3FHWA

Crystal structure of the protein prib from bordetella parapertussis. northeast structural genomics consortium target bpr162.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
100
Chain Sequence
b'MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of the protein priB from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR162.
rcsb
source organism Bordetella parapertussis
molecule tags Dna binding protein
total genus 15
structure length 100
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fhwA00
1X6OA 2NZOA 3K7UC 3HOYH 1TWGH 1DGSA 1GO3E 3I4MG 4AYBG 3HOZG 1Q86C 4DV7Q 3PO2G 4IFDI 3PO3H 1YHAA 3D31A 3E9HA 3CCQA 4IOAA 1X3EA 2CWPA 1XJVA 4A3KH 3PUXA 3J81c 3M85A 1XPRA 1W2BA 2Q2UA 4X66L 5IWAQ 3F2DA 4BBSG 2LXKA 3OW2A 4MNOA 2AMCB 1LYLA 1LM0A 1YHQA 4IOCA 1RIPA 1UE6A 2PMZE 3BJUA 1WCMG 1MJEA 4DR3Q 3HOUH 3MXNB 2PI2E 1Z9FA 2N49A 1KQSA 2IHEA 3M4PA 1J5EQ 4LF8Q 2BH2A 1B8AA 4LFBQ 1JB7A 4DV4Q 2GN5A 4P73A 3RZOH 2KBNA 4A3CH 2VNUD 1HZBA 2Z6KC 3CMAA 4DV2Q 2VQFL 2A19A 2UUAL 2D0PA 2RF4A 1EIFA 3CAMA 1JT8A 5IYBG 1K3RA 1KRSA 1VQFA 1WFQA 2FXQA 3D0FA 2JA5G 2WB1E 1AE3A 3CXCA 2HT1A 2GVAA 2JQOA 5M5YH 3EIVA 2E5LL 3L0OA 1SMXA 5IYCH 1HZAA 4YWMA 5IP9G 2UUCQ 1HR0W 4UP9A 2ZM6L 1HR0L 5DLQE 2JE6I 2YTXA 4DV0L 3H15A 4X62L 1VQAA 3FKIG 4LF4L 1HNZQ 2NN6G 5GAGC 4JOIC 3CCMA 3T1HL 1U5KA 1XPUA 1GVPA 1WJJA 3GTOH 1CKOA 3AQQA 4BY1G 2UUBL 1LTLA 1E3PA 3HKZG 1K0RA 2ZTDA 4BA2I 1VQCA 3G4SA 3CP0A 1VQBA 1IBKQ 2MO0A 4GKJQ 3HFZB 2HIXA 2F4VQ 4LFAL 3A5UA 1VQPA 2CFMA 4P72A 2Q2IA 4LF6L 1KL9A 1X3GA 5IWAL 1OXVA 3S2HH 1EUJA 3PF4A 3GTPH 3DM3A 1XTDA 2XTIA 4AIMA 2R7FA 2XGTA 1KC8C 4XIGS 2VL6A 2BH8A 1M1KC 3ZJYC 3L2PA 1QUQA 3CCEA 1N33Q 4A3DH 5ELNA 1CSQA 2B63H 1PH9A 4LF8L 1Y1VG 2N78A 4LFBL 5IYDH 5M3MG 4DV4L 4ALPA 2PNHA 3STBD 3H3VI 3CC7A 2CKZB 4DV2L 4KI0A 4DV3L 1I6HH 2D0OA 2JA8G 2MO1A 4IFDJ 3CCSA 3TQYA 4B3TL 3S2DH 3J81i 1EYGA 1N8RC 1WOCA 4X66Q 3CW2C 1PH3A 4LF9L 1FL0A 4AQYQ 4NXNQ 2R92H 4A3BH 4A3EH 5GROA 3M4QA 4A3GG 4A3IH 2MFIA 3KLWA 2UXCQ 3A0JA 1VQOA 1LUZA 3DLLA 1HNWL 2IX0A 4JI1L 3HOWH 3HOVH 5FLXc 1VQGA 3CPFA 5C4XH 2AWOA 4GOPA 5K36G 4TVAB 3CCUA 3J7A5 2LSSA 4BBRH 5FLMG 2WAQG 1PYBA 3S24A 5FJ8H 1YBYA 4EX5A 2RCNA 4A3JH 1VCIA 1K83H 4HIDA 2ES2A 1TXYA 4HIMA 4LF5L 1GKHA 1VQ9A 2NVTH 4L5SA 3K7AH 2Z0SA 2VQFQ 4LUZA 4QJFA 1VQ4A 2UUAQ 5E7NA 1S3OA 3CCVA 4PG3A 4IPDA 3H3VH 3F1ZA 1E22A 1IBMQ 2R7DA 1N32L 5LMUL 1IBKL 5AJ3Q 1V43A 1BBUA 1UE1A 3HOXH 4JI7Q 4OX9Q 2E5LQ 2F4VL 5IT9c 1V9PA 4A3MG 1EFWA 2ZM6Q 2E2HH 1SLJA 2UU9Q 3A5ZB 2VW9A 4DUZQ 1YZ6A 1JJ2A 1SFOH 2OQ0A 4DV0Q 1Q82C 1YNXA 2ATWA 4LFCL 5C3EG 3JAMc 1Q1EA 3UDIA 1FGUA 4MZ9A 3U4ZA 3S17H 3UDXA 4QIWE 3UE1A 3PUWA 4YHHQ 4BA1I 4C3IH 4EQ5A 1E7ZA 1VQJA 2Y0SE 2ZTCA 5HGQA 1K9MC 4Y52H 1WCMH 1NMGA 3CQZH 4YWKA 2NN6I 3JC66 4UP8A 5C0XJ 3ULPA 1Q81C 2UUBQ 1Q1BA 1FVIA 4QGUA 1ASZA 2C35B 3CMEA 4DK6C 4H02A 1PH1A 1V1QA 4A93G 1PFSA 3PUVA 4YCWA 2ZJPA 1X55A 4K0KQ 2F52A 2ZTEA 4LFAQ 1YJ9A 1O7IA 4LF6Q 3KYHC 1MJCA 4GLAC 2CCZA 3CCLA 3CC4A 4AQYL 4A3LG 4NXNL 3BU2A 4HIKA 4C3HH 1VQ6A 2NVXH 3S1QH 2RHQB 2CQOA 2JA5H 1XNQQ 4DR6L 1CSPA 2ALYB 2NZHA 2VUMG 3RR5A 1NTGA 2WP8J 3H0GG 3S1NH 5IP9H 1X3FA 4JI8L 2K5HA 5BR8L 3W5OA 1IL2A 2EIFA 1NE3A 2N8NA 3KDFA 2E8GA 4DR5Q 1QVGA 1PH8A 3GO5A 4DV3Q 5M5WH 4GS3A 1EIYB 1I3QH 1UE5A 1YHBA 3ERSX 5C44G 2VQEL 4B3SQ 4JBWA 3M4OH 4B3TQ 3BZCA 4RMFA 4YCVA 4HJ5A 1IBML 4A3FH 4B3RL 5IY0A 4BY1H 4LF9Q 4JI2Q 2UXBQ 5AJ3L 2EQSA 4JI7L 4HIOA 4OX9L 1N9WA 2L15A 1C9OA 4C2MH 3RNUA 3HOYG 4YWLA 2F3IA 1HNWQ 4JI1Q 2UU9L 4JYAQ 1KHIA 4DUZL 4DR2L 3ICEA 4JBKA 1VQNA 3PO3G 2R93H 4QQBX 2K5VA 1S40A 1CUKA 4X64Q 4A3KG 2Q2HA 1YJWA 4YHHL 4WJ4A 3FP9A 2Q2TA 1OTCA 4DR7Q 5GAHC 4LF5Q 4JI5L 4HJ9A 3K80C 1SROA 2YTYA 4UY8C 4IO9A 4A75A 3M7NA 4R1JA 1JJCB 2AWNA 4OWTB 4IJHA 2VS1A 1N32Q 1L0WA 3TEHB 5LMUQ 4HJ7A 3S16H 1Y1VH 1X9NA 4GN5A 4K0KL 3G48A 1UWVA 2OTJA 3T1YL 4JI3L 2VZAA 4DPGA 3GD7A 4A3CG 2JA8H 1QUQB 4LF7L 1Q46A 3LGJA 1XNQL 4LFCQ 1OXXK 3PSIA 4LNQA 4IPGA 3JAMi 3S1MH 3AYHB 1PVOA 5GADC 4BY7H 1EOVA 1PH4A 4OO1G 1VQKA 4DKAC 5JEAG 4UP7A 4B3RQ 5JJIA 1HZCA 4LUVA 3J81j 1L1OA 4HJ8A 5IYCG 2K14A 3KJPA 4P71A 1X54A 4DAMA 2YV5A 1D8LA 1KRTA 1C0AA 4JCVE 3PUYA 4DR5L 4GKKQ 2PQAA 2JEBI 4GN3B 2JJQA 2KCTA 3KF6A 1KD1C 4B3SL 4B3MQ 1XMOQ 2LXJA 4YY3L 4LW1A 4TQUS 4R4QA 1KAWA 1SR3A 4JI2L 2ASBA 3GTLH 2MNAA 4GOPC 1D7QA 4GOPB 1B70B 4DR6Q 2AHOB 2R7ZG 1Z47A 4JYAL 1PV4A 4OWWB 1X65A 3KJOA 4JV5Q 4IPCA 4JI8Q 1TWHH 4X64L 2K52A 5J3BA 5BR8Q 1AH9A 1E1TA 4QL5A 1Y1WG 3I4NG 4GLVB 4DR7L 4WJ3M 1HJPA 3UDGA 4X65L 4RG1A 1Q12A 1G291 3W1BA 4GKKL 1TWCH 1TWAH 3PGZA 2VQEQ 1A8VA 4JBJA 2OWOA 3SGIA 3PIPA 3GTGH 4NXML 2E2IH 4KHZA 1R9TH 2IT1A 3I55A 2I5HA 1VQLA 1A62A 1VQMA 2HIVA 3CF5A 3I4MH 4LWCA 3HOZH 2IHFA 3EBEA 2N3SA 3M3YH 3PO2H 1GD7A 1I50H 5C0XG 2B29A 1QVCA 4DR2Q 2A1AA 4IJLA 4BXXG 1HH2P 4BBSH 1VQDA 3J80c 1N36L 4A3LH 1MIUA 1UEBA 1BVSA 1CKNA 4A3BG 1Q8KA 1PYSB 3MEFA 1OXUA 4MTNA 4DAYB 2ZJRA 3E9IA 5M3FG 3ULJA 4DV1Q 4DV5L 4KLKA 3G71A 1C7YA 4JI5Q 2A8VA 2IY5B 1XPOA 5EAYA 1YEZA 3H0GH 4A4IA 2JK8A 3S14H 3KF8B 3F8TA 4DUYQ 2JA7G 5C4XG 2I5MX 5C4JH 4GNXA 4JI0L 4B3ML 1XMOL 2KHIA 4O2DA 2OTLA 4APVA 3STBC 3T1YQ 4JI3Q 2K5NA 3ER0A 3FHWA 3F2BA 2QA4A 4HJAA 4A3JG 1MKHA 1GM5A 2JA6G 4LF7Q 4OONA 1J6QA 5IYBH 2QGQA 3W1GA 4NPSA 3WWVA 4DK3C 2BA0A 1G6PA 4P75A 4GLXA 4AYBE 3U58A 2ZJQA 2UXDL 2GVBA 3GTQH 3HOXG 3KDFB 1QVFA 4JV5L 3EN2A 1U0LA 2KCMA 2R6GA 4OO1I 2YTVA 3ULLA 3GDEA 3NBHB 1UE7A 3AEVA 3KFUA 3FKIH 3L7ZC 3TRZA 5JJKA 2BA1A 1K73C 3OTOQ 1XNRL 2OQKA 3RLOA 1ASYA 4YY3Q 5M5XH 1Q7YC 2OCEA 2VY3A 2KENA 4R4CA 5GAEC 1P8LA 1IBLL 4PZ7A 4OXPA 1VQIA 5IP7G 2WB1G 2I0QA 2K50A 1JMCA 2PI2A 4PZ6A 3CD6A 3IRBA 1I94Q 4DR4Q 3A74A 4J15A 1EQRA 1WI5A 1VS0A 3UDFA 3CCJA 2UXCL 4IPHA 3RZDH 3BZKA 2H5XA 2UXBL 2ID0A 4DV1L 1IYJB 4X65Q 3PIOA 2B3GA 2KHJA 3HKSA 1XMQL 4R4OA 3KOJA 3RLFA 1S72A 1K8GA 1WYDA 2YU9H 2Z6KA 3K0XA 3HOUG 4NXMQ 4ME3A 1RL2A 3OYYA 1FJGL 2K4KA 3NENA 4X6AH 3PUZA 3I4OA 4DUYL 5LMNQ 2HHHQ 4O0AA 3E0EA 5M3MH 4C3JH 2D62A 4L5QA 4P74A 1EQQA 2DUDA 4A76A 3TS2A 2MQHA 1IXRA 3I2ZA 1KXLA 3S1RH 3CPWA 5GQOA 2E2JH 5IE8A 1G51A 3J7ZC 3GTKH 2YYZA 4Y7NH 1L1OC 3HKZE 1L1OB 3J80i 1BKBA 1E1OA 4POFA 1N36Q 1BBWA 5C0XI 4DV6Q 4DR1L 3VDYA 4JG2A 4A3FG 4IFDG 4DV5Q 3U4VA 1HNXQ 4JI6Q 4A3GH 3RN2A 4JOIA 2PQAB 3NEMA 