3FHWA

Crystal structure of the protein prib from bordetella parapertussis. northeast structural genomics consortium target bpr162.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
100
Chain Sequence
MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of the protein priB from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR162.
rcsb
source organism Bordetella parapertussis
molecule tags Dna binding protein
total genus 15
structure length 100
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fhwA00
4A76A 2Y0SG 2E8GA 3G4SA 4DR1Q 3J81j 1M90C 3F2CA 4POFA 3NENA 1UE1A 1YHAA 2YTVA 1UEBA 2B63H 2UXDL 4UP7A 1I5FA 2HIXA 2CKZB 3EN2A 5M3FH 1ASYA 4DUYL 3HOXH 3T1YQ 3A74A 3S16H 5GAHC 4DR3L 3GTQH 2JA9A 4GS3A 1PA6A 1QUQB 3RR5A 3VDYA 3K7UC 3HFZB 1OXXK 4DAYB 1BVSA 4NXNQ 1VQNA 2ATWA 2JEAI 3GTJH 4LUZA 1E1OA 1CSPA 1Q1BA 2D0OA 2PMZE 1I3QH 1KC8C 4KLKA 1OXTA 5M5YH 3HOUG 4WJ3M 2E5LQ 1WFQA 2I5HA 5C0XI 4GOPA 2NVTH 3AEVA 2Q2UA 5E7NA 2IX1A 3CPWA 2JJQA 3RLNA 4JI3L 3STBC 4EQ5A 3CCLA 2HHHL 1KXLA 3H15A 3W5OA 4PZ6A 1IBKL 4LFBQ 2KENA 2NN6I 3I4MG 4JI1Q 1D8LA 2WAQG 2VQFQ 2OTLA 2ZJQA 3HOYH 2B3GA 4L5QA 2R6GA 3CPFA 3AYHB 1TWGH 4B3SL 1TWCH 2PQAA 4DUZQ 1VS0A 3PO2H 4A3FH 1K83H 3CCSA 5LMUL 1EOVA 4YCVA 1WI5A 1YZ6A 3BU2A 4BY7G 2K5NA 4P75A 1EYGA 4IO9A 2OWOA 1SN8A 3L2PA 4HJAA 1AE3A 2JA8G 4X62Q 1BKBA 1JE5A 1VQ4A 4JI4L 3I4NG 2AWNA 1IYJB 2HIVA 4NXML 1E24A 1HNWL 4LF8Q 1UE7A 4LF6L 1RIPA 1X6OA 2L15A 5GROA 1PH1A 4A3EG 3MEFA 4YWLA 4KHZA 2VQEL 5DLQE 1VQBA 4A93G 3KDFA 1L1OB 4R4QA 4YWMA 4JCVE 3CCJA 1WJJA 2NVYH 4DR2L 2ZM6Q 4PZ7A 4DV6L 3M4OH 2V1CC 3HOZH 2I5MX 4K0KQ 2LSSA 4YCUA 5M5WH 3E0EA 3B6YA 4JOIA 2ES2A 1MKHA 1XNQQ 2NVQH 3D31A 2I5LX 4R4IA 1QUQA 4B3TL 4HIOA 4LF5Q 1FVIA 1YBYA 1JB7A 2ASBA 1YHBA 1EIYB 2N49A 3H0GG 1AH9A 1X9NA 2BH8A 3CAMA 2E2JH 2R7ZG 3J81c 1MJEA 2JA5G 1K9MC 4LF7Q 4AH6A 4DV1Q 5FLMH 2Z6KA 3CC2A 2JA7H 4IPDA 4OO1G 1GO3E 4BBRH 4JOIC 3PUWA 1ASZA 1HR0W 4X66Q 4MTNA 4DR1L 1HNZQ 4R4CA 4QL5A 3AFPA 5AJ3Q 3I56A 4OX9Q 1K0RA 1VCIA 5C4JH 1VQAA 4LUVA 1NY4A 4BA2I 4P74A 4RG1A 1PH8A 1N36Q 3GO5A 3TS2A 3AFQA 2R7DA 4GKKQ 1H95A 2BA1A 3S1MH 1XMOQ 2KHJA 2JA6H 4KI0A 1XPOA 2VNUD 1G51A 4NXNL 4LFAL 4A3GH 3PF4A 1XPUA 2CWAA 2K4KA 1I6HH 4DNIA 1VQ9A 1KRTA 4A3JG 1OTCA 2ZJPA 4DPGA 2K5HA 3CF5A 2KBNA 4Y7NH 2E5LL 1QVGA 1G291 3S14H 1PH5A 4BY1G 1SROA 3T1HQ 4C2MH 3PF5A 4JV5L 3UDIA 4LFBL 4P71A 1VQFA 4JI1L 2UUAQ 5FJ8G 1GVPA 3HOVG 4DV3Q 3ER0A 1SMXA 2VZAA 4AYBE 2R92H 1WCMG 1Q8KA 2MFIA 1EWIA 1PHJA 4DUZL 2WB1G 1NTGA 3I7FA 3K8AA 1FJGQ 2OTJA 3CC7A 1T9HA 4A3MG 4A3KG 3RN2A 2I0QA 3A5UA 4B3RQ 5IYDH 2UU9Q 4R1JA 2CWPA 3FKIG 1L1OC 4DV5L 4JI5Q 4X62L 3HOYG 3S2HH 2Y0SE 1HZAA 4ALPA 1PYBA 1IBMQ 3TREA 4X64L 1J5EL 1TWFH 3FP9A 4A3FG 2MNAA 5J3BA 2UUBL 4KHPQ 2CFMA 1S40A 4LF9Q 4GLVB 2CCZA 1GD7A 1KQSA 2NVXH 3HKZG 1SR3A 3M85A 1YNXA 1JJCB 2A19A 4B3ML 5C3EH 3F1ZA 4DR5L 4JI7Q 5IP9H 2R93H 4XTCS 3D0FA 2VUMH 1XNQL 1YJNA 1J6QA 2WFWA 3DLLA 1LUZA 3A0JA 4JBJA 3CMAA 1EUJA 4LF5L 2UXCL 2VW9A 4HIMA 5JJLA 5HY6A 4DV7L 1NBWA 4PG3A 4H02A 5C44H 4JI6Q 4JBMA 4LNQA 4TVAB 5IWAQ 1TWHH 4LF7L 4OONA 1CSQA 3ULLA 3BJUA 4XIGS 2OQ0A 1HJPA 2WAQE 4AIMA 1PH6A 1VQ5A 4MZ9A 1WOCA 3KF6A 3PO3H 4LF4Q 4IFDJ 3PIOA 3JAMc 3U58A 3RZOH 3CCVA 1Y1WH 3TQYA 3G48A 3J7A5 1A63A 4DR7Q 5LMNQ 5AJ3L 1VQEA 2PI2E 2ZJRA 4A3DH 4YY3Q 3H3VH 2R7FA 4JG2A 5FLMG 3UE1A 4DV0L 1VQMA 2BA0A 1Q81C 1MIUA 3GD7A 3ULPA 1N36L 2JA7G 2WP8J 4A4IA 4GKKL 1AE2A 1LYLA 1KAWA 4BBRG 1YJ9A 1CUKA 5JJIA 2GN5A 1QVCA 1XMOL 4MNOA 2DUDA 3GTKH 4BXXH 4DK3C 1BBUA 4POGA 2PI2A 3EIVA 3GTOH 3K80C 3PGZA 3EBEA 2UXBL 2RCNA 1VQKA 3M7NA 3CCMA 3ERSX 1RL2A 4IPHA 3OYYA 4OWTB 1VQPA 2AHOB 1VQ7A 2EIFA 1YJWA 2JA6G 1QZGA 3JAMi 3U4ZA 1N33Q 5M5XH 2UUAL 2BH2A 1V9PA 5GAEC 5IT9c 5C0XG 4DV3L 3RN5A 2ZTDA 4BBSG 3HOWG 4QJFA 1TWAH 5GQOA 3SGIA 1K8AC 4DR4Q 3KLWA 1YHQA 1K8GA 2NZHA 1Y1VG 2N78A 3CCRA 5M3MH 1JJGA 2NN6G 1N34Q 5K36G 1VQGA 4JI8Q 1C0AA 3F2BA 2KCTA 3U50C 4LFCL 5IYBG 2UU9L 2UUCL 4AQYQ 4A3BG 4IOAA 1U0LA 1Z9FA 2QEXA 4IFDI 3STBD 5IYCG 4IJLA 1X55A 3W1GA 4DV4L 1PH4A 1IBML 3WWVA 4DR6Q 2JK8A 3UDFA 1XJVA 5FLXc 2JQOA 3RZDH 1PH3A 4KHPL 1N32Q 2F52A 2JE6I 4LF9L 2UXDQ 3NEMA 1PFSA 1Y14B 3HOUH 1YITA 2GVBA 4BA1I 2A1AA 4DUYQ 4IJHA 2Q2HA 4APVA 4JI7L 3K7AH 4LWCA 3RLFA 1VQ6A 4A3IG 2B29A 4NPSA 3DM3A 3H3VI 3S1QH 3T1YL 3I4MH 5IP7H 1HZCA 1EQRA 1CKNB 3CMEA 4O2DA 3PSIA 3J7ZC 4IOCA 2NZOA 2YTYA 1A62A 1O7IA 2B63G 1VQOA 3J81i 5EAYA 2HHHQ 1GM5A 1IBKQ 4BY7H 1Q46A 5M3FG 4L5TA 3HOXG 2VUMG 1IZ6A 3PUVA 3S1NH 2XTIA 1UE6A 2N8NA 4UPAA 2JA8H 3L0OA 3Q8DA 1L1OA 1XMQQ 4P72A 1Q7YC 4B3SQ 2WB1E 3I4NH 1UE5A 1YEZA 4RMFA 3M4QA 1CKMA 4DR7L 2VQFL 5LMNL 2KCMA 1X65A 3GDEA 4A3EH 4DV2Q 2GVAA 3NELA 4YY3L 4WJ4A 1P16A 1I50H 1VQHA 4J15A 1PH9A 5ELNA 4X65Q 1GKHA 1B7YB 3KF8B 3M9BA 2A8VA 3S24A 1Y1WG 1IL2A 2F3IA 1HNWQ 4B3MQ 2ALYB 2KHIA 2VL6A 4GN3B 4GOPB 1N8RC 3AQQA 3IRBA 3LGJA 3S2DH 3HKZE 4PMWA 3PO2G 4LF8L 4DV6Q 1Q1EA 5BR8Q 1JMCA 4NB3A 1L0WA 5H1SE 4YHHQ 2R7ZH 1G6PA 1HZ9A 2IX0A 1LTLA 4A3LH 4QGUA 3ZJYC 1X54A 4HJ5A 1N33L 1XNRQ 2AKWB 5JEAJ 2PQAB 2ZM6L 4GNXB 4BXXG 1FGUA 4UP9A 4B3TQ 3MXNB 4K0KL 2D0PA 1X3EA 4AYBG 1BBWA 2IHFA 2DGYA 4IPCA 1X3GA 1OXVA 4UP8A 1MJCA 4HJ9A 4JI8L 1N34L 2ZTEA 2F4VQ 1W2BA 3A5ZB 4LW1A 3UE0A 4GLXA 1PVOA 1YVCA 3HOZG 1A0IA 4AQYL 5C4XH 1E3PA 3PCOB 4IPGA 4DK6C 1OXUA 2K50A 2LXKA 3K0XA 4C3JH 4DV1L 1YIJA 1VQDA 1EIFA 3I2ZA 2N3SA 4DR6L 3BZKA 3KDFB 3E9IA 5M3MG 2Q2TA 3ICEA 1N32L 1K3RA 4X66L 2YYZA 1W3SA 4A3JH 1HNZL 1NMFA 1S3OA 1VQ8A 1B8AA 4JI2Q 4OX9L 4FDBA 1Q86C 4JYAQ 1Q82C 5HGQA 4GLAC 2FXQA 3OTOQ 4BY1H 4L5RC 3CCEA 3OW2A 3CXCA 4LFAQ 2K75A 2VS1A 2H5XA 1IBLQ 2E2IH 2EXDA 4YCWA 5FJ8H 3HOVH 3GTGH 2YV5A 1KRSA 1EQQA 1WCMH 4GKJQ 2JEBI 3FHWA 4L5SA 1C7YA 3UDGA 1OXSC 1HR0Q 1N9WA 4A3KH 4A3MH 3J80c 1R9TH 4JV5Q 2E2HH 3M3YH 1PYSB 3W1BA 1VQCA 4JI0Q 4HIKA 4A3CH 3FKIH 5IP7G 1B70B 3I4OA 1UWVA 2HQLA 4ME3A 3CC4A 3T1HL 4R4OA 3F8TA 3CW2C 1XMQL 2YU9H 1HNXQ 2C35B 3KOJA 4LUOA 4GNXA 3GTMH 4A3GG 5GADC 2AMCB 1PH2A 1NJIC 2YTXA 4GOPC 1QVFA 4DV2L 3L7ZC 3GTLH 4OO1I 1K73C 1I94Q 2D62A 4R4TA 1VQLA 1FJGL 4DV5Q 5IY0A 3PV0A 1JJ2A 4X6AH 1FL0A 1E7ZA 2PNHA 1IXRA 1DGSA 4X65L 2RF4A 4B3RL 2Z0SA 3M4PA 4X64Q 1NMGA 1J5EQ 3PIPA 3U4VA 4JI5L 2UUBQ 4HJ7A 4GNXC 4P73A 2R92G 1D7QA 2MQHA 3J80i 2RHSB 4DKAC 3K81C 5ELOA 2OQKA 1XPRA 5BR8L 3S17H 2Q2IA 4DR5Q 4DAMA 4YHHL 1V43A 5IYDG 1E1TA 3CP0A 3BZCA 1EFWA 1XNRL 4DR3Q 4OXPA 5LMNW 4A75A 1VQJA 2UXCQ 3I55A 5JEAG 5GAGC 4DV7Q 3TS0A 4QIWE 3F2DA 2VY3A 4OWXB 2QA4A 1A8VA 2MO1A 2F4VL 1KD1C 1SRUA 4A3LG 2IY5B 1SFOH 4UY8C 5C3EG 2OCEA 3HKSA 4JC0A 4JI6L 4HIDA 3E9HA 4JI3Q 5IP9G 5IWAL 1V1QA 3CQZH 4O0AA 4QY7A 3JC66 2R93G 1S72A 3RLOA 1TXYA 1Z47A 4HJ8A 3G71A 1PH7A 1PV4A 1QZHA 2EQSA 4LF4L 1NE3A 3CCUA 3TRZA 4C3IH 3CCQA 2K52A 3PUXA 2MO0A 5C44G 4DV0Q 3TEHB 5LMUQ 4IFDG 1HH2P 4JI2L 5C4XG 2ZTCA 4JYAL 1KL9A 4TQUS 1P8LA 4JBWA 2Z6KC 3OTOL 4A93H 3PUZA 1Q12A 1IBLL 2K5VA 1WYDA 2CQOA 4PZ8A 3PO3G 4JI4Q 1SE8A 2K14A 2ID0A 1M1KC 4Y52H 4BBSH 4NXMQ 3HOWH 2UXBQ 4GKJL 2XGTA 4LF6Q 1JT8A 2HT1A 1Y1VH 3KJOA 4A3DG 2VQEQ 1HR0L 3CD6A 5JJKA 3KF6B 3S1RH 5C0XJ 4DR2Q 1XTDA 3H0GH 4JI0L 2RHQB 5IE8A 5IYBH 3KYHC 1U5KA 2AWOA 4A3BH 2JA5H 1X3FA 1CKOA 3G6EA 3PUYA 5IYCH 1HNXL 1KHIA 4QQBX 3UDXA 4GN4B 2LXJA 1E22A 2IT1A 3KJPA 1KIXA 4DR4L 1LM0A 1SLJA 2QGQA 4A3CG 2UUCQ 4EX5A 1YI2A 1HZBA 1I94L 4LFCQ 4C3HH 1CKNA 4YWKA 4JBKA 3RNUA 3KFUA 4GN5A 1L2FA 4DV4Q 3NBHB 1VQIA 4A3IH 4OWWB 3GTPH 3S15H 1X56A 3ULJA 2IHEA 1C9OA
chains in the Genus database with same CATH superfamily
2Y0SG 1M90C 3J81j 5NUCA 3F2CA 5KYLA 2YTVA 2B63H 4UP7A 2K01A 2A69C 2HIXA 5M3FH 1QWYA 1IKMA 3A74A 1I50B 2CH4A 5GAHC 4DR3L 4FF2A 1A15A 3RR5A 3VDYA 1SYEA 2ATWA 3HFZB 1BVSA 3AMUA 2EYJA 1Q1BA 1ONLA 3KF8A 3HOUG 1GXDC 1Q3LA 5C0XI 4EQOA 2NTTA 3CPWA 2PZWA 1KABA 2WKDA 3CRLC 4PNYA 4JI3L 3RLNA 2B2UA 4EQ5A 2R7ZB 1QNUA 4PZ6A 4N8X1 2VQFQ 2OTLA 4L5QA 3CPFA 1VF5C 3AYHB 1TWCH 1TU2B 3PO2H 5F2DA 1F2MA 1X3QA 1YNNC 4BY7G 2K5NA 2Z8LA 4IO9A 2OWOA 1SN8A 1BO0A 1JE5A 1B3QA 2HIVA 1HNWL 3SEBA 4LF8Q 1HFNA 1GUWA 5DLQE 1JC7A 3CCJA 1STYA 2D5DA 4DR2L 2NVYH 2RDGA 4PZ7A 4IN3A 3M4OH 3MEHA 1ESRA 4BY1B 3B6YA 1XNQQ 2I5LX 2E2IB 4J8QA 2F0UA 4LF5Q 4G7OC 1FVIA 1I3QB 3E0JA 4IURA 3K59A 1EIYB 2N49A 1J8IA 2R7ZG 2LKVA 4EQPA 4B08A 3K57A 4A3MB 1A3UA 3SXHA 2JA7H 2MGSA 4BBRH 3PUWA 5EJWA 5LL6X 1HR0W 2RSOA 3HOYB 1SYGA 3GTMB 2RQXA 3I56A 1GUGA 1VQAA 2EOTA 4LUVA 4BA2I 1WTRA 3FMCA 1N36Q 1BR9A 1H95A 2KHJA 2VNUD 1G51A 4N8FA 4RGMA 4NXNL 3PF4A 1XWEA 1RCVD 1DZ1A 1I6VC 1PRTD 4Y7NH 3S17B 4BY1G 4ZRZA 3T1HQ 4C2MH 3PF5A 2CVRA 4OIJA 4KMUC 3Q23A 4JV5L 3MFYA 5ELCA 1DM0B 1TR5A 5FJ8G 3NPPA 2R92H 2MFIA 5I2XA 1CA6A 4DUZL 4ZKCB 3W3AA 3K8AA 1BF4A 4A3MG 2KHSA 2E2JB 1EEFD 2XSCA 2B2WC 4R1JA 1PTOB 1L1OC 4JI5Q 5ELFA 3HOYG 1NAPA 2Y0SE 4ALPA 1HUNA 1VMPA 3D6CA 3TREA 4X64L 5I6YA 4KHPQ 3I3CA 2PPBC 4IALA 1KQSA 2N88A 3F1ZA 4JI7Q 5IP9H 3TP8A 3D0FA 2VUMH 1YJNA 1J6QA 1NUCA 4JBJA 1AW7A 5EKIA 4HIMA 3GP7A 3PQIA 1M4VA 1NBWA 5C44H 4DV7L 2EPBA 2NBFA 4JI6Q 4LNQA 4K5VA 4LF7L 1BCPD 4AIMA 1HTPA 1PH6A 3PO3H 4PMCA 4LK1C 4FXGC 4CDDC 5J22A 1SNMA 2F0QA 4C56C 5LMNQ 3A55A 4ILWA 2RBMA 4A3DH 2B8GA 2KECA 2R7FA 4JG2A 3T51B 3Q22A 5FLMG 1EYDA 5E4WC 3GD7A 1LT6D 4A4IA 1AE2A 1GUSA 1KAWA 2EYPA 3IL8A 1QVCA 4MNOA 3GTKH 1HA6A 4POGA 3NBHA 4K8IA 3GTOH 2UXBL 3TDQA 2RCNA 3K5LA 1VQKA 3ERSX 1RL2A 3OYYA 4OWTB 4QIWB 3T53B 1PZID 5BN3A 1QZGA 3JAMi 2A69D 1F2ZA 2J0TD 1S5CD 3TZUA 1N33Q 5G3LF 1V8QA 