 5GJWC 2O8FA 1TAGA 1W5SA 1ZU5A 4EPYA 3DHWC 3PIRA 1DELA 4TWZA 2IYZA 2ZREA 3Q85A 1QHHB 2DY1A 2G6BA 4KJZA 4QM7A 5HKKA 4PAOA 1OXTA 1XTJA 4Q9IA 5JEEA 4CW7A 5F3WB 1T3HA 3DO6A 4MRSA 3W8RA 4ZDKA 3SNHA 3C5CA 3KB1A 1R5NA 3LRPA 4V0MA 2WJIA 1G7RA 1XPOA 2R6AA 2HCBA 5KSYA 3OHMA 4KBGA 1NG9A 1GNQA 1B0UA 4BFZA 1AS2A 1KDOA 2QTVB 1CJUC 2WWXA 1Z0IA 4BZXA 4JLMA 4DCUA 3CZQA 3Q72A 4TTRA 5E95A 1OXUA 3JZAA 5AUPB 4IKEA 5JRJA 1MH1A 1P2SA 4QJ3A 2QI9C 1OFTA 2XSZA 4LHYA 2V9PA 4TQAA 1G6OA 2CHGA 1NIJA 4R98A 2ZI5A 2R6CA 4DSUA 5L3QA 3ZDQA 3EPJA 2GF0A 4PC6A 3CRVA 2QP4A 5AR1A 4NYIR 4TMXA 4EFNA 2V7QA 5FOVA 4EQ6A 2WMOB 5H68A 1EFCA 3GFOA 3SE0A 1EK0A 4M1SA 2DHRA 3X1WA 2ZRCA 2PT7A 2AK3A 3OE7D 2H17A 2WMNB 2Q9CA 1Z29A 1F2UA 1I4TD 4ZIRA 4KODA 1XP8A 1OFHA 1J99A 2PJRA 4XOIA 2ZEJA 5C4GB 4MH0R 1FUKA 2V7QD 1G291 2PX3A 1R2QA 2E9SA 4BEJA 2HUPA 5J4LA 4NDZA 4BPBA 2YC2C 1P75A 2OT3B 1KJZA 3H0KA 2GZAA 5IRCD 4NBSA 3RS3A 1OT3A 2RMKA 4DLTA 1TUEA 5K8UA 3L82B 1QHNA 5KPDA 3GLFE 1W7AA 5EXSA 4I1OA 3HPQA 4BFVA 4ZKDA 4PX9A 3PR1A 2QE7D 3HYRA 3BK7A 1ELOA 2GESA 1J8YF 1VG9B 4D81A 4LJ9A 3CRW1 1R4AA 3T5GA 3AQ4A 4C4PA 1J90A 3QEOA 3HYTA 4DKXA 4BWYA 2E87A 1GKUB 2ZRIA 2BM0A 1OLOA 5EXXA 1E9FA 4AY2A 3C41J 4LYFA 1G3IA 1NY6A 2ZYUX 4YDSA 5HR5A 1FUUA 2VPPA 2WJVA 3ZQ6A 4HAXA 1MT0A 2BBOA 4JLDA 2QMUA 3GEEA 4A9AA 2J46A 4V0NA 1ZC3A 1DS6A 4JYCA 4CEJB 1W46A 3KQHA 4TZ6A 3EC2A 1GUAA 4DLWA 4HUQA 3BERA 2BMDA 2ZETA 5KUTA 1LTQA 2F9LA 2EFGA 3BH7A 1MO6A 3CONA 3MJRA 4Q21A 4ZPXA 4M1TA 4C3ZA 3OESA 4IEIA 3B6EA 2XXAB 1ZRHA 2PCJA 2Q9BA 1UF9A 4C9BA 1ZAKA 3VHXA 1GNPA 4BE7B 1ZM7A 1FL9A 2RH5A 5FUWA 2DFNA 4OI2A 1FNMA 3AKCA 1P2VA 1ZUHA 3CPEA 4TTPA 4YMSA 1ZCAA 1KK1A 1XJQA 4DIDA 1E1QA 1S96A 3CF2A 3B5JA 2OBLA 3FMPB 4OK5A 1YZTA 1JR6A 2Q3HA 2A78A 3FKSD 3SEAA 1L8QA 1OE0A 2IYUA 3KFVA 3RANA 4B48A 3Q9LA 1KTVA 2G83A 2IWHA 2C77A 2VP4A 3KX2A 1COWA 3MCAA 1E9AA 2F1HA 3IQWA 4GL2A 2B7BA 1XEWX 5CM9C 4G1UC 4KVAA 4BGDA 3BH0A 3U44A 4XH9B 3QXSA 4U02A 6Q21A 1HTWA 3WNBA 1FQJA 1PUJA 4QL3A 3C14C 4Q4JA 2BIFA 2REOA 3TH5A 4UNRA 5DI9A 2XNDD 4NYJQ 4RKFA 1Q57A 1IJFA 4A82A 1IY2A 4B6FA 1HURA 1S0UA 5FOWA 3K0AB 2X77A 1K5GA 3V00A 3OEHA 4AYXA 2CCKA 1COWD 4UNQA 3SOPA 4HAVA 3FPAA 1UBEA 1ZD8A 4RVCA 5KNDA 4IDNA 4Q1AA 4URYR 2CDNA 1IXZA 2HEIA 1U0JA 1Z6YA 1XTIA 4JVSB 4NZYA 4WXPA 2D7DA 3BIFA 4PO1A 3BB1A 2IL1A 3H86A 3NTUA 2BKUA 4OI0A 1HYQA 4MYUA 3EPHA 5FL7D 4M1WA 2VP2A 2P6NA 1RZ3A 2O8CA 2ANCA 3KDSE 2Q6TA 1G8YA 4QFMA 4QHSA 4DEXA 3R9WA 4MGKR 1ZD1A 1MKYA 2VP6A 3ADBA 5D3MA 1Z83A 1GRRA 1VCNA 4PPNA 2PZGA 3QPUA 2I3BA 3GLGB 2WHXA 2DFLA 1GRQA 4QOSA 5IT5A 4NL4H 3SS8A 4KITB 5DI3A 3QVVA 5FOTA 5UKDA 1GP2A 5EZ5A 1Q1QA 5H1YA 3L2OB 2WV9A 4D4KA 4MYCA 1DADA 4HZUA 1DAIA 4PQRA 4FMCB 2FEMA 1SVIA 5EJEA 1CJKC 5BW8A 1EXMA 4B3XA 3UMFA 2Z4SA 4UXJA 1LB1B 5JFGA 1NNEA 4P4SA 1CULC 4LV5B 2HXYA 5FTMA 1AIPA 1VCOA 3GLGA 1WBBA 4EFLA 5DLQC 4JL6A 1RRGA 4A15A 1ZMXA 1DO2A 3RS7A 4DLZA 4PAQA 4QNMA 3TGPA 1G18A 5HTKA 2CLDX 2XZOA 1Z3IX 3K09A 3KTAA 5IK2A 1Q1BA 4M9QA 3L43A 4WBSA 1VHLA 1G3QA 4O25A 1VG8A 2Z5FA 3PV0A 5KDLA 1ZVQA 3KQLA 1OF1A 3H1TA 1IAQA 2QAGC 2RGGA 3LA6A 1XMVA 1ZUIA 2RHMA 1CBUA 2K5UA 3AUYA 3EA0A 2J7PD 2ZAOA 1R10A 1U8AA 4Z8YA 4ZIRB 1FTNA 1KZ7B 4JS0A 4WW0A 2ZXUA 4Q02A 3WMEA 1JQLB 5B30A 3RSOA 2DWQA 1FW6A 1JEEA 1VIYA 3N2EA 1C4OA 3BS4A 1YE8A 4JVLA 4A0HA 3R9XA 2ODNA 5FTNA 4C7OA 4IFBA 3U3KA 1OHHD 4N1AA 5SZJA 1KKMA 2HF9A 3E1SA 1Z2AA 4ZI3A 3I61A 1QRAA 1ZUNB 4Q00A 2CNWA 3EXAA 4V0OA 4H9GA 4DC9A 4ITRC 1E32A 2OLJA 4HAWA 3T12A 2I1QA 1NI3A 3D6TB 4J0QA 4JL8A 3SYLA 4HDOB 4B75A 4NCHA 4X8HA 1DBSA 3BOSA 2G9NA 1G17A 1GSIA 3P26A 2O0KA 5TV2A 1KO7A 5CM8B 4JMPA 2JLXA 5FTKA 3RC8A 2WTUA 2PL3A 2JATA 2WBLC 2YYZA 3FGNA 3CPJB 3NBYC 4D6PA 4I1UA 2ODBA 1AN0A 4OQFA 3AH8A 1E2DA 4BZPA 3F8TA 2PX0A 1ZIOA 4D26A 1G7CA 2V6IA 2ZR7A 1F48A 1ZNWA 2P6UA 3C8UA 1YR7A 2GDJA 2RAPA 1G19A 1II8B 3OEEA 1KAGA 1U8ZA 3LAWA 2CL0X 5EUMA 1G4UR 2D2FA 1N5IA 1SVSA 1XFAA 4PO8A 4YLGA 1ODFA 3FE2A 4HUQB 5FBQB 2NO9A 3B82A 2A2ZA 5E7IA 4P4TA 4XJXA 5E4FA 1UKVY 3A1UA 3W34A 1QHSA 2QP3A 1U2RA 1XDBA 3BORA 3AGQA 1PLKA 1OFUX 1Z6AA 1Z63A 2ANBA 3BFKA 1XTKA 4L15A 2OUKA 121PA 3EARA 2VSOA 4EJSA 1X3SA 5DYIA 3ND8A 4HAZA 4JVMA 1H8HA 2BBTA 3F3YA 621PA 3THYA 3D7MA 4KVGA 1C1YA 3U7HB 3IHWA 3O8DA 2FH5B 4OYHA 3GJ7A 4JJZA 4P3YA 4GZLA 1E2NA 1KYIA 3LW8A 3PUVA 1V5WA 3LDAA 4ZCMA 4QGHA 2YWGA 5CJ2A 3G0HA 4FWIB 4POAA 3CB4A 3CRQA 1E2LA 1Z2CA 1DAKA 1ZIPA 2VHJA 2XTZA 3X1ZA 3KZ1E 4JKIA 2OAP1 3UG6A 1E2QA 3BAFA 3QKRB 1WB9A 1Q22A 4TYPA 3SFZA 5IDVA 1P7CA 2AHOA 2XZPA 5KDOA 4NYJR 2D4HA 4FMCF 3V9PA 5FH9A 3OF5A 3KB2A 3VKHA 3Q5DA 2R9VA 3TMKA 1IY0A 3I1FA 1KSHA 2XOKD 1W1WA 4IDPA 3VKWA 4PHFA 4M53A 5CLLA 1ZM2A 1VTKA 3ZGXA 1CTQA 2IX3A 1P5ZB 1F2UB 3GMTA 2F1RA 3QNUA 4LJ7A 1UFQA 4WIAA 2OAQ1 4PXAA 5FOXA 4RD6A 2EFHB 1Z0JA 2KE5A 4DDWA 4TYYA 1IXSB 4TYWA 4QM6A 5J4VA 1ZNYA 2GETA 1DO0A 3IKJA 2O5VA 2AD5A 2OCBA 4WZBE 2VIIA 4C2TA 1G3UA 2FZ4A 4B44A 4BRWA 5CIQA 3KUDA 5JRZA 3B1VA 2J7PA 1PV4A 3AP3A 3QY0A 5CDFA 3ZS8A 1QVAA 4F93B 