2R7ZH 5H1SE 5JJLA 3KF6B 4DV7L 1OXSC 1IZ6A 1PHJA 1B7YB 3G6EA 4R4IA 1L2FA 1NMFA 1PA6A 1PH2A 5FLMH 1QZGA 2R93G 4JI0Q 1H95A 3GTJH 3OTOL 4JI4Q 4JC0A 1YIJA 1N34Q 1Y1WH 4UPAA 3I4NH 3UE0A 3CC2A 4DR3L 3TS0A 3CCRA 4KHPQ 3K8AA 3AFQA 1A0IA 1A63A 4L5RC 4QY7A 1SRUA 2I5LX 2UXDQ 1J5EL 1QZHA 2EXDA 1KIXA 1I94L 4DR4L 5ELOA 1HZ9A 4A3MH 2CWAA 4DNIA 1NBWA 3I7FA 2NVYH 3AFPA 3TREA 2DGYA 1P16A 1VQ8A 1W3SA 4NB3A 5C3EH 1VQ7A 4BXXH 2QEXA 4JBMA 5JEAJ 1SN8A 1T9HA 1XNRQ 4JI6L 1CKMA 3PV0A 1OXTA 4GN4B 4BY7G 4R4TA 5M3FH 1VQ5A 2NVQH 4A3DG 1PH5A 5LMNW 5LMNL 3B6YA 1YJNA 3NELA 1PH7A 2HHHL 2IX1A 2B63G 1YITA 1IBLQ 4PMWA 2UUCL 3S15H 1JJGA 2WAQE 2WFWA 1Y14B 5IYDG 3K81C 1NJIC 2K75A 4A93H 2JA7H 3U50C 1AE2A 3F2CA 1EWIA 1CKNB 4L5TA 1I5FA 1HNZL 1NY4A 1VQHA 2JA9A 1YVCA 2JA6H 4DV6L 2AKWB 4XTCS 4YCUA 2R92G 1HNXL 4A3EG 4FDBA 4GNXC 1TWFH 1XMQQ 4GNXB 4A3IG 2VUMH 1VQEA 1FJGQ 1SE8A 2Y0SG 3HOWG 3RLNA 3HOVG 4GKJL 3GTMH 4OWXB 4JI4L 4BBRG 4LUOA 1HR0Q 1N34L 2RHSB 5FJ8G 1YI2A 1JE5A 5HY6A 5C44H 4X62Q 3M9BA 2V1CC 3PF5A 3PCOB 1K8AC 4LF4Q 1PH6A 2JEAI 3T1HQ 4KHPL 4PZ8A 1M90C 1N33L 1X56A 2HQLA 3RN5A 4DR1Q 1E24A 4POGA 4AH6A 3I56A 3Q8DA 5IP7H
chains in the Genus database with same CATH superfamily
1X6OA 2NZOA 3K7UC 4L6TB 2QILA 4JVZA 4XQQA 4AYBG 4FF3A 5A2QE 3EFXD 3MVVA 3D31A 1E2VA 2HQEA 3OWFA 1EY0A 3MXGA 2B2WA 1LYLA 1LM0A 4XDXA 3D6CA 3BJUA 2EVBA 1WCMG 5EGTA 3E3XA 1J5EQ 4LF8Q 1B8AA 1B53A 3NUCA 3SK4A 2KBNA 2HDLA 5FO8B 2VNUD 2PZUA 4DV2Q 1NR2A 3Q24A 1VF5C 3K6OA 3CAMA 5IYBG 3NWSA 1KRSA 1WFQA 2VXWA 2WB1E 2V4DA 4XT1B 1C4QA 2R3ZA 4Z9CB 5I6YA 2RSOA 1SMXA 1HZAA 2ZM6L 3NP8A 2PNRC 1BCPD 3H15A 4LF4L 3T1HL 1ET6A 1XPUA 1GVPA 4K14A 3K5LA 1CKOA 3AQQA 3BDOA 1LTLA 3L3OC 1STEA 3D4RA 3CP0A 1VQBA 4HMJA 5JVG3 3VYRA 4GKJQ 3DWAA 1STAA 4M1UB 3S2HH 5IWAL 3PF4A 1OO9B 2X69A 3GTPH 5CC4A 4XIGS 4KN7C 1QUQA 3OMCA 2QCPX 1PH9A 2MP1A 3EJIA 5M3MG 3HS0C 4DV4L 4ALPA 2PNHA 5KIXA 4WFN3 1JOQA 4IFDJ 3I70A 4EQNA 2R7ZB 3QWNA 3J81i 1EYGA 3LWUA 1N8RC 1WOCA 1PH3A 4A3BH 4NXNQ 5ELCA 4KY7A 5GROA 1STYA 3SHLA 3S2HB 2MFIA 1MSGA 1J9OA 4CHTB 5I6WA 2IX0A 3NBIA 3DLLA 3GTPB 2A6EC 2HDMA 1VQGA 5C4XH 4GOPA 3CCUA 1SNQA 5G3LF 1HTPA 5E3FA 1U4MA 3K58A 3IAYA 1PRTB 2RCNA 4A3JH 4LF5L 1TY2A 3K7AH 2Z0SA 2VQFQ 4LUZA 3NE5B 4QJFA 1CA5A 5E7NA 4PG3A 3F1ZA 4ABNA 1E22A 2R7DA 5BN3A 5AJ3Q 5IT9c 2PYKA 4A3BB 1WTHA 2DNEA 2I46A 1SLJA 2XNAC 4TRDA 2UU9Q 1IW7C 4DV0Q 4RFBA 2ATWA 4LFCL 1FGUA 3UE1A 1CI3M 5C4XB 2ZTCA 5EBCA 1JOKA 3A55A 1NMGA 5KNCA 4A3JB 3KLRA 1D5MC 1QB5D 1W6JA 2C35B 3CMEA 1PH1A 3K7AB 3PUVA 1G2TA 4YCWA 3H3VC 4K0KQ 2F52A 2ZTEA 1O7IA 1SYBA 3KF8A 2PZWA 4BWGB 4AQYL 1B2TA 4HIKA 1PZID 2RHQB 2JYOA 4KY5A 3RR5A 3H0GG 5CV9A 1X3FA 3LWEA 4O1NA 5I9PA 4RGOS 2A5HA 3I90A 3R3OA 2NN6H 4N8FA 2VQEL 1BBXC 1PTOF 4JBWA 4DXGA 1LT3D 4LF9Q 3I4LA 3A8JE 2EQSA 2HCIA 3HG9A 3TZDA 1C9OA 2LS01 2E2DC 3CRKC 3RNUA 3SR1A 4WJWA 2WACA 4JI1Q 5L37A 2WIIB 4E6IA 3ICEA 4JBKA 2MUYA 3PO3G 2R93H 1S40A 2B2YA 2Q2HA 1YJWA 3FP9A 1OTCA 5A35A 1TY0A 4KMUC 3K80C 3KUPA 4NMZA 2YTYA 4UY8C 1KLGD 1JJCB 4J1MA 5KYIA 4OWTB 4IJHA 2VS1A 2F0TA 1X9NA 1DXMA 5C3XA 4NDXA 3T1YL 2VZAA 3GD7A 1HCZA 5FOBB 4A3CG 2BE5C 3P20A 2EYHA 5KNBA 1FYCA 5DAUA 3S1MH 3JAMi 2A69C 5FKAC 2R93B 3HZXA 3DWPA 5JEAG 1HZCA 4C56C 2K14A 4P71A 4DAMA 1LV9A 2YV5A 1UUPA 4DR5L 2EXZA 1U4RA 4GN3B 3T56B 1KD1C 1NR4A 2B2TC 1XMOQ 2IJ0A 4LW1A 4XYQA 4TQUS 4R9WA 1TR5A 4B9XA 2MNAA 4JK1C 2K33A 4KD4A 1Z47A 2LMCB 2FMMA 1EYAA 3T51B 3S1MB 4JI8Q 1TWHH 3VR4A 4X64L 1GOZA 1EY6A 3I4NG 4DR7L 1HJPA 4X65L 3W1BA 1H9MA 1A8VA 2E2IH 1BQQT 1F77A 2IT1A 3BG3A 3ZYYX 1VQLA 1JORA 5ISRA 2NUCA 4FO2A 1VQMA 2L12A 4MIUA 3RUZA 1ICWA 2R92B 2EY1A 4JW0A 1B4OA 1VQDA 3J80c 1WTVA 1N36L 4G57A 1PYSB 4DAYB 4JI6L 4B3RL 2A73B 2UXBQ 1TWHB 4KLKA 3G71A 1I4GA 1XPOA 1YEZA 3S14H 3AMUA 1IHZA 1EY8A 2I5MX 4B9WA 5C4JH 1O80A 2B39A 2E2IB 3STBC 4JI3Q 3FPPA 1V1OA 2QA4A 1ENCA 1GM5A 5I4DA 4LF7Q 5IYBH 5J1ZA 2QGQA 3W1GA 1FR3A 4GLXA 4RKBA 4U673 2EJMA 2KVMA 3NK9A 2RCFA 2GVBA 1A6XA 3HOXG 2M9VA 1IKMA 1ILPA 3ULLA 1WTQA 4ZUIA 3NBHB 1UEAB 1RCVD 2AQ2B 2EJFC 4FNFA 5FO9B 4R8IA 1ASYA 4YY3Q 2JP1A 3S14B 2KENA 5C4JB 1HQMC 4LMQD 4WRDA 1SYEA 4PZ7A 4CJ0B 1GUOA 1VQIA 1FNVA 1JMCA 3QOLA 1MI2A 2A6HD 3CD6A 2QKIC 1II3A 4J15A 4DFAA 1D1KA 2F3VA 2DNCA 4N8X1 4PMCA 3RZDH 1K3BC 4K8IA 3NQIA 2KHJA 3HKSA 4DA2A 2H4OA 3RLFA 3KOJA 3PIOA 3CU7A 5CGKA 1BNZA 5M3MH 1WD0A 4P74A 3E6ZX 1A3UA 3I2ZA 2B2VA 1S5ED 3CPWA 5GQOA 1CQFA 1H9RA 1KDCA 3GTKH 4H7BA 4POFA 4DV6Q 4N9PA 4A3FG 2KQ3A 1ONLA 1MD2D 3DEPA 2RKSA 2HUGA 5DM73 1IZ6A 3RZDB 1HRJA 1NMFA 2XSCA 1QZGA 4JI0Q 3KBGA 4DAPA 4HTHA 5DM63 5M3MB 4RA8A 3CC2A 2RDHA 2A68C 4KKSA 3K5NA 2O5IC 1JICA 1SRUA 4TSSA 1J5EL 2MJ8A 2G9DA 1I94L 1BXTA 2B8FA 3GTKB 2CWAA 3I7FA 2K5QA 2NVYH 3AFPA 1EQTA 1TS5A 2P5ZX 2SNSA 4NB3A 2OXPA 5JVH3 1IL8A 1SN8A 5KEEA 1GXDC 1XNRQ 1E0BA 2CQAA 1PH7A 3PIO3 1YITA 1IBLQ 2WAQE 2DY8A 2QEJC 2EY5A 1AE2A 3F2CA 1NY4A 1J8IA 1ILQA 1YVCA 2JA6H 2D2CC 4FDBA 5TSSA 2NVYB 3QG1A 1TWFH 1W6KA 4NW2A 3P1HA 5AFWA 3GV3A 4GKJL 3GQBA 4KKUA 1M4VA 1A2TA 2EYJA 1HR0Q 2RHSB 1YI2A 3MXUA 1JE5A 4X62Q 1JWMD 1XTCD 3OWEB 4Q5VA 1PH6A 3QOJA 4KHPL 1ZEQX 1EQVA 3RN5A 4POGA 4MN3A 1TWGH 2JA6B 2B2WC 1LTGD 3PO3H 1XYIA 1AEXA 1X3EA 1H9SB 1TWFB 2FINB 5D65A 1XJVA 3PUXA 4IOAA 4G4KA 1XPRA 2XN9C 1JE4A 2FMCA 5FO7B 3OW2A 4MNOA 1FNUA 3NXWA 4HCSA 4IOCA 2M2LA 2PMZE 1HUNA 3MXNB 2IW3A 1Z9FA 1KQSA 1STGA 2IHEA 3M4PA 1PFMA 1CA6A 3CHBD 1GUNA 4LFBQ 2GN5A 4I65A 2F0LA 4P73A 3RZOH 4A3CH 2E74C 3A56A 2VQFL 1TWGB 2RF4A 4X3KA 2XIWA 1JT8A 2F0PA 3D0FA 3TBIB 1A15A 1EIGA 3PO3B 2DJFC 2EDGA 5M5YH 1MBYA 5CYUA 3O13A 1SXTA 1TQOA 3NHHA 4UP9A 2YTXA 4DV0L 3FPUB 2I07B 3VYSA 1VQAA 2NN6G 1NNXA 4LAAA 1KDBA 4MTKA 3GTOH 2EE1A 2PO4A 1HFNA 4IUTA 4HMIA 3RZOB 4BA2I 1VQCA 4EGVA 4KV6A 4ZKCB 2F4VQ 3IFTA 2Q2IA 4HEDA 1KL9A 1X3GA 1EUJA 4KHVA 5M5YB 1XTDA 1EZ8A 2R7FA 3OPOA 2BCOA 2CHBD 3ZJYC 3L2PA 1N33Q 4A3DH 5ELNA 1ESRA 5CORA 2N78A 2M00A 3CC7A 2CKZB 3GTOB 3CKIB 4KI0A 1SNDA 3TQYA 4DNTB 4X66Q 2K03A 4LF9L 5D3DA 1HHVA 4A3EH 1DM0B 4ME5A 3M4QA 4A3GG 4A3IH 3I4NB 3I91A 4JI1L 3HOWH 3CPFA 1EZ6A 4DF7A 1LTSD 1PYBA 3S24A 4EX5A 3T4AC 1E2ZA 1O7ZA 1VCIA 3ITPA 1TXYA 1VQ9A 5LL6S 2CVRA 3H3VH 4IPDA 4M8AA 2AQ3B 4K6DA 1IBMQ 3QO2A 1IBKL 1UE1A 3HOXH 2K28A 2OEOA 4Q0FA 4JI7Q 2E5LQ 1EFWA 5CBEE 4H44C 4A3EB 1YZ6A 