2ZXOA 5C0XG 5IT9c 3GTQB 4ID6A 4DV3L 2ZTDA 2NB0A 1K8AC 4DR4Q 1O7ZA 2B2YA 2QKIC 2E76C 3SK6A 1LTSD 1N34Q 4OEMB 5K36G 1C0AA 5I9PA 2UU9L 3A56A 2FINB 5IOCA 5IYCG 4IJLA 1IBML 1EY7A 4DR6Q 4L8JA 2JK8A 3T56B 4PV1C 3UDFA 5KYIA 2JQOA 3RZDH 1Y1WB 5T1IA 2JE6I 4CJ2C 2UXDQ 3HOUH 4F8MA 5I4DA 1B50A 2Q8TA 4LWCA 3IAYA 1YNND 1EY5A 2CH4W 4NPSA 3H3VI 2F0VA 5EKKA 1HZCA 2OF1A 2A6EC 1ENCA 4AYBB 1VDZA 1E2WA 1O7IA 3F2UA 1F2YA 2HHHQ 1IBKQ 3R8BA 4BY7H 5CV8A 3PUVA 1D1KA 4F7XA 3L0OA 3HOZB 1L1OA 4IUTA 1Q7YC 5KRUA 2K03A 1CKMA 1WTOA 2VQFL 5M3MB 4DV2Q 4YY3L 3H91A 1I50H 5EKLA 4J15A 1PH9A 4CHTB 1GKHA 5CV9A 1CTMA 1Y1WG 1IL2A 4DNTB 3HGBA 2KHIA 2IX3A 4GOPB 1EU3A 1B9NA 1N8RC 5JEAH 4LF8L 3V05A 1L0WA 2R7ZH 4M1UB 2RVLA 1HZ9A 1DXMA 2PMZB 1X54A 3WDNA 3VYTA 4DXGA 4UP9A 4AYBG 2JA6B 2DGYA 3E6ZX 4TSSA 4A3GB 2BE5D 1M8AA 4IPCA 2F4VQ 4JI8L 1W2BA 4LW1A 1PVOA 1K3BC 1YVCA 3HOZG 3D3RA 4RCNA 2LXKA 1FR3A 1VQDA 2AQ3B 3E9IA 2DY7A 5M3MG 1SYDA 2Q2TA 3ICEA 2C5CA 4ZLTF 4JI2Q 3JAME 1ICWA 4JYAQ 3J7AV 2AQ2B 4BY1H 2PNRC 2A6HC 3CCEA 3OW2A 4LFAQ 1IBLQ 2E2IH 5FJ8H 3MTSA 1KRSA 2JEBI 3S2DB 2R3ZA 1OXSC 4A3MH 1PFBA 3J80c 4QMGA 3W1BA 1VQCA 2F1MA 1B70B 3TMEA 1KLUD 4ME3A 1LTTD 3T1HL 4R4OA 3F8TA 4A3GG 1HNXQ 2BDNA 3KLRA 4GNXA 3GTMH 1I4RA 4RKBA 2YTXA 1G6ZA 4OO1I 3AB9A 2D62A 1EYCA 1HXYD 1ZYRC 3L9AX 4H7BA 5IY0A 2LS01 1FL0A 1IXRA 4JI5L 2O4XA 1MGSA 3DEPA 1ENAA 2QDLA 3RZOB 5ELOA 1CQVA 3S17H 2Q2IA 3QB3A 4DAMA 1EY4A 2EY5A 1EQTA 1UNSA 3URYA 1DD2A 1XNRL 4DR3Q 3VYUA 5COYA 4A75A 1CFMA 4XXEA 3I55A 1G8ZD 4ZKBB 3TS0A 4QIWE 3F2DA 5K5PA 1A8VA 2FJ2A 4OGQC 4JI6L 4JC0A 4JI3Q 1V1QA 3JC66 1Z47A 4HJ8A 4UAIA 3G71A 1PV4A 2PYKA 2EY6A 4KY5A 1BUVT 4NMZA 1EOTA 1QCBD 1JWSD 3DWQA 3TEHB 1VMCA 3R2IA 1HH2P 2XIWA 3NP8A 3D4WA 2D9UA 1KL9A 4HEDA 1CZWA 5IODA 3PUZA 2CQAA 1EZ6A 2K5VA 1WYDA 1JICA 5C0XH 4Y52H 4GKJL 2RA4A 1LO5D 3CD6A 4DR2Q 1XTDA 4JI0L 1V1PB 1CM9A 4KJOA 1PZJD 1TT2A 3G6EA 5IYCH 5JPNC 1UEAB 4GN4B 2HUGA 3H09A 1KAAA 2LXJA 2L11A 2F3WA 2IT1A 3KJPA 4DR4L 4IZ8A 4A3CG 4X3KA 4LFCQ 4WRDA 2K5DA 1SFOB 1WTHA 1STHA 4OWWB 1O7YA 3ULJA 3I4OA 2RKSA 2IHEA 2K32A 2JA8B 1C9OA 3G4SA 3QJYA 1DJRD 1ML0D 1UEBA 4RA8A 2UXDL 1FGBD 1TY2A 1I5FA 1Z6HA 3EN2A 1W6KA 1STBA 4S3SA 3T1YQ 3S16H 3GTQH 1B4OA 2JA9A 1U4LA 3MXUA 4NXNQ 1OXXK 4JW0A 1CT1D 3OPOA 4LUZA 1PDQA 1E1OA 2PMZE 1KC8C 1DYQA 4KLKA 3X3MA 4YIJA 1LV9A 5FKAC 4WJ3M 1QOHA 4RGOS 3OWFA 3AEVA 2I5HA 1QNKA 3KK7A 3H0GB 5E7NA 2IX1A 2SNMA 3STBC 3CCLA 1KXLA 1IYUA 2HHHL 1RDPD 4LAAA 3H15A 1IBKL 3C3LA 2NN6I 2ZJQA 3KBGA 1K8OA 1KLGD 2PQAA 4R9WA 4DUZQ 1TVXA 3MXNA 4A3FH 3CCSA 4RHSA 1WI5A 4ZUIA 2EJFC 4FYDA 3L2PA 2J4XA 1AE3A 1JOKA 2JA8G 1VQ4A 4JI4L 5CGKA 4B9XA 1LTAD 3MXGA 1E24A 3QIAA 4LF6L 1RIPA 1PH1A 3MEFA 5AFWA 1VQBA 4A93G 3T13A 4FNFA 2ZM6Q 2V1CC 3HOZH 3VR6A 5FLXE 3E0EA 4JOIA 2ES2A 2NVQH 3GTJB 5KIXA 4HIOA 4FF3A 1JB7A 3HOVB 2ASBA 1YHBA 5IGEA 3GTGB 3H0GG 1X9NA 4LMQD 2C9OA 2WB1B 1MJEA 2EY2A 4LF7Q 5KNDA 1L0YB 2TSSA 5I9OA 3M3YB 1EEID 1H9RA 3U9SA 4IPDA 3MZ5A 2V4DA 4OO1G 2JP1A 3LWEA 4MN3A 4HCSA 4R4CA 3AFPA 4OX9Q 1TS2A 4KN4C 4P74A 3GO5A 5CYUA 3HKZB 3AFQA 3TS2A 1ZYRD 3E5SA 2JA6H 4XT1B 4LFAL 4A3GH 1ICFB 3ONAB 2CWAA 2K4KA 5IGDA 1SDFA 3LNNA 4DNIA 2P5ZX 2PCFB 1KRTA 1OTCA 2ZJPA 2WKCA 1QVGA 1G291 1JCKB 1PH5A 4K2LA 4DA2A 4L63B 1BCPC 3UDIA 5IGGA 1KTKA 3HOVG 1UUPA 4DV3Q 3GV3A 1PHJA 2QCPX 2WB1G 1NTGA 4XQNA 1FJGQ 2L1BA 3RN2A 3A5UA 3CU7A 2UU9Q 2CWPA 2GA4B 1GJXA 3D4DA 1HZAA 1IBMQ 1XX8A 3FP9A 3K6OA 5E4XA 3SVMA 2F0JA 1I4HA 5C4JB 1LTBD 2KUMA 3HKZG 2H4OA 1A3TA 1RHPA 4O42A 3CKIB 4IUUA 2WFWA 1LUZA 3CMAA 1WTWA 3P75A 1E2VA 4BBSB 2XNAC 1R4QB 4FVMA 4H02A 1BBXC 3S14B 5C4HA 1TWHH 4OONA 3W2DA 3ULLA 3S1RB 2OQ0A 1HJPA 2SDFA 2A68C 2I46A 3RZOH 3CCVA 3TQYA 3BG3A 4HCEA 5AJ3L 2PI2E 2ZJRA 4YY3Q 3H3VH 3NWTA 2EDGA 3CRKC 1PXUA 3DUZA 4ZYSA 1Q81C 4RFBA 4C3HB 5JJIA 1YJ9A 4ZUJA 3J7YW 1NSNS 4A3IB 4DK3C 4BXXH 3S15B 1RJTA 4KY6A 5JAVA 5FLXL 1R4PB 3EIVA 5LHY1 3EBEA 2DNEA 1MD2D 3P7JA 3M7NA 1HQRD 3P20A 1EY6A 2XRQD 3NK9A 2UUAL 1V9PA 1NR4A 1RF2D 4BBSG 4QJFA 5GQOA 3KLWA 1K8GA 2NZHA 2N78A 2NN6G 4DAYA 4JI8Q 5M5YB 1RD9D 2KCTA 4LFCL 3K0YA 1SMYD 2QEXA 5IIFA 4IFDI 3STBD 4EVOA 3W1GA 3WWVA 2KCNA 1XJVA 2B2YC 2O2LD 1XYIA 2F52A 1Y14B 1YITA 3R93A 3BZDB 4C3HG 1FNWA 3H6MA 4F88A 4UDUC 3RLFA 1KDAA 4A3IG 3T1YL 4V190 1EQRA 5C4ZA 1CKNB 1EL0A 5G3LD 2BE5C 3NQTA 3L3OC 1MBYA 1A62A 3J81i 5ISRA 3FDTA 1B2TA 1IZ6A 1H9KA 2XTIA 2ZXPA 4UPAA 2JA8H 5M5XB 1Z7TA 2E74C 4P72A 4B3SQ 2WB1E 1PMRA 1SE4A 4DR7L 3GDEA 3NELA 1C8CA 4WJ4A 2B2VC 3KF8B 1B7YB 3BVMA 3S24A 2KEEA 2F0KA 2K5WA 4HMJA 4HAEA 4K5WA 3ERQA 2DNCA 1DONA 3FVQA 1TS5A 3IRBA 3HKZE 5A35A 2HQEA 3OOCA 4PMWA 3RMHA 1U4RA 4DV6Q 1Q1EA 4NB3A 1G6PA 4KV6A 2IX0A 1LTGD 4QGUA 1SNOA 1XNRQ 5JEAJ 2ZM6L 1FGUA 4OO1H 1PRTB 1AEXA 2D0PA 2WV6D 1I4XA 5I6WA 2MJ8A 1SNPA 4G57A 1X3PA 1C48A 1TS3A 2X6GA 1UAPA 2ZTEA 4L6TB 3I91A 1A2UA 3A5ZB 3FRPB 1A0IA 5FO8B 3S1NB 3PCOB 4IPGA 2RSNA 1W6JA 2QF7A 3BZKA 1N32L 2F4IA 1W3SA 2K1BA 1NMFA 3A8KE 5DNFA 1VQ8A 4OL7A 1CZGA 4OX9L 1Q82C 5KNCA 5LL6S 1B53A 2K75A 2VS1A 2FMCA 4YCWA 3HOVH 3I73A 2RCFA 4G4KA 3S2HB 3GTGH 1EQQA 1BXTA 4GKJQ 1MSGA 1II3A 1RKNA 3I4LA 3M3YH 4JI0Q 4HIKA 5IP7G 5J1ZA 5CR3A 5C3EB 1XMQL 2YU9H 5T1GA 5C5MA 3DWAA 4KKTA 4KY7A 3MA2B 1ILPA 4DK1A 2AUJD 1BCPB 2XWJB 3QR8A 3DXJC 5IT9E 1FJGL 3PV0A 1JJ2A 1X32A 4X6AH 5C4XB 1E7ZA 1WD0A 1PTOF 5J39A 4FP5D 3M4PA 2F0NA 4X3UA 2K04A 3U4VA 2UUBQ 3BVGA 4K8JA 4GNXC 3HRZC 4TRDA 2A68D 4RWSC 1SNCA 2RHSB 3J80i 3J81E 4DKAC 3K81C 2OQKA 1XPRA 5BR8L 1NCVA 1E1TA 1JWUD 2Q8RE 2LFNA 3MWYW 1J9OA 5LMNW 1G2TA 2UXCQ 2MO1A 1SRUA 3R3OA 5E1FA 4A3LG 1R9TB 4XYOA 2IY5B 4UY8C 5C3EG 2OCEA 3HKSA 2O5IC 3E9HA 1SYFA 2B2VA 5ELBA 1I4GA 1JWMD 2EQSA 3S9WA 4U673 3CCUA 3TRZA 3QO2A 1TWAB 2K52A 3CCQA 4DV0Q 3GTLB 4IFDG 5C4XG 2ZTCA 4TQUS 1P8LA 4JBWA 2Z6KC 4WJWA 4DK0A 3OTOL 1Q12A 2IW3A 4PZ8A 4JI4Q 1SE8A 2XRSD 2RDHA 3OIPA 2ID0A 4BBSH 2L55A 3M7GA 4LF6Q 1TKWB 1RTOA 1FNVA 3NQIA 2NN6H 2TMPA 1HR0L 5JJKA 3S1RH 1NR2A 2EVBA 5C0XJ 1KNAA 1TY0A 3KYHC 2AWOA 4V0BA 5DM73 2B8FA 4R8IA 2ZXRA 3FPUB 1HQMC 1KHIA 4CKBA 2JXMB 2WAQB 3V96A 2HDLA 1I94L 4C3HH 4JK1C 4B9WA 4JBKA 1L2FA 3NBHB 1VQIA 4A3IH 3S15H 4LJZC 1T5EA 3Q6SA 1A6XA 3MHBA 4A76A 2E8GA 1O78A 4POFA 3NENA 1UE1A 4K6LA 2F0OA 2KA7A 4A3EB 2MP1A 2PO4A 1S4ZA 2F0MA 1ASYA 4OIKA 4GS3A 2EXZA 1PA6A 1QUQB 3D6WA 2ICIA 4G7ZC 2JEAI 1K0SA 1CSPA 2F0EA 2D0OA 1I3QH 1OXTA 2IWHA 5M5YH 1DCZA 3TP7A 4DNRB 2CW0D 2NTSA 2Q2UA 2JJQA 1O80A 1PZKD 3W5OA 2JA5B 1HPCA 1IL8A 2XN9C 3J80E 1D8LA 2WAQG 3HOYH 2I07B 2R6GA 4B3SL 3R2TA 1JOOA 2Z4HA 4YCVA 4NDXA 3BU2A 4Q0FA 1H9SA 3J81L 4U68A 2M9VA 1G91A 3T4AC 1BKBA 3SK4A 1EY9A 3QG1A 1EFID 3NHHA 4C3JB 5D14A 1UE7A 2L15A 4A3EG 4YWLA 4KHZA 2VQEL 3KDFA 1L1OB 4A3JB 4JCVE 2AQ1B 3OMGA 4DV6L 3NTIA 2A5HA 2LSSA 3A8JE 5IGCA 4KHVA 3D31A 3OSOA 4R4IA 4CKCA 3U9OA 4RAUC 2PW5A 3DM1A 1WCMB 2BH8A 3CAMA 2E2JH 3SK5A 1JOQA 2JA5G 3NTKA 1GOZA 2J7ZA 4AH6A 1BOSA 4O1NA 1PTOH 3MXPA 5FLMH 2KCCA 2Z6KA 3CC2A 1D1IA 2F0HA 3FKIB 1GO3E 4JOIC 3SR1A 4X66Q 3IFTA 4DR1L 1HNZQ 1EIGA 4DN4M 4PMBA 3IFDA 5AJ3Q 4J1MA 1K0RA 1VCIA 2HCCA 1NY4A 1PH8A 2IL8A 2PQEA 3QWNA 1ZEQX 4C3JG 1DOMA 1XPOA 2EYLA 3E3XA 3CHBD 1Q90A 2HD3A 4K6DA 5FO9B 1XPUA 2G5DA 4IUPA 1VQ9A 4A3JG 4IUQA 1AP0A 1QG7A 2E5LL 1AFPA 1SYBA 5K36H 4LFBL 4QUFA 5I2YA 4P71A 1FD7D 3NE5B 1WTVA 1VQFA 4JI1L 2UUAQ 1GVPA 1STGA 2ENBA 5C5LA 1ET6A 4AYBE 1WCMG 1EWIA 2L9HA 1LABA 2OTJA 3CC7A 2I0QA 1ET9A 3PMFA 3FKIG 1SJED 4X62L 2JA7B 3S2HH 4MTKA 4BBRB 3CQZB 3JAML 1SSOA 2EYHA 5J3BA 2UUBL 4XQQA 4R8NA 4GLVB 2CCZA 1SR3A 4HTHA 3M85A 5C3EH 3V2TA 4XTCS 5DAUA 4A93B 2A74C 3VA5A 3DLLA 3BDCA 3A0JA 1EUJA 2UXCL 5HY6A 3HOWB 3J80L 3EQLC 4Y7NB 4IFDH 1Y1VB 4TVAB 5IWAQ 1CSQA 3C1FA 2WAQE 1VQ5A 5CMDA 1SMYC 1EQVA 3KF6A 4CBVA 4LF4Q 3KLSX 3PIOA 4A3BB 3U58A 1Y1WH 4DR7Q 2EJGC 1VQEA 1ILQA 3UE1A 4DV0L 2BA0A 2JA7G 2G9DA 2WP8J 4GKKL 1LYLA 1JR0D 4BBRG 1XMOL 2EYFA 4RHRA 3VR4A 1BBUA 3A54A 3K5OA 3CCMA 2OEOA 1AZQA 1VQPA 2AHOB 3U4ZA 2VUMB 3HOXB 5FOBB 5GAEC 3HOWG 1TWAH 3SGIA 1D2BA 1JQYD 1Y1VG 3CCRA 2JYOA 1F9PA 5IGBA 5M3MH 1JJGA 3I8ZA 5KGUA 5IYBG 2NVTB 2L5TA 4A3BG 4IOAA 1RTNA 1Z9FA 1STNA 1U4MA 1PH3A 5FLXc 1N32Q 2D2CC 3VA7A 4LF9L 4C1NK 3D8GA 1T5XD 3DHQA 1TWGB 4BA1I 2A1AA 4DUYQ 4IJHA 1K83B 5EBCA 1VQ6A 1D5ZC 4FXDA 2KOLA 5C3WA 3G6JB 3CMEA 5EPJA 2LMCB 3PSIA 3GTOB 2NZOA 2YTYA 3KBXA 1VQOA 5FO7B 3NBIA 1GM5A 1YNJC 2VUMG 3BVZA 3HOXG 1UE6A 2N8NA 3Q8DA 2ZT9C 1XMQQ 4KK7A 1UE5A 2K33A 1YEZA 5M5WB 4RMFA 3OW7A 3M4QA 2BDOA 5EBDA 2KCMA 1X65A 4A3EH 2RDFA 1MI2A 4EQNA 4DF7A 2F03A 1VF7A 2M00A 4FF1A 1JE4A 4XQJA 4MHEA 1ZXTA 2F3IA 2F0PA 4N9TA 4B3MQ 2XWBB 3AQQA 3LGJA 3S2DH 1QB5D 5BR8Q 1JMCA 1S5BD 5H1SE 3G7LA 1ENFA 4HJ5A 2AKWB 2PQAB 4B3TQ 3MXNB 4H0LC 3MVVA 3S1MB 2K28A 2IHFA 3WOEA 1X3GA 1OXVA 1I6HB 3NTHA 2O5JC 1Y8OB 4GLXA 3I90A 4AQYL 4CGYB 1E3PA 5JVH3 4DK6C 1OXUA 4C3JH 2K5QA 3EJIA 3OWEB 1YIJA 1EIFA 1IHZA 2N3SA 1HHVA 4KKSA 3NWSA 1KDBA 2F0IA 1DOLA 1K3RA 4X66L 2KQ3A 1HNZL 4A3JH 4H13C 2QILA 1B8AA 4FDBA 4JVZA 4WORA 3OMCA 1Q86C 2K7VA 4GLAC 2FXQA 3OTOQ 4L5RC 2H5XA 3A8IE 2EYMA 5EGTA 2EXDA 4MIUA 1WD1A 1TQOA 2YV5A 1Y8NB 1WCMH 3FHWA 1TWFB 3A7AB 1C7YA 1HR0Q 1SNQA 3T16A 1G2SA 3I70A 3ND8A 1PYSB 3ND9A 2K6AA 2VB2X 4A3CH 2NVXB 3FKIH 3NUCA 2Z1CA 1GHJA 1UWVA 1H9JA 1ESFA 2HQLA 3CW2C 2R93B 2C35B 4LUOA 1AN8A 1HUMA 5GADC 2L4NA 1PH2A 1NJIC 2JN4A 2MUYA 3H94A 4GOPC 5JPMC 1QVFA 3L7ZC 1I94Q 1CI3M 4R4TA 1VQLA 4K5XA 4DV5Q 1SBBB 1XTCD 4M8AA 3K5NA 2PNHA 4X65L 2Z0SA 1J5EQ 2MHVA 