5CYOA 1E6CA 1W2HA 3LV8A 2ZSEA 3P4XA 4IRUB 5CIWA 5FBVB 1C9KA 2ZI3A 2QROA 2C8VA 1ZYUA 2YJTD 2H5EA 2QM8A 4C0QC 5IK2D 1X8JA 4HDQB 4Z8XA 1RVDA 3B1XA 1DOAA 1NKTA 2NGRA 2ZSDA 3CBQA 3PXGA 2C98A 1AKEA 4QXAA 2X1VA 1VMAA 1GVNB 4I1VA 1ZM9A 2IS4A 2P2LA 1AQUA 1IONA 4NYMQ 1XPRA 2EFEB 1KHTA 1NG1A 4HLUC 4Q66C 4RD1A 2A5DA 5K8TA 1GZSA 3RAPR 2LKCA 4B47A 3D3QA 1N6OA 2IUSA 3HR8A 1CP2A 1E2JA 1WP9A 4CEJA 2HT6A 4BQSA 5CLQA 1D8TA 2JJ1A 3EIQA 3K9HA 1P73A 3CH4B 3VR6A 1P3JA 1K5DA 1Y63A 3GJ4A 3KFXA 1HT2E 3UMRA 2XITA 2OBNA 4W7SA 5LPNA 1FX0A 1O3YA 4PPQA 4US1R 1ONBA 3THXA 3QF7A 5FPYA 1E2FA 3FB4A 2DBYA 2ZR0A 3LBIA 2O8BB 2VLIA 4HUTA 4DLSA 3QSYA 2WJJA 2GJKA 2W0SA 3GLIB 3I32A 3UATA 3ZLJA 2OXCA 1AGPA 2EVWX 3QXXA 4Q4LA 1XZQA 3FHCB 4PSAA 1Q20A 2WWHA 2FFHA 4MUBA 4TLBA 4DWJA 2C78A 3PFIA 2FPKA 1Z06A 5FL7A 2VBCA 1SVMA 5AJWA 5DH9A 2FN4A 1XEXB 1CIPA 3WBKA 1NLYA 1T6NA 3A4LA 5DHAA 4BFTA 5A4JA 4B3CA 1Y3AA 1N6RA 2IYQA 3BE4A 1MO3A 4IW3B 3CO5A 3PEWA 1TMKA 1E1RA 2FSIA 3U61B 3T15A 1A2BA 4KSCA 4GDFA 1FPMA 2BBWA 3D8BA 1YU9A 3SZRA 3EZ2A 3OEHD 4LDJA 1RJ9A 1FQKA 4LJ6A 3RS4A 5JECA 4CEHA 1NP6A 3K0EA 3R7WB 1E2MA 1KI6A 2H92A 2CVHA 4XD7A 1KO8A 4GMDA 4BFSA 2ZUCA 1YZNA 3MD0A 2ORVA 4HEJA 4JT2A 4RFSA 4B73A 2J5XA 4KBFA 3VX4A 3AF4A 2QM7A 4OHYA 4ILEA 2GTPA 5KSPA 3MWLA 4KFTA 4BLQA 2GBLA 2EFDB 1RKBA 2J9RA 1W0JA 2Z6VA 4NH0A 4Q7JB 4TLDA 2PT5A 4A2PA 1QF9A 2P5SA 3OFND 1M1YE 3EZ9A 3CF0A 1E9EA 3LQQA 1YZGA 1GNRA 4RZXA 3FKSA 3Q7PA 4AKEA 1E0AA 2FU5C 4OL0A 5KDDA 1TPZA 1IN4A 3TAUA 3RRYA 4B6EA 3AEZA 4Q47A 1NVVR 5GJVC 1RFLA 4TLAA 2G1JA 1GOTA 2E1RA 4AG6A 2QMOA 3NC1C 1A7JA 2JJ2D 2REBA 3B9QA 1HV8A 5GVSA 2WJYA 1SVOA 4A8JB 1EFUA 2OEPA 3TLXA 4TMZA 2CLCX 1NBME 2W00A 3CIOA 1AM4D 1MR3F 2HJGA 2G0NA 5EE3A 1T9HA 3H84A 1RYFA 2VP5A 2Q21A 5EZ6B 1I4DD 2FA9A 1FP7A 2WWWA 3IO3A 2D2EA 3KL4A 3DKVA 2YOHA 4OQMA 4G5OA 1F3OA 2AFIE 2BC9A 4DJTA 5JJLA 3AM1A 1KMQA 1P2UA 2OCPA 3FMIA 3PUYA 5F9HA 3QKUA 3NG1A 3GJ5A 3TKLA 4PTLA 5CDFE 2O8FB 2FF7A 5JSZB 4Q18A 2EYUA 4BEBA 2IA5A 3BXZA 3GLHB 3VTKA 2G1KA 1QHHA 2CMKA 1KY2A 1W49A 2R44A 4OJKA 5FFMA 2ZRPA 1RE0A 3THOA 4EPTA 1YZQA 1GFIA 2VH5R 3ETLA 5L3SA 2P65A 3LH5A 1JB1A 5GJBA 5SZIA 2JEOA 1Z07A 3AVTA 2WIBA 2D62A 4IVQA 5D3MB 2PMKA 2WOOA 1R7RA 3LVRE 1NMZA 2PEZA 4ESHA 4DUGA 2B8WA 2ZVQX 1R0WA 5BQ5A 3SYKA 3W6OA 1N6IA 1SZPA 1G8GA 2IEYA 4DSOA 3LVQE 2JDIA 1EX7A 3R8FA 5EQTA 4EPRA 3UWOA 2LWIA 1KO1A 4HB0A 1Q1ZA 2ZJOA 3WNDA 2BOVA 1DAHA 3SFVA 4RY2A 3SC3A 1N0WA 1GAJA 3SYNA 1NN0A 2IW3A 1S1CA 1Z6TA 1E9SA 1G3MA 3HDTA 1H65A 4RJLA 2QSZA 4HLCA 1GWNA 2R8RA 3QG1A 3RSLA 4A1FA 4D0NA 3NVAA 2VHTA 1JR3E 3QI2A 1OYWA 3NIBA 5EP4A 5F9FA 2OXRA 3HPRA 3IILA 3SI7A 2GCPA 4NYMR 3RABA 5AUNB 3THWA 4TLEA 4BLPA 2F7SA 4Q4JB 4UKDA 4I81A 1U90A 4FCVA 1MO4A 2ZJBA 3GEHA 4MDFA 1XD2A 4DVGA 4MQBA 3K09C 5E7JA 4IDHA 2ZSFA 4RD3A 3AGPA 2OHFA 1XRJA 2EW1A 1XWIA 1O87A 521PA 3R7WA 3GLFB 4A0RA 4C0KA 5FBLB 1ZM3A 2XSZD 4C0SA 1G8PA 2BMJA 2FFBA 1XCPA 4HATA 1R5OA 5FR2A 2FGKA 2YVUA 3WMGA 4US0R 5G41A 3WHLA 2WWIA 2JLWA 5FOSA 1WQ1R 3VFDA 1S3SA 3DPUA 3ZVRA 2WM9B 3KQKA 1Q44A 1CR4A 3EW9A 721PA 2ZI9A 1OSNA 3LWNA 1A1VA 3QENA 3TQCA 1G64A 2V54A 1P9WA 1P6XA 1W4RA 2O8DA 3T35A 3FDIA 3TRFA 4O2LA 4GMXA 2PBRA 5HKKD 1IN7A 1EG7A 2KSQA 2H8KA 2EFCB 3K1JA 1IY1A 1CJTC 3T1QA 1YR9A 5HE8A 2ERYA 4Q1CA 2BWJA 3QQ5A 1P4SA 5AJVB 5L3SB 1XTSA 3GLIA 3U60B 2NO7A 2OFWA 1ZM4A 3WBJA 1W0KD 4HZUB 2WPDA 5DISB 3TUJC 3IGFA 4A4DA 5ELXA 2HLDA 3CH5A 2OBMA 1CJMA 3BD9A 1U8YA 2PJZA 1Z28A 4LRWA 3EZFA 5M04A 2C99A 3ASYA 4OK6A 1HE8B 1WDTA 2G0TA 1UAAA 4ON9A 4ZO4A 4Z1MD 3GPLA 1TEXA 2QORA 2ZI6A 4FCTA 2JLUA 5DE3A 2BCGY 4X8OA 1NRJB 3ADDA 2DWPA 4BUJA 3GLHE 3FHTA 3CUEF 1UADA 4Q4AA 1N5JA 1KSGA 1A82A 2CK3A 4MKGA 4AIIA 1KNXA 4KU4A 2GA8A 1E79A 4OK3A 4TZ0A 1BKDR 5J47A 5SZKB 2CEAA 2N42A 4LHWA 2GXUA 3SBDA 2O8EB 3GLFA 5JJKA 1ZBDA 3FYHA 2Z43A 1YRAA 2JCSA 3PVSA 2XTMA 2ONJA 1GKYA 4ASUA 2GEUA 1ZW6A 4RD0A 2WKPA 1N6KA 2BM1A 1Q3HA 4LBWA 2W6JD 1LNZA 2R6FA 3L8YA 3T5DA 3WRYC 2GK7A 3GEIA 4E07A 1LV7A 2JLSA 2R6DA 3QVUA 4PR0A 2C04A 1II0A 4BFWA 1J7KA 2VF8A 2GCOB 1NLZA 4OI1A 2AD1A 2ZANA 3QPVA 4JJKA 2ZJAA 1VECA 4HAYA 3TNFA 5KNBA 3U2QA 1NSFA 3A8TA 4PSKA 4YMVA 3I5YA 4NCJA 4XSGA 1T5LA 4U5XA 1Z6XA 4NPHA 4F7WA 3M6AA 4Q19A 5F2EA 3NHBA 1T0JB 5FPTA 2VQSA 4AKGA 5H70A 2FG5A 3EC1A 4GP7A 2XNSA 2IUUA 1JALA 2BCJQ 3L0IB 3JVUA 4DDTA 1Z0FA 4DB2A 3GFTA 2ZYVX 3VNVA 5FPSA 2XEXA 1KMHA 2W83A 4XVUA 2MSCB 2DWOA 2F43A 1RW4A 4Q9KA 1DAGA 4LK2A 2NPIA 3PUZA 2RGAA 3DOFA 2QL6A 3RS2A 4OKSA 1OXXK 3AF2A 1L2TA 4RD4A 5D3QA 3SHFA 2LCFA 1HUQA 4PAMA 4XTRA 4MRRA 2Q0HA 3WYAA 4B3GA 2HYIC 3AKDA 1GL7A 2GXSA 3LXXA 4UNPA 3R8CA 3U7GA 1DAMA 1OW3B 2ODWA 2QA5A 3X1YA 4W9MC 1LF5A 1NN5A 3O47A 5J5CA 1X86B 3GLIE 4V0ME 1P62B 1IN8A 3KXKA 4TN1A 1Z0KA 4FWTA 3MMPA 1XU4A 4JT4A 1GTVA 4GFDA 4AG5A 1R8SA 2VYFA 3BRWD 1W4AA 3O8BA 4TYQA 1AK2A 1BMFD 4EAQA 3ZJYA 2FDCA 1OIWA 1G20E 2QRZA 3CR7A 1XD8A 1B23P 4JLJA 3RWOA 4G0NA 2RGBA 1AZSC 4URXR 1XMIA 3N5CA 3MRSA 2WWGA 1II8A 4HLUA 1N0VC 2IXGA 1PVOA 2ZYWX 2AX4A 