1HPCA 3IKJA 4EQOA 4A3IB 3UDIA 2Y0SB 3E5SA 4LJZC 3HOWB 3PUWA 4YHHQ 1BUVT 4BA1I 1K9MC 1E7ZA 5HGQA 5C0XJ 1SAPA 3ULPA 2NN6I 4UP8A 3H91A 1ASZA 4DAYA 1SE4A 4OEMB 5EKIA 1V1QA 1PFSA 1YNJC 2ENBA 3AU7A 1LACA 4LFAQ 4LF6Q 1MJCA 1SE2A 4GLAC 3VR5A 2CCZA 1KTKA 3V96A 3HOXB 4FYDA 3BU2A 1VQ6A 2NVXH 2JA5H 1XNQQ 2HCCA 2VUMG 1LT5D 2WP8J 2F0HA 3S1NH 1SJHD 5IP9H 3Q0AA 4JI8L 2K5HA 4G7OC 1IL2A 2EIFA 1PH8A 2F4IA 4GS3A 1EIYB 1UE5A 1YHBA 5C44G 3U9SA 1AN8A 4B3TQ 4RMFA 4YCVA 1I4XA 3NBHA 4A3FH 4JI2Q 1I6VC 4OX9L 3BVZA 1F2MA 1KAAA 1ZYRC 2B2YC 1C48A 1HNWQ 5EPJA 4JYAQ 1KHIA 4DUZL 2NVXB 1F9SA 1EL0A 1VQNA 3SK8A 2JA5B 2K5VA 1DOMA 4A3KG 1IYVA 2Q2TA 3S1NB 4IN3A 1DYQA 3BZDB 4R1JA 3K5OA 1EEID 2AWNA 1YNNC 1G8ZD 3TEHB 3S16H 1DOKA 1Y1VH 3GP7A 4GN5A 4J8QA 1UWVA 4A3FB 4JI3L 1RHPA 3A54A 3W3AA 4DPGA 2JA8H 3H09A 4LF7L 3OHXC 1OXXK 4K5XA 1EOVA 1B1ZA 1VQKA 1QG7A 5C5LA 4HJ8A 5IYCG 1X54A 4DU9A 5K36H 1C0AA 1GHKA 3DWQA 4DNRB 4B3SL 3R2TA 2LXJA 2XRSD 1LABA 4YY3L 3S16B 2DN8A 1Y1VB 1KAWA 4IURA 2RDFA 2G5DA 2RSNA 1M8AA 5EKLA 4IUUA 2JA8B 4F8MA 1PV4A 1SMYD 5I2YA 4OWWB 2J7ZA 3N6RA 4IPCA 1AH9A 3NPPA 4WJ3M 1BCPC 1BO0A 1TWAH 3PGZA 4JBJA 3SGIA 4C1NI 4UAIA 4HAEA 4KHZA 1R9TH 2I5HA 1A62A 4NP5A 2HIVA 2IHFA 2WINB 2N3SA 3M3YH 1I50H 2CH4W 2QF7A 4DR2Q 3D8GA 1EU3A 4IJLA 1U4PA 2L9HA 1CM9A 4A3LH 1MIUA 4B08A 1Q8KA 5HGTA 1SFOH 1OXUA 3E9IA 4DV1Q 4JI5Q 2F0KA 3OSOA 1C7YA 1LT4D 1XXGA 3HEJA 3VR3A 4A4IA 2JK8A 3VYTA 1WTRA 1SYDA 2EOTA 2XWJB 4ID6A 4IQZA 1TWAB 4JI0L 3D4WA 4H13C 5IT9L 4B3ML 1R9TB 1I4HA 1I4RA 2K5NA 5HURA 3FHWA 5JOBA 4HJAA 4FXGC 2JA6G 4OONA 1J6QA 1G6PA 3ERQA 4NPSA 2BA0A 3M3YB 1HA5A 1V1PB 1I50B 3FMCA 3KLSX 4JV5L 2KCMA 2R6GA 2YTVA 1SFOB 5IGFA 3TRZA 1X3PA 1MSHA 1I4PA 5JJKA 3SDZA 3J81L 1XNRL 5KGUA 3RLOA 2PMZB 2F0UA 1Q7YC 1H9SA 2Q8RE 3WOFA 1KABA 1LTID 1IBLL 5ELDA 3A8IE 5D14A 2PI2A 3IRBA 3MXNA 3J7AF 1EYCA 2Z1CA 1EQRA 1VS0A 3UDFA 4KK7A 3CCJA 2UXCL 4IPHA 2H5XA 5C5MA 4C3HG 2B3GA 1EWHA 3K0XA 2NYZD 5JPMC 5J39A 4ME3A 1RL2A 2F0MA 3OYYA 2K4KA 5J22A 4OO1H 3P75A 4DUYL 4YIJA 2D62A 1PRTD 2DY7A 3L9AX 5C3WA 1RF2D 2MQHA 1IXRA 1KXLA 3S1RH 5IE8A 2L4NA 5T1IA 2BDNA 4Y7NH 1L1OC 3SK5A 2L11A 3HKZE 3J80i 1BKBA 1E1OA 1BBWA 3VDYA 4JG2A 1HNXQ 4A3GH 3RN2A 2PQAB 1ZKOA 2LFNA 5H1SE 2F0WA 2F0GA 3G6EA 1PA6A 1L2FA 4ODGA 1PH2A 1HA6A 1RTNA 4FF4A 4HN7A 3OTOL 5EBDA 3CCRA 3K8AA 3FVQA 1A0IA 3VR6A 1FD7D 4QY7A 3S1RB 2UXDQ 1KIXA 4DR4L 1JCKB 4Y7NB 4N9TA 1JWSD 5JJZA 1NBWA 1SJED 5C0XH 3NTHA 4A3GB 1P16A 1W3SA 3TP6A 1EIHA 4JBMA 5JEAJ 4ZUJA 4DXFA 1VQ5A 4A3DG 1PH5A 5LMNW 5LMNL 3B6YA 2HHHL 3A7AB 4KTAA 4PMWA 4F88A 1Y14B 2KHSA 2K75A 2JA7H 5FLXL 1EWIA 3D3RA 3ND8A 4L5TA 2SEBD 1F2YA 1VQHA 2JA9A 1B50A 3FRPB 2AKWB 4ZCKA 4YCUA 2SOBA 2L55A 4A3EG 4GNXC 4PQXA 4A3IG 2VUMH 4K5VA 3VA5A 1SE8A 2Y0SG 3HOWG 3GTMH 4DK1A 1PTOH 5I2XA 4OWXB 1O7LA 4JI4L 3NWTA 1N34L 4QMGA 2EY6A 5C44H 3M9BA 3PF5A 3PCOB 1K8AC 4LF4Q 1VMPA 3JAML 3R93A 3T1HQ 2JA7B 1N33L 1Y8PB 1Q8IA 4DR1Q 2E75C 3Q6SA 4GZYC 5M9OA 1DGSA 1GO3E 3I4MG 1WTPA 1Q86C 1WTWA 3PO2G 3E9HA 2CWPA 1CFMA 4A3KH 1EY7A 2VUMB 4RGNA 2Q2UA 4X66L 4UDUC 5IWAQ 3F2DA 4BBSG 2LXKA 3GTMB 4KY6A 1PTOB 3N52A 1YHQA 1RIPA 1UE6A 2F0VA 3C1EA 1S5DD 1I4QA 3EA6A 3TDQA 4K2KA 1SEBD 3ND9A 3QJYA 2N49A 5C44B 2BH2A 4CKCA 4DV4Q 4FF1A 1HZBA 2Z6KC 4PV1C 3CMAA 2QDLA 1C8CA 4G7HC 2F03A 2WB1B 2D0PA 2O4XA 1K3RA 2FXQA 2JA5G 1AE3A 2HT1A 4IFDH 1TS2A 2VB2X 3G7LA 3L0OA 4A3KB 2E5LL 5IYCH 5IP9G 1AP0A 1ML0D 1PZJD 5DLQE 1WTXA 2JE6I 1O7YA 1TIID 1HNZQ 1Y8OB 4JOIC 3DXJC 4ZK9B 1WJJA 3KLSA 1LLRD 1DD2A 4KD3A 3U9OA 1E3PA 3TZUA 2K05A 5C4HA 1K0RA 1R4PB 1DJRD 1BDOA 2F0NA 3M4YA 3H94A 3HFZB 4LFAL 2CFMA 4P72A 4LF6L 2O5JC 3BDLA 1OXVA 2XTIA 4AIMA 3E0JA 2F0OA 2L5TA 2XGTA 1KC8C 1M1KC 2D5DA 1CSQA 2B63H 4LF8L 1Y1VG 3HP3A 2DJGC 1FNWA 4HCEA 3H3VI 2PZTA 3MFGA 3R8BA 4C1NK 3W2DA 2A6HC 4DV2L 2D0OA 2JA8G 3CCSA 1CT1D 4B3TL 5CMDA 2GA4B 3VYUA 1K28A 4AQYQ 4R8NA 2B2TA 4FVMA 1GUGA 3A8KE 3A0JA 2R61A 1LUZA 1HNWL 1T5XD 3HOVH 2IWHA 5K36G 2AWOA 2CH4A 1TS4A 2LSSA 2IX3A 5FLMG 2WAQG 4X3UA 1BCPF 5FJ8H 1K83H 4HIDA 2B63B 1PTOD 4HIMA 1VF7A 2WKCA 3HRZC 4V190 1KNEA 2UUAQ 3BYTB 3CCVA 4ZYSA 2K04A 2NZ1D 2VB3X 1BBUA 5IT9E 4X3TA 4RHRA 3A5ZB 2VW9A 1JJ2A 1RJTA 2OQ0A 1U9RA 3S17H 1Q1EA 3U4ZA 1CZGA 4QIWE 3HOVB 4C3IH 4EQ5A 1EWCA 1MGSA 5EQ0A 3VA7A 2XWBB 3CQZH 4YWKA 2UUBQ 5KYLA 1G91A 1FVIA 1K83B 4RCOA 4XYOA 1H9JA 4H02A 4TKOB 5FK9C 3J81E 2CW0D 1X55A 2EYMA 2MHVA 3CCLA 3CC4A 1NCVA 4A3LG 4NXNL 3SXHA 4C3HH 3S1QH 1CSPA 2NZHA 1NTGA 2FFKB 5NUCA 5IOCA 1SDFA 3S17B 4QUCA 1V1PA 5DEHA 4C3IB 3MWYW 1QVGA 2N8NA 4DR5Q 3GO5A 1PYWD 3CQZB 4DV3Q 3BZCA 1GJXA 1SNCA 4HJ5A 4BY1H 3T13A 5AJ3L 4HIOA 1N9WA 2L15A 1Y8NB 4CKEA 1X3QA 3HOYG 4ZAIA 4WORA 2UU9L 4C3HB 4DR2L 4H0LC 4OHJA 3S1QB 1SYCA 4QQBX 1K8OA 1CUKA 4X64Q 5IGEA 4OGQC 1SBBB 4DR7Q 5GAHC 1EY4A 4JI5L 4HJ9A 1DZ1A 1JQYD 4A75A 1N32Q 5LMUQ 4HJ7A 2K5WA 3TP7A 1QILA 4K0KL 4FXKC 5IGGA 2OTJA 4BY1B 1Q46A 3HKZB 1LO5D 5ELEA 3LGJA 3PSIA 2KEEA 4ZKBB 4LNQA 1PVOA 3AYHB 5GADC 1HXYD 4OO1G 2EYLA 1ZXTA 4DKAC 4B3RQ 3K57A 4LUVA 5CV7A 3J81j 2AQ1B 3DHQA 3DMUA 3PUYA 3V2TA 2PQAA 1RKNA 2JEBI 2Z4HA 2JJQA 2KCTA 1BOSA 1F2ZA 4QB4A 2ASBA 3GTLH 1PLFA 4GOPC 1PZKD 2QW7A 4G7ZC 2AUKA 4DR6Q 1U4LA 5FLXE 3BVMA 2BDOA 2L1BA 5BR8Q 4A3DB 2KECA 1Q12A 1G291 4XQJA 5JPNC 3PIPA 1STBA 3CF5A 3I4MH 4LWCA 3PO2H 1GD7A 3K59A 3GTLB 1D2BA 5C0XG 3Q23A 1QVCA 1EYDA 3JAME 2JN4A 1HH2P 1ICFB 4BBSH 1UEBA 5DNFA 1A3TA 1JC7A 2QDBA 3MEFA 4MTNA 4XXEA 2LY7A 3ULJA 2IY5B 5BN5A 5EAYA 1Z6HA 1PFNA 3MA2B 2JA7G 1SNPA 1XMOL 3RMHA 2OTLA 3X3MA 3ER0A 3F2BA 1MKHA 4KJNA 2JSOA 3I4MB 4DK3C 3GV6A 3BS1A 2HD3A 3PO2B 4AYBE 4CDDC 3U58A 4KKTA 2UXDL 2B2UA 1QVFA 3KDFB 4BBSB 1U0LA 4OO1I 3AEVA 3L7ZC 1L0XB 2RVLA 1K73C 2OQKA 4PNYA 5M5XH 1X32A 4ULLA 1P8LA 3PIP3 2WB1G 2K50A 5T1GA 2SDFA 2ICEC 3NQTA 2NB0A 1I94Q 4RGTA 3A74A 3PMFA 3EROA 1WI5A 1XWEA 1GUTA 2PCFB 2UXBL 2YU9H 4GKKQ 1WYDA 1HUMA 4NXMQ 4X6AH 3UI2A 3NENA 1F2LA 2A6ED 3PUZA 4L5QA 5E1FA 4V0BA 1EQQA 5M5XB 3MAQA 3KBXA 1G51A 3J7ZC 3OIQA 1SYGA 1L1OB 4I7AA 5C0XI 4DR1L 2JXMB 4IFDG 4DV5Q 3U4VA 2H1EA 3M7GA 4IALA 2R7ZH 1NUCA 3BVGA 1B3QA 3KF6B 1WD1A 1PHJA 1B7YB 4R4IA 4OL7A 1IW7D 2YU9B 3NTKA 5FLMH 1H95A 4JPBW 3GTJH 2K7VA 1A3VA 4RGMA 1YIJA 5COYA 1Y1WH 4UPAA 3WDNA 3K5MA 4RWSC 3H6MA 2B8GA 1QJOA 3TS0A 4KHPQ 3MHBA 2NBFA 4L5RC 2J0TD 5KRUA 