3PIPA 2X69A 1D7QA 5CV4A 1EU4A 4DR5Q 4YHHL 1V43A 5TSSA 5IYDG 1OO9B 1JORA 4OXPA 1B44D 5JEAG 2B39A 4ZQ3A 1CK1A 3GV6A 4ME5A 1STEA 1KD1C 3SK8A 1SFOH 4QCLA 5IWAL 4O0AA 3CQZH 1EY8A 2PZTA 2R93G 1S72A 3RLOA 2SNSA 4LF4L 1E2ZA 1PTOD 1NE3A 2N55A 3RD4A 2MO0A 2PZUA 2Z4IA 1TS4A 2NZ1D 3DMUA 1EWCA 4XDXA 4A93H 3BDOA 3X3NA 1B1ZA 4RKLA 1M1KC 2IJ0A 3HOWH 2LY7A 2HT1A 1Y1VH 3KJOA 2VQEQ 2E75C 3VYRA 2CW0C 1RODA 3H0GH 5IE8A 1LTID 1HA5A 2OT2A 5IYBH 4A3BH 1LT3D 3PUYA 1F2LA 5A2QE 3K7AB 3S1QB 3I4MB 3D4RA 1E22A 1LM0A 1SLJA 2QGQA 3UI2A 2UUCQ 1YI2A 3DWPA 3KFUA 4GN5A 4HN7A 4DV4Q 1PFNA 1YNJD 4NP5A 3H3VC 4X3SA 3SHLA 1X56A 3IKJA 4DR1Q 3I4NB 4FXKC 3QOJA 1D6EC 2FHTA 1YHAA 4Q5VA 2DJFC 3PIO3 2CKZB 4RGTA 4DUYL 1L0XB 3HOXH 2NWGA 1KNEA 3K7UC 4DAYB 1VQNA 3VR3A 3GTJH 1IW7C 1IKLA 5HURA 2E5LQ 1WFQA 4GOPA 2NVTH 4PQXA 1S5FD 4LFBQ 2KENA 3I4MG 4JI1Q 5C3XA 1PYWD 3ZYYX 2B3GA 1MSHA 4C1NI 1TWGH 4HR7B 4XYQA 1HFGA 1VS0A 1K83H 5LMUL 1D5MC 1JB3A 1EOVA 3EVQA 1S5DD 1YZ6A 2WIIB 4P75A 1EYGA 4HJAA 1EWHA 4X62Q 2VB3X 1EYAA 1ZKOA 3I4NG 2BOSA 2AWNA 1IYJB 3HEJA 5KEEA 4NXML 5ELDA 3TBIB 5GROA 1X6OA 4KTAA 2Q8IB 4B3ML 3C46A 3K5MA 2M2LA 1Y8PB 3QOLA 5EPLA 2QW7A 5E3FA 4R4QA 4YWMA 5C6AA 1WJJA 3S16B 2I5MX 4K0KQ 4YCUA 5M5WH 4ZK9B 1MKHA 1PRTF 1LLRD 4XT3B 1QUQA 2G9HD 4B3TL 1YBYA 4IUVA 1AH9A 2F0SA 5KNBA 2B2TC 3J81c 1K9MC 4A3KB 4DV1Q 2EJMA 3OHXC 1IYVA 2E2HB 2EE1A 1SXTA 1ASZA 4ZAIA 4MTNA 4QL5A 1PLFA 4OHJA 4A3FB 1E0BA 5C4JH 4RG1A 4K14A 2F0LA 2R7DA 4GKKQ 3C2PA 4FF4A 1SYCA 2BA1A 3S1MH 1XMOQ 2K05A 4KI0A 1H9MA 4QF4A 1I6HH 5A2QL 4DPGA 2VXWA 2K5HA 3CF5A 2KBNA 5DEHA 3S14H 2B2WA 3K58A 2KVMA 4NW2A 1SROA 2DJGC 3TP5A 3BS1A 2NVQB 3ER0A 1SMXA 2VZAA 1Q8KA 4H44C 2F0GA 3N6RA 4KD4A 3I7FA 4CJ0B 1BCPF 1T9HA 1FNUA 4JPBW 3Q24A 4A3KG 5JOBA 4B3RQ 4G7HC 5IYDH 4DV5L 5CV5A 1EY0A 1PYBA 3MFGA 1Q8IA 5ELEA 1TWFH 2WINB 4CDCC 1TIID 2MNAA 4A3FG 1WVLA 1J5EL 3TSSA 1AZPA 2CFMA 3HZXA 1S40A 1Y69U 4LF9Q 1F77A 1GD7A 2NVXH 4C3IB 4TKOB 1YNXA 4ZCKA 1JJCB 2A19A 1LTRD 4DR5L 1NNXA 2R93H 4RH6A 1XNQL 4DAVA 3FEWX 3P1HA 4LF5L 5JJLA 2VW9A 2QEJC 2SEBD 4PG3A 2Z9HA 5FK9C 2DN8A 4JBMA 5BN5A 4N9PA 4CDEC 1SJHD 2F0WA 3BJUA 3NSWA 4XIGS 3EROA 4MZ9A 1WOCA 2FFKB 3SE0A 4HSVA 4IFDJ 3JAMc 5IT9L 3BYTB 1QE6A 1V1PA 2FMMA 3J7A5 3G48A 1A63A 1WTPA 3WOFA 4X3TA 4BWGB 1F9RA 2Z6BA 4I7AA 1VQMA 1N36L 1MIUA 2H1EA 2EYOA 3ULPA 1CUKA 2GN5A 4IUNA 3LX0A 1KDCA 2DUDA 3LWUA 3GTPB 1A3VA 4CJ1B 2PI2A 4C3IG 4EGVA 3K80C 3PGZA 5D3DA 3PIP3 4IPHA 1VQ7A 2EIFA 1YJWA 2B2TA 2JA6G 1QILA 2B63B 3MAQA 5M5XH 2XVSA 5M3FB 2BH2A 3RN5A 2F0DA 4K2KA 1YHQA 4HMIA 5CV7A 1IW7D 1VQGA 2JSOA 1TWHB 2DY8A 3F2BA 3U50C 2UUCL 3Q0AA 4AQYQ 1HCZA 2A73B 1U0LA 1XXGA 4DGZA 4DV4L 1X55A 1PH4A 3KLSA 1BQQT 2QDBA 1SE3A 4IQZA 3VR5A 4KHPL 4KJNA 3NEMA 1PFSA 1B3AA 2GVBA 1TWCB 2E2DC 1F9QA 3PO2B 3J7AF 2Q2HA 4APVA 4JI7L 3K7AH 1SAPA 2B29A 3DM3A 3S1QH 2L0CA 3I4MH 5IP7H 4O2DA 3J7ZC 4IOCA 1BNZA 2B63G 5EAYA 1B9MA 1Q46A 5M3FG 4L5TA 2X6LA 4I65A 3S1NH 4DU9A 2NVYB 5EPKA 3M4OB 3TN2A 4E6IA 4KD3A 3I4NH 3SDZA 4BS9A 1S5ED 5LMNL 2PW7A 3A7LA 1SEBD 2GVAA 4DAPA 1P16A 1HRJA 1VQHA 3BDLA 5ELNA 4X65Q 2A8VA 3M9BA 3NXWA 1HNWQ 2ALYB 4GN3B 2VL6A 1WTXA 4ULLA 3TP6A 1CHPD 3PO2G 5CBEE 5HGTA 4NKLA 4OELB 1WTQA 4YHHQ 1I4PA 1LTLA 5JVG3 4A3LH 3ZJYC 1N33L 4BXXG 4GNXB 5EQ0A 1U9RA 4K0KL 1X3EA 1BBWA 1H9SB 2A6ED 1LT5D 3ITPA 2NYZD 1LACA 1N34L 4UP8A 3TZDA 1MJCA 4HJ9A 3AU7A 3UE0A 1U4PA 5D3IB 2F0FA 5C4XH 2K50A 3K0XA 2SOBA 4DV1L 4C2MB 3I2ZA 4DR6L 3KDFB 4DFAA 1GUTA 2KJXA 2YYZA 2ICEC 3C1EA 2R92B 1S3OA 4QB4A 1LT4D 1D5XC 4KKUA 2BCOA 4WFN3 5HGQA 1I4QA 3CXCA 1CQFA 1BDOA 3O13A 1DOKA 5CBAE 4L5SA 1FYCA 3MC0B 3UDGA 1N9WA 4A3KH 1R9TH 4JV5Q 2E2HH 2R61A 3GQBA 1CHQD 1O7LA 4DXFA 3CC4A 3EA6A 5D65A 2MPMA 3KOJA 1PTOC 2AMCB 4UHVA 4DV2L 3GTLH 1A2TA 1K73C 3EFXD 1MHWC 5C44B 1STAA 2B2UC 1DGSA 2AUKA 2F3VA 2RF4A 4I7ZC 4X64Q 4B3RL 1NMGA 3RUZA 4ODGA 4HJ7A 1GHKA 3PO3B 4P73A 2R92G 2MQHA 1PRTC 1EZ8A 1HTLD 4F87A 5CC4A 2HCIA 5DM63 3BYYB 4RCOA 2KEDA 4A3DB 1GUOA 2HDMA 3CP0A 3BZCA 2A6HD 1EFWA 1SNDA 5JJZA 5CV6A 1VQJA 5GAGC 4DV7Q 1GUNA 5CORA 3GTKB 3HG9A 2VY3A 4OWXB 1QJOA 3DEOA 2QA4A 2EZVA 1EIHA 2F4VL 1C4QA 1K28A 4FO2A 4HIDA 5IP9G 4GZYC 4QY7A 1TXYA 1PH7A 5L37A 2YU9B 1QZHA 4KN7C 5IGFA 5BN4A 3VYSA 4C3IH 3PUXA 2Y0SB 2F0TA 3HS0C 4ABNA 5C44G 5LMUQ 4JI2L 4J6HA 1CA5A 4JYAL 1SE2A 3OIQA 2IPKD 3FPPA 1IBLL 2CQOA 3KUPA 3PO3G 1PFMA 2K14A 4NXMQ 2UXBQ 4HSPA 2XGTA 1JT8A 2EY1A 4RGNA 1V1OA 4A3DG 3RZDB 3KF6B 3HOUB 2RHQB 1U5KA 4P2CB 2JA5H 2CHBD 1X3FA 1CKOA 1HNXL 3N52A 4QQBX 3UDXA 2WACA 2OXPA 1KIXA 4CDFC 2NUCA 4EX5A 1HZBA 2L12A 4QUCA 1CKNA 3I72A 5M9OA 4Z9CB 4YWKA 3VR2A 3RNUA 1K8MA 3HP3A 3GTPH 4BY7B 1F9SA 3M4YA 4CKEA
chains in the Genus database with same CATH topology
4A76A 2Y0SG 2E8GA 3G4SA 4DR1Q 3J81j 1M90C 3F2CA 4POFA 3NENA 1UE1A 1YHAA 2YTVA 1UEBA 2B63H 2UXDL 4UP7A 1I5FA 2HIXA 2CKZB 3EN2A 5M3FH 1ASYA 4DUYL 3HOXH 3T1YQ 3A74A 3S16H 5GAHC 4DR3L 3GTQH 2JA9A 4GS3A 1PA6A 1QUQB 3RR5A 3VDYA 3K7UC 3HFZB 1OXXK 4DAYB 1BVSA 4NXNQ 1VQNA 2ATWA 2JEAI 3GTJH 4LUZA 1E1OA 1CSPA 1Q1BA 2D0OA 2PMZE 1I3QH 1KC8C 4KLKA 1OXTA 5M5YH 3HOUG 4WJ3M 2E5LQ 1WFQA 2I5HA 5C0XI 4GOPA 2NVTH 3AEVA 2Q2UA 5E7NA 2IX1A 3CPWA 2JJQA 3RLNA 4JI3L 3STBC 4EQ5A 3CCLA 2HHHL 1KXLA 3H15A 3W5OA 4PZ6A 1IBKL 4LFBQ 2KENA 2NN6I 3I4MG 4JI1Q 1D8LA 2WAQG 2VQFQ 2OTLA 2ZJQA 3HOYH 2B3GA 4L5QA 2R6GA 3CPFA 3AYHB 1TWGH 4B3SL 1TWCH 2PQAA 4DUZQ 1VS0A 3PO2H 4A3FH 1K83H 3CCSA 5LMUL 1EOVA 4YCVA 1WI5A 1YZ6A 3BU2A 4BY7G 2K5NA 4P75A 1EYGA 4IO9A 2OWOA 1SN8A 3L2PA 4HJAA 1AE3A 2JA8G 4X62Q 1BKBA 1JE5A 1VQ4A 4JI4L 3I4NG 2AWNA 1IYJB 2HIVA 4NXML 1E24A 1HNWL 4LF8Q 1UE7A 4LF6L 1RIPA 1X6OA 2L15A 5GROA 1PH1A 4A3EG 3MEFA 4YWLA 4KHZA 2VQEL 5DLQE 1VQBA 4A93G 3KDFA 1L1OB 4R4QA 4YWMA 4JCVE 3CCJA 1WJJA 2NVYH 4DR2L 2ZM6Q 4PZ7A 4DV6L 3M4OH 2V1CC 3HOZH 2I5MX 4K0KQ 2LSSA 4YCUA 5M5WH 3E0EA 3B6YA 4JOIA 2ES2A 1MKHA 1XNQQ 2NVQH 3D31A 2I5LX 4R4IA 1QUQA 4B3TL 4HIOA 4LF5Q 1FVIA 1YBYA 1JB7A 2ASBA 1YHBA 1EIYB 2N49A 3H0GG 1AH9A 1X9NA 2BH8A 3CAMA 2E2JH 2R7ZG 3J81c 1MJEA 2JA5G 1K9MC 4LF7Q 4AH6A 4DV1Q 5FLMH 2Z6KA 3CC2A 2JA7H 4IPDA 4OO1G 1GO3E 4BBRH 4JOIC 3PUWA 1ASZA 1HR0W 4X66Q 4MTNA 4DR1L 1HNZQ 4R4CA 4QL5A 3AFPA 5AJ3Q 3I56A 4OX9Q 1K0RA 1VCIA 5C4JH 1VQAA 4LUVA 1NY4A 4BA2I 4P74A 4RG1A 1PH8A 1N36Q 3GO5A 3TS2A 3AFQA 2R7DA 4GKKQ 1H95A 2BA1A 3S1MH 1XMOQ 2KHJA 2JA6H 4KI0A 1XPOA 2VNUD 1G51A 4NXNL 4LFAL 4A3GH 3PF4A 1XPUA 2CWAA 2K4KA 1I6HH 4DNIA 1VQ9A 1KRTA 4A3JG 1OTCA 2ZJPA 4DPGA 2K5HA 3CF5A 2KBNA 4Y7NH 2E5LL 1QVGA 1G291 3S14H 1PH5A 4BY1G 1SROA 3T1HQ 4C2MH 3PF5A 4JV5L 3UDIA 4LFBL 4P71A 1VQFA 4JI1L 2UUAQ 5FJ8G 1GVPA 3HOVG 4DV3Q 3ER0A 1SMXA 2VZAA 4AYBE 2R92H 1WCMG 1Q8KA 2MFIA 1EWIA 1PHJA 4DUZL 2WB1G 1NTGA 3I7FA 3K8AA 1FJGQ 2OTJA 3CC7A 1T9HA 4A3MG 4A3KG 3RN2A 2I0QA 3A5UA 4B3RQ 5IYDH 2UU9Q 4R1JA 2CWPA 3FKIG 1L1OC 4DV5L 4JI5Q 4X62L 3HOYG 3S2HH 2Y0SE 1HZAA 4ALPA 1PYBA 1IBMQ 3TREA 4X64L 1J5EL 1TWFH 3FP9A 4A3FG 2MNAA 5J3BA 2UUBL 4KHPQ 2CFMA 1S40A 4LF9Q 4GLVB 2CCZA 1GD7A 1KQSA 2NVXH 3HKZG 1SR3A 3M85A 1YNXA 1JJCB 2A19A 4B3ML 5C3EH 3F1ZA 4DR5L 4JI7Q 5IP9H 2R93H 4XTCS 3D0FA 2VUMH 1XNQL 1YJNA 1J6QA 2WFWA 3DLLA 1LUZA 3A0JA 4JBJA 3CMAA 1EUJA 4LF5L 2UXCL 2VW9A 4HIMA 5JJLA 5HY6A 4DV7L 1NBWA 4PG3A 4H02A 5C44H 4JI6Q 4JBMA 4LNQA 4TVAB 5IWAQ 1TWHH 4LF7L 4OONA 1CSQA 3ULLA 3BJUA 4XIGS 2OQ0A 1HJPA 2WAQE 4AIMA 1PH6A 1VQ5A 4MZ9A 1WOCA 3KF6A 3PO3H 4LF4Q 4IFDJ 3PIOA 3JAMc 3U58A 3RZOH 3CCVA 1Y1WH 3TQYA 3G48A 3J7A5 1A63A 4DR7Q 5LMNQ 5AJ3L 1VQEA 2PI2E 2ZJRA 4A3DH 4YY3Q 3H3VH 2R7FA 4JG2A 5FLMG 3UE1A 4DV0L 1VQMA 2BA0A 1Q81C 1MIUA 3GD7A 3ULPA 1N36L 2JA7G 2WP8J 4A4IA 4GKKL 1AE2A 1LYLA 1KAWA 4BBRG 1YJ9A 1CUKA 5JJIA 2GN5A 1QVCA 1XMOL 4MNOA 2DUDA 3GTKH 4BXXH 4DK3C 1BBUA 4POGA 2PI2A 3EIVA 3GTOH 3K80C 3PGZA 3EBEA 2UXBL 2RCNA 1VQKA 3M7NA 3CCMA 3ERSX 1RL2A 4IPHA 3OYYA 4OWTB 1VQPA 2AHOB 1VQ7A 2EIFA 1YJWA 2JA6G 1QZGA 3JAMi 3U4ZA 1N33Q 5M5XH 2UUAL 2BH2A 1V9PA 5GAEC 5IT9c 5C0XG 4DV3L 3RN5A 2ZTDA 4BBSG 3HOWG 4QJFA 1TWAH 5GQOA 3SGIA 1K8AC 4DR4Q 3KLWA 1YHQA 1K8GA 2NZHA 1Y1VG 2N78A 3CCRA 5M3MH 1JJGA 2NN6G 1N34Q 5K36G 1VQGA 4JI8Q 1C0AA 3F2BA 2KCTA 3U50C 4LFCL 5IYBG 2UU9L 2UUCL 4AQYQ 4A3BG 4IOAA 1U0LA 1Z9FA 2QEXA 4IFDI 3STBD 5IYCG 4IJLA 1X55A 3W1GA 4DV4L 1PH4A 1IBML 3WWVA 4DR6Q 2JK8A 3UDFA 1XJVA 5FLXc 2JQOA 3RZDH 1PH3A 4KHPL 1N32Q 2F52A 2JE6I 4LF9L 2UXDQ 3NEMA 1PFSA 1Y14B 3HOUH 1YITA 2GVBA 4BA1I 2A1AA 4DUYQ 4IJHA 2Q2HA 4APVA 4JI7L 3K7AH 4LWCA 3RLFA 1VQ6A 4A3IG 2B29A 4NPSA 3DM3A 3H3VI 3S1QH 3T1YL 3I4MH 5IP7H 1HZCA 1EQRA 1CKNB 3CMEA 4O2DA 3PSIA 3J7ZC 4IOCA 2NZOA 2YTYA 1A62A 1O7IA 2B63G 1VQOA 3J81i 5EAYA 2HHHQ 1GM5A 1IBKQ 4BY7H 1Q46A 5M3FG 4L5TA 3HOXG 2VUMG 1IZ6A 3PUVA 3S1NH 2XTIA 1UE6A 2N8NA 4UPAA 2JA8H 3L0OA 3Q8DA 1L1OA 1XMQQ 4P72A 1Q7YC 4B3SQ 2WB1E 3I4NH 1UE5A 1YEZA 4RMFA 3M4QA 1CKMA 4DR7L 2VQFL 5LMNL 2KCMA 1X65A 3GDEA 4A3EH 4DV2Q 2GVAA 3NELA 4YY3L 4WJ4A 1P16A 1I50H 1VQHA 4J15A 1PH9A 5ELNA 4X65Q 1GKHA 1B7YB 3KF8B 3M9BA 2A8VA 3S24A 1Y1WG 1IL2A 2F3IA 1HNWQ 4B3MQ 2ALYB 2KHIA 2VL6A 4GN3B 4GOPB 1N8RC 3AQQA 3IRBA 3LGJA 3S2DH 3HKZE 4PMWA 3PO2G 4LF8L 4DV6Q 1Q1EA 5BR8Q 1JMCA 4NB3A 1L0WA 5H1SE 4YHHQ 2R7ZH 1G6PA 1HZ9A 2IX0A 1LTLA 4A3LH 4QGUA 3ZJYC 1X54A 4HJ5A 1N33L 1XNRQ 2AKWB 5JEAJ 2PQAB 2ZM6L 4GNXB 4BXXG 1FGUA 4UP9A 4B3TQ 3MXNB 4K0KL 2D0PA 1X3EA 4AYBG 1BBWA 2IHFA 2DGYA 4IPCA 1X3GA 1OXVA 4UP8A 1MJCA 4HJ9A 4JI8L 1N34L 2ZTEA 2F4VQ 1W2BA 3A5ZB 4LW1A 3UE0A 4GLXA 1PVOA 