3S1AA 5FPKA 1DEKA 5FOUA 3PQCA 1JJVA 3L0PA 2IYTA 3HWSA 4YQFA 5J4YA 1UKZA 1W4CA 1YRBA 2JASA 3RHFA 3FWYA 5K8IA 1XB2A 1S9HA 3OAAD 1IM2A 2WKQA 2XJ4A 1ZCBA 4I99A 3U6KA 2IF0A 3AUXA 2VSXA 1Z22A 1JECA 3GFPA 2IWRA 2QT1A 3M0EA 2GXAA 3CRRA 4DCNA 3CZPA 1F60A 3KKMA 2AR7A 5EE0A 5KPJA 3QBTA 4TL6A 4PFSA 4NU0A 1E2EA 2C9YA 3B7GA 1OB2A 4PO9A 5C18A 1I2MA 4KYIB 4ARZB 4B34A 2VL7A 4K8OA 3AVOA 4DCTA 1MRSA 2IS6A 4UJ3A 3AKEA 2G3YA 4DSNA 2FEOA 2ZS7A 3B1WA 5FUVA 1OKKA 5KSOA 1TEVA 2BJVA 1GITA 2R62A 5KSZA 4QHYA 4NONA 2ZITA 5DNYB 1XJCA 4FI3C 3MWYW 1J2JA 5FI0B 2RCNA 1NY5A 2IHBA 3WHKA 3Q3JB 5HPYB 5CB6A 3E70C 2VP9A 1FMLA 3IO5A 1RJ9B 4LJ4A 4RZ3A 3TQFA 4Q1BA 3U7FB 3CNNA 5F98A 1XTQA 3LW7A 4I1SA 1N25A 2WVJA 1G6HA 1EWRA 5BN4A 1NMXA 1XMSA 2JLRA 4IDQA 1SXJD 2JIZA 4AYTA 3LLMA 2MSDB 2YWEA 3K0FA 4TSFA 3IIKA 1OFIA 1N2CE 3ADCA 1Z0AA 2FSHA 1W47A 3I72A 4LBVA 3ZZTA 2EQBA 2YHSA 2C9CA 4DIEA 4C2UA 2OG2A 1LS1A 1DAFA 1E3MA 1G21E 2R65A 2XJ9A 3TSZA 5GJCA 5JBQA 3IEUA 4D4JA 3DKPA 3AVYA 3TIFA 1D5CA 2HJVA 2ZE7A 1OXSC 1FZQA 2ORIA 1SKYB 1UEIA 3CLVA 4NTZA 3EPLA 2W6ID 5DYGA 4B71A 1D2EA 5K8LA 2O8BA 2RB4A 4C0JA 1E9BA 3E5HA 1JR3D 4PZLA 5DN6D 2J0UA 2IC5A 2C03A 3GJ3A 5B2ZA 1E2IA 5EP2A 1QHYA 5AJYA 2ATXA 1T3LA 2CHVA 2YWFA 4PSVA 3MLEA 4DHEA 4LJ8A 1BO6A 2GAOA 5TB5A 3NWJA 3VMFA 3M1IA 2IXFA 2ZE8A 4KSBA 1U0HC 4IEEA 4URVR 3A1WA 4LJ5A 1EESA 4LCBA 4L9WA 1JJ7A 4N0DA 1OYYA 4OHZA 1JQJC 3KJGA 5ANRB 1DG1G 2XGJA 2W0MA 4JKYA 3C15C 3JZMA 4G5GA 2AL7A 3GCGA 3BFVA 1NF3A 4GT1A 2O8CB 1QZXA 2VA8A 4QNRA 3SQXA 1NKSA 1HE1C 2WSSA 5EE5B 4KLZA 2RGNC 4B74A 5L3VA 5DSZA 1YZLA 4CT5A 2AXPA 4GSYA 3X1DA 4MKFA 4NCIA 3AF3A 1T3SA 1E2KA 2GEVA 3TE6A 2H7VA 3CX7A 3DDCA 3K70C 4BLTA 2HCJB 4YXWA 3ONWA 3QG5A 2GZDA 2VO1A 3I73A 3NXSA 4JLPA 4OHXA 4V03A 3TSOA 1F6BA 2R6GA 4B43A 5JCPA 1YHNA 3VNUA 2BDTA 2UKDA 4UNSA 2ORWA 2J87A 3LNCA 5FL3A 3CW2A 1QHGA 1XCGB 1R5BA 1Q1EA 4B32A 2WJHA 2QNRA 3K8YA 5FPHA 1M74A 4YXWD 1J8MF 4TL7A 4W5JA 4PZYA 1Q3TA 2GJAA 4FMDB 4GBMA 3B1YA 2GHIA 4EKDA 1KJYA 2H16A 4JLKA 2ATVA 2JLQA 2P67A 3P1JA 4MA4A 4X8LA 3I92A 4BLSA 2GJ9A 2GAAA 3KQNA 1D2NA 2IF2A 1SKQA 3KUCA 1EFRA 1OH6A 1GRNA 2QUZA 3CX6A 3NH9A 1M8PA 4ERNA 4DLRA 1SXJB 2OZEA 1HEIA 1LW7A 2PZFA 1NLFA 2QEQA 2AK2A 4D80A 4K81B 1TX4B 1SGWA 5JEDA 5KU1A 2LKDA 1TUIA 4BRUA 5JMTA 4O2RA 3QJYA 5KOYA 4Q9HA 3HU2A 1G16A 1OV4A 2B21A 4S35A 4CT4B 1IBRA 1W36B 1BS1A 2J3EA 1NVUQ 3U3JA 1E2PA 2BKEA 2J7KA 4JVNA 1UEJA 1AKYA 4JZKA 3OIYA 5H8WA 4M9XA 3NEYA 3KJEA 4B3FX 1NBMD 4M4SA 2CVFA 3BBPA 1G3RA 1E94E 4XWKA 4B3DA 3X1XA 1KDPA 2IEZA 2NO0A 2RGNA 5DN6A 2BMEA 3THYB 3UKDA 2L0XA 1X1SA 3AP1A 4FD2A 5EE1A 1NVVQ 3EPKA 1OIXA 1TQ6A 5CITA 2DFTA 4LC0A 1P72A 3DM5A 4HDCA 4MGIR 4A0FA 1P2TA 4C0BA 5A5GA 3U4QB 1XPUA 3EWSA 3L0OA 1ANKA 3GJXC 5JZVA 2XB4A 4C0HA 3G82C 4Q48A 2HT1A 3PEVA 3K0FB 2J41A 2OV2A 4KI0A 4DLXA 4AK9A 2GNOA 1W2GA 2OSBA 3KKPA 4Z51A 2WOJA 3MUFA 4AKIA 1FFHA 3QF4B 4HI0E 4MUAA 3GQBA 4QHTA 5B57C 4C0AC 1LVGA 1NJFA 421PA 2JIZD 4QBFA 1WF3A 2GJSA 5TMPA 3X2SA 1L7VC 4LJYA 2XTNA 1GM5A 4DDVA 3QPWA 1XEFA 3T1TA 1G1MA 4L16A 2A5JA 3DEFA 4PQYA 3LBHA 5C2JB 2N1BA 1IHUA 1XX6A 4TMKA 1YZKA 4IJMA 4QKQA 1UKEA 1G7SA 4LHVA 1DARA 1TL7C 2QSYA 4KCGA 2F3TA 2V8OA 1TADA 2ZI7A 1SQ5A 1DVRA 2QAJA 3AKYA 4ZV4A 3AVUA 4GRAA 3BB3A 3VU9A 1G8HA 1ZINA 1H8ED 2PLFA 3UK6A 4Q4HA 2MMCA 3K9GA 2A5GA 1LY1A 2YC4C 4M9ZA 3ND9A 3IPXA 3VAAA 1R8QA 4U00A 1VKJA 2NZJA 4OHVA 1D6JA 4R2IA 3SDZA 4E09A 5DGXA 3A1SA 4LBYA 1LF0A 1U81A 1BOFA 2ZJZA 3FFAA 3QF4A 2AXNA 1P9NA 1JEDA 1XMJA 2AN9A 4QRHA 4LWZA 4EIWA 4Q7MB 1ESMA 3UANA 1E1RD 1TU3A 4AI6A 2HV8A 2C9OA 4OI4A 4NMMA 4GI7A 3OAAA 1GIAA 1MV5A 4CYMA 5JS7A 4MKIA 5EP3A 1CRPA 2Q3FA 4DB4A 1X8LA 2J45A 2BHRA 2BEJA 3TBKA 2NO6A 3N70A 4QBIA 3EG5A 4PC2A 2ZJ2A 4HB4A 4NHOA 2V55B 3MGCA 4G5RA 1XXHE 1D2MA 1ZD9A 3DVLA 1NL3A 3ICEA 1MOZA 4L8GA 3KJHA 1F5NA 1K6MA 3VR5A 1W44A 2NQ2C 4M0LA 1KI1A 1OIVA 3T1OA 3SJBA 2GZHA 4A8JC 5JJIA 4B2LA 3DL0A 4UQOA 5G3YA 5AUOB 3WYFA 1NBMA 2QN6A 1UDWA 3UWKA 5E7MA 3DMNA 2REXB 2JLVA 4G3XA 4WOPA 1T91A 2RHDA 4EJSB 3IIJA 4E03A 5JS8A 4IOKA 2QP9X 4LGMA 2VP0A 1G7TA 1XF9A 2NTYC 3RWMB 2JJ1D 4OBEA 4Y0AA 2V3CC 1US8A 2IYXA 3LLUA 2F1IA 2BBSA 2A7QA 2BVNA 3P32A 4QC2A 2O8DB 2VEDA 1E69A 1YR6A 2GILA 4JBXA 4NE2A 4RKEA 4JLOA 2ZRDA 2O0HA 4F38A 2F43B 4MITA 1KY3A 1EFRD 4PHGA 1WXQA 3K0CC 2UZIR 3TVDA 2ZU0C 2IXEA 4V0KA 4HLDA 3GD7A 4TLCA 2VRWA 3PCRB 1RIFA 4KFRA 1SKYE 3C5HA 3TW8B 3MWKA 3ZIAA 1X1RA 3U3MA 4MDEA 4D0GA 4DBLC 3KKOA 4LYAA 1A5TA 2C96A 4Q03A 2QQEA 1N6PA 4B35A 3QBVA 1G5TA 2IHYA 2HF8A 2YOGA 2WSMA 4D4MA 4GZMA 2NOAA 5JCZA 4RZUA 4V0LA 2IYSA 2OLKA 2ZI4A 2KB0A 2J0SA 2EU8A 3K0AA 4EPXA 4Q5IA 3DZ8A 1JPNA 1N5KA 3B13B 4H1UA 1D9XA 3FVQA 1II9A 1TQDA 3U44B 2OO7A 1EGAA 3GJ8A 4PHTA 3ZH9B 1N6LA 3SN6A 1HY3A 2W6JA 3WP0A 2B6HA 2Q3MA 1IJEA 2QPTA 5TDHA 4S2EA 1E0JA 2ZQ5A 3I3SR 1KK0A 2KWIA 4Q9LA 3T06B 4B76A 2ZSAA 4DXAA 2WSSD 3Q7QA 2IT1A 4CF7A 5IHPA 1KOFA 2ZRMA 2AKAB 4PC1A 2FNAA 2ZYTX 2F1JA 1KI8A 4I4LA 4XVQA 4PQFA 2CCGA 4HAUA 2XOKA 3EZ7A 4KV9A 5HCNA 5CK4A 