2EXDA 2Q8IB 1HTLD 1Y69U 3TREA 3AB9A 2DGYA 4IUQA 1VQ8A 4BXXH 3PQIA 5KNDA 2Z6BA 3V05A 2NWGA 1CKMA 4HSVA 4BY7G 1TU2B 1GUSA 5E4WC 5M3FH 1YJNA 2WAQB 2IX1A 3S15H 2B63G 4L8JA 3GTJB 1JJGA 1Y1WB 4RH6A 1NJIC 4P2CB 3U50C 2F0FA 1CKNB 2PW5A 5LHY1 5IIFA 3A7LA 1HNZL 3SK6A 3R2IA 3D6WA 3KK7A 4DV6L 4XTCS 1DOLA 1D5ZC 1XMQQ 4GNXB 1CHPD 1QCBD 1VQEA 1FJGQ 3SEBA 5IGCA 3RLNA 3HOVG 5CV6A 3MTSA 1UNSA 1TT2A 3J7YW 5FJ8G 5M3FB 3S15B 3NSWA 4QIWB 1SNMA 3RD4A 1LTRD 2JEAI 3CRLC 1X56A 2ICIA 2TSSA 1E24A 4AH6A 3Q8DA 5I9OA 5IP7H 3HOYH 1DCZA 2XVSA 3HOZG 4DV7Q 1SMYC 4IFDI 2BE5D 1YHAA 3T16A 3CCQA 3M85A 2PQEA 5E4XA 2EY2A 3J81c 1W2BA 1CK1A 2A69D 1RTOA 2AMCB 2RQXA 4C3IG 4UHVA 1MJEA 1F9QA 5ELFA 4DR3Q 3HOUH 3J7AV 1CQVA 2PI2E 3QIAA 2KCCA 5F2DA 1JB7A 1EY9A 1NAPA 2D9UA 4U68A 2KEDA 3HOYB 2A19A 2UUAL 1EIFA 1JOOA 3FEWX 1VQFA 3CXCA 2GVAA 2JQOA 3EIVA 2PW7A 2B2VC 2RDGA 1R4QB 4YWMA 4ILWA 2UUCQ 1QNKA 1HR0W 1HR0L 3EVQA 4X62L 3FKIG 3HOUB 4ZLTF 5GAGC 3CCMA 2XRQD 2NTSA 1U5KA 1K0SA 4CBVA 1F9PA 3SE0A 4BY1G 1T5EA 1RD9D 2UUBL 3HKZG 2ZTDA 2KJXA 2SNMA 3G4SA 1IBKQ 2MO0A 2HIXA 3A5UA 1VQPA 2Q8TA 4QCLA 3DEOA 3F2UA 2BOSA 1XX8A 3DM3A 1V8QA 2L0CA 2ZT9C 4S3SA 3OOCA 3VR2A 2VL6A 2BH8A 2J4XA 2C9OA 3CCEA 4EQPA 1O78A 4LFBL 5IYDH 5CV8A 4C3JG 1F9RA 1Z7TA 3STBD 1S5BD 1I6HH 4DV3L 4J6HA 2MO1A 5IGDA 4IUVA 3S2DH 2N88A 2LKVA 3CW2C 1FL0A 2R92H 1RDPD 2A74C 5IODA 3KLWA 1TKWB 1VQOA 1JR0D 5FLXc 4TVAB 3DM1A 3J7A5 4K2LA 4BBRH 1PRTC 1YBYA 5K5PA 4CDFC 1K8MA 2ES2A 1AFPA 1GKHA 2NVTH 4L5SA 4CDEC 1VQ4A 2N55A 1S3OA 4EVOA 1N32L 5LMUL 4I7ZC 1I6HB 5CV5A 5C6AA 1V43A 4OX9Q 2F4VL 3S2DB 1V9PA 2TMPA 4A3MG 3OMGA 2ZM6Q 2E2HH 4DUZQ 1Q82C 2X6GA 4L63B 4FP5D 1YNXA 3TP5A 4CDCC 3TN2A 5C3EG 3JAMc 4MZ9A 3Q22A 3UDXA 3J80L 1VQJA 2Y0SE 4Y52H 4BS9A 4BBRB 1WCMH 1NSNS 1Q81C 2ZXPA 2F1MA 3JC66 3C2PA 1Q1BA 3D4DA 4QGUA 4DK6C 2NVTB 4A93G 2EJGC 4K8JA 1PMRA 4RAUC 2ZJPA 1YJ9A 4DGZA 1PFBA 3KYHC 2EPBA 4AYBB 1KDAA 2CQOA 4OIKA 4DR6L 2E2HB 1QWYA 2ALYB 2K5DA 5EPLA 5BR8L 3W5OA 1NE3A 3KDFA 2E8GA 4QF4A 5A2QL 1WCMB 5D3IB 5M5WH 2EZVA 1I3QH 3ERSX 4B3SQ 4RHSA 1SYFA 2FHTA 1EEFD 2A68D 4CJ2C 1IBML 2OT2A 5IY0A 4XQNA 4JI7L 2E76C 3NTIA 4C2MH 1S4ZA 1ESFA 4YWLA 2F3IA 2X6LA 1BF4A 5G3LD 5JAVA 4NKLA 1STHA 4YHHL 4WJ4A 1GUWA 1CZWA 4LF5Q 3OW7A 2WKDA 1SROA 3IL8A 4KJOA 4IO9A 5CR3A 4DAVA 3M7NA 1L0WA 5M5WB 1AW7A 1QNUA 1I3QB 3WOEA 3G48A 2K32A 1HQRD 1D5XC 1QUQB 1KLUD 2KUMA 4C2MB 1XNQL 4LFCQ 3IFDA 4IPGA 1RODA 4LK1C 1JWUD 4BY7H 1PH4A 2RA4A 5EKKA 1H9KA 5JJIA 4UP7A 1L1OA 1WTOA 3TMEA 3KJPA 3EQLC 4RCNA 4KN4C 1D8LA 1SE3A 1KRTA 4JCVE 3MFYA 1LT6D 2PPBC 3KF6A 4K6LA 4B3MQ 4R4QA 4JI2L 1SR3A 2KOLA 3I73A 1D7QA 1EOTA 4GOPB 1B70B 3K0YA 4ZQ3A 2AHOB 2R7ZG 2K01A 4JYAL 2WV6D 4OIJA 1VDZA 3ONAB 4IUPA 3I3CA 1X65A 3KJOA 4JV5Q 2K52A 5J3BA 4BY7B 2AUJD 1EU4A 3TSSA 1E1TA 3I72A 4QL5A 2K6AA 1Y1WG 4GLVB 3UDGA 4K5WA 4RG1A 4GKKL 1TWCH 2RBMA 2VQEQ 2OWOA 3GTGH 4NXML 3I55A 1LTAD 3MEHA 4QUFA 4FXDA 3HOZH 3EBEA 4DK0A 1B3AA 1ENFA 2B29A 2A1AA 4BXXG 1BVSA 1CKNA 3MC0B 4A3BG 2I0QA 2UXCQ 4DV5L 5M3FG 2ZJRA 2A8VA 1D1IA 3H0GH 1TS3A 3SVMA 3KF8B 4O42A 3F8TA 4DUYQ 5C4XG 4GNXA 1TWCB 4IZ8A 2KHIA 4O2DA 3GTGB 4APVA 1G6ZA 1TVXA 3T1YQ 4A3JG 2NTTA 4OELB 2B2UC 1D6EC 2EYOA 3TP8A 3HOZB 2IL8A 3WWVA 4P75A 3C46A 1PXUA 4CGYB 1IYUA 4FF2A 2ZJQA 3QR8A 3GTQH 4CJ1B 3EN2A 4MHEA 3LNNA 5C4ZA 2G9HD 1L0YB 3GDEA 1UE7A 3KFUA 3FKIH 1AZQA 5LL6X 2BA1A 1HFGA 3I8ZA 3OTOQ 3H0GB 2OF1A 2OCEA 1PTOC 2EYPA 3C3LA 2VY3A 4R4CA 1DONA 1STNA 5GAEC 2KA7A 5IGBA 1VMCA 1CHQD 3QB3A 4OXPA 4F87A 5IP7G 4HR7B 3T53B 3MXPA 4PZ6A 1MHWC 4DR4Q 2O2LD 3X3NA 1EY5A 1KNAA 1GHJA 5EPKA 3BYYB 3GTQB 3BZKA 2ID0A 4DV1L 1IYJB 4X65Q 1QOHA 1XMQL 1K8GA 4R4OA 1S72A 2Z6KA 3HOUG 1FJGL 1B9MA 2F0EA 3FKIB 5JEAH 3BDCA 3I4OA 3LX0A 5LMNQ 1Q3LA 2HHHQ 4O0AA 3E0EA 1EFID 4C3JH 1G2SA 2F3WA 2DUDA 1A2UA 4A76A 3TS2A 2F0DA 1B9NA 4XT3B 2E2JH 2F0JA 2CW0C 3P7JA 1PDQA 2F0QA 2YYZA 1N36Q 4CKBA 3M4OH 1CTMA 2Z9HA 4JI6Q 2EYFA 4JOIA 2F0SA 3NEMA 4DN4M 5JJLA 4DV7L 1OXSC 1QE6A 5CV4A 3FDTA 2R93G 4RKLA 4JI4Q 4JC0A 4X3SA 1N34Q 3I4NH 1Q90A 4C3JB 4F7XA 3UE0A 4DR3L 1SSOA 1B44D 2K1BA 3AFQA 1A63A 2FJ2A 2I5LX 2E2JB 1YNJD 1QZHA 1WVLA 5ELBA 5ELOA 1HZ9A 4A3MH 4DNIA 3M4OB 3C1FA 5CBAE 1JB3A 1VQ7A 5C3EH 3G6JB 1BCPB 2QEXA 4HSPA 3MZ5A 1T9HA 1S5FD 3HGBA 3PV0A 4GN4B 1OXTA 1AZPA 4R4TA 2NVQH 1LTBD 1ET9A 1S5CD 3NELA 2UUCL 3OIPA 5IYDG 2WFWA 3K81C 2ZXRA 4A93H 1IKLA 1PRTF 1ENAA 1E2WA 2ZXOA 4IUNA 1I5FA 3J80E 5BN4A 2KCNA 3URYA 1FGBD 2R92G 1HNXL 4A3MB 1ZYRD 2IPKD 1SNOA 2MPMA 5C3EB 2Z8LA 4PMBA 2Z4IA 4BBRG 4ZRZA 1LTTD 4LUOA 3DUZA 3S9WA 2NVQB 1UAPA 2F0IA 1BR9A 5HY6A 2V1CC 2C5CA 2MGSA 5EJWA 4PZ8A 4A93B 1M90C 2HQLA 1YNND 3I56A
chains in the Genus database with same CATH topology
1X6OA 2NZOA 3K7UC 3HOYH 1TWGH 1DGSA 1GO3E 3I4MG 4AYBG 3HOZG 1Q86C 4DV7Q 3PO2G 4IFDI 3PO3H 1YHAA 3D31A 3E9HA 3CCQA 4IOAA 1X3EA 2CWPA 1XJVA 4A3KH 3PUXA 3J81c 3M85A 1XPRA 1W2BA 2Q2UA 4X66L 5IWAQ 3F2DA 4BBSG 2LXKA 3OW2A 4MNOA 2AMCB 1LYLA 1LM0A 1YHQA 4IOCA 1RIPA 1UE6A 2PMZE 3BJUA 1WCMG 1MJEA 4DR3Q 3HOUH 3MXNB 2PI2E 1Z9FA 2N49A 1KQSA 2IHEA 3M4PA 1J5EQ 4LF8Q 2BH2A 1B8AA 4LFBQ 1JB7A 4DV4Q 2GN5A 4P73A 3RZOH 2KBNA 4A3CH 2VNUD 1HZBA 2Z6KC 3CMAA 4DV2Q 2VQFL 2A19A 2UUAL 2D0PA 2RF4A 1EIFA 3CAMA 1JT8A 5IYBG 1K3RA 1KRSA 1VQFA 1WFQA 2FXQA 3D0FA 2JA5G 2WB1E 1AE3A 3CXCA 2HT1A 2GVAA 2JQOA 5M5YH 3EIVA 2E5LL 3L0OA 1SMXA 5IYCH 1HZAA 4YWMA 5IP9G 2UUCQ 1HR0W 4UP9A 2ZM6L 1HR0L 5DLQE 2JE6I 2YTXA 4DV0L 3H15A 4X62L 1VQAA 3FKIG 4LF4L 1HNZQ 2NN6G 5GAGC 4JOIC 3CCMA 3T1HL 1U5KA 1XPUA 1GVPA 1WJJA 3GTOH 1CKOA 3AQQA 4BY1G 2UUBL 1LTLA 1E3PA 3HKZG 1K0RA 2ZTDA 4BA2I 1VQCA 3G4SA 3CP0A 1VQBA 1IBKQ 2MO0A 4GKJQ 3HFZB 2HIXA 2F4VQ 4LFAL 3A5UA 1VQPA 2CFMA 4P72A 2Q2IA 4LF6L 1KL9A 1X3GA 5IWAL 1OXVA 3S2HH 1EUJA 3PF4A 3GTPH 3DM3A 1XTDA 2XTIA 4AIMA 2R7FA 2XGTA 1KC8C 4XIGS 2VL6A 2BH8A 1M1KC 3ZJYC 3L2PA 1QUQA 3CCEA 1N33Q 4A3DH 5ELNA 1CSQA 2B63H 1PH9A 4LF8L 1Y1VG 2N78A 4LFBL 5IYDH 5M3MG 4DV4L 4ALPA 2PNHA 3STBD 3H3VI 3CC7A 2CKZB 4DV2L 4KI0A 4DV3L 1I6HH 2D0OA 2JA8G 2MO1A 4IFDJ 3CCSA 3TQYA 4B3TL 3S2DH 3J81i 1EYGA 1N8RC 1WOCA 4X66Q 3CW2C 1PH3A 4LF9L 1FL0A 4AQYQ 4NXNQ 2R92H 4A3BH 4A3EH 5GROA 3M4QA 4A3GG 4A3IH 2MFIA 3KLWA 2UXCQ 3A0JA 1VQOA 1LUZA 3DLLA 1HNWL 2IX0A 4JI1L 3HOWH 3HOVH 5FLXc 1VQGA 3CPFA 5C4XH 2AWOA 