1YVCA 3HOZG 1A0IA 4AQYL 5C4XH 1E3PA 3PCOB 4IPGA 4DK6C 1OXUA 2K50A 2LXKA 3K0XA 4C3JH 4DV1L 1YIJA 1VQDA 1EIFA 3I2ZA 2N3SA 4DR6L 3BZKA 3KDFB 3E9IA 5M3MG 2Q2TA 3ICEA 1N32L 1K3RA 4X66L 2YYZA 1W3SA 4A3JH 1HNZL 1NMFA 1S3OA 1VQ8A 1B8AA 4JI2Q 4OX9L 4FDBA 1Q86C 4JYAQ 1Q82C 5HGQA 4GLAC 2FXQA 3OTOQ 4BY1H 4L5RC 3CCEA 3OW2A 3CXCA 4LFAQ 2K75A 2VS1A 2H5XA 1IBLQ 2E2IH 2EXDA 4YCWA 5FJ8H 3HOVH 3GTGH 2YV5A 1KRSA 1EQQA 1WCMH 4GKJQ 2JEBI 3FHWA 4L5SA 1C7YA 3UDGA 1OXSC 1HR0Q 1N9WA 4A3KH 4A3MH 3J80c 1R9TH 4JV5Q 2E2HH 3M3YH 1PYSB 3W1BA 1VQCA 4JI0Q 4HIKA 4A3CH 3FKIH 5IP7G 1B70B 3I4OA 1UWVA 2HQLA 4ME3A 3CC4A 3T1HL 4R4OA 3F8TA 3CW2C 1XMQL 2YU9H 1HNXQ 2C35B 3KOJA 4LUOA 4GNXA 3GTMH 4A3GG 5GADC 2AMCB 1PH2A 1NJIC 2YTXA 4GOPC 1QVFA 4DV2L 3L7ZC 3GTLH 4OO1I 1K73C 1I94Q 2D62A 4R4TA 1VQLA 1FJGL 4DV5Q 5IY0A 3PV0A 1JJ2A 4X6AH 1FL0A 1E7ZA 2PNHA 1IXRA 1DGSA 4X65L 2RF4A 4B3RL 2Z0SA 3M4PA 4X64Q 1NMGA 1J5EQ 3PIPA 3U4VA 4JI5L 2UUBQ 4HJ7A 4GNXC 4P73A 2R92G 1D7QA 2MQHA 3J80i 2RHSB 4DKAC 3K81C 5ELOA 2OQKA 1XPRA 5BR8L 3S17H 2Q2IA 4DR5Q 4DAMA 4YHHL 1V43A 5IYDG 1E1TA 3CP0A 3BZCA 1EFWA 1XNRL 4DR3Q 4OXPA 5LMNW 4A75A 1VQJA 2UXCQ 3I55A 5JEAG 5GAGC 4DV7Q 3TS0A 4QIWE 3F2DA 2VY3A 4OWXB 2QA4A 1A8VA 2MO1A 2F4VL 1KD1C 1SRUA 4A3LG 2IY5B 1SFOH 4UY8C 5C3EG 2OCEA 3HKSA 4JC0A 4JI6L 4HIDA 3E9HA 4JI3Q 5IP9G 5IWAL 1V1QA 3CQZH 4O0AA 4QY7A 3JC66 2R93G 1S72A 3RLOA 1TXYA 1Z47A 4HJ8A 3G71A 1PH7A 1PV4A 1QZHA 2EQSA 4LF4L 1NE3A 3CCUA 3TRZA 4C3IH 3CCQA 2K52A 3PUXA 2MO0A 5C44G 4DV0Q 3TEHB 5LMUQ 4IFDG 1HH2P 4JI2L 5C4XG 2ZTCA 4JYAL 1KL9A 4TQUS 1P8LA 4JBWA 2Z6KC 3OTOL 4A93H 3PUZA 1Q12A 1IBLL 2K5VA 1WYDA 2CQOA 4PZ8A 3PO3G 4JI4Q 1SE8A 2K14A 2ID0A 1M1KC 4Y52H 4BBSH 4NXMQ 3HOWH 2UXBQ 4GKJL 2XGTA 4LF6Q 1JT8A 2HT1A 1Y1VH 3KJOA 4A3DG 2VQEQ 1HR0L 3CD6A 5JJKA 3KF6B 3S1RH 5C0XJ 4DR2Q 1XTDA 3H0GH 4JI0L 2RHQB 5IE8A 5IYBH 3KYHC 1U5KA 2AWOA 4A3BH 2JA5H 1X3FA 1CKOA 3G6EA 3PUYA 5IYCH 1HNXL 1KHIA 4QQBX 3UDXA 4GN4B 2LXJA 1E22A 2IT1A 3KJPA 1KIXA 4DR4L 1LM0A 1SLJA 2QGQA 4A3CG 2UUCQ 4EX5A 1YI2A 1HZBA 1I94L 4LFCQ 4C3HH 1CKNA 4YWKA 4JBKA 3RNUA 3KFUA 4GN5A 1L2FA 4DV4Q 3NBHB 1VQIA 4A3IH 4OWWB 3GTPH 3S15H 1X56A 3ULJA 2IHEA 1C9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A76 A;  2Y0S G;  2E8G A;  3G4S A;  4DR1 Q;  3J81 j;  1M90 C;  3F2C A;  4POF A;  3NEN A;  1UE1 A;  1YHA A;  2YTV A;  1UEB A;  2B63 H;  2UXD L;  4UP7 A;  1I5F A;  2HIX A;  2CKZ B;  3EN2 A;  5M3F H;  1ASY A;  4DUY L;  3HOX H;  3T1Y Q;  3A74 A;  3S16 H;  5GAH C;  4DR3 L;  3GTQ H;  2JA9 A;  4GS3 A;  1PA6 A;  1QUQ B;  3RR5 A;  3VDY A;  3K7U C;  3HFZ B;  1OXX K;  4DAY B;  1BVS A;  4NXN Q;  1VQN A;  2ATW A;  2JEA I;  3GTJ H;  4LUZ A;  1E1O A;  1CSP A;  1Q1B A;  2D0O A;  2PMZ E;  1I3Q H;  1KC8 C;  4KLK A;  1OXT A;  5M5Y H;  3HOU G;  4WJ3 M;  2E5L Q;  1WFQ A;  2I5H A;  5C0X I;  4GOP A;  2NVT H;  3AEV A;  2Q2U A;  5E7N A;  2IX1 A;  3CPW A;  2JJQ A;  3RLN A;  4JI3 L;  3STB C;  4EQ5 A;  3CCL A;  2HHH L;  1KXL A;  3H15 A;  3W5O A;  4PZ6 A;  1IBK L;  4LFB Q;  2KEN A;  2NN6 I;  3I4M G;  4JI1 Q;  1D8L A;  2WAQ G;  2VQF Q;  2OTL A;  2ZJQ A;  3HOY H;  2B3G A;  4L5Q A;  2R6G A;  3CPF A;  3AYH B;  1TWG H;  4B3S L;  1TWC H;  2PQA A;  4DUZ Q;  1VS0 A;  3PO2 H;  4A3F H;  1K83 H;  3CCS A;  5LMU L;  1EOV A;  4YCV A;  1WI5 A;  1YZ6 A;  3BU2 A;  4BY7 G;  2K5N A;  4P75 A;  1EYG A;  4IO9 A;  2OWO A;  1SN8 A;  3L2P A;  4HJA A;  1AE3 A;  2JA8 G;  4X62 Q;  1BKB A;  1JE5 A;  1VQ4 A;  4JI4 L;  3I4N G;  2AWN A;  1IYJ B;  2HIV A;  4NXM L;  1E24 A;  1HNW L;  4LF8 Q;  1UE7 A;  4LF6 L;  1RIP A;  1X6O A;  2L15 A;  5GRO A;  1PH1 A;  4A3E G;  3MEF A;  4YWL A;  4KHZ A;  2VQE L;  5DLQ E;  1VQB A;  4A93 G;  3KDF A;  1L1O B;  4R4Q A;  4YWM A;  4JCV E;  3CCJ A;  1WJJ A;  2NVY H;  4DR2 L;  2ZM6 Q;  4PZ7 A;  4DV6 L;  3M4O H;  2V1C C;  3HOZ H;  2I5M X;  4K0K Q;  2LSS A;  4YCU A;  5M5W H;  3E0E A;  3B6Y A;  4JOI A;  2ES2 A;  1MKH A;  1XNQ Q;  2NVQ H;  3D31 A;  2I5L X;  4R4I A;  1QUQ A;  4B3T L;  4HIO A;  4LF5 Q;  1FVI A;  1YBY A;  1JB7 A;  2ASB A;  1YHB A;  1EIY B;  2N49 A;  3H0G G;  1AH9 A;  1X9N A;  2BH8 A;  3CAM A;  2E2J H;  2R7Z G;  3J81 c;  1MJE A;  2JA5 G;  1K9M C;  4LF7 Q;  4AH6 A;  4DV1 Q;  5FLM H;  2Z6K A;  3CC2 A;  2JA7 H;  4IPD A;  4OO1 G;  1GO3 E;  4BBR H;  4JOI C;  3PUW A;  1ASZ A;  1HR0 W;  4X66 Q;  4MTN A;  4DR1 L;  1HNZ Q;  4R4C A;  4QL5 A;  3AFP A;  5AJ3 Q;  3I56 A;  4OX9 Q;  1K0R A;  1VCI A;  5C4J H;  1VQA A;  4LUV A;  1NY4 A;  4BA2 I;  4P74 A;  4RG1 A;  1PH8 A;  1N36 Q;  3GO5 A;  3TS2 A;  3AFQ A;  2R7D A;  4GKK Q;  1H95 A;  2BA1 A;  3S1M H;  1XMO Q;  2KHJ A;  2JA6 H;  4KI0 A;  1XPO A;  2VNU D;  1G51 A;  4NXN L;  4LFA L;  4A3G H;  3PF4 A;  1XPU A;  2CWA A;  2K4K A;  1I6H H;  4DNI A;  1VQ9 A;  1KRT A;  4A3J G;  1OTC A;  2ZJP A;  4DPG A;  2K5H A;  3CF5 A;  2KBN A;  4Y7N H;  2E5L L;  1QVG A;  1G29 1;  3S14 H;  1PH5 A;  4BY1 G;  1SRO A;  3T1H Q;  4C2M H;  3PF5 A;  4JV5 L;  3UDI A;  4LFB L;  4P71 A;  1VQF A;  4JI1 L;  2UUA Q;  5FJ8 G;  1GVP A;  3HOV G;  4DV3 Q;  3ER0 A;  1SMX A;  2VZA A;  4AYB E;  2R92 H;  1WCM G;  1Q8K A;  2MFI A;  1EWI A;  1PHJ A;  4DUZ L;  2WB1 G;  1NTG A;  3I7F A;  3K8A A;  1FJG Q;  2OTJ A;  3CC7 A;  1T9H A;  4A3M G;  4A3K G;  3RN2 A;  2I0Q A;  3A5U A;  4B3R Q;  5IYD H;  2UU9 Q;  4R1J A;  2CWP A;  3FKI G;  1L1O C;  4DV5 L;  4JI5 Q;  4X62 L;  3HOY G;  3S2H H;  2Y0S E;  1HZA A;  4ALP A;  1PYB A;  1IBM Q;  3TRE A;  4X64 L;  1J5E L;  1TWF H;  3FP9 A;  4A3F G;  2MNA A;  5J3B A;  2UUB L;  4KHP Q;  2CFM A;  1S40 A;  4LF9 Q;  4GLV B;  2CCZ A;  1GD7 A;  1KQS A;  2NVX H;  3HKZ G;  1SR3 A;  3M85 A;  1YNX A;  1JJC B;  2A19 A;  4B3M L;  5C3E H;  3F1Z A;  4DR5 L;  4JI7 Q;  5IP9 H;  2R93 H;  4XTC S;  3D0F A;  2VUM H;  1XNQ L;  1YJN A;  1J6Q A;  2WFW A;  3DLL A;  1LUZ A;  3A0J A;  4JBJ A;  3CMA A;  1EUJ A;  4LF5 L;  2UXC L;  2VW9 A;  4HIM A;  5JJL A;  5HY6 A;  4DV7 L;  1NBW A;  4PG3 A;  4H02 A;  5C44 H;  4JI6 Q;  4JBM A;  4LNQ A;  4TVA B;  5IWA Q;  1TWH H;  4LF7 L;  4OON A;  1CSQ A;  3ULL A;  3BJU A;  4XIG S;  2OQ0 A;  1HJP A;  2WAQ E;  4AIM A;  1PH6 A;  1VQ5 A;  4MZ9 A;  1WOC A;  3KF6 A;  3PO3 H;  4LF4 Q;  4IFD J;  3PIO A;  3JAM c;  3U58 A;  3RZO H;  3CCV A;  1Y1W H;  3TQY A;  3G48 A;  3J7A 5;  1A63 A;  4DR7 Q;  5LMN Q;  5AJ3 L;  1VQE A;  2PI2 E;  2ZJR A;  4A3D H;  4YY3 Q;  3H3V H;  2R7F A;  4JG2 A;  5FLM G;  3UE1 A;  4DV0 L;  1VQM A;  2BA0 A;  1Q81 C;  1MIU A;  3GD7 A;  3ULP A;  1N36 L;  2JA7 G;  2WP8 J;  4A4I A;  4GKK L;  1AE2 A;  1LYL A;  1KAW A;  4BBR G;  1YJ9 A;  1CUK A;  5JJI A;  2GN5 A;  1QVC A;  1XMO L;  4MNO A;  2DUD A;  3GTK H;  4BXX H;  4DK3 C;  1BBU A;  4POG A;  2PI2 A;  3EIV A;  3GTO H;  3K80 C;  3PGZ A;  3EBE A;  2UXB L;  2RCN A;  1VQK A;  3M7N A;  3CCM A;  3ERS X;  1RL2 A;  4IPH A;  3OYY A;  4OWT B;  1VQP A;  2AHO B;  1VQ7 A;  2EIF A;  1YJW A;  2JA6 G;  1QZG A;  3JAM i;  3U4Z A;  1N33 Q;  5M5X H;  2UUA L;  2BH2 A;  1V9P A;  5GAE C;  5IT9 c;  5C0X G;  4DV3 L;  3RN5 A;  2ZTD A;  4BBS G;  3HOW G;  4QJF A;  1TWA H;  5GQO A;  3SGI A;  1K8A C;  4DR4 Q;  3KLW A;  1YHQ A;  1K8G A;  2NZH A;  1Y1V G;  2N78 A;  3CCR A;  5M3M H;  1JJG A;  2NN6 G;  1N34 Q;  5K36 G;  1VQG A;  4JI8 Q;  1C0A A;  3F2B A;  2KCT A;  3U50 C;  4LFC L;  5IYB G;  2UU9 L;  2UUC L;  4AQY Q;  4A3B G;  4IOA A;  1U0L A;  1Z9F A;  2QEX A;  4IFD I;  3STB D;  5IYC G;  4IJL A;  1X55 A;  3W1G A;  4DV4 L;  1PH4 A;  1IBM L;  3WWV A;  4DR6 Q;  2JK8 A;  3UDF A;  1XJV A;  5FLX c;  2JQO A;  3RZD H;  1PH3 A;  4KHP L;  1N32 Q;  2F52 A;  2JE6 I;  4LF9 L;  2UXD Q;  3NEM A;  1PFS A;  1Y14 B;  3HOU H;  1YIT A;  2GVB A;  4BA1 I;  2A1A A;  4DUY Q;  4IJH A;  2Q2H A;  4APV A;  4JI7 L;  3K7A H;  4LWC A;  3RLF A;  1VQ6 A;  4A3I G;  2B29 A;  4NPS A;  3DM3 A;  3H3V I;  3S1Q H;  3T1Y L;  3I4M H;  5IP7 H;  1HZC A;  1EQR A;  1CKN B;  3CME A;  4O2D A;  3PSI A;  3J7Z C;  4IOC A;  2NZO A;  2YTY A;  1A62 A;  1O7I A;  2B63 G;  1VQO A;  3J81 i;  5EAY A;  2HHH Q;  1GM5 A;  1IBK Q;  4BY7 H;  1Q46 A;  5M3F G;  4L5T A;  3HOX G;  2VUM G;  1IZ6 A;  3PUV A;  3S1N H;  2XTI A;  1UE6 A;  2N8N A;  4UPA A;  2JA8 H;  3L0O A;  3Q8D A;  1L1O A;  1XMQ Q;  4P72 A;  1Q7Y C;  4B3S Q;  2WB1 E;  3I4N H;  1UE5 A;  1YEZ A;  4RMF A;  3M4Q A;  1CKM A;  4DR7 L;  2VQF L;  5LMN L;  2KCM A;  1X65 A;  3GDE A;  4A3E H;  4DV2 Q;  2GVA A;  3NEL A;  4YY3 L;  4WJ4 A;  1P16 A;  1I50 H;  1VQH A;  4J15 A;  1PH9 A;  5ELN A;  4X65 Q;  1GKH A;  1B7Y B;  3KF8 B;  3M9B A;  2A8V A;  3S24 A;  1Y1W G;  1IL2 A;  2F3I A;  1HNW Q;  4B3M Q;  2ALY B;  2KHI A;  2VL6 A;  4GN3 B;  4GOP B;  1N8R C;  3AQQ A;  3IRB A;  3LGJ A;  3S2D H;  3HKZ E;  4PMW A;  3PO2 G;  4LF8 L;  4DV6 Q;  1Q1E A;  5BR8 Q;  1JMC A;  4NB3 A;  1L0W A;  5H1S E;  4YHH Q;  2R7Z H;  1G6P A;  1HZ9 A;  2IX0 A;  1LTL A;  4A3L H;  4QGU A;  3ZJY C;  1X54 A;  4HJ5 A;  1N33 L;  1XNR Q;  2AKW B;  5JEA J;  2PQA B;  2ZM6 L;  4GNX B;  4BXX G;  1FGU A;  4UP9 A;  4B3T Q;  3MXN B;  4K0K L;  2D0P A;  1X3E A;  4AYB G;  1BBW A;  2IHF A;  2DGY A;  4IPC A;  1X3G A;  1OXV A;  4UP8 A;  1MJC A;  4HJ9 A;  4JI8 L;  1N34 L;  2ZTE A;  2F4V Q;  1W2B A;  3A5Z B;  4LW1 A;  3UE0 A;  4GLX A;  1PVO A;  1YVC A;  3HOZ G;  1A0I A;  4AQY L;  5C4X H;  1E3P A;  3PCO B;  4IPG A;  4DK6 C;  1OXU A;  2K50 A;  2LXK A;  3K0X