1KI4A 3QKRA 3CRMA 3FMOB 3KTAB 5G40A 4RSGA 4EFMA 3IIMA 5JWOA 1IN5A 1KDRA 2AKYA 5DO9A 2ZUDA 2RGEA 2WJGA 2XXAA 4L5BA 3AB3A 1IN6A 3ZVLA 1FTSA 1E79D 4FMBB 2R2AA 4UXIA 3ZZ0A 2A30A 4YONB 2CK3D 1KNQA 1VCIA 1UDXA 4AWXA 4PZZA 5C4MA 2DFKB 4UJ5A 3NDBB 3Q8XB 1US8B 3ADKA 3M4YA 4EJSC 1JR3A 4TMWA 4Z1MA 1S2MA 2RGXA 3A36A 3QUSA 3VHLB 3JVVA 2P5TB 3W8NA 1YKSA 4LSGA 3BWDD 4FW9A 3QIAA 5JI3E 4P4SB 4R2HA 4YMUA 5FTLA 5G3ZA 3QKSA 2QGZA 3TUIC 4LJAA 2FZLA 3ZZUA 5DIFA 2D7CA 1E98A 1W0KA 3IEVA 1JPJA 3HR7A 3LXRA 1VG1A 2QT0A 4CEIB 1N3BA 1IOZA 3LD9A 5GVRA 1XEWY 2AWNA 5LB2A 1ETUA 3AP2A 1K8RA 5EE9A 5BN3A 2W2VA 3LBNA 4QGAA 1Z47A 4LHZA 4TSFD 1A2KC 3NBXX 4P33A 4M21A 4URZR 1OPXA 4AURA 1UJ2A 1S8FA 3OEED 1BH2A 2J1LA 1AA9A 1ZC4A 5FUXA 3B85A 4Q1FA 5FUYA 3VR2A 1L4UA 5FBRB 1U9IA 3SHWA 4URUR 2AWOA 3BJIC 1T8UA 1ZNXA 3NKVA 3A6PC 1QBKC 2NIPA 4LYJA 1TF7A 1XXHA 5BWMA 1NVXQ 4N3NA 4M1KA 2EWVA 3WXMA 2ERXA 2KBEA 1WRBA 1ZJ6A 4OQXA 2VHCA 4JL5A 3K0SA 2C95A 2ZS9A 3PEUA 3UPUA 1EFTA 3KXLA 2GEDA 4LI0A 1WBDA 4RFSB 1KZGB 4QBHA 5FBWB 5FI1B 3MSXA 1QDEA 3RS5A 5J4KA 2CNWD 2QRNA 1HQYE 1M7BA 1XD2B 2C5LA 3AF1A 5EP1A 3RS0A 2PCLA 1DTSA 2ZE6A 1T5IA 1VYUA 1XCMA 1JI0A 1N5LA 2FJUA 3OIUA 4LZZA 5HZHA 3EZ6A 4EUNA 3CWQA 3RVBA 2J59A 2QENA 4WVFA 3ZIAD 2ZM5A 2X2FA 2I1VB 1M2OB 3GP8A 4HSEA 1ZP6A 4C30A 4BLRA 2OFXA 1I4LD 4M1OA 1KI3A 3W9YA 3QE0A 3TSWA 2PH1A 4ESVA 3P4YA 1JBKA 4LY6A 2ZRBA 2ODEA 1XEXA 3GJ0A 2ECKA 2FE4A 3RDPA 3R20A 2XZLA 2EWWA 3CNLA 4CGZA 2H1LA 2UZ3A 4URWR 2QQ0A 3V4RA 2YNMA 4WZAE 4A6XA 1T8TA 2Z83A 2JDID 3TK1A 4PC7A 2F6RA 1R0XA 5JWHA 1SXJE 2QMHA 1FMJA 2QPAA 3FOZA 1BMFA 3A1TA 4B2IA 4PPGA 1G9XA 1XJ0A 3ECCA 1HT1E 1W36C 1FX0B 3WMFA 1U9IC 1CR2A 3MG9A 4RCYA 1Z8FA 1PLLA 4W5HA 2ZAMA 4YC7A 4TL8A 4RCZA 4FIDA 3A4MA 3NBZC 3W5IA 1RRPA 1XD9A 4DLYA 5DI3B 2DYKA 5TY0A 2ZRAA 3VX3A 3H4MA 5AJZA 4YMTA 1E96A 1JAIA 5EXPA 3TR0A 2B8TA 4XWOA 4U7DA 1OH8A 3OZXA 4KLNA 1FNNA 3VR1A 4QG7A 1ESNA 3BGWA 1AS3A 5IF9A 4ABYA 3TUZC 1G41A 4A0GA 3UMSA 3TJZA 2IS1A 4F91B 2QBYB 4FINA 3HU1A 4M1MA 2ZIAA 3O8RA 2ZS8A 1FP6A 3NC0C 4RFVA 1QHIA 1E9RA 2GRJA 4V02A 3ZD7A 3VR3A 3FTQA 3SR0A 5LD2B 4LHXA 4DRZA 5HE9A 1BYIA 1YVDA 1S4QA 2YOFA 1SVKA 4AKHA 4R7ZA 4E5UA 2FGJA 8OHMA 4XTCS 2CJWA 3EIEA 2F9MA 4NCKA 1XNJA 4O0MA 1H8EA 3K53A 3RRMA 4DT1A 3ICQB 2CL6X 2GCOA 3IDQA 5AUQA 3REFA 3VU9B 4M8NE 1GL9B 2W2TA 4P0TA 2N46A 3ZQJA 3OFNA 3BH6A 2X2EA 1Z08A 3UIEA 4M1YA 1P61B 1M34E 1G5RA 4IHQA 2CBZA 3HP1A 2GWHA 3LO5A 4IXNA 4Q1DA 4EPVA 2XNDA 2OESA 4KO8A 3CNOA 4CIDA 1IQPA 3VKGA 2X8AA 4KFUA 2FPLA 3CF6R 4JSYA 2GBLC 2QZ4A 1G4AE 3TW4A 3ZYCA 2GVDC 2I4IA 3WRXC 2VHUA 3PUWA 2HDNB 2D06A 4ZDIA 2WAYA 2ZVPX 2ZSBA 1CR1A 3TR5A 4HZIA 3DZDA 1JXMA 2O0JA 2O8EA 2IK8A 4Q1EA 1AGRA 1KK2A 1I2DA 3U3RA 5E3HA 3QXCA 2NZ8A 3U5ZB 3KJIA 2D3WA 3I5XA 2W2XA 4KYUA 4ACAA 2WAXA 2OCYC 221PA 3SQWA 1LS6A 2WKRA 1NJGA 1TQ2A 4A2QA 5AWFC 2V6JA 3MJHA 3RRNA 2QBYA 3CR8A 2ZRLA 3NEJA 4CEIA 3KXIA 4II7A 4DCSA 2Z4RA 4MRVA 2CE2X 3CX8A 4QGGA 4DZZA 2IS2A 1KSFX 2ASEA 4PC3A 5KYKA 3ASZA 4JSTA 1MRNA 2QY9A 2HLDD 2ZJ8A 1NIPA 3NDPA 4KHZA 4LPSA 2JAQA 2XAUA 5JSZA 2NMVA 4P31A 2WPDD 4WAUA 4WZ6A 3DMDA 3PG5A 1OB5A 3ZD6A 1NMYA 1E99A 1M6NA 2B7CA 2OILA 1NVWQ 2QGNA 3B1ZA 4NP6A 4BASA 3IUYA 1HQCA 2XB2A 4PPFA 2G88A 3W3ZB 1Z0DA 1RYHA 2CL7X 2MMGA 2VF7A 1QHXA 2GKSA 2HXSA 3GLGE 4LV6A 3P27A 4TTQA 1SVLA 4JLNA 4A92A 4ZI2A 4KAXA 4GNKA 3ZVMA 2CHQA 4LBZA 3W5JA 2QPOA 2VHQA 3QKTA 2P0EA 1YJ5A 4ACBA 4LOAA 4M9SA 3J81k 1E0KA 2Y8EA 1FOEB 3SU8A 2YZ2A 4B3BA 4KFSA 4TMVA 5EUQB 4E22A 5GADl 1AQYA 5AJXA 1X8KA 5CK5A 3I8SA 2QE7A 2QMEA 4DLVA 4LV8B 4LX0A 1E4VA 2AFHE 4IFEA 1PJRA 4A8JA 3VQTA 1VPLA 2YKGA 1N6HA 1UKYA 5DHFA 4JBWA 1WE2A 2UVQA 2IYRA 3RC3A 4FMDF 3SBEA 4IVRA 3V4FA 1SVWA 4YMWA 3U3OA 2BV3A 5KO2A 3NBFA 3CM0A 1F2TB 1RC8A 1LFDB 2G77B 1XBTA 2W58A 2J0VA 3OIWA 4DDUA 3B2EA 4UXHA 1SHKA 3FKQA 2FFQA 4BFYA 1HA3A 3U7EB 5TARA 3CKLA 4D25A 4C7OB 1XTRA 4IXMA 1RRFA 4PHHA 2FX3A 1VYTA 1DAEA 5CJPA 4XIGS 1U98A 2GVZC 4TQUS 4MYHA 2H57A 1E2GA 1V43A 3OE7A 5BYKA 1KK3A 1KO5A 3PEYA 3T61A 2ZU6A 2ZRKA 2GF9A 3FFBA 2GK6A 2VTKA 3K0CA 4MGZR 3W6NA 4D2IA 4EQ6B 3SJCA 2X19A 3IBYA 2J0QA 4CZ2A 2YINC 5P21A 1VIAA 2ZPTX 3EAQA 4QGFA 4AYWA 3BFXA 4R71A 4RD2A 3MFYA 1J70A 2CJWB 2ZUBA 3EX7C 3P20A 1P9RA 1P60A 2HYDA 3IPYA 3LX5A 5LBIA 1UBGA 4DCVA 5BN5A 1QVRA 3WNCA 1YQTA 1KDTA 2ZRHA 3AVWA 3PUXA 1ZNZA 4DUGD 2FV8A 5BYJA 2RGCA 1TU4A 4P32A 1VHTA 2ZJYA 3O8CA 1G5PA 2OE2A 1L4YA 4JLVA 5L3RA 1M7HA 3A37A 4K46A 3PENA 2PEYA 2A3RA 2ZR9A 4TMTA 3W3AA 4Q01A 4F4CA 4BFUA 4Q7LA 1N0UA 4FCWA 1WCV1 3AF0A 3U6BA 4L4UA 3ZVNA 1PUIA 2W6IA 2IYLD 1KIMA 2SHKA 4DLUA 3SJAA 3PJRA 1T0HB 2F55A 2J0UB 1CXZA 1NN1A 3W6PA 1QG4A 3LY5A 4KXFB 2F3RA 4Q9JA 1AJEA 1UBFA 4JLAA 5JLJA 1Q0UA 1KKLA 1UBCA 5KHOC 3CPHA 1EWQA 5C46F 3WYGA 2FMXA 1UPTA 4TT3D 4MRNA 1CLUA 2ZRGA 3RLFA 4BFXA 1S3GA 3A1VA 3IBGA 1QG2A 3LFUA 1GILA 4LPKA 3K70D 1E0SA 2V1UA 2V1XA 2IYVA 2JJ2A 3C16C 2A5YB 3CWZA 4Q7KA 3C7KA 4X8MA 2DB3A 1SXJA 3IHLA 1G8FA 4OHWA 3ZS9A 1M7GA 4H1VA 4US2R 2ZRJA 3L0SA 