4GOPA 5K36G 4TVAB 3CCUA 3J7A5 2LSSA 4BBRH 5FLMG 2WAQG 1PYBA 3S24A 5FJ8H 1YBYA 4EX5A 2RCNA 4A3JH 1VCIA 1K83H 4HIDA 2ES2A 1TXYA 4HIMA 4LF5L 1GKHA 1VQ9A 2NVTH 4L5SA 3K7AH 2Z0SA 2VQFQ 4LUZA 4QJFA 1VQ4A 2UUAQ 5E7NA 1S3OA 3CCVA 4PG3A 4IPDA 3H3VH 3F1ZA 1E22A 1IBMQ 2R7DA 1N32L 5LMUL 1IBKL 5AJ3Q 1V43A 1BBUA 1UE1A 3HOXH 4JI7Q 4OX9Q 2E5LQ 2F4VL 5IT9c 1V9PA 4A3MG 1EFWA 2ZM6Q 2E2HH 1SLJA 2UU9Q 3A5ZB 2VW9A 4DUZQ 1YZ6A 1JJ2A 1SFOH 2OQ0A 4DV0Q 1Q82C 1YNXA 2ATWA 4LFCL 5C3EG 3JAMc 1Q1EA 3UDIA 1FGUA 4MZ9A 3U4ZA 3S17H 3UDXA 4QIWE 3UE1A 3PUWA 4YHHQ 4BA1I 4C3IH 4EQ5A 1E7ZA 1VQJA 2Y0SE 2ZTCA 5HGQA 1K9MC 4Y52H 1WCMH 1NMGA 3CQZH 4YWKA 2NN6I 3JC66 4UP8A 5C0XJ 3ULPA 1Q81C 2UUBQ 1Q1BA 1FVIA 4QGUA 1ASZA 2C35B 3CMEA 4DK6C 4H02A 1PH1A 1V1QA 4A93G 1PFSA 3PUVA 4YCWA 2ZJPA 1X55A 4K0KQ 2F52A 2ZTEA 4LFAQ 1YJ9A 1O7IA 4LF6Q 3KYHC 1MJCA 4GLAC 2CCZA 3CCLA 3CC4A 4AQYL 4A3LG 4NXNL 3BU2A 4HIKA 4C3HH 1VQ6A 2NVXH 3S1QH 2RHQB 2CQOA 2JA5H 1XNQQ 4DR6L 1CSPA 2ALYB 2NZHA 2VUMG 3RR5A 1NTGA 2WP8J 3H0GG 3S1NH 5IP9H 1X3FA 4JI8L 2K5HA 5BR8L 3W5OA 1IL2A 2EIFA 1NE3A 2N8NA 3KDFA 2E8GA 4DR5Q 1QVGA 1PH8A 3GO5A 4DV3Q 5M5WH 4GS3A 1EIYB 1I3QH 1UE5A 1YHBA 3ERSX 5C44G 2VQEL 4B3SQ 4JBWA 3M4OH 4B3TQ 3BZCA 4RMFA 4YCVA 4HJ5A 1IBML 4A3FH 4B3RL 5IY0A 4BY1H 4LF9Q 4JI2Q 2UXBQ 5AJ3L 2EQSA 4JI7L 4HIOA 4OX9L 1N9WA 2L15A 1C9OA 4C2MH 3RNUA 3HOYG 4YWLA 2F3IA 1HNWQ 4JI1Q 2UU9L 4JYAQ 1KHIA 4DUZL 4DR2L 3ICEA 4JBKA 1VQNA 3PO3G 2R93H 4QQBX 2K5VA 1S40A 1CUKA 4X64Q 4A3KG 2Q2HA 1YJWA 4YHHL 4WJ4A 3FP9A 2Q2TA 1OTCA 4DR7Q 5GAHC 4LF5Q 4JI5L 4HJ9A 3K80C 1SROA 2YTYA 4UY8C 4IO9A 4A75A 3M7NA 4R1JA 1JJCB 2AWNA 4OWTB 4IJHA 2VS1A 1N32Q 1L0WA 3TEHB 5LMUQ 4HJ7A 3S16H 1Y1VH 1X9NA 4GN5A 4K0KL 3G48A 1UWVA 2OTJA 3T1YL 4JI3L 2VZAA 4DPGA 3GD7A 4A3CG 2JA8H 1QUQB 4LF7L 1Q46A 3LGJA 1XNQL 4LFCQ 1OXXK 3PSIA 4LNQA 4IPGA 3JAMi 3S1MH 3AYHB 1PVOA 5GADC 4BY7H 1EOVA 1PH4A 4OO1G 1VQKA 4DKAC 5JEAG 4UP7A 4B3RQ 5JJIA 1HZCA 4LUVA 3J81j 1L1OA 4HJ8A 5IYCG 2K14A 3KJPA 4P71A 1X54A 4DAMA 2YV5A 1D8LA 1KRTA 1C0AA 4JCVE 3PUYA 4DR5L 4GKKQ 2PQAA 2JEBI 4GN3B 2JJQA 2KCTA 3KF6A 1KD1C 4B3SL 4B3MQ 1XMOQ 2LXJA 4YY3L 4LW1A 4TQUS 4R4QA 1KAWA 1SR3A 4JI2L 2ASBA 3GTLH 2MNAA 4GOPC 1D7QA 4GOPB 1B70B 4DR6Q 2AHOB 2R7ZG 1Z47A 4JYAL 1PV4A 4OWWB 1X65A 3KJOA 4JV5Q 4IPCA 4JI8Q 1TWHH 4X64L 2K52A 5J3BA 5BR8Q 1AH9A 1E1TA 4QL5A 1Y1WG 3I4NG 4GLVB 4DR7L 4WJ3M 1HJPA 3UDGA 4X65L 4RG1A 1Q12A 1G291 3W1BA 4GKKL 1TWCH 1TWAH 3PGZA 2VQEQ 1A8VA 4JBJA 2OWOA 3SGIA 3PIPA 3GTGH 4NXML 2E2IH 4KHZA 1R9TH 2IT1A 3I55A 2I5HA 1VQLA 1A62A 1VQMA 2HIVA 3CF5A 3I4MH 4LWCA 3HOZH 2IHFA 3EBEA 2N3SA 3M3YH 3PO2H 1GD7A 1I50H 5C0XG 2B29A 1QVCA 4DR2Q 2A1AA 4IJLA 4BXXG 1HH2P 4BBSH 1VQDA 3J80c 1N36L 4A3LH 1MIUA 1UEBA 1BVSA 1CKNA 4A3BG 1Q8KA 1PYSB 3MEFA 1OXUA 4MTNA 4DAYB 2ZJRA 3E9IA 5M3FG 3ULJA 4DV1Q 4DV5L 4KLKA 3G71A 1C7YA 4JI5Q 2A8VA 2IY5B 1XPOA 5EAYA 1YEZA 3H0GH 4A4IA 2JK8A 3S14H 3KF8B 3F8TA 4DUYQ 2JA7G 5C4XG 2I5MX 5C4JH 4GNXA 4JI0L 4B3ML 1XMOL 2KHIA 4O2DA 2OTLA 4APVA 3STBC 3T1YQ 4JI3Q 2K5NA 3ER0A 3FHWA 3F2BA 2QA4A 4HJAA 4A3JG 1MKHA 1GM5A 2JA6G 4LF7Q 4OONA 1J6QA 5IYBH 2QGQA 3W1GA 4NPSA 3WWVA 4DK3C 2BA0A 1G6PA 4P75A 4GLXA 4AYBE 3U58A 2ZJQA 2UXDL 2GVBA 3GTQH 3HOXG 3KDFB 1QVFA 4JV5L 3EN2A 1U0LA 2KCMA 2R6GA 4OO1I 2YTVA 3ULLA 3GDEA 3NBHB 1UE7A 3AEVA 3KFUA 3FKIH 3L7ZC 3TRZA 5JJKA 2BA1A 1K73C 3OTOQ 1XNRL 2OQKA 3RLOA 1ASYA 4YY3Q 5M5XH 1Q7YC 2OCEA 2VY3A 2KENA 4R4CA 5GAEC 1P8LA 1IBLL 4PZ7A 4OXPA 1VQIA 5IP7G 2WB1G 2I0QA 2K50A 1JMCA 2PI2A 4PZ6A 3CD6A 3IRBA 1I94Q 4DR4Q 3A74A 4J15A 1EQRA 1WI5A 1VS0A 3UDFA 3CCJA 2UXCL 4IPHA 3RZDH 3BZKA 2H5XA 2UXBL 2ID0A 4DV1L 1IYJB 4X65Q 3PIOA 2B3GA 2KHJA 3HKSA 1XMQL 4R4OA 3KOJA 3RLFA 1S72A 1K8GA 1WYDA 2YU9H 2Z6KA 3K0XA 3HOUG 4NXMQ 4ME3A 1RL2A 3OYYA 1FJGL 2K4KA 3NENA 4X6AH 3PUZA 3I4OA 4DUYL 5LMNQ 2HHHQ 4O0AA 3E0EA 5M3MH 4C3JH 2D62A 4L5QA 4P74A 1EQQA 2DUDA 4A76A 3TS2A 2MQHA 1IXRA 3I2ZA 1KXLA 3S1RH 3CPWA 5GQOA 2E2JH 5IE8A 1G51A 3J7ZC 3GTKH 2YYZA 4Y7NH 1L1OC 3HKZE 1L1OB 3J80i 1BKBA 1E1OA 4POFA 1N36Q 1BBWA 5C0XI 4DV6Q 4DR1L 3VDYA 4JG2A 4A3FG 4IFDG 4DV5Q 3U4VA 1HNXQ 4JI6Q 4A3GH 3RN2A 4JOIA 2PQAB 3NEMA 2R7ZH 5H1SE 5JJLA 3KF6B 4DV7L 1OXSC 1IZ6A 1PHJA 1B7YB 3G6EA 4R4IA 1L2FA 1NMFA 1PA6A 1PH2A 5FLMH 1QZGA 2R93G 4JI0Q 1H95A 3GTJH 3OTOL 4JI4Q 4JC0A 1YIJA 1N34Q 1Y1WH 4UPAA 3I4NH 3UE0A 3CC2A 4DR3L 3TS0A 3CCRA 4KHPQ 3K8AA 3AFQA 1A0IA 1A63A 4L5RC 4QY7A 1SRUA 2I5LX 2UXDQ 1J5EL 1QZHA 2EXDA 1KIXA 1I94L 4DR4L 5ELOA 1HZ9A 4A3MH 2CWAA 4DNIA 1NBWA 3I7FA 2NVYH 3AFPA 3TREA 2DGYA 1P16A 1VQ8A 1W3SA 4NB3A 5C3EH 1VQ7A 4BXXH 2QEXA 4JBMA 5JEAJ 1SN8A 1T9HA 1XNRQ 4JI6L 1CKMA 3PV0A 1OXTA 4GN4B 4BY7G 4R4TA 5M3FH 1VQ5A 2NVQH 4A3DG 1PH5A 5LMNW 5LMNL 3B6YA 1YJNA 3NELA 1PH7A 2HHHL 2IX1A 2B63G 1YITA 1IBLQ 4PMWA 2UUCL 3S15H 1JJGA 2WAQE 2WFWA 1Y14B 5IYDG 3K81C 1NJIC 2K75A 4A93H 2JA7H 3U50C 1AE2A 3F2CA 1EWIA 1CKNB 4L5TA 1I5FA 1HNZL 1NY4A 1VQHA 2JA9A 1YVCA 2JA6H 4DV6L 2AKWB 4XTCS 4YCUA 2R92G 1HNXL 4A3EG 4FDBA 4GNXC 1TWFH 1XMQQ 4GNXB 4A3IG 2VUMH 1VQEA 1FJGQ 1SE8A 2Y0SG 3HOWG 3RLNA 3HOVG 4GKJL 3GTMH 4OWXB 4JI4L 4BBRG 4LUOA 1HR0Q 1N34L 2RHSB 5FJ8G 1YI2A 1JE5A 5HY6A 5C44H 4X62Q 3M9BA 2V1CC 3PF5A 3PCOB 1K8AC 4LF4Q 1PH6A 2JEAI 3T1HQ 4KHPL 4PZ8A 1M90C 1N33L 1X56A 2HQLA 3RN5A 4DR1Q 1E24A 4POGA 4AH6A 3I56A 3Q8DA 5IP7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X6O A;  2NZO A;  3K7U C;  3HOY H;  1TWG H;  1DGS A;  1GO3 E;  3I4M G;  4AYB G;  3HOZ G;  1Q86 C;  4DV7 Q;  3PO2 G;  4IFD I;  3PO3 H;  1YHA A;  3D31 A;  3E9H A;  3CCQ A;  4IOA A;  1X3E A;  2CWP A;  1XJV A;  4A3K H;  3PUX A;  3J81 c;  3M85 A;  1XPR A;  1W2B A;  2Q2U A;  4X66 L;  5IWA Q;  3F2D A;  4BBS G;  2LXK A;  3OW2 A;  4MNO A;  2AMC B;  1LYL A;  1LM0 A;  1YHQ A;  4IOC A;  1RIP A;  1UE6 A;  2PMZ E;  3BJU A;  1WCM G;  1MJE A;  4DR3 Q;  3HOU H;  3MXN B;  2PI2 E;  1Z9F A;  2N49 A;  1KQS A;  2IHE A;  3M4P A;  1J5E Q;  4LF8 Q;  2BH2 A;  1B8A A;  4LFB Q;  1JB7 A;  4DV4 Q;  2GN5 A;  4P73 A;  3RZO H;  2KBN A;  4A3C H;  2VNU D;  1HZB A;  2Z6K C;  3CMA A;  4DV2 Q;  2VQF L;  2A19 A;  2UUA L;  2D0P A;  2RF4 A;  1EIF A;  3CAM A;  1JT8 A;  5IYB G;  1K3R A;  1KRS A;  1VQF A;  1WFQ A;  2FXQ A;  3D0F A;  2JA5 G;  2WB1 E;  1AE3 A;  3CXC A;  2HT1 A;  2GVA A;  