A;  4C3J H;  4DV1 L;  1YIJ A;  1VQD A;  1EIF A;  3I2Z A;  2N3S A;  4DR6 L;  3BZK A;  3KDF B;  3E9I A;  5M3M G;  2Q2T A;  3ICE A;  1N32 L;  1K3R A;  4X66 L;  2YYZ A;  1W3S A;  4A3J H;  1HNZ L;  1NMF A;  1S3O A;  1VQ8 A;  1B8A A;  4JI2 Q;  4OX9 L;  4FDB A;  1Q86 C;  4JYA Q;  1Q82 C;  5HGQ A;  4GLA C;  2FXQ A;  3OTO Q;  4BY1 H;  4L5R C;  3CCE A;  3OW2 A;  3CXC A;  4LFA Q;  2K75 A;  2VS1 A;  2H5X A;  1IBL Q;  2E2I H;  2EXD A;  4YCW A;  5FJ8 H;  3HOV H;  3GTG H;  2YV5 A;  1KRS A;  1EQQ A;  1WCM H;  4GKJ Q;  2JEB I;  3FHW A;  4L5S A;  1C7Y A;  3UDG A;  1OXS C;  1HR0 Q;  1N9W A;  4A3K H;  4A3M H;  3J80 c;  1R9T H;  4JV5 Q;  2E2H H;  3M3Y H;  1PYS B;  3W1B A;  1VQC A;  4JI0 Q;  4HIK A;  4A3C H;  3FKI H;  5IP7 G;  1B70 B;  3I4O A;  1UWV A;  2HQL A;  4ME3 A;  3CC4 A;  3T1H L;  4R4O A;  3F8T A;  3CW2 C;  1XMQ L;  2YU9 H;  1HNX Q;  2C35 B;  3KOJ A;  4LUO A;  4GNX A;  3GTM H;  4A3G G;  5GAD C;  2AMC B;  1PH2 A;  1NJI C;  2YTX A;  4GOP C;  1QVF A;  4DV2 L;  3L7Z C;  3GTL H;  4OO1 I;  1K73 C;  1I94 Q;  2D62 A;  4R4T A;  1VQL A;  1FJG L;  4DV5 Q;  5IY0 A;  3PV0 A;  1JJ2 A;  4X6A H;  1FL0 A;  1E7Z A;  2PNH A;  1IXR A;  1DGS A;  4X65 L;  2RF4 A;  4B3R L;  2Z0S A;  3M4P A;  4X64 Q;  1NMG A;  1J5E Q;  3PIP A;  3U4V A;  4JI5 L;  2UUB Q;  4HJ7 A;  4GNX C;  4P73 A;  2R92 G;  1D7Q A;  2MQH A;  3J80 i;  2RHS B;  4DKA C;  3K81 C;  5ELO A;  2OQK A;  1XPR A;  5BR8 L;  3S17 H;  2Q2I A;  4DR5 Q;  4DAM A;  4YHH L;  1V43 A;  5IYD G;  1E1T A;  3CP0 A;  3BZC A;  1EFW A;  1XNR L;  4DR3 Q;  4OXP A;  5LMN W;  4A75 A;  1VQJ A;  2UXC Q;  3I55 A;  5JEA G;  5GAG C;  4DV7 Q;  3TS0 A;  4QIW E;  3F2D A;  2VY3 A;  4OWX B;  2QA4 A;  1A8V A;  2MO1 A;  2F4V L;  1KD1 C;  1SRU A;  4A3L G;  2IY5 B;  1SFO H;  4UY8 C;  5C3E G;  2OCE A;  3HKS A;  4JC0 A;  4JI6 L;  4HID A;  3E9H A;  4JI3 Q;  5IP9 G;  5IWA L;  1V1Q A;  3CQZ H;  4O0A A;  4QY7 A;  3JC6 6;  2R93 G;  1S72 A;  3RLO A;  1TXY A;  1Z47 A;  4HJ8 A;  3G71 A;  1PH7 A;  1PV4 A;  1QZH A;  2EQS A;  4LF4 L;  1NE3 A;  3CCU A;  3TRZ A;  4C3I H;  3CCQ A;  2K52 A;  3PUX A;  2MO0 A;  5C44 G;  4DV0 Q;  3TEH B;  5LMU Q;  4IFD G;  1HH2 P;  4JI2 L;  5C4X G;  2ZTC A;  4JYA L;  1KL9 A;  4TQU S;  1P8L A;  4JBW A;  2Z6K C;  3OTO L;  4A93 H;  3PUZ A;  1Q12 A;  1IBL L;  2K5V A;  1WYD A;  2CQO A;  4PZ8 A;  3PO3 G;  4JI4 Q;  1SE8 A;  2K14 A;  2ID0 A;  1M1K C;  4Y52 H;  4BBS H;  4NXM Q;  3HOW H;  2UXB Q;  4GKJ L;  2XGT A;  4LF6 Q;  1JT8 A;  2HT1 A;  1Y1V H;  3KJO A;  4A3D G;  2VQE Q;  1HR0 L;  3CD6 A;  5JJK A;  3KF6 B;  3S1R H;  5C0X J;  4DR2 Q;  1XTD A;  3H0G H;  4JI0 L;  2RHQ B;  5IE8 A;  5IYB H;  3KYH C;  1U5K A;  2AWO A;  4A3B H;  2JA5 H;  1X3F A;  1CKO A;  3G6E A;  3PUY A;  5IYC H;  1HNX L;  1KHI A;  4QQB X;  3UDX A;  4GN4 B;  2LXJ A;  1E22 A;  2IT1 A;  3KJP A;  1KIX A;  4DR4 L;  1LM0 A;  1SLJ A;  2QGQ A;  4A3C G;  2UUC Q;  4EX5 A;  1YI2 A;  1HZB A;  1I94 L;  4LFC Q;  4C3H H;  1CKN A;  4YWK A;  4JBK A;  3RNU A;  3KFU A;  4GN5 A;  1L2F A;  4DV4 Q;  3NBH B;  1VQI A;  4A3I H;  4OWW B;  3GTP H;  3S15 H;  1X56 A;  3ULJ A;  2IHE A;  1C9O A; 
#chains in the Genus database with same CATH topology
 2Y0S G;  1M90 C;  3J81 j;  5NUC A;  3F2C A;  5KYL A;  2YTV A;  2B63 H;  4UP7 A;  2K01 A;  2A69 C;  2HIX A;  5M3F H;  1QWY A;  1IKM A;  3A74 A;  1I50 B;  2CH4 A;  5GAH C;  4DR3 L;  4FF2 A;  1A15 A;  3RR5 A;  3VDY A;  1SYE A;  2ATW A;  3HFZ B;  1BVS A;  3AMU A;  2EYJ A;  1Q1B A;  1ONL A;  3KF8 A;  3HOU G;  1GXD C;  1Q3L A;  5C0X I;  4EQO A;  2NTT A;  3CPW A;  2PZW A;  1KAB A;  2WKD A;  3CRL C;  4PNY A;  4JI3 L;  3RLN A;  2B2U A;  4EQ5 A;  2R7Z B;  1QNU A;  4PZ6 A;  4N8X 1;  2VQF Q;  2OTL A;  4L5Q A;  3CPF A;  1VF5 C;  3AYH B;  1TWC H;  1TU2 B;  3PO2 H;  5F2D A;  1F2M A;  1X3Q A;  1YNN C;  4BY7 G;  2K5N A;  2Z8L A;  4IO9 A;  2OWO A;  1SN8 A;  1BO0 A;  1JE5 A;  1B3Q A;  2HIV A;  1HNW L;  3SEB A;  4LF8 Q;  1HFN A;  1GUW A;  5DLQ E;  1JC7 A;  3CCJ A;  1STY A;  2D5D A;  4DR2 L;  2NVY H;  2RDG A;  4PZ7 A;  4IN3 A;  3M4O H;  3MEH A;  1ESR A;  4BY1 B;  3B6Y A;  1XNQ Q;  2I5L X;  2E2I B;  4J8Q A;  2F0U A;  4LF5 Q;  4G7O C;  1FVI A;  1I3Q B;  3E0J A;  4IUR A;  3K59 A;  1EIY B;  2N49 A;  1J8I A;  2R7Z G;  2LKV A;  4EQP A;  4B08 A;  3K57 A;  4A3M B;  1A3U A;  3SXH A;  2JA7 H;  2MGS A;  4BBR H;  3PUW A;  5EJW A;  5LL6 X;  1HR0 W;  2RSO A;  3HOY B;  1SYG A;  3GTM B;  2RQX A;  3I56 A;  1GUG A;  1VQA A;  2EOT A;  4LUV A;  4BA2 I;  1WTR A;  3FMC A;  1N36 Q;  1BR9 A;  1H95 A;  2KHJ A;  2VNU D;  1G51 A;  4N8F A;  4RGM A;  4NXN L;  3PF4 A;  1XWE A;  1RCV D;  1DZ1 A;  1I6V C;  1PRT D;  4Y7N H;  3S17 B;  4BY1 G;  4ZRZ A;  3T1H Q;  4C2M H;  3PF5 A;  2CVR A;  4OIJ A;  4KMU C;  3Q23 A;  4JV5 L;  3MFY A;  5ELC A;  1DM0 B;  1TR5 A;  5FJ8 G;  3NPP A;  2R92 H;  2MFI A;  5I2X A;  1CA6 A;  4DUZ L;  4ZKC B;  3W3A A;  3K8A A;  1BF4 A;  4A3M G;  2KHS A;  2E2J B;  1EEF D;  2XSC A;  2B2W C;  4R1J A;  1PTO B;  1L1O C;  4JI5 Q;  5ELF A;  3HOY G;  1NAP A;  2Y0S E;  4ALP A;  1HUN A;  1VMP A;  3D6C A;  3TRE A;  4X64 L;  5I6Y A;  4KHP Q;  3I3C A;  2PPB C;  4IAL A;  1KQS A;  2N88 A;  3F1Z A;  4JI7 Q;  5IP9 H;  3TP8 A;  3D0F A;  2VUM H;  1YJN A;  1J6Q A;  1NUC A;  4JBJ A;  1AW7 A;  5EKI A;  4HIM A;  3GP7 A;  3PQI A;  1M4V A;  1NBW A;  5C44 H;  4DV7 L;  2EPB A;  2NBF A;  4JI6 Q;  4LNQ A;  4K5V A;  4LF7 L;  1BCP D;  4AIM A;  1HTP A;  1PH6 A;  3PO3 H;  4PMC A;  4LK1 C;  4FXG C;  4CDD C;  5J22 A;  1SNM A;  2F0Q A;  4C56 C;  5LMN Q;  3A55 A;  4ILW A;  2RBM A;  4A3D H;  2B8G A;  2KEC A;  2R7F A;  4JG2 A;  3T51 B;  3Q22 A;  5FLM G;  1EYD A;  5E4W C;  3GD7 A;  1LT6 D;  4A4I A;  1AE2 A;  1GUS A;  1KAW A;  2EYP A;  3IL8 A;  1QVC A;  4MNO A;  3GTK H;  1HA6 A;  4POG A;  3NBH A;  4K8I A;  3GTO H;  2UXB L;  3TDQ A;  2RCN A;  3K5L A;  1VQK A;  3ERS X;  1RL2 A;  3OYY A;  4OWT B;  4QIW B;  3T53 B;  1PZI D;  5BN3 A;  1QZG A;  3JAM i;  2A69 D;  1F2Z A;  2J0T D;  1S5C D;  3TZU A;  1N33 Q;  5G3L F;  1V8Q A;  2ZXO A;  5C0X G;  5IT9 c;  3GTQ B;  4ID6 A;  4DV3 L;  2ZTD A;  2NB0 A;  1K8A C;  4DR4 Q;  1O7Z A;  2B2Y A;  2QKI C;  2E76 C;  3SK6 A;  1LTS D;  1N34 Q;  4OEM B;  5K36 G;  1C0A A;  5I9P A;  2UU9 L;  3A56 A;  2FIN B;  5IOC A;  5IYC G;  4IJL A;  1IBM L;  1EY7 A;  4DR6 Q;  4L8J A;  2JK8 A;  3T56 B;  4PV1 C;  3UDF A;  5KYI A;  2JQO A;  3RZD H;  1Y1W B;  5T1I A;  2JE6 I;  4CJ2 C;  2UXD Q;  3HOU H;  4F8M A;  5I4D A;  1B50 A;  2Q8T A;  4LWC A;  3IAY A;  1YNN D;  1EY5 A;  2CH4 W;  4NPS A;  3H3V I;  2F0V A;  5EKK A;  1HZC A;  2OF1 A;  2A6E C;  1ENC A;  4AYB B;  1VDZ A;  1E2W A;  1O7I A;  3F2U A;  1F2Y A;  2HHH Q;  1IBK Q;  3R8B A;  4BY7 H;  5CV8 A;  3PUV A;  1D1K A;  4F7X A;  3L0O A;  3HOZ B;  1L1O A;  4IUT A;  1Q7Y C;  5KRU A;  2K03 A;  1CKM A;  1WTO A;  2VQF L;  5M3M B;  4DV2 Q;  4YY3 L;  3H91 A;  1I50 H;  5EKL A;  4J15 A;  1PH9 A;  4CHT B;  1GKH A;  5CV9 A;  1CTM A;  1Y1W G;  1IL2 A;  4DNT B;  3HGB A;  2KHI A;  2IX3 A;  4GOP B;  1EU3 A;  1B9N A;  1N8R C;  5JEA H;  4LF8 L;  3V05 A;  1L0W A;  2R7Z H;  4M1U B;  2RVL A;  1HZ9 A;  1DXM A;  2PMZ B;  1X54 A;  3WDN A;  3VYT A;  4DXG A;  4UP9 A;  4AYB G;  2JA6 B;  2DGY A;  3E6Z X;  4TSS A;  4A3G B;  2BE5 D;  1M8A A;  4IPC A;  2F4V Q;  4JI8 L;  1W2B A;  4LW1 A;  1PVO A;  1K3B C;  1YVC A;  3HOZ G;  3D3R A;  4RCN A;  2LXK A;  1FR3 A;  1VQD A;  2AQ3 B;  3E9I A;  2DY7 A;  5M3M G;  1SYD A;  2Q2T A;  3ICE A;  2C5C A;  4ZLT F;  4JI2 Q;  3JAM E;  1ICW A;  4JYA Q;  3J7A V;  2AQ2 B;  4BY1 H;  2PNR C;  2A6H C;  3CCE A;  3OW2 A;  4LFA Q;  1IBL Q;  2E2I H;  5FJ8 H;  3MTS A;  1KRS A;  2JEB I;  3S2D B;  2R3Z A;  1OXS C;  4A3M H;  1PFB A;  3J80 c;  4QMG A;  3W1B A;  1VQC A;  2F1M A;  1B70 B;  3TME A;  1KLU D;  4ME3 A;  1LTT D;  3T1H L;  4R4O A;  3F8T A;  4A3G G;  1HNX Q;  2BDN A;  3KLR A;  4GNX A;  3GTM H;  1I4R A;  4RKB A;  2YTX A;  1G6Z A;  4OO1 I;  3AB9 A;  2D62 A;  1EYC A;  1HXY D;  1ZYR C;  3L9A X;  4H7B A;  5IY0 A;  2LS0 1;  1FL0 A;  1IXR A;  4JI5 L;  2O4X A;  1MGS A;  3DEP A;  1ENA A;  2QDL A;  3RZO B;  5ELO A;  1CQV A;  3S17 H;  2Q2I A;  3QB3 A;  4DAM A;  1EY4 A;  2EY5 A;  1EQT A;  1UNS A;  3URY A;  1DD2 A;  1XNR L;  4DR3 Q;  3VYU A;  5COY A;  4A75 A;  1CFM A;  4XXE A;  3I55 A;  1G8Z D;  4ZKB B;  3TS0 A;  4QIW E;  3F2D A;  5K5P A;  1A8V A;  2FJ2 A;  4OGQ C;  4JI6 L;  4JC0 A;  4JI3 Q;  1V1Q A;  3JC6 6;  1Z47 A;  4HJ8 A;  4UAI A;  3G71 A;  1PV4 A;  2PYK A;  2EY6 A;  4KY5 A;  1BUV T;  4NMZ A;  1EOT A;  1QCB D;  1JWS D;  3DWQ A;  3TEH B;  1VMC A;  3R2I A;  1HH2 P;  2XIW A;  3NP8 A;  3D4W A;  2D9U A;  1KL9 A;  4HED A;  1CZW A;  5IOD A;  3PUZ A;  2CQA A;  1EZ6 A;  2K5V A;  1WYD A;  1JIC A;  5C0X H;  4Y52 H;  4GKJ L;  2RA4 A;  1LO5 D;  3CD6 A;  4DR2 Q;  1XTD A;  4JI0 L;  1V1P B;  1CM9 A;  4KJO A;  1PZJ D;  1TT2 A;  3G6E A;  5IYC H;  5JPN C;  1UEA B;  4GN4 B;  2HUG A;  3H09 A;  1KAA A;  2LXJ A;  2L11 A;  2F3W A;  2IT1 A;  3KJP A;  4DR4 L;  4IZ8 A;  4A3C G;  4X3K A;  4LFC Q;  4WRD A;  2K5D A;  1SFO B;  1WTH A;  1STH A;  4OWW B;  1O7Y A;  3ULJ A;  3I4O A;  2RKS A;  2IHE A;  2K32 A;  2JA8 B;  1C9O A;  3G4S A;  3QJY A;  1DJR D;  1ML0 D;  1UEB A;  4RA8 A;  2UXD L;  1FGB D;  1TY2 A;  1I5F A;  1Z6H A;  3EN2 A;  1W6K A;  1STB A;  4S3S A;  3T1Y Q;  