4DSTA 3QEJA 1CS4C 4PANA 2WZQA 3B9PA 1OH7A 3QXHA 4LC1A 2PZEA 1GDDA 5SZHB 4GPTA 3SJZA 1CEEA 1Z5ZA 4TL9A 2DPXA 4BLOA 5FTJA 4CVNA 2V4ZA 4D82A 4TYNA 4NYIQ 2QTHA 3W90A 2QTFA 5BXQC 2BJWA 2ZJ5A 1E2HA 2Q9AA 4QBGB 2QAGA 1W0JD 2FSGA 4MYTA 1OJLA 5B58C 5LDDC 2YWHA 1XZPA 4M22A 4GOKA 2Z0MA 1OKKD 5EXTA 4CRWB 4TQ9A 1E9DA 4F4IA 3BC1A 1CJVC 2EYQA 1OXVA 4ZCIA 1BYUA 4Q4HB 2IYWA 2OCAA 4GOXA 4XD7D 1D9ZA 1TF5A 3EIHA 4ARZA 1EX6A 2ZTSA 4RZ2A 4ZDWA 3RYTC 1HH4A 1KAOA 1Z6GA 2JLYA 5B64A 4WA7A 1OHHA 3RRZA 1N6NA 1R0YA 1F2TA 1RRCA 1W48A 3G5UA 2JJ8A 1KI7A 2P3SA 4QJ4A 4DEYA 2NG1A 2OM2A 2GCNA 5JHHB 1KSJA 1TF2A 2PLRA 4DT1B 1DPFA 1TNDA 3AVPA 1MO5A 3HU3A 3LQRA 3NHAA 1MABA 2B92A 1BIFA 1W5TA 1KGDA 1U99A 2GXQA 2RGDA 3E2IA 4EDHA 3MAAC 4GOJA 2ZRNA 3EASA 4HLQB 2FSFA 2JA1A 4IOJA 3AVQA 1VYVA 4Y0VA 3WP1B 4BZQA 1XXHB 3N2IA 4D4LA 4EPWA 1JAHA 4W5WA 2CE7A 1W4BA 1PZNA 4B2PA 5KTYA 2WWYA 3S1AB 1U94A 2KI5A 1Q12A 2H18A 4OQNA 3LX8A 3DM9B 3A4NA 4GP6A 1CU1A 3B8HA 3AVVA 5J4HA 3F0TA 1KO4A 3I62A 4XWAA 4ZKEA 4R9UC 1T4GA 2A5FA 2XX3A 3H2YA 1E9CA 4C0LA 4QJ5A 1DE0A 4MRPA 1UM8A 4IVPA 3I4LA 4AD8A 3T1VA 3U4QA 4NKRA 3AV0B 3K9LA 1RPZA 4YDHB 5TXGA 2C2HA 3R9IA 1SHZA 3UG7A 1A4RA 5HCIA 5A0FA 5C1BA 3OIVA 1SULA 1CRQA 3THXB 3QKSB 3GLHA 3QOFA 4IOMA 2GJ8A 3MWJA 2DCUA 1S9DA 2FFAA 3K9NA 3L8ZA 5CYPA 5LB4A 4A36A 3DOEA 4G01B 4IOLA 2OFOA 4HB3A 3KQUA 4UNNA 1KMHB 3B60A 3K70B 3EWAA 1GG2A 2PMDA 3IQXA 4G5SA 1PLJA 1OH5A 5G53C 2FPMA 1DG3A 2WWFA 2FOLA 2JGNA 2WIAA 1TQ4A 2MSEB 3VR4A 1VCMA 2NO1A 4ZCLA 4ZDJA 4P4UA 4MKHA 1WMSA 2CCJA 3RNLA 1R6BX 1KI2A 2WICA 4HYYA 2TMKA 4JIMA 4OQLA 3TVTA 4XVRA 1R0ZA 2YV5A 3FHOA 4HB2A 4AC9A 4LUCA 4F92B 1KJWA 2D74A 2QG6A 1MABB 4L9SA 5AK0A 5LD2C 2QU8A 1JNYA 1YR8A 2O52A 2IYYA 3GJ6A 5CB8A 5JI2E 3EA5A 1EFHA 1WA5A 2ONKA 5FR1A 2DR3A 5L8VA 4O3MA 5J40A 4B33A 5JHGB 1AS0A 3HJNA 1CF4A 1ZU4A 1KI6B 3KKQA 1SXJC 3UXMA 4CEHB 2RKOA 1TTTA 1VG0B 2P6RA 2CLSA 2ZRFA 3BB4A 1X6VA 4ASUD 2QAGB 3NH6A 4N0EA 3D31A 3THWB 4JLBA 3WY9A 1U0LA 3FMFA 2BMFA 2ZROA 1VDZA 4MGYR 2IBMA 3B78A 3A58B 3T34A 4F4JA 2KBFA 2IUTA 2KJQA
chains in the Genus database with same CATH superfamily
4I08A 3E5RA 2Q4TA 4X1YA 4IDOA 5L3QB 1QTNA 4BV2A 1R9JA 1SC6A 1X14A 2CMFA 3QBEA 3V4VB 5KJ6A 3PD0A 3KQQA 3P2OA 3KCQA 4A2WA 3IOMA 3LUAA 3QLUA 1MC5A 2BEKA 2V0CA 3TI7A 4HX5A 2H0RA 4BV9A 4FXPA 4OEHA 2JLZA 1ZIYA 4OB6A 5ES3A 4Z0NA 3L40A 2ZBRA 2SBTA 3ZCVA 1A7AA 1U31A 2NZWA 1L5NA 1YZUA 3UT0A 4LYHA 2YZNA 2Z2XA 2HSEA 1O7JA 2CXXA 3OSUA 4OQYA 4PLWA 4X7PA 3SEQA 4J0FA 4BNDB 1F8FA 4D0LB 5LWQA 4G5QA 3VISA 4DNQA 2OO5C 3Q9SA 3EBLA 2A9KA 3NWOA 4ZT7A 3ZHCA 5KNCA 2YJZA 5GJWC 4JUAA 3BJRA 1DIHA 1ZU5A 3ZUPA 4TXMA 4EPYA 4Y9RA 1L5RA 1RMYA 3TOZA 1Q0QA 3ZWCA 2O23A 1QHHB 2G6BA 1LBTA 4BXOA 1O0BA 4CW7A 2IU6A 4UZSA 1UFVA 3ANYB 4QX6A 2P6OA 3GPIA 4PFQA 3LUPA 4QVKA 3KB1A 1UMKA 3EPPA 2JHGA 4V0MA 5HRCA 2WJIA 3D54D 3R6TA 3AM3A 3ICOA 2HCBA 2VJYA 3OHMA 4CNBA 3JQRA 1OWPA 3VOTA 1NG9A 4BZXA 2BGNA 3L8HA 4MPDA 4UCFA 2FWMX 3KUXA 4AZ0B 3BSSA 4DNOA 2QV7A 2D1SA 3P7MA 1GQSA 3E61A 4N5IX 1OXMA 2JLCA 2JAXA 1KJQA 4M88A 1FVXA 1KMCA 2G9RA 3DQQA 3R24A 5H7XA 3R7BA 2WRZA 3CKKA 2FCAA 3TDMA 1WS6A 5E9JA 3AI3A 1I0IA 1V47A 2VBIA 4MMXB 4TQAA 5AM3A 2GZSA 2JFHA 3HV0A 3IP1A 5FWYB 3K8ZA 3WLHA 4EAAA 3IPLA 4RTQA 4F2HA 5E7MA 3D0OA 1E7YA 2D4AA 3P2JA 1EFPB 1JEQA 2D2IA 2FW7A 3DSRA 4Z49A 1L8AA 5L3QA 3ZDQA 4ZVSA 1L5WA 3HHPA 1HDRA 5K0FA 3UTDA 4DJDC 3M9LA 4RTOA 4MTLA 2R4TA 1L4MA 1MHPA 3ODGA 5J9FA 4CFSA 4GE0A 1NR5A 1XF1A 2XD4A 1PG5A 4EQ6A 2B2CA 2WMOB 1V8ZA 4H16A 4OU4A 3GFOA 1PG0A 4RA6A 3IE0A 4F7DA 1HMYA 3AERA 2ZRCA 2AK3A 4MQ6A 2AB0A 3WSTA 1G2OA 1Y4AE 2Q9CA 1Z29A 3DGEC 3GFBA 3ZNPA 5ECGC 2CNNA 5EHXA 1BKSB 4KODA 2DR0A 4LWQA 1XP8A 4YJ2A 5GZ1A 4MWSA 1L4FA 2PG3A 2EZUA 3FI9A 3ESAA 2VDPB 4MH0R 5GGYA 3H2JA 1I6KA 4J0IA 3QJ5A 4QTXA 1EUZA 1C1DB 3UWSA 2PX3A 3HN7A 2NZXA 4GDMA 4DZRA 2RHRA 5J4LA 4RM3A 2CGEA 2DY0A 4ZOLB 3RFUA 4EJ0A 2H1OA 5JZOA 1WLYA 4QASA 2HMAA 4B09A 1BXZA 2FPGA 4FEGA 4LQCA 4RSHA 5DTIA 1WCIA 1JZTA 2O20A 5K8UA 1TUEA 1EEHA 8MHTA 3L0CA 3L82B 3O90A 3G2MA 3EVTA 4B17A 4ER0A 2XKAA 3UB2A 3R6WA 3HPQA 3B20A 3ZE0B 3T54A 1MJNA 3VNSA 3HYRA 4U2BA 3A9WA 2GESA 3D6NB 3ZH2A 2OYRA 3STHA 3CYFA 1J5PA 2FKNA 2WUVA 2HX1A 5D5QA 3T5GA 4RHTA 1JMVA 1NYTA 1W94A 3FF4A 2P8SA 5F76A 1SPBS 4AF8A 4GLOA 3QI7A 5HOEA 1GZUA 1CCWA 5E38A 4NF2A 3HEBA 3NALA 1OLOA 4LCJA 5EXXA 4QA9A 1AKRA 4Z9YA 2J3MA 2VXBA 1RBZA 3QTBA 1IXYA 2ZK7A 1LX6A 1G3IA 1NY6A 5G0SA 3ZWOA 1DOZA 1C81A 1ETHA 3JQBC 3T6KA 3WWYA 4DWOA 2BBOA 2CN1A 1W30A 3GEEA 5DM4A 1EB9A 2J46A 2NVWA 1RQXA 3QK7A 4UPVA 1DS6A 3UQZA 3SE7A 4LYYA 1SCBA 2X4LA 4P5EA 3ZHTA 4E2WA 4CEJB 1W46A 1Y3DE 4TZ6A 3WR5A 4DLWA 1IFXA 3AL3A 4Y98A 4IAOA 3DO5A 4EITA 4CKWA 1L5ZA 4PIVA 4XRGA 4CT0A 2I62A 2F9LA 3O1HB 1MO6A 1H9AA 2GPAA 2VJAA 4KKVA 3F6PA 4R1SA 2QJOA 4H7HA 2R00C 3FRIA 1O08A 5IZ4A 2XXAB 2GM3A 1YL6A 1ZRHA 2C20A 2PCJA 2VEOA 3MRTA 2OQVA 4BNKA 3WKEA 4GVPA 4DE5A 3DYBA 3Q6IA 3Q98A 1HDCA 2QL7A 1ZM7A 4FS8A 4HGRA 2IDZA 2OO5A 4GMKA 4W7HA 2PD6A 3K6RA 