2JQO A;  5M5Y H;  3EIV A;  2E5L L;  3L0O A;  1SMX A;  5IYC H;  1HZA A;  4YWM A;  5IP9 G;  2UUC Q;  1HR0 W;  4UP9 A;  2ZM6 L;  1HR0 L;  5DLQ E;  2JE6 I;  2YTX A;  4DV0 L;  3H15 A;  4X62 L;  1VQA A;  3FKI G;  4LF4 L;  1HNZ Q;  2NN6 G;  5GAG C;  4JOI C;  3CCM A;  3T1H L;  1U5K A;  1XPU A;  1GVP A;  1WJJ A;  3GTO H;  1CKO A;  3AQQ A;  4BY1 G;  2UUB L;  1LTL A;  1E3P A;  3HKZ G;  1K0R A;  2ZTD A;  4BA2 I;  1VQC A;  3G4S A;  3CP0 A;  1VQB A;  1IBK Q;  2MO0 A;  4GKJ Q;  3HFZ B;  2HIX A;  2F4V Q;  4LFA L;  3A5U A;  1VQP A;  2CFM A;  4P72 A;  2Q2I A;  4LF6 L;  1KL9 A;  1X3G A;  5IWA L;  1OXV A;  3S2H H;  1EUJ A;  3PF4 A;  3GTP H;  3DM3 A;  1XTD A;  2XTI A;  4AIM A;  2R7F A;  2XGT A;  1KC8 C;  4XIG S;  2VL6 A;  2BH8 A;  1M1K C;  3ZJY C;  3L2P A;  1QUQ A;  3CCE A;  1N33 Q;  4A3D H;  5ELN A;  1CSQ A;  2B63 H;  1PH9 A;  4LF8 L;  1Y1V G;  2N78 A;  4LFB L;  5IYD H;  5M3M G;  4DV4 L;  4ALP A;  2PNH A;  3STB D;  3H3V I;  3CC7 A;  2CKZ B;  4DV2 L;  4KI0 A;  4DV3 L;  1I6H H;  2D0O A;  2JA8 G;  2MO1 A;  4IFD J;  3CCS A;  3TQY A;  4B3T L;  3S2D H;  3J81 i;  1EYG A;  1N8R C;  1WOC A;  4X66 Q;  3CW2 C;  1PH3 A;  4LF9 L;  1FL0 A;  4AQY Q;  4NXN Q;  2R92 H;  4A3B H;  4A3E H;  5GRO A;  3M4Q A;  4A3G G;  4A3I H;  2MFI A;  3KLW A;  2UXC Q;  3A0J A;  1VQO A;  1LUZ A;  3DLL A;  1HNW L;  2IX0 A;  4JI1 L;  3HOW H;  3HOV H;  5FLX c;  1VQG A;  3CPF A;  5C4X H;  2AWO A;  4GOP A;  5K36 G;  4TVA B;  3CCU A;  3J7A 5;  2LSS A;  4BBR H;  5FLM G;  2WAQ G;  1PYB A;  3S24 A;  5FJ8 H;  1YBY A;  4EX5 A;  2RCN A;  4A3J H;  1VCI A;  1K83 H;  4HID A;  2ES2 A;  1TXY A;  4HIM A;  4LF5 L;  1GKH A;  1VQ9 A;  2NVT H;  4L5S A;  3K7A H;  2Z0S A;  2VQF Q;  4LUZ A;  4QJF A;  1VQ4 A;  2UUA Q;  5E7N A;  1S3O A;  3CCV A;  4PG3 A;  4IPD A;  3H3V H;  3F1Z A;  1E22 A;  1IBM Q;  2R7D A;  1N32 L;  5LMU L;  1IBK L;  5AJ3 Q;  1V43 A;  1BBU A;  1UE1 A;  3HOX H;  4JI7 Q;  4OX9 Q;  2E5L Q;  2F4V L;  5IT9 c;  1V9P A;  4A3M G;  1EFW A;  2ZM6 Q;  2E2H H;  1SLJ A;  2UU9 Q;  3A5Z B;  2VW9 A;  4DUZ Q;  1YZ6 A;  1JJ2 A;  1SFO H;  2OQ0 A;  4DV0 Q;  1Q82 C;  1YNX A;  2ATW A;  4LFC L;  5C3E G;  3JAM c;  1Q1E A;  3UDI A;  1FGU A;  4MZ9 A;  3U4Z A;  3S17 H;  3UDX A;  4QIW E;  3UE1 A;  3PUW A;  4YHH Q;  4BA1 I;  4C3I H;  4EQ5 A;  1E7Z A;  1VQJ A;  2Y0S E;  2ZTC A;  5HGQ A;  1K9M C;  4Y52 H;  1WCM H;  1NMG A;  3CQZ H;  4YWK A;  2NN6 I;  3JC6 6;  4UP8 A;  5C0X J;  3ULP A;  1Q81 C;  2UUB Q;  1Q1B A;  1FVI A;  4QGU A;  1ASZ A;  2C35 B;  3CME A;  4DK6 C;  4H02 A;  1PH1 A;  1V1Q A;  4A93 G;  1PFS A;  3PUV A;  4YCW A;  2ZJP A;  1X55 A;  4K0K Q;  2F52 A;  2ZTE A;  4LFA Q;  1YJ9 A;  1O7I A;  4LF6 Q;  3KYH C;  1MJC A;  4GLA C;  2CCZ A;  3CCL A;  3CC4 A;  4AQY L;  4A3L G;  4NXN L;  3BU2 A;  4HIK A;  4C3H H;  1VQ6 A;  2NVX H;  3S1Q H;  2RHQ B;  2CQO A;  2JA5 H;  1XNQ Q;  4DR6 L;  1CSP A;  2ALY B;  2NZH A;  2VUM G;  3RR5 A;  1NTG A;  2WP8 J;  3H0G G;  3S1N H;  5IP9 H;  1X3F A;  4JI8 L;  2K5H A;  5BR8 L;  3W5O A;  1IL2 A;  2EIF A;  1NE3 A;  2N8N A;  3KDF A;  2E8G A;  4DR5 Q;  1QVG A;  1PH8 A;  3GO5 A;  4DV3 Q;  5M5W H;  4GS3 A;  1EIY B;  1I3Q H;  1UE5 A;  1YHB A;  3ERS X;  5C44 G;  2VQE L;  4B3S Q;  4JBW A;  3M4O H;  4B3T Q;  3BZC A;  4RMF A;  4YCV A;  4HJ5 A;  1IBM L;  4A3F H;  4B3R L;  5IY0 A;  4BY1 H;  4LF9 Q;  4JI2 Q;  2UXB Q;  5AJ3 L;  2EQS A;  4JI7 L;  4HIO A;  4OX9 L;  1N9W A;  2L15 A;  1C9O A;  4C2M H;  3RNU A;  3HOY G;  4YWL A;  2F3I A;  1HNW Q;  4JI1 Q;  2UU9 L;  4JYA Q;  1KHI A;  4DUZ L;  4DR2 L;  3ICE A;  4JBK A;  1VQN A;  3PO3 G;  2R93 H;  4QQB X;  2K5V A;  1S40 A;  1CUK A;  4X64 Q;  4A3K G;  2Q2H A;  1YJW A;  4YHH L;  4WJ4 A;  3FP9 A;  2Q2T A;  1OTC A;  4DR7 Q;  5GAH C;  4LF5 Q;  4JI5 L;  4HJ9 A;  3K80 C;  1SRO A;  2YTY A;  4UY8 C;  4IO9 A;  4A75 A;  3M7N A;  4R1J A;  1JJC B;  2AWN A;  4OWT B;  4IJH A;  2VS1 A;  1N32 Q;  1L0W A;  3TEH B;  5LMU Q;  4HJ7 A;  3S16 H;  1Y1V H;  1X9N A;  4GN5 A;  4K0K L;  3G48 A;  1UWV A;  2OTJ A;  3T1Y L;  4JI3 L;  2VZA A;  4DPG A;  3GD7 A;  4A3C G;  2JA8 H;  1QUQ B;  4LF7 L;  1Q46 A;  3LGJ A;  1XNQ L;  4LFC Q;  1OXX K;  3PSI A;  4LNQ A;  4IPG A;  3JAM i;  3S1M H;  3AYH B;  1PVO A;  5GAD C;  4BY7 H;  1EOV A;  1PH4 A;  4OO1 G;  1VQK A;  4DKA C;  5JEA G;  4UP7 A;  4B3R Q;  5JJI A;  1HZC A;  4LUV A;  3J81 j;  1L1O A;  4HJ8 A;  5IYC G;  2K14 A;  3KJP A;  4P71 A;  1X54 A;  4DAM A;  2YV5 A;  1D8L A;  1KRT A;  1C0A A;  4JCV E;  3PUY A;  4DR5 L;  4GKK Q;  2PQA A;  2JEB I;  4GN3 B;  2JJQ A;  2KCT A;  3KF6 A;  1KD1 C;  4B3S L;  4B3M Q;  1XMO Q;  2LXJ A;  4YY3 L;  4LW1 A;  4TQU S;  4R4Q A;  1KAW A;  1SR3 A;  4JI2 L;  2ASB A;  3GTL H;  2MNA A;  4GOP C;  1D7Q A;  4GOP B;  1B70 B;  4DR6 Q;  2AHO B;  2R7Z G;  1Z47 A;  4JYA L;  1PV4 A;  4OWW B;  1X65 A;  3KJO A;  4JV5 Q;  4IPC A;  4JI8 Q;  1TWH H;  4X64 L;  2K52 A;  5J3B A;  5BR8 Q;  1AH9 A;  1E1T A;  4QL5 A;  1Y1W G;  3I4N G;  4GLV B;  4DR7 L;  4WJ3 M;  1HJP A;  3UDG A;  4X65 L;  4RG1 A;  1Q12 A;  1G29 1;  3W1B A;  4GKK L;  1TWC H;  1TWA H;  3PGZ A;  2VQE Q;  1A8V A;  4JBJ A;  2OWO A;  3SGI A;  3PIP A;  3GTG H;  4NXM L;  2E2I H;  4KHZ A;  1R9T H;  2IT1 A;  3I55 A;  2I5H A;  1VQL A;  1A62 A;  1VQM A;  2HIV A;  3CF5 A;  3I4M H;  4LWC A;  3HOZ H;  2IHF A;  3EBE A;  2N3S A;  3M3Y H;  3PO2 H;  1GD7 A;  1I50 H;  5C0X G;  2B29 A;  1QVC A;  4DR2 Q;  2A1A A;  4IJL A;  4BXX G;  1HH2 P;  4BBS H;  1VQD A;  3J80 c;  1N36 L;  4A3L H;  1MIU A;  1UEB A;  1BVS A;  1CKN A;  4A3B G;  1Q8K A;  1PYS B;  3MEF A;  1OXU A;  4MTN A;  4DAY B;  2ZJR A;  3E9I A;  5M3F G;  3ULJ A;  4DV1 Q;  4DV5 L;  4KLK A;  3G71 A;  1C7Y A;  4JI5 Q;  2A8V A;  2IY5 B;  1XPO A;  5EAY A;  1YEZ A;  3H0G H;  4A4I A;  2JK8 A;  3S14 H;  3KF8 B;  3F8T A;  4DUY Q;  2JA7 G;  5C4X G;  2I5M X;  5C4J H;  4GNX A;  4JI0 L;  4B3M L;  1XMO L;  2KHI A;  4O2D A;  2OTL A;  4APV A;  3STB C;  3T1Y Q;  4JI3 Q;  2K5N A;  3ER0 A;  3FHW A;  3F2B A;  2QA4 A;  4HJA A;  4A3J G;  1MKH A;  1GM5 A;  2JA6 G;  4LF7 Q;  4OON A;  1J6Q A;  5IYB H;  2QGQ A;  3W1G A;  4NPS A;  3WWV A;  4DK3 C;  2BA0 A;  1G6P A;  4P75 A;  4GLX A;  4AYB E;  3U58 A;  2ZJQ A;  2UXD L;  2GVB A;  3GTQ H;  