3S16 H;  3GTQ H;  1B4O A;  2JA9 A;  1U4L A;  3MXU A;  4NXN Q;  1OXX K;  4JW0 A;  1CT1 D;  3OPO A;  4LUZ A;  1PDQ A;  1E1O A;  2PMZ E;  1KC8 C;  1DYQ A;  4KLK A;  3X3M A;  4YIJ A;  1LV9 A;  5FKA C;  4WJ3 M;  1QOH A;  4RGO S;  3OWF A;  3AEV A;  2I5H A;  1QNK A;  3KK7 A;  3H0G B;  5E7N A;  2IX1 A;  2SNM A;  3STB C;  3CCL A;  1KXL A;  1IYU A;  2HHH L;  1RDP D;  4LAA A;  3H15 A;  1IBK L;  3C3L A;  2NN6 I;  2ZJQ A;  3KBG A;  1K8O A;  1KLG D;  2PQA A;  4R9W A;  4DUZ Q;  1TVX A;  3MXN A;  4A3F H;  3CCS A;  4RHS A;  1WI5 A;  4ZUI A;  2EJF C;  4FYD A;  3L2P A;  2J4X A;  1AE3 A;  1JOK A;  2JA8 G;  1VQ4 A;  4JI4 L;  5CGK A;  4B9X A;  1LTA D;  3MXG A;  1E24 A;  3QIA A;  4LF6 L;  1RIP A;  1PH1 A;  3MEF A;  5AFW A;  1VQB A;  4A93 G;  3T13 A;  4FNF A;  2ZM6 Q;  2V1C C;  3HOZ H;  3VR6 A;  5FLX E;  3E0E A;  4JOI A;  2ES2 A;  2NVQ H;  3GTJ B;  5KIX A;  4HIO A;  4FF3 A;  1JB7 A;  3HOV B;  2ASB A;  1YHB A;  5IGE A;  3GTG B;  3H0G G;  1X9N A;  4LMQ D;  2C9O A;  2WB1 B;  1MJE A;  2EY2 A;  4LF7 Q;  5KND A;  1L0Y B;  2TSS A;  5I9O A;  3M3Y B;  1EEI D;  1H9R A;  3U9S A;  4IPD A;  3MZ5 A;  2V4D A;  4OO1 G;  2JP1 A;  3LWE A;  4MN3 A;  4HCS A;  4R4C A;  3AFP A;  4OX9 Q;  1TS2 A;  4KN4 C;  4P74 A;  3GO5 A;  5CYU A;  3HKZ B;  3AFQ A;  3TS2 A;  1ZYR D;  3E5S A;  2JA6 H;  4XT1 B;  4LFA L;  4A3G H;  1ICF B;  3ONA B;  2CWA A;  2K4K A;  5IGD A;  1SDF A;  3LNN A;  4DNI A;  2P5Z X;  2PCF B;  1KRT A;  1OTC A;  2ZJP A;  2WKC A;  1QVG A;  1G29 1;  1JCK B;  1PH5 A;  4K2L A;  4DA2 A;  4L63 B;  1BCP C;  3UDI A;  5IGG A;  1KTK A;  3HOV G;  1UUP A;  4DV3 Q;  3GV3 A;  1PHJ A;  2QCP X;  2WB1 G;  1NTG A;  4XQN A;  1FJG Q;  2L1B A;  3RN2 A;  3A5U A;  3CU7 A;  2UU9 Q;  2CWP A;  2GA4 B;  1GJX A;  3D4D A;  1HZA A;  1IBM Q;  1XX8 A;  3FP9 A;  3K6O A;  5E4X A;  3SVM A;  2F0J A;  1I4H A;  5C4J B;  1LTB D;  2KUM A;  3HKZ G;  2H4O A;  1A3T A;  1RHP A;  4O42 A;  3CKI B;  4IUU A;  2WFW A;  1LUZ A;  3CMA A;  1WTW A;  3P75 A;  1E2V A;  4BBS B;  2XNA C;  1R4Q B;  4FVM A;  4H02 A;  1BBX C;  3S14 B;  5C4H A;  1TWH H;  4OON A;  3W2D A;  3ULL A;  3S1R B;  2OQ0 A;  1HJP A;  2SDF A;  2A68 C;  2I46 A;  3RZO H;  3CCV A;  3TQY A;  3BG3 A;  4HCE A;  5AJ3 L;  2PI2 E;  2ZJR A;  4YY3 Q;  3H3V H;  3NWT A;  2EDG A;  3CRK C;  1PXU A;  3DUZ A;  4ZYS A;  1Q81 C;  4RFB A;  4C3H B;  5JJI A;  1YJ9 A;  4ZUJ A;  3J7Y W;  1NSN S;  4A3I B;  4DK3 C;  4BXX H;  3S15 B;  1RJT A;  4KY6 A;  5JAV A;  5FLX L;  1R4P B;  3EIV A;  5LHY 1;  3EBE A;  2DNE A;  1MD2 D;  3P7J A;  3M7N A;  1HQR D;  3P20 A;  1EY6 A;  2XRQ D;  3NK9 A;  2UUA L;  1V9P A;  1NR4 A;  1RF2 D;  4BBS G;  4QJF A;  5GQO A;  3KLW A;  1K8G A;  2NZH A;  2N78 A;  2NN6 G;  4DAY A;  4JI8 Q;  5M5Y B;  1RD9 D;  2KCT A;  4LFC L;  3K0Y A;  1SMY D;  2QEX A;  5IIF A;  4IFD I;  3STB D;  4EVO A;  3W1G A;  3WWV A;  2KCN A;  1XJV A;  2B2Y C;  2O2L D;  1XYI A;  2F52 A;  1Y14 B;  1YIT A;  3R93 A;  3BZD B;  4C3H G;  1FNW A;  3H6M A;  4F88 A;  4UDU C;  3RLF A;  1KDA A;  4A3I G;  3T1Y L;  4V19 0;  1EQR A;  5C4Z A;  1CKN B;  1EL0 A;  5G3L D;  2BE5 C;  3NQT A;  3L3O C;  1MBY A;  1A62 A;  3J81 i;  5ISR A;  3FDT A;  1B2T A;  1IZ6 A;  1H9K A;  2XTI A;  2ZXP A;  4UPA A;  2JA8 H;  5M5X B;  1Z7T A;  2E74 C;  4P72 A;  4B3S Q;  2WB1 E;  1PMR A;  1SE4 A;  4DR7 L;  3GDE A;  3NEL A;  1C8C A;  4WJ4 A;  2B2V C;  3KF8 B;  1B7Y B;  3BVM A;  3S24 A;  2KEE A;  2F0K A;  2K5W A;  4HMJ A;  4HAE A;  4K5W A;  3ERQ A;  2DNC A;  1DON A;  3FVQ A;  1TS5 A;  3IRB A;  3HKZ E;  5A35 A;  2HQE A;  3OOC A;  4PMW A;  3RMH A;  1U4R A;  4DV6 Q;  1Q1E A;  4NB3 A;  1G6P A;  4KV6 A;  2IX0 A;  1LTG D;  4QGU A;  1SNO A;  1XNR Q;  5JEA J;  2ZM6 L;  1FGU A;  4OO1 H;  1PRT B;  1AEX A;  2D0P A;  2WV6 D;  1I4X A;  5I6W A;  2MJ8 A;  1SNP A;  4G57 A;  1X3P A;  1C48 A;  1TS3 A;  2X6G A;  1UAP A;  2ZTE A;  4L6T B;  3I91 A;  1A2U A;  3A5Z B;  3FRP B;  1A0I A;  5FO8 B;  3S1N B;  3PCO B;  4IPG A;  2RSN A;  1W6J A;  2QF7 A;  3BZK A;  1N32 L;  2F4I A;  1W3S A;  2K1B A;  1NMF A;  3A8K E;  5DNF A;  1VQ8 A;  4OL7 A;  1CZG A;  4OX9 L;  1Q82 C;  5KNC A;  5LL6 S;  1B53 A;  2K75 A;  2VS1 A;  2FMC A;  4YCW A;  3HOV H;  3I73 A;  2RCF A;  4G4K A;  3S2H B;  3GTG H;  1EQQ A;  1BXT A;  4GKJ Q;  1MSG A;  1II3 A;  1RKN A;  3I4L A;  3M3Y H;  4JI0 Q;  4HIK A;  5IP7 G;  5J1Z A;  5CR3 A;  5C3E B;  1XMQ L;  2YU9 H;  5T1G A;  5C5M A;  3DWA A;  4KKT A;  4KY7 A;  3MA2 B;  1ILP A;  4DK1 A;  2AUJ D;  1BCP B;  2XWJ B;  3QR8 A;  3DXJ C;  5IT9 E;  1FJG L;  3PV0 A;  1JJ2 A;  1X32 A;  4X6A H;  5C4X B;  1E7Z A;  1WD0 A;  1PTO F;  5J39 A;  4FP5 D;  3M4P A;  2F0N A;  4X3U A;  2K04 A;  3U4V A;  2UUB Q;  3BVG A;  4K8J A;  4GNX C;  3HRZ C;  4TRD A;  2A68 D;  4RWS C;  1SNC A;  2RHS B;  3J80 i;  3J81 E;  4DKA C;  3K81 C;  2OQK A;  1XPR A;  5BR8 L;  1NCV A;  1E1T A;  1JWU D;  2Q8R E;  2LFN A;  3MWY W;  1J9O A;  5LMN W;  1G2T A;  2UXC Q;  2MO1 A;  1SRU A;  3R3O A;  5E1F A;  4A3L G;  1R9T B;  4XYO A;  2IY5 B;  4UY8 C;  5C3E G;  2OCE A;  3HKS A;  2O5I C;  3E9H A;  1SYF A;  2B2V A;  5ELB A;  1I4G A;  1JWM D;  2EQS A;  3S9W A;  4U67 3;  3CCU A;  3TRZ A;  3QO2 A;  1TWA B;  2K52 A;  3CCQ A;  4DV0 Q;  3GTL B;  4IFD G;  5C4X G;  2ZTC A;  4TQU S;  1P8L A;  4JBW A;  2Z6K C;  4WJW A;  4DK0 A;  3OTO L;  1Q12 A;  2IW3 A;  4PZ8 A;  4JI4 Q;  1SE8 A;  2XRS D;  2RDH A;  3OIP A;  2ID0 A;  4BBS H;  2L55 A;  3M7G A;  4LF6 Q;  1TKW B;  1RTO A;  1FNV A;  3NQI A;  2NN6 H;  2TMP A;  1HR0 L;  5JJK A;  3S1R H;  1NR2 A;  2EVB A;  5C0X J;  1KNA A;  1TY0 A;  3KYH C;  2AWO A;  4V0B A;  5DM7 3;  2B8F A;  4R8I A;  2ZXR A;  3FPU B;  1HQM C;  1KHI A;  4CKB A;  2JXM B;  2WAQ B;  3V96 A;  2HDL A;  1I94 L;  4C3H H;  4JK1 C;  4B9W A;  4JBK A;  1L2F A;  3NBH B;  1VQI A;  4A3I H;  3S15 H;  4LJZ C;  1T5E A;  3Q6S A;  1A6X A;  3MHB A;  4A76 A;  2E8G A;  1O78 A;  4POF A;  3NEN A;  1UE1 A;  4K6L A;  2F0O A;  2KA7 A;  4A3E B;  2MP1 A;  2PO4 A;  1S4Z A;  2F0M A;  1ASY A;  4OIK A;  4GS3 A;  2EXZ A;  1PA6 A;  1QUQ B;  3D6W A;  2ICI A;  4G7Z C;  2JEA I;  1K0S A;  1CSP A;  2F0E A;  2D0O A;  1I3Q H;  1OXT A;  2IWH A;  5M5Y H;  1DCZ A;  3TP7 A;  4DNR B;  2CW0 D;  2NTS A;  2Q2U A;  2JJQ A;  1O80 A;  1PZK D;  3W5O A;  2JA5 B;  1HPC A;  1IL8 A;  2XN9 C;  3J80 E;  1D8L A;  2WAQ G;  3HOY H;  2I07 B;  2R6G A;  4B3S L;  3R2T A;  1JOO A;  2Z4H A;  4YCV A;  4NDX A;  3BU2 A;  4Q0F A;  1H9S A;  3J81 L;  4U68 A;  2M9V A;  1G91 A;  3T4A C;  1BKB A;  3SK4 A;  1EY9 A;  3QG1 A;  1EFI D;  3NHH A;  4C3J B;  5D14 A;  1UE7 A;  2L15 A;  4A3E G;  4YWL A;  4KHZ A;  2VQE L;  3KDF A;  1L1O B;  4A3J B;  4JCV E;  2AQ1 B;  3OMG A;  4DV6 L;  3NTI A;  2A5H A;  2LSS A;  3A8J E;  5IGC A;  4KHV A;  3D31 A;  3OSO A;  4R4I A;  4CKC A;  3U9O A;  4RAU C;  2PW5 A;  3DM1 A;  1WCM B;  2BH8 A;  3CAM A;  2E2J H;  3SK5 A;  1JOQ A;  2JA5 G;  3NTK A;  1GOZ A;  2J7Z A;  4AH6 A;  1BOS A;  4O1N A;  1PTO H;  3MXP A;  5FLM H;  2KCC A;  2Z6K A;  3CC2 A;  1D1I A;  2F0H A;  3FKI B;  1GO3 E;  4JOI C;  3SR1 A;  4X66 Q;  3IFT A;  4DR1 L;  1HNZ Q;  1EIG A;  4DN4 M;  4PMB A;  3IFD A;  5AJ3 Q;  4J1M A;  1K0R A;  1VCI A;  2HCC A;  1NY4 A;  1PH8 A;  2IL8 A;  2PQE A;  3QWN A;  1ZEQ X;  4C3J G;  1DOM A;  1XPO A;  2EYL A;  3E3X A;  3CHB D;  1Q90 A;  2HD3 A;  4K6D A;  5FO9 B;  1XPU A;  2G5D A;  4IUP A;  1VQ9 A;  4A3J G;  4IUQ A;  1AP0 A;  1QG7 A;  2E5L L;  1AFP A;  1SYB A;  5K36 H;  4LFB L;  4QUF A;  5I2Y A;  4P71 A;  1FD7 D;  3NE5 B;  1WTV A;  1VQF A;  4JI1 L;  2UUA Q;  1GVP A;  1STG A;  2ENB A;  5C5L A;  1ET6 A;  4AYB E;  1WCM G;  1EWI A;  2L9H A;  1LAB A;  2OTJ A;  3CC7 A;  2I0Q A;  1ET9 A;  3PMF A;  3FKI G;  1SJE D;  4X62 L;  2JA7 B;  3S2H H;  4MTK A;  4BBR B;  3CQZ B;  3JAM L;  1SSO A;  2EYH A;  5J3B A;  2UUB L;  4XQQ A;  4R8N A;  4GLV B;  2CCZ A;  1SR3 A;  4HTH A;  3M85 A;  5C3E H;  3V2T A;  4XTC S;  5DAU A;  4A93 B;  2A74 C;  3VA5 A;  3DLL A;  3BDC A;  3A0J A;  1EUJ A;  2UXC L;  5HY6 A;  3HOW B;  3J80 L;  3EQL C;  4Y7N B;  4IFD H;  1Y1V B;  4TVA B;  5IWA Q;  1CSQ A;  3C1F A;  2WAQ E;  1VQ5 A;  5CMD A;  1SMY C;  1EQV A;  3KF6 A;  4CBV A;  4LF4 Q;  3KLS X;  3PIO A;  4A3B B;  3U58 A;  1Y1W H;  4DR7 Q;  2EJG C;  1VQE A;  1ILQ A;  3UE1 A;  4DV0 L;  2BA0 A;  2JA7 G;  2G9D A;  2WP8 J;  4GKK L;  1LYL A;  1JR0 D;  4BBR G;  1XMO L;  2EYF A;  4RHR A;  3VR4 A;  1BBU A;  3A54 A;  3K5O A;  3CCM A;  2OEO A;  1AZQ A;  1VQP A;  2AHO B;  3U4Z A;  2VUM B;  3HOX B;  5FOB B;  5GAE C;  3HOW G;  1TWA H;  3SGI A;  1D2B A;  1JQY D;  1Y1V G;  3CCR A;  2JYO A;  1F9P A;  5IGB A;  5M3M H;  1JJG A;  3I8Z A;  5KGU A;  5IYB G;  2NVT B;  2L5T A;  4A3B G;  4IOA A;  1RTN A;  1Z9F A;  1STN A;  1U4M A;  1PH3 A;  5FLX c;  1N32 Q;  2D2C C;  3VA7 A;  4LF9 L;  4C1N K;  3D8G A;  1T5X D;  3DHQ A;  1TWG B;  4BA1 I;  2A1A A;  4DUY Q;  4IJH A;  1K83 B;  5EBC A;  1VQ6 A;  1D5Z C;  4FXD A;  2KOL A;  5C3W A;  3G6J B;  3CME A;  5EPJ A;  2LMC B;  3PSI A;  3GTO B;  2NZO A;  2YTY A;  3KBX A;  1VQO A;  5FO7 B;  3NBI A;  1GM5 A;  1YNJ C;  2VUM G;  3BVZ A;  3HOX G;  1UE6 A;  2N8N A;  3Q8D A;  2ZT9 C;  1XMQ Q;  4KK7 A;  1UE5 A;  2K33 A;  1YEZ A;  5M5W B;  4RMF A;  3OW7 A;  3M4Q A;  2BDO A;  5EBD A;  2KCM A;  1X65 A;  4A3E H;  2RDF A;  1MI2 A;  4EQN A;  4DF7 A;  2F03 A;  1VF7 A;  