1M67A 2DFNA 3FOAA 1FNCA 1PBNA 2HHCA 4TTPA 4YMSA 4S0XA 1QV9A 2OBLA 4ZO9A 3USZA 1BXRA 2Q3HA 2ZT5A 4NPAA 4YK7A 3WA7A 2UYGA 4MV9A 1OE0A 4DRXB 2IYUA 1H2ZA 2PX8A 4MS1A 3DC7A 3SF8B 1OC2A 5IMSA 4D9MA 1V9CA 7MDHA 4KPYA 3OPVA 2VNIA 2IHKA 1ZCJA 2C8JA 1IJKA 1BWSA 2RG7A 2VP4A 4KRXA 2CFTA 3OLYA 3IQWA 2F1HA 5IMBA 4YB8A 3JYPA 1JWLA 5C1OA 4IILA 5LQUA 3UQYS 1VMEA 1NJ1A 4ZEOA 5JNUA 3PGLA 1BEZA 3BWXA 3DT8A 3I53A 4I1RA 1ZGCA 4KO1S 4PR3A 5GV8A 3WNBA 4QL3A 1B8VA 3E35A 1FEZA 3ZV6A 4CQNA 1XROA 1RWOA 2BIFA 4Q4JA 5EKTA 1I30A 4UNRA 1E5DA 2CUKA 1L6RA 4DGSA 4RKFA 2BHNA 4TX1A 1F4VA 3H2GA 1A04A 2XA1A 4H77A 1IY2A 4KQXA 4A82A 3DBHB 3GZJA 5FA8A 3ER8A 4R8VA 4B6FA 4KQIA 2Z2YA 1O6CA 2X77A 1C1XA 3OEHA 1T35A 1P18A 2A7XA 5B7NA 1YDEA 2H7YA 1COWD 4UNQA 4Y67A 1VPVA 3UVEA 5KTMA 1W96A 3DBRB 1ZD8A 1KBZA 5KNDA 2QX8A 3SP1A 4IDNA 5EIEA 3EGEA 3JZIA 3HKDB 3RVOA 1PJ4A 1XTIA 2IIVA 4MQEB 4BX9A 2Y1EA 5EPEA 4BO0A 3RV4A 5JXGA 4KBYA 4WXPA 3M4NA 4MAFA 1IBMB 3BIFA 3CVJA 3CZAA 3EEIA 1IVNA 1U3CA 2GCIA 4IG9A 5IBRA 2IL1A 3NTUA 3PSHA 4MXDA 1SUFA 2VP2A 3DP7A 4PHCA 4ZCQA 4EFDA 2ANCA 4DEXA 4QFMA 5A5DA 2FY8A 4WKPA 4MGKR 1WDMA 1U2ZA 2YQ5A 3VR4D 4J91A 5ECDA 1Q0HA 2QTTA 1E1DA 5AKEA 3TLMA 5KS2A 3THSA 2I7VA 5KOJA 3QM1A 1GRRA 1GQFA 3N7UA 4PPNA 4BV3A 5COBA 4C78A 4LFBB 2I3BA 2O2IA 2YFYA 4I2NA 4P92A 5EI5A 5JS2A 1PT6A 3GLGB 1K68A 4AY6A 1E2BA 1ZRNA 5TQ2B 4NL4H 3M2PA 1N78A 1F3LA 3AB7A 3GH3A 3PFHA 4EW3A 1WABA 1YQWA 3BIJA 3QVVA 3R8XA 1QLJA 1RQPA 1GP2A 1UFOA 2WPNA 5H1YA 2FF5A 3WYBA 2H2DA 1X2BA 4D4KA 3NNDA 2I7DA 3GFRA 2OM6A 2YCLA 1Y7HA 1TCCA 1H9CA 1PYDA 1EXMA 5ES4B 2HA6A 4HH1A 3N75A 3MIIA 4Y6OA 5IFKA 2X5XA 2O6HA 4JT9A 4P4SA 1CULC 3TLYA 3ZZMA 2NQTA 4IEFB 3E53A 3AR9A 1G5FA 2Z8YA 1AIPA 2YZKA 1TT7A 3PWTA 3LT4A 3C1UA 4HQ6A 4KEAA 4MVJF 3KB6A 4B3TB 4JL6A 1RJGA 2BZGA 2I7CA 2JGJA 3TFQA 4OJYA 5J2TB 1HYGA 3KTOA 2BGGA 2O3RA 3IMEA 4DLZA 4F2DA 1NX6A 4PAQA 5BWNA 2JFYA 2I4RA 4INAA 4MPRA 4QNMA 3KEOA 2R8OA 2HU7A 3TGPA 1WDKA 4QLAA 3QMPA 1V6CA 5HTKA 1GPJA 2EFJA 1EVKA 2O2XA 4EKNB 1GGMA 2VYND 3BREA 4DF3A 1IVSA 4F9GA 3GPCA 2H7CA 3KTAA 1F4PA 1QP4A 3ULKA 3HBLA 1IOWA 1TM7E 3I9FA 3L43A 1QPGA 1EPUA 1KBQA 1PW5A 3DE0X 1H2EA 1P0MA 3K8QA 1G3QA 3PGVA 4NOJA 4B6GA 5KSWB 1B15A 3BDAA 2GEFA 4NI5A 4C2AA 1WMBA 1Y5NA 2XD9A 1A2QA 1Z26A 1ZVQA 3H1TA 4KLAA 1A27A 2AFRA 4AMVA 1IAQA 5GM2A 1YCFA 1S8NA 4XIFA 1FYXA 1N0HA 1LWOA 4NV0A 3PPYA 1GTG1 3F6YA 1Y1PA 3N86A 4EB8A 2RBKA 1R10A 1U8AA 2ZAOA 4BC1A 5C53B 1BE0A 1QORA 1C1DA 1MFPA 2ZXUA 4KIJA 5J2UB 3LPDA 5B30A 2IY7A 2P4UA 4HQKA 3RSOA 1RADA 2AI2A 2R60A 4KQ1A 1PJCA 1OUMA 1SXIA 2WAMA 2ECFA 4XB6B 3ZDBA 4WOCA 4C7OA 2I71A 2I3AA 3M6FA 5TF0A 3ZU2A 4N1AA 1LDNA 3O26A 1TD1A 2QW8A 4OBWA 1ODCA 3JARB 1QRAA 1IMJA 3DZCA 1E92A 1YBAA 3OPYB 4OY3A 2V4UA 4FPXA 2OLJA 2R2GA 3GG9A 4HAWA 1QO0D 2JD1A 2Z57A 1Q95A 3FNFA 3O75A 4TROA 3RBXA 3D6TB 4J0QA 4CI9A 4Z7NB 1UK6A 1Z4LA 1JEQB 5TQJA 4OKNA 2ZYAA 3ENQA 1G17A 2FE1A 4EW1A 3R0IA 2XQVA 5TV2A 1EXNA 3RM3A 2VDOB 3H1AA 4UQPA 1XTTA 5CM8B 5GWXA 5L4LA 4FOSA 1JEYB 5FTKA 1IZ0A 1XA0A 3SXUA 2QTZA 4YAGA 4RA9A 1JG6A 3HXTA 4OFWA 2CB0A 1RXIA 2HHJA 1EXWA 1I1QB 4LTMA 4OIFA 2B25A 3VDQA 4EJ2A 1DP4A 2FEPA 3VR5H 2BKVA 1E2DA 3F8TA 3OLVA 2AG1A 1F48A 1FLNA 1U5BA 1RCFA 3HL0A 3KLBA 2P6UA 2DQKA 3I45A 5IFLA 1AD2A 1BMDA 2PNFA 2I7XA 2J48A 4J6EA 2PY6A 2RK4A 4FNGA 2HOQA 4KI7A 1G20A 5EUMA 3RVNA 1JHRA 1YL5A 1XCBA 3CIFA 1N5IA 3OH8A 4V3CA 1AF4A 1MIHA 1XFAA 3PFGA 3P9CA 3FE2A 2W98A 3SEFA 1UK9A 3VBCA 1JU4A 4MQUA 4C4ZA 1TXGA 3GUHA 4XJXA 3R5XA 1MG0A 5E4FA 4EY3A 2DBVO 4FHCA 3RFFA 1LGYA 1X70A 4RVFA 4D0SA 4C3OB 1U2RA 1YCGA 3U7RA 5DX1A 5CCBA 3MS4A 5L7TA 1XG5A 1DC8A 1IY9A 4H2DA 2PVCA 1U04A 1XTKA 4G97A 4IV8A 1DDIA 4ZT6A 4JI1B 2OUKA 3RPEA 1BXKA 3EARA 2VSOA 2X3YA 3BICA 3FNQA 3L8EA 4HDSB 4KKXB 4KMSA 4KP7A 1H8HA 5BVHA 3JU3A 3S7TA 4WZAA 5GIPE 2GO7A 4OQZA 1Y3CE 4CLXA 3G3EA 4OYHA 2RGRA 2VNHA 1XZMA 4KWEA 2BELA 1WMFA 1EUCA 1AHNA 2YV3A 1AG9A 2VZ0A 2VPYA 4OMUA 3RS8A 3CB4A 3GZNB 1E2LA 4A91A 1ADGA 4B6JA 4EA7A 3E1KA 5L7YA 5LVAA 3DFMA 3OCVA 1GU0A 3O1IC 1V2GA 1E2QA 2Z04A 3L6CA 3QKRB 1Q0ZA 3Q3HA 1EM8B 2BHTA 2WUGA 2E85A 5C31A 4KZKA 2XZPA 5KDOA 3A6EA 1PO7A 1J0CA 3E8SA 1IIRA 4FMCF 4LHEA 5LMZA 1X19A 2PFGA 3HC7A 2JFXA 3OF5A 5JJBA 2X1HA 3VKHA 2B99A 1SUIA 2REQB 1NVBA 1UZUA 3CB2A 5EIOA 3QEAZ 2R9VA 3HMQA 4Z7JA 1IY0A 3U4GA 2ZB7A 1KSHA 3LTNC 2VCHA 1EVLA 3GDFA 4UUQA 3ROZA 3T7JA 4RA9B 5B55A 2A1TS 5IAOA 3FR8A 4ARVA 4RNDB 1ZXLA 4PHFA 1ZM2A 2DPLA 3KJZA 3ET5A 3ZGXA 2ZB3A 2IX3A 3GMTA 1SEVA 2PKEA 1HO3A 1UK7A 1VSUA 2GR9A 1UFQA 1MB9A 3V7FA 2HO5A 2RAVA 4WLFA 1QJCA 5FOXA 2BGTA 4FSXA 4RSRA 2J3JA 4U7JA 3RSQA 1GEEA 2KE5A 4EEZA 5K3EA 4TYYA 4TYWA 4QM6A 1RWBA 4TT8A 2NACA 2DUWA 1H2BA 4PICA 2O5VA 1OTXA 1GPNA 2H3HA 1CWUA 4NH4A 2CW5A 3BMNB 1AXGA 3R3SA 3DE7X 1OCEA 3AG5A 4KWIA 4CDMA 2AOWA 1M2VA 3PWZA 4II2A 1SB9A 1A69A 2G63A 3ZG6A 2EIHA 3ELBA 3PHCA 5CDFA 3ZS8A 3JWGA 1QQBA 4F93B 1FFBA 3LV8A 1W2HA 4X94A 1UWCA 4RDHA 5I9MA 1QBGA 4TVKA 1WVMA 1ZYUA 5JZBA 4FILA 2QQ5A 1K1EA 3Q3EA 1JLLB 