3HOX G;  3KDF B;  1QVF A;  4JV5 L;  3EN2 A;  1U0L A;  2KCM A;  2R6G A;  4OO1 I;  2YTV A;  3ULL A;  3GDE A;  3NBH B;  1UE7 A;  3AEV A;  3KFU A;  3FKI H;  3L7Z C;  3TRZ A;  5JJK A;  2BA1 A;  1K73 C;  3OTO Q;  1XNR L;  2OQK A;  3RLO A;  1ASY A;  4YY3 Q;  5M5X H;  1Q7Y C;  2OCE A;  2VY3 A;  2KEN A;  4R4C A;  5GAE C;  1P8L A;  1IBL L;  4PZ7 A;  4OXP A;  1VQI A;  5IP7 G;  2WB1 G;  2I0Q A;  2K50 A;  1JMC A;  2PI2 A;  4PZ6 A;  3CD6 A;  3IRB A;  1I94 Q;  4DR4 Q;  3A74 A;  4J15 A;  1EQR A;  1WI5 A;  1VS0 A;  3UDF A;  3CCJ A;  2UXC L;  4IPH A;  3RZD H;  3BZK A;  2H5X A;  2UXB L;  2ID0 A;  4DV1 L;  1IYJ B;  4X65 Q;  3PIO A;  2B3G A;  2KHJ A;  3HKS A;  1XMQ L;  4R4O A;  3KOJ A;  3RLF A;  1S72 A;  1K8G A;  1WYD A;  2YU9 H;  2Z6K A;  3K0X A;  3HOU G;  4NXM Q;  4ME3 A;  1RL2 A;  3OYY A;  1FJG L;  2K4K A;  3NEN A;  4X6A H;  3PUZ A;  3I4O A;  4DUY L;  5LMN Q;  2HHH Q;  4O0A A;  3E0E A;  5M3M H;  4C3J H;  2D62 A;  4L5Q A;  4P74 A;  1EQQ A;  2DUD A;  4A76 A;  3TS2 A;  2MQH A;  1IXR A;  3I2Z A;  1KXL A;  3S1R H;  3CPW A;  5GQO A;  2E2J H;  5IE8 A;  1G51 A;  3J7Z C;  3GTK H;  2YYZ A;  4Y7N H;  1L1O C;  3HKZ E;  1L1O B;  3J80 i;  1BKB A;  1E1O A;  4POF A;  1N36 Q;  1BBW A;  5C0X I;  4DV6 Q;  4DR1 L;  3VDY A;  4JG2 A;  4A3F G;  4IFD G;  4DV5 Q;  3U4V A;  1HNX Q;  4JI6 Q;  4A3G H;  3RN2 A;  4JOI A;  2PQA B;  3NEM A;  2R7Z H;  5H1S E;  5JJL A;  3KF6 B;  4DV7 L;  1OXS C;  1IZ6 A;  1PHJ A;  1B7Y B;  3G6E A;  4R4I A;  1L2F A;  1NMF A;  1PA6 A;  1PH2 A;  5FLM H;  1QZG A;  2R93 G;  4JI0 Q;  1H95 A;  3GTJ H;  3OTO L;  4JI4 Q;  4JC0 A;  1YIJ A;  1N34 Q;  1Y1W H;  4UPA A;  3I4N H;  3UE0 A;  3CC2 A;  4DR3 L;  3TS0 A;  3CCR A;  4KHP Q;  3K8A A;  3AFQ A;  1A0I A;  1A63 A;  4L5R C;  4QY7 A;  1SRU A;  2I5L X;  2UXD Q;  1J5E L;  1QZH A;  2EXD A;  1KIX A;  1I94 L;  4DR4 L;  5ELO A;  1HZ9 A;  4A3M H;  2CWA A;  4DNI A;  1NBW A;  3I7F A;  2NVY H;  3AFP A;  3TRE A;  2DGY A;  1P16 A;  1VQ8 A;  1W3S A;  4NB3 A;  5C3E H;  1VQ7 A;  4BXX H;  2QEX A;  4JBM A;  5JEA J;  1SN8 A;  1T9H A;  1XNR Q;  4JI6 L;  1CKM A;  3PV0 A;  1OXT A;  4GN4 B;  4BY7 G;  4R4T A;  5M3F H;  1VQ5 A;  2NVQ H;  4A3D G;  1PH5 A;  5LMN W;  5LMN L;  3B6Y A;  1YJN A;  3NEL A;  1PH7 A;  2HHH L;  2IX1 A;  2B63 G;  1YIT A;  1IBL Q;  4PMW A;  2UUC L;  3S15 H;  1JJG A;  2WAQ E;  2WFW A;  1Y14 B;  5IYD G;  3K81 C;  1NJI C;  2K75 A;  4A93 H;  2JA7 H;  3U50 C;  1AE2 A;  3F2C A;  1EWI A;  1CKN B;  4L5T A;  1I5F A;  1HNZ L;  1NY4 A;  1VQH A;  2JA9 A;  1YVC A;  2JA6 H;  4DV6 L;  2AKW B;  4XTC S;  4YCU A;  2R92 G;  1HNX L;  4A3E G;  4FDB A;  4GNX C;  1TWF H;  1XMQ Q;  4GNX B;  4A3I G;  2VUM H;  1VQE A;  1FJG Q;  1SE8 A;  2Y0S G;  3HOW G;  3RLN A;  3HOV G;  4GKJ L;  3GTM H;  4OWX B;  4JI4 L;  4BBR G;  4LUO A;  1HR0 Q;  1N34 L;  2RHS B;  5FJ8 G;  1YI2 A;  1JE5 A;  5HY6 A;  5C44 H;  4X62 Q;  3M9B A;  2V1C C;  3PF5 A;  3PCO B;  1K8A C;  4LF4 Q;  1PH6 A;  2JEA I;  3T1H Q;  4KHP L;  4PZ8 A;  1M90 C;  1N33 L;  1X56 A;  2HQL A;  3RN5 A;  4DR1 Q;  1E24 A;  4POG A;  4AH6 A;  3I56 A;  3Q8D A;  5IP7 H; 
#chains in the Genus database with same CATH topology
 1X6O A;  2NZO A;  3K7U C;  4L6T B;  2QIL A;  4JVZ A;  4XQQ A;  4AYB G;  4FF3 A;  5A2Q E;  3EFX D;  3MVV A;  3D31 A;  1E2V A;  2HQE A;  3OWF A;  1EY0 A;  3MXG A;  2B2W A;  1LYL A;  1LM0 A;  4XDX A;  3D6C A;  3BJU A;  2EVB A;  1WCM G;  5EGT A;  3E3X A;  1J5E Q;  4LF8 Q;  1B8A A;  1B53 A;  3NUC A;  3SK4 A;  2KBN A;  2HDL A;  5FO8 B;  2VNU D;  2PZU A;  4DV2 Q;  1NR2 A;  3Q24 A;  1VF5 C;  3K6O A;  3CAM A;  5IYB G;  3NWS A;  1KRS A;  1WFQ A;  2VXW A;  2WB1 E;  2V4D A;  4XT1 B;  1C4Q A;  2R3Z A;  4Z9C B;  5I6Y A;  2RSO A;  1SMX A;  1HZA A;  2ZM6 L;  3NP8 A;  2PNR C;  1BCP D;  3H15 A;  4LF4 L;  3T1H L;  1ET6 A;  1XPU A;  1GVP A;  4K14 A;  3K5L A;  1CKO A;  3AQQ A;  3BDO A;  1LTL A;  3L3O C;  1STE A;  3D4R A;  3CP0 A;  1VQB A;  4HMJ A;  5JVG 3;  3VYR A;  4GKJ Q;  3DWA A;  1STA A;  4M1U B;  3S2H H;  5IWA L;  3PF4 A;  1OO9 B;  2X69 A;  3GTP H;  5CC4 A;  4XIG S;  4KN7 C;  1QUQ A;  3OMC A;  2QCP X;  1PH9 A;  2MP1 A;  3EJI A;  5M3M G;  3HS0 C;  4DV4 L;  4ALP A;  2PNH A;  5KIX A;  4WFN 3;  1JOQ A;  4IFD J;  3I70 A;  4EQN A;  2R7Z B;  3QWN A;  3J81 i;  1EYG A;  3LWU A;  1N8R C;  1WOC A;  1PH3 A;  4A3B H;  4NXN Q;  5ELC A;  4KY7 A;  5GRO A;  1STY A;  3SHL A;  3S2H B;  2MFI A;  1MSG A;  1J9O A;  4CHT B;  5I6W A;  2IX0 A;  3NBI A;  3DLL A;  3GTP B;  2A6E C;  2HDM A;  1VQG A;  5C4X H;  4GOP A;  3CCU A;  1SNQ A;  5G3L F;  1HTP A;  5E3F A;  1U4M A;  3K58 A;  3IAY A;  1PRT B;  2RCN A;  4A3J H;  4LF5 L;  1TY2 A;  3K7A H;  2Z0S A;  2VQF Q;  4LUZ A;  3NE5 B;  4QJF A;  1CA5 A;  5E7N A;  4PG3 A;  3F1Z A;  4ABN A;  1E22 A;  2R7D A;  5BN3 A;  5AJ3 Q;  5IT9 c;  2PYK A;  4A3B B;  1WTH A;  2DNE A;  2I46 A;  1SLJ A;  2XNA C;  4TRD A;  2UU9 Q;  1IW7 C;  4DV0 Q;  4RFB A;  2ATW A;  4LFC L;  1FGU A;  3UE1 A;  1CI3 M;  5C4X B;  2ZTC A;  5EBC A;  1JOK A;  3A55 A;  1NMG A;  5KNC A;  4A3J B;  3KLR A;  1D5M C;  1QB5 D;  1W6J A;  2C35 B;  3CME A;  1PH1 A;  3K7A B;  3PUV A;  1G2T A;  4YCW A;  3H3V C;  4K0K Q;  2F52 A;  2ZTE A;  1O7I A;  1SYB A;  3KF8 A;  2PZW A;  4BWG B;  4AQY L;  1B2T A;  4HIK A;  1PZI D;  2RHQ B;  2JYO A;  4KY5 A;  3RR5 A;  3H0G G;  5CV9 A;  1X3F A;  3LWE A;  4O1N A;  5I9P A;  4RGO S;  2A5H A;  3I90 A;  3R3O A;  2NN6 H;  4N8F A;  2VQE L;  1BBX C;  1PTO F;  4JBW A;  4DXG A;  1LT3 D;  4LF9 Q;  3I4L A;  3A8J E;  2EQS A;  2HCI A;  3HG9 A;  3TZD A;  1C9O A;  2LS0 1;  2E2D C;  3CRK C;  3RNU A;  3SR1 A;  4WJW A;  2WAC A;  4JI1 Q;  5L37 A;  2WII B;  4E6I A;  3ICE A;  4JBK A;  2MUY A;  3PO3 G;  2R93 H;  1S40 A;  2B2Y A;  2Q2H A;  1YJW A;  3FP9 A;  1OTC A;  5A35 A;  1TY0 A;  4KMU C;  3K80 C;  3KUP A;  4NMZ A;  2YTY A;  4UY8 C;  1KLG D;  1JJC B;  4J1M A;  5KYI A;  4OWT B;  4IJH A;  2VS1 A;  2F0T A;  1X9N A;  1DXM A;  5C3X A;  4NDX A;  3T1Y L;  2VZA A;  3GD7 A;  1HCZ A;  5FOB B;  4A3C G;  2BE5 C;  3P20 A;  2EYH A;  5KNB A;  1FYC A;  5DAU A;  3S1M H;  3JAM i;  2A69 C;  5FKA C;  2R93 B;  3HZX A;  3DWP A;  5JEA G;  1HZC A;  4C56 C;  2K14 A;  4P71 A;  4DAM A;  1LV9 A;  2YV5 