2M00 A;  4FF1 A;  1JE4 A;  4XQJ A;  4MHE A;  1ZXT A;  2F3I A;  2F0P A;  4N9T A;  4B3M Q;  2XWB B;  3AQQ A;  3LGJ A;  3S2D H;  1QB5 D;  5BR8 Q;  1JMC A;  1S5B D;  5H1S E;  3G7L A;  1ENF A;  4HJ5 A;  2AKW B;  2PQA B;  4B3T Q;  3MXN B;  4H0L C;  3MVV A;  3S1M B;  2K28 A;  2IHF A;  3WOE A;  1X3G A;  1OXV A;  1I6H B;  3NTH A;  2O5J C;  1Y8O B;  4GLX A;  3I90 A;  4AQY L;  4CGY B;  1E3P A;  5JVH 3;  4DK6 C;  1OXU A;  4C3J H;  2K5Q A;  3EJI A;  3OWE B;  1YIJ A;  1EIF A;  1IHZ A;  2N3S A;  1HHV A;  4KKS A;  3NWS A;  1KDB A;  2F0I A;  1DOL A;  1K3R A;  4X66 L;  2KQ3 A;  1HNZ L;  4A3J H;  4H13 C;  2QIL A;  1B8A A;  4FDB A;  4JVZ A;  4WOR A;  3OMC A;  1Q86 C;  2K7V A;  4GLA C;  2FXQ A;  3OTO Q;  4L5R C;  2H5X A;  3A8I E;  2EYM A;  5EGT A;  2EXD A;  4MIU A;  1WD1 A;  1TQO A;  2YV5 A;  1Y8N B;  1WCM H;  3FHW A;  1TWF B;  3A7A B;  1C7Y A;  1HR0 Q;  1SNQ A;  3T16 A;  1G2S A;  3I70 A;  3ND8 A;  1PYS B;  3ND9 A;  2K6A A;  2VB2 X;  4A3C H;  2NVX B;  3FKI H;  3NUC A;  2Z1C A;  1GHJ A;  1UWV A;  1H9J A;  1ESF A;  2HQL A;  3CW2 C;  2R93 B;  2C35 B;  4LUO A;  1AN8 A;  1HUM A;  5GAD C;  2L4N A;  1PH2 A;  1NJI C;  2JN4 A;  2MUY A;  3H94 A;  4GOP C;  5JPM C;  1QVF A;  3L7Z C;  1I94 Q;  1CI3 M;  4R4T A;  1VQL A;  4K5X A;  4DV5 Q;  1SBB B;  1XTC D;  4M8A A;  3K5N A;  2PNH A;  4X65 L;  2Z0S A;  1J5E Q;  2MHV A;  3PIP A;  2X69 A;  1D7Q A;  5CV4 A;  1EU4 A;  4DR5 Q;  4YHH L;  1V43 A;  5TSS A;  5IYD G;  1OO9 B;  1JOR A;  4OXP A;  1B44 D;  5JEA G;  2B39 A;  4ZQ3 A;  1CK1 A;  3GV6 A;  4ME5 A;  1STE A;  1KD1 C;  3SK8 A;  1SFO H;  4QCL A;  5IWA L;  4O0A A;  3CQZ H;  1EY8 A;  2PZT A;  2R93 G;  1S72 A;  3RLO A;  2SNS A;  4LF4 L;  1E2Z A;  1PTO D;  1NE3 A;  2N55 A;  3RD4 A;  2MO0 A;  2PZU A;  2Z4I A;  1TS4 A;  2NZ1 D;  3DMU A;  1EWC A;  4XDX A;  4A93 H;  3BDO A;  3X3N A;  1B1Z A;  4RKL A;  1M1K C;  2IJ0 A;  3HOW H;  2LY7 A;  2HT1 A;  1Y1V H;  3KJO A;  2VQE Q;  2E75 C;  3VYR A;  2CW0 C;  1ROD A;  3H0G H;  5IE8 A;  1LTI D;  1HA5 A;  2OT2 A;  5IYB H;  4A3B H;  1LT3 D;  3PUY A;  1F2L A;  5A2Q E;  3K7A B;  3S1Q B;  3I4M B;  3D4R A;  1E22 A;  1LM0 A;  1SLJ A;  2QGQ A;  3UI2 A;  2UUC Q;  1YI2 A;  3DWP A;  3KFU A;  4GN5 A;  4HN7 A;  4DV4 Q;  1PFN A;  1YNJ D;  4NP5 A;  3H3V C;  4X3S A;  3SHL A;  1X56 A;  3IKJ A;  4DR1 Q;  3I4N B;  4FXK C;  3QOJ A;  1D6E C;  2FHT A;  1YHA A;  4Q5V A;  2DJF C;  3PIO 3;  2CKZ B;  4RGT A;  4DUY L;  1L0X B;  3HOX H;  2NWG A;  1KNE A;  3K7U C;  4DAY B;  1VQN A;  3VR3 A;  3GTJ H;  1IW7 C;  1IKL A;  5HUR A;  2E5L Q;  1WFQ A;  4GOP A;  2NVT H;  4PQX A;  1S5F D;  4LFB Q;  2KEN A;  3I4M G;  4JI1 Q;  5C3X A;  1PYW D;  3ZYY X;  2B3G A;  1MSH A;  4C1N I;  1TWG H;  4HR7 B;  4XYQ A;  1HFG A;  1VS0 A;  1K83 H;  5LMU L;  1D5M C;  1JB3 A;  1EOV A;  3EVQ A;  1S5D D;  1YZ6 A;  2WII B;  4P75 A;  1EYG A;  4HJA A;  1EWH A;  4X62 Q;  2VB3 X;  1EYA A;  1ZKO A;  3I4N G;  2BOS A;  2AWN A;  1IYJ B;  3HEJ A;  5KEE A;  4NXM L;  5ELD A;  3TBI B;  5GRO A;  1X6O A;  4KTA A;  2Q8I B;  4B3M L;  3C46 A;  3K5M A;  2M2L A;  1Y8P B;  3QOL A;  5EPL A;  2QW7 A;  5E3F A;  4R4Q A;  4YWM A;  5C6A A;  1WJJ A;  3S16 B;  2I5M X;  4K0K Q;  4YCU A;  5M5W H;  4ZK9 B;  1MKH A;  1PRT F;  1LLR D;  4XT3 B;  1QUQ A;  2G9H D;  4B3T L;  1YBY A;  4IUV A;  1AH9 A;  2F0S A;  5KNB A;  2B2T C;  3J81 c;  1K9M C;  4A3K B;  4DV1 Q;  2EJM A;  3OHX C;  1IYV A;  2E2H B;  2EE1 A;  1SXT A;  1ASZ A;  4ZAI A;  4MTN A;  4QL5 A;  1PLF A;  4OHJ A;  4A3F B;  1E0B A;  5C4J H;  4RG1 A;  4K14 A;  2F0L A;  2R7D A;  4GKK Q;  3C2P A;  4FF4 A;  1SYC A;  2BA1 A;  3S1M H;  1XMO Q;  2K05 A;  4KI0 A;  1H9M A;  4QF4 A;  1I6H H;  5A2Q L;  4DPG A;  2VXW A;  2K5H A;  3CF5 A;  2KBN A;  5DEH A;  3S14 H;  2B2W A;  3K58 A;  2KVM A;  4NW2 A;  1SRO A;  2DJG C;  3TP5 A;  3BS1 A;  2NVQ B;  3ER0 A;  1SMX A;  2VZA A;  1Q8K A;  4H44 C;  2F0G A;  3N6R A;  4KD4 A;  3I7F A;  4CJ0 B;  1BCP F;  1T9H A;  1FNU A;  4JPB W;  3Q24 A;  4A3K G;  5JOB A;  4B3R Q;  4G7H C;  5IYD H;  4DV5 L;  5CV5 A;  1EY0 A;  1PYB A;  3MFG A;  1Q8I A;  5ELE A;  1TWF H;  2WIN B;  4CDC C;  1TII D;  2MNA A;  4A3F G;  1WVL A;  1J5E L;  3TSS A;  1AZP A;  2CFM A;  3HZX A;  1S40 A;  1Y69 U;  4LF9 Q;  1F77 A;  1GD7 A;  2NVX H;  4C3I B;  4TKO B;  1YNX A;  4ZCK A;  1JJC B;  2A19 A;  1LTR D;  4DR5 L;  1NNX A;  2R93 H;  4RH6 A;  1XNQ L;  4DAV A;  3FEW X;  3P1H A;  4LF5 L;  5JJL A;  2VW9 A;  2QEJ C;  2SEB D;  4PG3 A;  2Z9H A;  5FK9 C;  2DN8 A;  4JBM A;  5BN5 A;  4N9P A;  4CDE C;  1SJH D;  2F0W A;  3BJU A;  3NSW A;  4XIG S;  3ERO A;  4MZ9 A;  1WOC A;  2FFK B;  3SE0 A;  4HSV A;  4IFD J;  3JAM c;  5IT9 L;  3BYT B;  1QE6 A;  1V1P A;  2FMM A;  3J7A 5;  3G48 A;  1A63 A;  1WTP A;  3WOF A;  4X3T A;  4BWG B;  1F9R A;  2Z6B A;  4I7A A;  1VQM A;  1N36 L;  1MIU A;  2H1E A;  2EYO A;  3ULP A;  1CUK A;  2GN5 A;  4IUN A;  3LX0 A;  1KDC A;  2DUD A;  3LWU A;  3GTP B;  1A3V A;  4CJ1 B;  2PI2 A;  4C3I G;  4EGV A;  3K80 C;  3PGZ A;  5D3D A;  3PIP 3;  4IPH A;  1VQ7 A;  2EIF A;  1YJW A;  2B2T A;  2JA6 G;  1QIL A;  2B63 B;  3MAQ A;  5M5X H;  2XVS A;  5M3F B;  2BH2 A;  3RN5 A;  2F0D A;  4K2K A;  1YHQ A;  4HMI A;  5CV7 A;  1IW7 D;  1VQG A;  2JSO A;  1TWH B;  2DY8 A;  3F2B A;  3U50 C;  2UUC L;  3Q0A A;  4AQY Q;  1HCZ A;  2A73 B;  1U0L A;  1XXG A;  4DGZ A;  4DV4 L;  1X55 A;  1PH4 A;  3KLS A;  1BQQ T;  2QDB A;  1SE3 A;  4IQZ A;  3VR5 A;  4KHP L;  4KJN A;  3NEM A;  1PFS A;  1B3A A;  2GVB A;  1TWC B;  2E2D C;  1F9Q A;  3PO2 B;  3J7A F;  2Q2H A;  4APV A;  4JI7 L;  3K7A H;  1SAP A;  2B29 A;  3DM3 A;  3S1Q H;  2L0C A;  3I4M H;  5IP7 H;  4O2D A;  3J7Z C;  4IOC A;  1BNZ A;  2B63 G;  5EAY A;  1B9M A;  1Q46 A;  5M3F G;  4L5T A;  2X6L A;  4I65 A;  3S1N H;  4DU9 A;  2NVY B;  5EPK A;  3M4O B;  3TN2 A;  4E6I A;  4KD3 A;  3I4N H;  3SDZ A;  4BS9 A;  1S5E D;  5LMN L;  2PW7 A;  3A7L A;  1SEB D;  2GVA A;  4DAP A;  1P16 A;  1HRJ A;  1VQH A;  3BDL A;  5ELN A;  4X65 Q;  2A8V A;  3M9B A;  3NXW A;  1HNW Q;  2ALY B;  4GN3 B;  2VL6 A;  1WTX A;  4ULL A;  3TP6 A;  1CHP D;  3PO2 G;  5CBE E;  5HGT A;  4NKL A;  4OEL B;  1WTQ A;  4YHH Q;  1I4P A;  1LTL A;  5JVG 3;  4A3L H;  3ZJY C;  1N33 L;  4BXX G;  4GNX B;  5EQ0 A;  1U9R A;  4K0K L;  1X3E A;  1BBW A;  1H9S B;  2A6E D;  1LT5 D;  3ITP A;  2NYZ D;  1LAC A;  1N34 L;  4UP8 A;  3TZD A;  1MJC A;  4HJ9 A;  3AU7 A;  3UE0 A;  1U4P A;  5D3I B;  2F0F A;  5C4X H;  2K50 A;  3K0X A;  2SOB A;  4DV1 L;  4C2M B;  3I2Z A;  4DR6 L;  3KDF B;  4DFA A;  1GUT A;  2KJX A;  2YYZ A;  2ICE C;  3C1E A;  2R92 B;  1S3O A;  4QB4 A;  1LT4 D;  1D5X C;  4KKU A;  2BCO A;  4WFN 3;  5HGQ A;  1I4Q A;  3CXC A;  1CQF A;  1BDO A;  3O13 A;  1DOK A;  5CBA E;  4L5S A;  1FYC A;  3MC0 B;  3UDG A;  1N9W A;  4A3K H;  1R9T H;  4JV5 Q;  2E2H H;  2R61 A;  3GQB A;  1CHQ D;  1O7L A;  4DXF A;  3CC4 A;  3EA6 A;  5D65 A;  2MPM A;  3KOJ A;  1PTO C;  2AMC B;  4UHV A;  4DV2 L;  3GTL H;  1A2T A;  1K73 C;  3EFX D;  1MHW C;  5C44 B;  1STA A;  2B2U C;  1DGS A;  2AUK A;  2F3V A;  2RF4 A;  4I7Z C;  4X64 Q;  4B3R L;  1NMG A;  3RUZ A;  4ODG A;  4HJ7 A;  1GHK A;  3PO3 B;  4P73 A;  2R92 G;  2MQH A;  1PRT C;  1EZ8 A;  1HTL D;  4F87 A;  5CC4 A;  2HCI A;  5DM6 3;  3BYY B;  4RCO A;  2KED A;  4A3D B;  1GUO A;  2HDM A;  3CP0 A;  3BZC A;  2A6H D;  1EFW A;  1SND A;  5JJZ A;  5CV6 A;  1VQJ A;  5GAG C;  4DV7 Q;  1GUN A;  5COR A;  3GTK B;  3HG9 A;  2VY3 A;  4OWX B;  1QJO A;  3DEO A;  2QA4 A;  2EZV A;  1EIH A;  2F4V L;  1C4Q A;  1K28 A;  4FO2 A;  4HID A;  5IP9 G;  4GZY C;  4QY7 A;  1TXY A;  1PH7 A;  5L37 A;  2YU9 B;  1QZH A;  4KN7 C;  5IGF A;  5BN4 A;  3VYS A;  4C3I H;  3PUX A;  2Y0S B;  2F0T A;  3HS0 C;  4ABN A;  5C44 G;  5LMU Q;  4JI2 L;  4J6H A;  1CA5 A;  4JYA L;  1SE2 A;  3OIQ A;  2IPK D;  3FPP A;  1IBL L;  2CQO A;  3KUP A;  3PO3 G;  1PFM A;  2K14 A;  4NXM Q;  2UXB Q;  4HSP A;  2XGT A;  1JT8 A;  2EY1 A;  4RGN A;  1V1O A;  4A3D G;  3RZD B;  3KF6 B;  3HOU B;  2RHQ B;  1U5K A;  4P2C B;  2JA5 H;  2CHB D;  1X3F A;  1CKO A;  1HNX L;  3N52 A;  4QQB X;  3UDX A;  2WAC A;  2OXP A;  1KIX A;  4CDF C;  2NUC A;  4EX5 A;  1HZB A;  2L12 A;  4QUC A;  1CKN A;  3I72 A;  5M9O A;  4Z9C B;  4YWK A;  3VR2 A;  3RNU A;  1K8M A;  3HP3 A;  3GTP H;  4BY7 B;  1F9S A;  3M4Y A;  4CKE A; 
#chains in the Genus database with same CATH homology