5BWBA 1H1LB 2YJTD 4NAHA 4ZU1X 1DKPA 1QAMA 1WDWB 2XUKA 2JVKA 2QZPA 1WAMA 3GUZA 2YHUA 4EVSA 3B1XA 2UU9B 2N3ZA 2VYNA 1JG3A 3D8TA 4EB3A 2C98A 4UEQA 3SY8A 3EZYA 3ICCA 1ULBA 4I1VA 1GVNB 2LDBA 3G9ZA 4YRDA 5FKJA 4KQGA 3ZDZB 6LDHA 2ZZMA 1NUPA 1AQUA 1J8VA 4GYWA 2FPUA 1PJSA 4NNJA 5LNK6 3EG9B 4HRAA 2AJLI 2OMKA 4LXUA 5I7OA 3SOZA 2OXTA 4QPPA 2YVKA 1GZSA 1O97C 3MTDA 5K8TA 2PA0A 3FPGA 2X4GA 3HR8A 2WJ6A 3NHLA 1MUUA 1NOKA 1N7HA 2RAUA 4CEJA 1U7DA 3IDSA 1C9EA 2C8LA 1ZKMA 3WWCA 1CJCA 2GPBA 1PT8A 2JJ1A 2OQ2A 3K9HA 3HB7A 3PNYA 1Z73A 3KEMA 4CL3A 3D4IA 1I14A 4LY0A 4BOYA 5HQ3B 1Z8HA 2B2XA 3A70A 3UMRA 1CZUA 2OBNA 4BNYA 3I6MA 2BJHA 3JY6A 4HG2A 5LPNA 1FX0A 2W5UA 3Q8LA 2V7WA 1RABA 3QF7A 1N8TA 5JBIA 1VHDA 4RTKA 3N2YA 1O58A 1JIUA 1TAHA 2ZR0A 2O8BB 3DBIA 4KXVA 5AYVA 1P80A 4XPIA 3HNOA 3LE8A 4BKMA 5A6SB 4E12A 4HUTA 1V71A 3QSYA 4R1QA 1EDOA 2WJJA 2W0SA 3MILA 4O4LA 4HN9A 2AE1A 3WS7A 5C3MA 2EVWX 3AX6A 1A9TA 1I9GA 4XB2A 1LJ8A 1O94A 1Q20A 1NUUA 4PIMA 4HQ0A 4ZWNA 4DWJA 2C78A 3H5AA 1G5QA 3QH4A 1MVLA 3K20A 4NEGA 5HFJA 4CCYB 3AI1A 2O06A 4QOGA 1SVMA 5AJWA 3S2UA 4RIHA 1UBTS 1UANA 1CIPA 3AYXB 3GCDA 4DQDA 4MVJI 3PQ8A 1B16A 5DHAA 1FRQA 3IVCA 1AXEA 1Y3AA 4YJ3F 1Y8RB 1NJ8A 1MX1A 3LK6A 1LTKA 1MIOB 1QGDA 4U7WA 1E1RA 3T15A 1ZK0A 4XYBA 4KSCA 2GEJA 2BBWA 1ZHOA 1R4NA 4W5RA 3LGSA 1GLGA 2FN8A 5ELMA 4UPEA 5HJ5A 1NE7A 2XVYA 3IPRA 2J30A 5B1IA 3PFNA 1DGQA 4XEHA 1Y5RA 1NP6A 2QTGA 2AN3A 3RLIA 1DIBA 4IZIA 1KI6A 2DUMA 2FUCA 1YZHA 4EYGA 3G5MA 1QXSA 1KH3A 1BJRE 1VCHA 4BFSA 4POOA 4RA6B 4HEJA 4JT2A 1YHZA 4RFSA 4ZVQA 1U8XX 4L27A 3ZC3A 2B82A 3KYDB 4OHYA 2QM7A 3R5TA 3CC8A 2GVNA 4DQLA 2QLLA 3BHNA 3ZTYA 5IANA 1T2AA 1MVOA 4NR0A 1KVTA 1TLLA 3DHNA 5CFNA 2J9RA 4K88A 4XFJA 5EJ2A 3DEKA 1I6LA 3EIUA 2Z6VA 4CMHA 1FSSA 4Q7JB 1KQ3A 4EKYA 1Z5PA 3OCZA 4A2PA 5IDXA 1OY1A 1LSJA 5AW1A 3EZ9A 3OZEA 1U28C 3CF0A 3HCPA 3JCZA 3Q40A 4R1PA 4B40A 4BKRA 4RZXA 3M6LA 4OA8A 4ETNA 2XRZA 3Q7PA 3E81A 1JHZA 4OL0A 2X4DA 3S2FA 5C80A 2NYAA 4IWYA 1TPZA 1XQWA 4IDAA 1AB5A 3IERA 3AEZA 4Q47A 5AI9A 3WLSA 2IU4A 5GJVC 2NO4A 2UV8A 2ZTLA 5DXAA 1X1DA 2FWPA 1IG3A 1BXRB 2OZVA 1A7JA 4GOLD 1HV8A 1X1TA 3AL0C 5HKAA 3LUCA 2OEPA 3MQ4A 4MPJA 1T5HX 4MRMA 2EP5A 1Y3BE 4WRRA 1QH1A 1IPFA 2JKZA 4RDCA 1BAPA 3LTEA 1Z45A 2FW6A 5EE3A 1T9HA 3O9ZA 2F4NA 3CNQS 1I4DD 2FA9A 1Q92A 4YCCA 4A23A 4HGNA 2AFHA 3KR9A 1WTAA 2VQEB 3EEYA 1G2QA 2OCPA 3O7MA 1EGMB 3OJWA 3P71T 1A77A 1J1IA 2DC1A 2FF7A 4Q05A 3V3KA 2NXNA 3KHKA 3VOSA 5HBRA 2R85A 4QYIA 2IA5A 1DJPA 3GLHB 3E0QA 4BEBA 1G59A 1KY2A 1W49A 2R44A 2JZOA 4BFCA 4TRJA 5GONB 1XVIA 4EPTA 5TGZA 5GJBA 2YMLA 2DHCA 5CA1A 4NJMA 5AVQA 2OCIA 4ZAZA 4WVLA 3OEWA 3SSOA 3VSBA 4LYEA 4FX5A 2PMKA 3CO0S 5KTRA 2PKWA 4CLOA 2YWJA 4IHJB 4GH5A 2FPRA 4ESHA 1E5VA 3MB5A 5H5JA 3SJ7A 2ZVQX 5B3JA 3SYKA 2VCYA 1PGQA 1N6IA 1IL0A 1SZPA 4O4IB 2IEYA 5ALYA 2NXCA 5ITWA 1ID8A 1IUOA 3HCOA 1JDJA 4DSOA 5BNFA 3X0DA 1C9YA 2X86A 5EQTA 4ZEXA 5HG0A 3UWOA 2LWIA 2NV6A 1KO1A 1Q1ZA 1DAHA 1GJRA 2R1TA 1RXCA 3OX2A 1RPAA 4LNHA 3KAKA 1N0WA 2O7VA 1GAJA 1XZFA 2BGUA 3SFTA 4MS3B 2RI1A 3ZXSA 1K7CA 1JDSA 1G3MA 1NVTA 1NQWA 1XZJA 3HDTA 3PF9A 4RJLA 4ZQGA 3VH2A 3RSLA 4NJOA 4K6KA 4QEDA 3A3YA 1JR3E 2H2GA 1E6KA 1OYWA 2OXRA 3HVKA 1U7HA 2GCPA 1T10A 3BL8A 2PGNA 1QLWA 2J9FA 5E3JA 2FWIA 3FZEA 3A27A 5KNBH 2UXBB 3NS7A 3L7DA 4BLPA 1LDMA 5KYTA 1U0RA 3ISVA 1VQ1A 4UKDA 2QVGA 2V6FA 2ZVJA 3LWZA 4I81A 4EF4A 5L6MB 4DMHA 4LQ4A 3P9NA 2DUJA 5DN9A 1Z35A 3PNKA 5E7JA 2ACWA 5EZYB 1H5UA 2ADMA 2BL4A 1VA4A 1JFRA 3AGPA 5FNVA 4FB5A 5KOIA 2UYOA 3IAS1 4ZHSA 4BMCA 2GPNA 1O87A 3MFQA 521PA 4X65B 4FLFA 1DEXA 5BN4A 2WV7A 3M6MD 3DDUA 1CQJB 4B7ZA 1JFSA 4XQCA 3MBOA 4P0QB 1TLFA 3ICEA 5K2MA 3Q7TA 5IJ9B 2ZYDA 1HFWA 3AHJA 2JI7A 5B37A 2MINB 4RE5A 3IUJA 5FI5A 2BMJA 2WZDA 2FGKA 1VJ0A 3DUFA 4NARA 4AMYA 4FYKA 4EYOA 5I4CA 3WGZA 2X0JA 3SBOA 1YXMA 4YCDA 2JLWA 1U1DA 1ZGJA 5M34A 2B5OA 3M83A 4UUOA 3SHVA 3TRJA 2DTXA 2L82A 3T1NA 2MR6A 3W0LB 3A4IA 3VJRA 2ZPUA 4XXHA 5DM2A 3EW9A 5C3UA 2ZI9A 1OSNA 1Z2EA 3H4TA 1YOBA 2PYDA 1PR9A 2O05A 3LWNA 4D96A 5ITSA 5KWIA 2ZDGA 4Y2TA 1P9WA 4QQNA 2JFNA 4YJFB 1D2RA 3N7AA 4JJAA 1KL7A 2DETA 1B93A 4ZOLF 3INTA 1U7PA 2D5LA 2QX6A 1WIWA 4QFDA 1IN7A 2H8KA 4KQHA 2D8MA 4H0FA 4RMJA 5IT9A 2BONA 4Q1CA 1P4SA 5K3OA 2PZAA 4LZLA 1CUAA 4CR6A 2JHPA 3FX2A 1W0KD 3LP8A 3TUJC 4A4DA 2C82A 4KOEC 3H99A 1O96A 4AIRA 2Y2VA 4BVAA 5CB0A 5K51A 1CJMA 2HPVA 3O4VA 5IBQA 3BD9A 4KO2S 5K3BA 3ZKAA 2PJZA 1R0LA 4OAQA 4RGYA 1Z28A 4LRWA 2HNAA 2POCA 2JFFA 1SG0A 5M04A 2C99A 3AXSA 2GBIA 1WDTA 1ODLA 2VPTA 3GGOA 4X6XA 4ON9A 5TEWA 3EVNA 4B79A 1UAAA 3UT5B 4HSGA 2ZI6A 2QORA 1U8CB 4YRTA 3D6HA 5DE3A 4AJ4A 2BCGY 1YBHA 2JLUA 3R5SA 4Q82A 4MNTA 4U2CA 1AQLA 4P4GA 3ADDA 3GLHE 4D3XA 2GKGA 1HETA 1UADA 5KAMA 1OXKB 5IYZF 4AIIA 5ICCA 3E5MA 5BMOA 5ITZA 2Y71A 1E79A 4IIGA 3DMYA 1Y1RA 4GXRA 1J25A 1M2FA 1TO2E 5JFOA 3AR8A 1DB3A 3L7IA 5J47A 4RELA 1CDZA 1XOIA 5IUKC 3UMVA 5DSXA 2QPLA 3W5HA 5I01A 2QLJA 3A3KA 1U9YA 3S40A 3TOXA 5JMWA 2RDMA 3WL5A 5HNKA 3H6HA 3GLFA 5JJKA 1G9TA 2ZSUA 3FYHA 1Z7YA 4D9NA 2A0YA 3CLSD 4QXPA 2IS4A 1PJZA 2XTMA 3PVSA 3UOAB 2AOUB 1CZLA 2ONJA 4OP3A 4ND8B 1F2VA 5EG5A 4LNUB 5B2EA 2B61A 5FX2A 1O03A 2G17A 1QRTA 1UBNA 3H97A 2WKPA 5ARBA 2LPMA 2OD7A 5AKLA 4TKUA 1N6KA 1NHGA 1VKOA 5HXAA 1TO1E 3PQ3A 3IEKA 1TVEA 2R6FA 1D0IA 5LQNA 3S2IA 3T5DA 3GLUA 1HSOA 2IW1A 1LV7A 3LQ2A 3QVUA 3RAEC 1II0A 4BFWA 2XYGA 2GKOA 1J7KA 1PR3A 2I3DA 1WQ4A 2QTMA 1FMCA 1NLZA 1IQRA 2ZANA 3TQOA 3EVDA 4DILA 2WHPA 4HAYA 1PFYA 3U7QA 5KNBA 5BV7A 4JUIA 4YMVA 1GADO 3VVBA 4NCJA 4XSGA 1I3LA 2FR1A 2A0WA 3CZRA 3FCAA 4HX9A 4ND5A 5G4KA 2YWRA 4C87A 2GMWA 2P1RA 4ZEWA 3I12A 3AFHA 5FXMA 4RK5A 4RVGA 1UAGA 5K0CA 3LT0A 3EWIA 5H70A 2FG5A 3EC1A 5JG7A 4GP7A 2QG9A 3VR3D 1DU4A 4K9QA 2XNSA 5I7FA 1P8AA 2FKAA 4P4LA 1E4EA 1JALA 4R1OA 5A7GA 1R4MB 2BYTA 3K2QA 4KR6A 1BSVA 1TJ5A 3HUDA 1DJOA 5E2AA 2JZCA 5TQ0A 1KMHA 4FDMA 2FMTA 3LUHA 4Q9KA 2ET6A 1DAGA 1K9VF 2HUNA 3ORFA 4LK2A 3T7DA 2C29D 1M6YA 4FE3A 2Y1DA 1SC9A 4O4LB 3RS2A 3AF2A 4ZMSA 1L2TA 4RD4A 1ESDA 1P3DA 1XV5A 1SHUX 4PAMA 1K7XB 2ZKIA 2Q0HA 3NGMA 4WJKB 4XTRA 1JTFA 2P4EA 4E1AA 1H66A 5K8VA 1A9XA 1GL7A 3U7GA 5BT8A 3DOHA 3T1HB 1FMFA 3F5SA 3U3DA 3QRWA 3D8RA 4D6XA 1JJAA 1LF5A 3EVFA 1X86B 3EZNA 3M5CA 1PZMA 3UUGA 5EVCA 4WBNA 5ALEA 2YYSA 3BRWA 4E6EA 2Q4OA 2A35A 3AJRA 1W581 3KXKA 1YULA 3JYNA 5IUJC 1U0NA 1QOPB 3O8BA 4C7JA 4TYQA 1GU7A 1R0CA 1BMFD 2EBFX 5CFRA 3CG4A 2HWKA 4RTLA 2A4KA 5BPFA 4JLJA 4G0NA 2CD9A 2FUNB 2HF7A 4FZRA 4J4TA 1GD1O 1AZSC 3OTWA 3BCSA 1UZLA 1QWOA 2WWGA 1II8A 1SO8A 3PZBA 1FRFS 4I0WB 4BKPA 4RTMA 2CT8A 4ND7A 1UC4B 2QNIA 1YB5A 2HMVA 3RS9A 2CZQA 4L3OA 5FOUA 1CDDA 3UH0A 4FFDA 2D6FA 4BMNA 5EL0A 1MQ8B 3L0PA 3HWSA 4LXIA 4YQFA 2YXPX 1SCKA 1BCRB 5EINA 1C7EA 4PQEA 1XCOA 3KHUA 4KDFA 3FWYA 5HS4A 1J8QA 3V8QA 5HRAA 5K8IA 2VC2B 4RC9A 2QD1A 1VJ5A 4R41A 2WKQA 1G5HA 1MB3A 2X76A 1B6TA 3T0GA 4Y7DA 5EJ8A 3HRKA 3D7SA 4M7WA 1R6VA 1JECA 3GFPA 4GM0A 3DTNA 4PWZA 2IWRA 2QT1A 5AVRA 3M0EA 3P52A 1YKFA 3CRRA 2GXAA 4GPAA 3L0BA 3D3WB 4PZCA 2FX2A 1SY7A 2BLLA 3F7MA 4A8HA 1E2EA 4UBKA 3B7GA 2R68A 2IY8A 3KSZO 4WESB 4WNYA 3WWPA 1T1IA 3ZU5A 3G0GA 4QWMA 2IELA 4PU0A 1IZ8A 5JVDB 3AERB 3HUFA 1L7OA 5F1PA 3PDIB 1MRSA 3TDKA 4UJ3A 4WEOA 3AKEA 4DA4A 4HMPA 4DSNA 2GO1A 4FOLA 1NYQA 2JGKA 3SZUA 2WT9A 4A10A 2EL7A 3O8OA 3DFUA 2BJVA 3PBKA 4EI2A 1C8VB 4GGPA 2D5CA 5FI0B 5HDQA 2VHYA 2IHBA 4LFCB 1TZMA 3MCZA 1MRZA 5HPYB 4OM7A 1LDEA 4W6ZA 3TQTA 3W06A 1JA0A 1R0KA 4FGJA 1RJ9B 1L7AA 4G37A 1PR6A 3SQOA 5C8YF 3ZD6A 4Q1BA 1RZRD 4EUFA 2EHDA 3T3IA 2YWCA 3T9EA 2COUA 3LW7A 4LGVA 5F98A 1N25A 3LYUA 1G6HA 3M9XA 4WCFB 2CJPA 1XMSA 2JLRA 3B7WA 4IDQA 2AW5A 1SBQA 4GW3A 5TX7A 1Z5GA 3AFMA 3ZJTA 2PUVA 2II6A 2JI8A 2OHHA 2YWEA 4FEAA 5JH7B 3R5HA 1XKTA 3ZW7A 4NBWA 2QRVB 2COEA 1OFIA 3E9EA 1Z0AA 1XHLA 1FMTA 3FUTA 4MGEA 1AUXA 1XLTC 1V1MA 2CB9A 4XUGB 5IC5A 3ZZTA 1PFWA 5FQNA 3PSAA 2PXCA 5SY4A 4IDGA 1P6UA 4G2NA 4P7BA 3ZLTA 4FFBB 1G21E 3QELA 2C5BA 2XJ9A 3PHHA 4LDZA 4NC9A 5DW0A 3TSZA 3H9QA 3CUTA 1ZCFA 3GMIA 3QWFA 4OD0A 2ZFUA 4D4JA 4Y1FA 3TIFA 4TKZA 1QGZA 3KXPA 4KE9A 4PYQA 5JAQA 3WYDA 1FZQA 1U3TA 5A06A 5LLTA 1SKYB 1PJQA 1YIDA 3CLVA 4CWAA 2XQKA 4REQB 3GGDA 1Q77A 3EPLA 2O8BA 2RB4A 3JWIA 4PCVA 4PGMA 4R81A 3H11A 5EHZA 2C0PA 1FDWA 2GRUA 4PZLA 4K6GA 2O3TA 1NBHA 1HLFA 2LE0A 2X42A 5BNZA 1XAJA 3ON5A 1R9MA 3H16A 3NYRA 4EUHA 4YRJA 4KTTE 4L72A 5AJYA 2JH8A 1Z4PX 3D2LA 2LIVA 4PSVA 5IKMA 4DQVA 2FUG6 1KOLA 4LJ8A 2ZIUB 1BO6A 4EOGA 2IYPA 5TB5A 3NWJA 2XH8A 4DSZA 5I4IA 2G8LA 2BEWB 1WCYA 1CY7A 2NSLA 3ZJVA 1OX5A 1GCUA 2IQ5A 1DL5A 3VNQA 2O4UX 2G7ZA 4IIEA 4ZEMA 3GP3A 4URVR 2YMPA 3V7NA 4EKEA 2WW8A 1ZW1A 4L9WA 2Z95A 4DUZB 4OHZA 5HF5A 1ODJA 1JQJC 1DKNA 5CGZA 1M0SA 3EXFB 3CE6A 5LFAA 2YIDA 3ZE7A 3JZMA 3GCGA 4GT1A 1K3UB 1NF3A 2EP7A 3D3JA 1Y1LA 2VA8A 1L1FA 2JIPA 3SQXA 1HKUA 5CU7A 2R11A 3EH2A 3CRNA 3QX9A 1EHIA 1T5DX 2XY4A 1X7YA 2RGNC 3L6RA 5EZYF 1K5PA 5ALOA 5DSZA 1YZLA 4F4FA 3H3FA 1JHQA 3A2LA 3KVOA 5EQDA 4GMHA 4JSRA 1Q7TA 4XIJA 1K0FA 1QYDA 2UXDB 2I4TA 4KTVE 3OT1A 5C8ZA 2XCLA 1VJRA 3VYVA 1A8IA 1GRVA 1KFBB 3L8CA 4UHDA 3AUTA 2HCJB 4OFBA 4EHKA 2JLAA 3L8MA 5K6AA 2B7LA 3CT4A 2I6UA 1BROA 3I28A 3JYQA 3I73A 3NXSA 2ZIXB 4TV9B 4JLPA 1F51E 4LNAA 2IOFA 3TSOA 5BV2P 1YHNA 3AEXA 3KLNA 3LKBA 1Z2NX 2I2BA 1MJ5A 3ID6C 2C58A 4TKMA 5A05A 5FL3A 3HXMA 5COQA 1U2GA 4U6NA 1R5BA 2HSZA 1CZOA 5EQJB 3ZIDA 2G1AA 2QTBA 3EGDB 4RU1A 3HCCA 1M74A 4TL7A 2C7OA 4W5JA 1N1DA 3D7LA 1D1SA 1S8AA 2CFCA 4Q9AA 4X95A 3N74A 1Q3TA 1W59A 3LGAA 4LE1A 3ZDAA 1CUGA 1DWQA 2ZJFA 1TJNA 2JLQA 2P67A 2PDAA 3P1JA 3M82A 3P2KA 5C8XA 2FMUA 1SKQA 2R1VA 2IUYA 4HD8A 4R05A 5DJ5A 1GRNA 3CX6A 3OY2A 4CV3A 1LLDA 5KC8A 3QFSA 5EA2A 3A3OA 1HEIA 1J4AA 4DBZA 1PK7A 1ORHA 3HGQA 3RRFA 1CB0A 2M6LA 421PA 5LL6P 4JYPA 2O5CA 3GT3A 4NJEB 3F7TA 2BEUA 5KU1A 2NU6A 5IJAA 1TM1E 5B2FA 5L4SA 3QJYA 3OU2A 4Q9HA 3WLTA 2L17A 4YUWA 4GC9A 4GPD1 2COKA 4RQAA 1J20A 1VGRA 2K7ZA 1OI3A 3KOUA 3PHGA 1NPTO 4WFIA 5FQOA 5HF8A 5KYXB 4RABA 3KFLA 2DMRA 2BKEA 3E7PA 1YFKA 2B4AA 1AKYA 4F4HA 2ZVDA 3L3BA 4BRZA 3IUSA 4HBGA 4M9XA 1A0OA