 4A76 A;  2Y0S G;  2E8G A;  3G4S A;  4DR1 Q;  3J81 j;  1M90 C;  3F2C A;  4POF A;  3NEN A;  1UE1 A;  1YHA A;  2YTV A;  1UEB A;  2B63 H;  2UXD L;  4UP7 A;  1I5F A;  2HIX A;  2CKZ B;  3EN2 A;  5M3F H;  1ASY A;  4DUY L;  3HOX H;  3T1Y Q;  3A74 A;  3S16 H;  5GAH C;  4DR3 L;  3GTQ H;  2JA9 A;  4GS3 A;  1PA6 A;  1QUQ B;  3RR5 A;  3VDY A;  3K7U C;  3HFZ B;  1OXX K;  4DAY B;  1BVS A;  4NXN Q;  1VQN A;  2ATW A;  2JEA I;  3GTJ H;  4LUZ A;  1E1O A;  1CSP A;  1Q1B A;  2D0O A;  2PMZ E;  1I3Q H;  1KC8 C;  4KLK A;  1OXT A;  5M5Y H;  3HOU G;  4WJ3 M;  2E5L Q;  1WFQ A;  2I5H A;  5C0X I;  4GOP A;  2NVT H;  3AEV A;  2Q2U A;  5E7N A;  2IX1 A;  3CPW A;  2JJQ A;  3RLN A;  4JI3 L;  3STB C;  4EQ5 A;  3CCL A;  2HHH L;  1KXL A;  3H15 A;  3W5O A;  4PZ6 A;  1IBK L;  4LFB Q;  2KEN A;  2NN6 I;  3I4M G;  4JI1 Q;  1D8L A;  2WAQ G;  2VQF Q;  2OTL A;  2ZJQ A;  3HOY H;  2B3G A;  4L5Q A;  2R6G A;  3CPF A;  3AYH B;  1TWG H;  4B3S L;  1TWC H;  2PQA A;  4DUZ Q;  1VS0 A;  3PO2 H;  4A3F H;  1K83 H;  3CCS A;  5LMU L;  1EOV A;  4YCV A;  1WI5 A;  1YZ6 A;  3BU2 A;  4BY7 G;  2K5N A;  4P75 A;  1EYG A;  4IO9 A;  2OWO A;  1SN8 A;  3L2P A;  4HJA A;  1AE3 A;  2JA8 G;  4X62 Q;  1BKB A;  1JE5 A;  1VQ4 A;  4JI4 L;  3I4N G;  2AWN A;  1IYJ B;  2HIV A;  4NXM L;  1E24 A;  1HNW L;  4LF8 Q;  1UE7 A;  4LF6 L;  1RIP A;  1X6O A;  2L15 A;  5GRO A;  1PH1 A;  4A3E G;  3MEF A;  4YWL A;  4KHZ A;  2VQE L;  5DLQ E;  1VQB A;  4A93 G;  3KDF A;  1L1O B;  4R4Q A;  4YWM A;  4JCV E;  3CCJ A;  1WJJ A;  2NVY H;  4DR2 L;  2ZM6 Q;  4PZ7 A;  4DV6 L;  3M4O H;  2V1C C;  3HOZ H;  2I5M X;  4K0K Q;  2LSS A;  4YCU A;  5M5W H;  3E0E A;  3B6Y A;  4JOI A;  2ES2 A;  1MKH A;  1XNQ Q;  2NVQ H;  3D31 A;  2I5L X;  4R4I A;  1QUQ A;  4B3T L;  4HIO A;  4LF5 Q;  1FVI A;  1YBY A;  1JB7 A;  2ASB A;  1YHB A;  1EIY B;  2N49 A;  3H0G G;  1AH9 A;  1X9N A;  2BH8 A;  3CAM A;  2E2J H;  2R7Z G;  3J81 c;  1MJE A;  2JA5 G;  1K9M C;  4LF7 Q;  4AH6 A;  4DV1 Q;  5FLM H;  2Z6K A;  3CC2 A;  2JA7 H;  4IPD A;  4OO1 G;  1GO3 E;  4BBR H;  4JOI C;  3PUW A;  1ASZ A;  1HR0 W;  4X66 Q;  4MTN A;  4DR1 L;  1HNZ Q;  4R4C A;  4QL5 A;  3AFP A;  5AJ3 Q;  3I56 A;  4OX9 Q;  1K0R A;  1VCI A;  5C4J H;  1VQA A;  4LUV A;  1NY4 A;  4BA2 I;  4P74 A;  4RG1 A;  1PH8 A;  1N36 Q;  3GO5 A;  3TS2 A;  3AFQ A;  2R7D A;  4GKK Q;  1H95 A;  2BA1 A;  3S1M H;  1XMO Q;  2KHJ A;  2JA6 H;  4KI0 A;  1XPO A;  2VNU D;  1G51 A;  4NXN L;  4LFA L;  4A3G H;  3PF4 A;  1XPU A;  2CWA A;  2K4K A;  1I6H H;  4DNI A;  1VQ9 A;  1KRT A;  4A3J G;  1OTC A;  2ZJP A;  4DPG A;  2K5H A;  3CF5 A;  2KBN A;  4Y7N H;  2E5L L;  1QVG A;  1G29 1;  3S14 H;  1PH5 A;  4BY1 G;  1SRO A;  3T1H Q;  4C2M H;  3PF5 A;  4JV5 L;  3UDI A;  4LFB L;  4P71 A;  1VQF A;  4JI1 L;  2UUA Q;  5FJ8 G;  1GVP A;  3HOV G;  4DV3 Q;  3ER0 A;  1SMX A;  2VZA A;  4AYB E;  2R92 H;  1WCM G;  1Q8K A;  2MFI A;  1EWI A;  1PHJ A;  4DUZ L;  2WB1 G;  1NTG A;  3I7F A;  3K8A A;  1FJG Q;  2OTJ A;  3CC7 A;  1T9H A;  4A3M G;  4A3K G;  3RN2 A;  2I0Q A;  3A5U A;  4B3R Q;  5IYD H;  2UU9 Q;  4R1J A;  2CWP A;  3FKI G;  1L1O C;  4DV5 L;  4JI5 Q;  4X62 L;  3HOY G;  3S2H H;  2Y0S E;  1HZA A;  4ALP A;  1PYB A;  1IBM Q;  3TRE A;  4X64 L;  1J5E L;  1TWF H;  3FP9 A;  4A3F G;  2MNA A;  5J3B A;  2UUB L;  4KHP Q;  2CFM A;  1S40 A;  4LF9 Q;  4GLV B;  2CCZ A;  1GD7 A;  1KQS A;  2NVX H;  3HKZ G;  1SR3 A;  3M85 A;  1YNX A;  1JJC B;  2A19 A;  4B3M L;  5C3E H;  3F1Z A;  4DR5 L;  4JI7 Q;  5IP9 H;  2R93 H;  4XTC S;  3D0F A;  2VUM H;  1XNQ L;  1YJN A;  1J6Q A;  2WFW A;  3DLL A;  1LUZ A;  3A0J A;  4JBJ A;  3CMA A;  1EUJ A;  4LF5 L;  2UXC L;  2VW9 A;  4HIM A;  5JJL A;  5HY6 A;  4DV7 L;  1NBW A;  4PG3 A;  4H02 A;  5C44 H;  4JI6 Q;  4JBM A;  4LNQ A;  4TVA B;  5IWA Q;  1TWH H;  4LF7 L;  4OON A;  1CSQ A;  3ULL A;  3BJU A;  4XIG S;  2OQ0 A;  1HJP A;  2WAQ E;  4AIM A;  1PH6 A;  1VQ5 A;  4MZ9 A;  1WOC A;  3KF6 A;  3PO3 H;  4LF4 Q;  4IFD J;  3PIO A;  3JAM c;  3U58 A;  3RZO H;  3CCV A;  1Y1W H;  3TQY A;  3G48 A;  3J7A 5;  1A63 A;  4DR7 Q;  5LMN Q;  5AJ3 L;  1VQE A;  2PI2 E;  2ZJR A;  4A3D H;  4YY3 Q;  3H3V H;  2R7F A;  4JG2 A;  5FLM G;  3UE1 A;  4DV0 L;  1VQM A;  2BA0 A;  1Q81 C;  1MIU A;  3GD7 A;  3ULP A;  1N36 L;  2JA7 G;  2WP8 J;  4A4I A;  4GKK L;  1AE2 A;  1LYL A;  1KAW A;  4BBR G;  1YJ9 A;  1CUK A;  5JJI A;  2GN5 A;  1QVC A;  1XMO L;  4MNO A;  2DUD A;  3GTK H;  4BXX H;  4DK3 C;  1BBU A;  4POG A;  2PI2 A;  3EIV A;  3GTO H;  3K80 C;  3PGZ A;  3EBE A;  2UXB L;  2RCN A;  1VQK A;  3M7N A;  3CCM A;  3ERS X;  1RL2 A;  4IPH A;  3OYY A;  4OWT B;  1VQP A;  2AHO B;  1VQ7 A;  2EIF A;  1YJW A;  2JA6 G;  1QZG A;  3JAM i;  3U4Z A;  1N33 Q;  5M5X H;  2UUA L;  2BH2 A;  1V9P A;  5GAE C;  5IT9 c;  5C0X G;  4DV3 L;  3RN5 A;  2ZTD A;  4BBS G;  3HOW G;  4QJF A;  1TWA H;  5GQO A;  3SGI A;  1K8A C;  4DR4 Q;  3KLW A;  1YHQ A;  1K8G A;  2NZH A;  1Y1V G;  2N78 A;  3CCR A;  5M3M H;  1JJG A;  2NN6 G;  1N34 Q;  5K36 G;  1VQG A;  4JI8 Q;  1C0A A;  3F2B A;  2KCT A;  3U50 C;  4LFC L;  5IYB G;  2UU9 L;  2UUC L;  4AQY Q;  4A3B G;  4IOA A;  1U0L A;  1Z9F A;  2QEX A;  4IFD I;  3STB D;  5IYC G;  4IJL A;  1X55 A;  3W1G A;  4DV4 L;  1PH4 A;  1IBM L;  3WWV A;  4DR6 Q;  2JK8 A;  3UDF A;  1XJV A;  5FLX c;  2JQO A;  3RZD H;  1PH3 A;  4KHP L;  1N32 Q;  2F52 A;  2JE6 I;  4LF9 L;  2UXD Q;  3NEM A;  1PFS A;  1Y14 B;  3HOU H;  1YIT A;  2GVB A;  4BA1 I;  2A1A A;  4DUY Q;  4IJH A;  2Q2H A;  4APV A;  4JI7 L;  3K7A H;  4LWC A;  3RLF A;  1VQ6 A;  4A3I G;  2B29 A;  4NPS A;  3DM3 A;  3H3V I;  3S1Q H;  3T1Y L;  3I4M H;  5IP7 H;  1HZC A;  1EQR A;  1CKN B;  3CME A;  4O2D A;  3PSI A;  3J7Z C;  4IOC A;  2NZO A;  2YTY A;  1A62 A;  1O7I A;  2B63 G;  1VQO A;  3J81 i;  5EAY A;  2HHH Q;  1GM5 A;  1IBK Q;  4BY7 H;  1Q46 A;  5M3F G;  4L5T A;  3HOX G;  2VUM G;  1IZ6 A;  3PUV A;  3S1N H;  2XTI A;  1UE6 A;  2N8N A;  4UPA A;  2JA8 H;  3L0O A;  3Q8D A;  1L1O A;  1XMQ Q;  4P72 A;  1Q7Y C;  4B3S Q;  2WB1 E;  3I4N H;  1UE5 A;  1YEZ A;  4RMF A;  3M4Q A;  1CKM A;  4DR7 L;  2VQF L;  5LMN L;  2KCM A;  1X65 A;  3GDE A;  4A3E H;  4DV2 Q;  2GVA A;  3NEL A;  4YY3 L;  4WJ4 A;  1P16 A;  1I50 H;  1VQH A;  4J15 A;  1PH9 A;  5ELN A;  4X65 Q;  1GKH A;  1B7Y B;  3KF8 B;  3M9B A;  2A8V A;  3S24 A;  1Y1W G;  1IL2 A;  2F3I A;  1HNW Q;  4B3M Q;  2ALY B;  2KHI A;  2VL6 A;  4GN3 B;  4GOP B;  1N8R C;  3AQQ A;  3IRB A;  3LGJ A;  3S2D H;  3HKZ E;  4PMW A;  3PO2 G;  4LF8 L;  4DV6 Q;  1Q1E A;  5BR8 Q;  1JMC A;  4NB3 A;  1L0W A;  5H1S E;  4YHH Q;  2R7Z H;  1G6P A;  1HZ9 A;  2IX0 A;  1LTL A;  4A3L H;  4QGU A;  3ZJY C;  1X54 A;  4HJ5 A;  1N33 L;  1XNR Q;  2AKW B;  5JEA J;  2PQA B;  2ZM6 L;  4GNX B;  4BXX G;  1FGU A;  4UP9 A;  4B3T Q;  3MXN B;  4K0K L;  2D0P A;  1X3E A;  4AYB G;  1BBW A;  2IHF A;  2DGY A;  4IPC A;  1X3G A;  1OXV A;  4UP8 A;  1MJC A;  4HJ9 A;  4JI8 L;  1N34 L;  2ZTE A;  2F4V Q;  1W2B A;  3A5Z B;  4LW1 A;  3UE0 A;  4GLX A;  1PVO A;  1YVC A;  3HOZ G;  1A0I A;  4AQY L;  5C4X H;  1E3P A;  3PCO B;  4IPG A;  4DK6 C;  1OXU A;  2K50 A;  2LXK A;  3K0X A;  4C3J H;  4DV1 L;  1YIJ A;  1VQD A;  1EIF A;  3I2Z A;  2N3S A;  4DR6 L;  3BZK A;  3KDF B;  3E9I A;  5M3M G;  2Q2T A;  3ICE A;  1N32 L;  1K3R A;  4X66 L;  2YYZ A;  1W3S A;  4A3J H;  1HNZ L;  1NMF A;  1S3O A;  1VQ8 A;  1B8A A;  4JI2 Q;  4OX9 L;  4FDB A;  1Q86 C;  4JYA Q;  1Q82 C;  5HGQ A;  4GLA C;  2FXQ A;  3OTO Q;  4BY1 H;  4L5R C;  3CCE A;  3OW2 A;  3CXC A;  4LFA Q;  2K75 A;  2VS1 A;  2H5X A;  1IBL Q;  2E2I H;  2EXD A;  4YCW A;  5FJ8 H;  3HOV H;  3GTG H;  2YV5 A;  1KRS A;  1EQQ A;  1WCM H;  4GKJ Q;  2JEB I;  3FHW A;  4L5S A;  1C7Y A;  3UDG A;  1OXS C;  1HR0 Q;  1N9W A;  4A3K H;  4A3M H;  3J80 c;  1R9T H;  4JV5 Q;  2E2H H;  3M3Y H;  1PYS B;  3W1B A;  1VQC A;  4JI0 Q;  4HIK A;  4A3C H;  3FKI H;  5IP7 G;  1B70 B;  3I4O A;  1UWV A;  2HQL A;  4ME3 A;  3CC4 A;  3T1H L;  4R4O A;  3F8T A;  3CW2 C;  1XMQ L;  2YU9 H;  1HNX Q;  2C35 B;  3KOJ A;  4LUO A;  4GNX A;  3GTM H;  4A3G G;  5GAD C;  2AMC B;  1PH2 A;  1NJI C;  2YTX A;  4GOP C;  1QVF A;  4DV2 L;  3L7Z C;  3GTL H;  4OO1 I;  1K73 C;  1I94 Q;  2D62 A;  4R4T A;  1VQL A;  1FJG L;  4DV5 Q;  5IY0 A;  3PV0 A;  1JJ2 A;  4X6A H;  1FL0 A;  1E7Z A;  2PNH A;  1IXR A;  1DGS A;  4X65 L;  2RF4 A;  4B3R L;  2Z0S A;  3M4P A;  4X64 Q;  1NMG A;  1J5E Q;  3PIP A;  3U4V A;  4JI5 L;  2UUB Q;  4HJ7 A;  4GNX C;  4P73 A;  2R92 G;  1D7Q A;  2MQH A;  3J80 i;  2RHS B;  4DKA C;  3K81 C;  5ELO A;  2OQK A;  1XPR A;  5BR8 L;  3S17 H;  2Q2I A;  4DR5 Q;  4DAM A;  4YHH L;  1V43 A;  5IYD G;  1E1T A;  3CP0 A;  3BZC A;  1EFW A;  1XNR L;  4DR3 Q;  4OXP A;  5LMN W;  4A75 A;  1VQJ A;  2UXC Q;  3I55 A;  5JEA G;  5GAG C;  4DV7 Q;  3TS0 A;  4QIW E;  3F2D A;  2VY3 A;  4OWX B;  2QA4 A;  1A8V A;  2MO1 A;  2F4V L;  1KD1 C;  1SRU A;  4A3L G;  2IY5 B;  1SFO H;  4UY8 C;  5C3E G;  2OCE A;  3HKS A;  4JC0 A;  4JI6 L;  4HID A;  3E9H A;  4JI3 Q;  5IP9 G;  5IWA L;  1V1Q A;  3CQZ H;  4O0A A;  4QY7 A;  3JC6 6;  2R93 G;  1S72 A;  3RLO A;  1TXY A;  1Z47 A;  4HJ8 A;  3G71 A;  1PH7 A;  1PV4 A;  1QZH A;  2EQS A;  4LF4 L;  1NE3 A;  3CCU A;  3TRZ A;  4C3I H;  3CCQ A;  2K52 A;  3PUX A;  2MO0 A;  5C44 G;  4DV0 Q;  3TEH B;  5LMU Q;  4IFD G;  1HH2 P;  4JI2 L;  5C4X G;  2ZTC A;  4JYA L;  1KL9 A;  4TQU S;  1P8L A;  4JBW A;  2Z6K C;  3OTO L;  4A93 H;  3PUZ A;  1Q12 A;  1IBL L;  2K5V A;  1WYD A;  2CQO A;  4PZ8 A;  3PO3 G;  4JI4 Q;  1SE8 A;  2K14 A;  2ID0 A;  1M1K C;  4Y52 H;  4BBS H;  4NXM Q;  3HOW H;  2UXB Q;  4GKJ L;  2XGT A;  4LF6 Q;  1JT8 A;  2HT1 A;  1Y1V H;  3KJO A;  4A3D G;  2VQE Q;  1HR0 L;  3CD6 A;  5JJK A;  3KF6 B;  3S1R H;  5C0X J;  4DR2 Q;  1XTD A;  3H0G H;  4JI0 L;  2RHQ B;  5IE8 A;  5IYB H;  3KYH C;  1U5K A;  2AWO A;  4A3B H;  2JA5 H;  1X3F A;  1CKO A;  3G6E A;  3PUY A;  5IYC H;  1HNX L;  1KHI A;  4QQB X;  3UDX A;  4GN4 B;  2LXJ A;  1E22 A;  2IT1 A;  3KJP A;  1KIX A;  4DR4 L;  1LM0 A;  1SLJ A;  2QGQ A;  4A3C G;  2UUC Q;  4EX5 A;  1YI2 A;  1HZB A;  1I94 L;  4LFC Q;  4C3H H;  1CKN A;  4YWK A;  4JBK A;  3RNU A;  3KFU A;  4GN5 A;  1L2F A;  4DV4 Q;  3NBH B;  1VQI A;  4A3I H;  4OWW B;  3GTP H;  3S15 H;  1X56 A;  3ULJ A;  2IHE A;  1C9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...