A;  1UUP A;  4DR5 L;  2EXZ A;  1U4R A;  4GN3 B;  3T56 B;  1KD1 C;  1NR4 A;  2B2T C;  1XMO Q;  2IJ0 A;  4LW1 A;  4XYQ A;  4TQU S;  4R9W A;  1TR5 A;  4B9X A;  2MNA A;  4JK1 C;  2K33 A;  4KD4 A;  1Z47 A;  2LMC B;  2FMM A;  1EYA A;  3T51 B;  3S1M B;  4JI8 Q;  1TWH H;  3VR4 A;  4X64 L;  1GOZ A;  1EY6 A;  3I4N G;  4DR7 L;  1HJP A;  4X65 L;  3W1B A;  1H9M A;  1A8V A;  2E2I H;  1BQQ T;  1F77 A;  2IT1 A;  3BG3 A;  3ZYY X;  1VQL A;  1JOR A;  5ISR A;  2NUC A;  4FO2 A;  1VQM A;  2L12 A;  4MIU A;  3RUZ A;  1ICW A;  2R92 B;  2EY1 A;  4JW0 A;  1B4O A;  1VQD A;  3J80 c;  1WTV A;  1N36 L;  4G57 A;  1PYS B;  4DAY B;  4JI6 L;  4B3R L;  2A73 B;  2UXB Q;  1TWH B;  4KLK A;  3G71 A;  1I4G A;  1XPO A;  1YEZ A;  3S14 H;  3AMU A;  1IHZ A;  1EY8 A;  2I5M X;  4B9W A;  5C4J H;  1O80 A;  2B39 A;  2E2I B;  3STB C;  4JI3 Q;  3FPP A;  1V1O A;  2QA4 A;  1ENC A;  1GM5 A;  5I4D A;  4LF7 Q;  5IYB H;  5J1Z A;  2QGQ A;  3W1G A;  1FR3 A;  4GLX A;  4RKB A;  4U67 3;  2EJM A;  2KVM A;  3NK9 A;  2RCF A;  2GVB A;  1A6X A;  3HOX G;  2M9V A;  1IKM A;  1ILP A;  3ULL A;  1WTQ A;  4ZUI A;  3NBH B;  1UEA B;  1RCV D;  2AQ2 B;  2EJF C;  4FNF A;  5FO9 B;  4R8I A;  1ASY A;  4YY3 Q;  2JP1 A;  3S14 B;  2KEN A;  5C4J B;  1HQM C;  4LMQ D;  4WRD A;  1SYE A;  4PZ7 A;  4CJ0 B;  1GUO A;  1VQI A;  1FNV A;  1JMC A;  3QOL A;  1MI2 A;  2A6H D;  3CD6 A;  2QKI C;  1II3 A;  4J15 A;  4DFA A;  1D1K A;  2F3V A;  2DNC A;  4N8X 1;  4PMC A;  3RZD H;  1K3B C;  4K8I A;  3NQI A;  2KHJ A;  3HKS A;  4DA2 A;  2H4O A;  3RLF A;  3KOJ A;  3PIO A;  3CU7 A;  5CGK A;  1BNZ A;  5M3M H;  1WD0 A;  4P74 A;  3E6Z X;  1A3U A;  3I2Z A;  2B2V A;  1S5E D;  3CPW A;  5GQO A;  1CQF A;  1H9R A;  1KDC A;  3GTK H;  4H7B A;  4POF A;  4DV6 Q;  4N9P A;  4A3F G;  2KQ3 A;  1ONL A;  1MD2 D;  3DEP A;  2RKS A;  2HUG A;  5DM7 3;  1IZ6 A;  3RZD B;  1HRJ A;  1NMF A;  2XSC A;  1QZG A;  4JI0 Q;  3KBG A;  4DAP A;  4HTH A;  5DM6 3;  5M3M B;  4RA8 A;  3CC2 A;  2RDH A;  2A68 C;  4KKS A;  3K5N A;  2O5I C;  1JIC A;  1SRU A;  4TSS A;  1J5E L;  2MJ8 A;  2G9D A;  1I94 L;  1BXT A;  2B8F A;  3GTK B;  2CWA A;  3I7F A;  2K5Q A;  2NVY H;  3AFP A;  1EQT A;  1TS5 A;  2P5Z X;  2SNS A;  4NB3 A;  2OXP A;  5JVH 3;  1IL8 A;  1SN8 A;  5KEE A;  1GXD C;  1XNR Q;  1E0B A;  2CQA A;  1PH7 A;  3PIO 3;  1YIT A;  1IBL Q;  2WAQ E;  2DY8 A;  2QEJ C;  2EY5 A;  1AE2 A;  3F2C A;  1NY4 A;  1J8I A;  1ILQ A;  1YVC A;  2JA6 H;  2D2C C;  4FDB A;  5TSS A;  2NVY B;  3QG1 A;  1TWF H;  1W6K A;  4NW2 A;  3P1H A;  5AFW A;  3GV3 A;  4GKJ L;  3GQB A;  4KKU A;  1M4V A;  1A2T A;  2EYJ A;  1HR0 Q;  2RHS B;  1YI2 A;  3MXU A;  1JE5 A;  4X62 Q;  1JWM D;  1XTC D;  3OWE B;  4Q5V A;  1PH6 A;  3QOJ A;  4KHP L;  1ZEQ X;  1EQV A;  3RN5 A;  4POG A;  4MN3 A;  1TWG H;  2JA6 B;  2B2W C;  1LTG D;  3PO3 H;  1XYI A;  1AEX A;  1X3E A;  1H9S B;  1TWF B;  2FIN B;  5D65 A;  1XJV A;  3PUX A;  4IOA A;  4G4K A;  1XPR A;  2XN9 C;  1JE4 A;  2FMC A;  5FO7 B;  3OW2 A;  4MNO A;  1FNU A;  3NXW A;  4HCS A;  4IOC A;  2M2L A;  2PMZ E;  1HUN A;  3MXN B;  2IW3 A;  1Z9F A;  1KQS A;  1STG A;  2IHE A;  3M4P A;  1PFM A;  1CA6 A;  3CHB D;  1GUN A;  4LFB Q;  2GN5 A;  4I65 A;  2F0L A;  4P73 A;  3RZO H;  4A3C H;  2E74 C;  3A56 A;  2VQF L;  1TWG B;  2RF4 A;  4X3K A;  2XIW A;  1JT8 A;  2F0P A;  3D0F A;  3TBI B;  1A15 A;  1EIG A;  3PO3 B;  2DJF C;  2EDG A;  5M5Y H;  1MBY A;  5CYU A;  3O13 A;  1SXT A;  1TQO A;  3NHH A;  4UP9 A;  2YTX A;  4DV0 L;  3FPU B;  2I07 B;  3VYS A;  1VQA A;  2NN6 G;  1NNX A;  4LAA A;  1KDB A;  4MTK A;  3GTO H;  2EE1 A;  2PO4 A;  1HFN A;  4IUT A;  4HMI A;  3RZO B;  4BA2 I;  1VQC A;  4EGV A;  4KV6 A;  4ZKC B;  2F4V Q;  3IFT A;  2Q2I A;  4HED A;  1KL9 A;  1X3G A;  1EUJ A;  4KHV A;  5M5Y B;  1XTD A;  1EZ8 A;  2R7F A;  3OPO A;  2BCO A;  2CHB D;  3ZJY C;  3L2P A;  1N33 Q;  4A3D H;  5ELN A;  1ESR A;  5COR A;  2N78 A;  2M00 A;  3CC7 A;  2CKZ B;  3GTO B;  3CKI B;  4KI0 A;  1SND A;  3TQY A;  4DNT B;  4X66 Q;  2K03 A;  4LF9 L;  5D3D A;  1HHV A;  4A3E H;  1DM0 B;  4ME5 A;  3M4Q A;  4A3G G;  4A3I H;  3I4N B;  3I91 A;  4JI1 L;  3HOW H;  3CPF A;  1EZ6 A;  4DF7 A;  1LTS D;  1PYB A;  3S24 A;  4EX5 A;  3T4A C;  1E2Z A;  1O7Z A;  1VCI A;  3ITP A;  1TXY A;  1VQ9 A;  5LL6 S;  2CVR A;  3H3V H;  4IPD A;  4M8A A;  2AQ3 B;  4K6D A;  1IBM Q;  3QO2 A;  1IBK L;  1UE1 A;  3HOX H;  2K28 A;  2OEO A;  4Q0F A;  4JI7 Q;  2E5L Q;  1EFW A;  5CBE E;  4H44 C;  4A3E B;  1YZ6 A;  1HPC A;  3IKJ A;  4EQO A;  4A3I B;  3UDI A;  2Y0S B;  3E5S A;  4LJZ C;  3HOW B;  3PUW A;  4YHH Q;  1BUV T;  4BA1 I;  1K9M C;  1E7Z A;  5HGQ A;  5C0X J;  1SAP A;  3ULP A;  2NN6 I;  4UP8 A;  3H91 A;  1ASZ A;  4DAY A;  1SE4 A;  4OEM B;  5EKI A;  1V1Q A;  1PFS A;  1YNJ C;  2ENB A;  3AU7 A;  1LAC A;  4LFA Q;  4LF6 Q;  1MJC A;  1SE2 A;  4GLA C;  3VR5 A;  2CCZ A;  1KTK A;  3V96 A;  3HOX B;  4FYD A;  3BU2 A;  1VQ6 A;  2NVX H;  2JA5 H;  1XNQ Q;  2HCC A;  2VUM G;  1LT5 D;  2WP8 J;  2F0H A;  3S1N H;  1SJH D;  5IP9 H;  3Q0A A;  4JI8 L;  2K5H A;  4G7O C;  1IL2 A;  2EIF A;  1PH8 A;  2F4I A;  4GS3 A;  1EIY B;  1UE5 A;  1YHB A;  5C44 G;  3U9S A;  1AN8 A;  4B3T Q;  4RMF A;  4YCV A;  1I4X A;  3NBH A;  4A3F H;  4JI2 Q;  1I6V C;  4OX9 L;  3BVZ A;  1F2M A;  1KAA A;  1ZYR C;  2B2Y C;  1C48 A;  1HNW Q;  5EPJ A;  4JYA Q;  1KHI A;  4DUZ L;  2NVX B;  1F9S A;  1EL0 A;  1VQN A;  3SK8 A;  2JA5 B;  2K5V A;  1DOM A;  4A3K G;  1IYV A;  2Q2T A;  3S1N B;  4IN3 A;  1DYQ A;  3BZD B;  4R1J A;  3K5O A;  1EEI D;  2AWN A;  1YNN C;  1G8Z D;  3TEH B;  3S16 H;  1DOK A;  1Y1V H;  3GP7 A;  4GN5 A;  4J8Q A;  1UWV A;  4A3F B;  4JI3 L;  1RHP A;  3A54 A;  3W3A A;  4DPG A;  2JA8 H;  3H09 A;  4LF7 L;  3OHX C;  1OXX K;  4K5X A;  1EOV A;  1B1Z A;  1VQK A;  1QG7 A;  5C5L A;  4HJ8 A;  5IYC G;  1X54 A;  4DU9 A;  5K36 H;  1C0A A;  1GHK A;  3DWQ A;  4DNR B;  4B3S L;  3R2T A;  2LXJ A;  2XRS D;  1LAB A;  4YY3 L;  3S16 B;  2DN8 A;  1Y1V B;  1KAW A;  4IUR A;  2RDF A;  2G5D A;  2RSN A;  1M8A A;  5EKL A;  4IUU A;  2JA8 B;  4F8M A;  1PV4 A;  1SMY D;  5I2Y A;  4OWW B;  2J7Z A;  3N6R A;  4IPC A;  1AH9 A;  3NPP A;  4WJ3 M;  1BCP C;  1BO0 A;  1TWA H;  3PGZ A;  4JBJ A;  3SGI A;  4C1N I;  4UAI A;  4HAE A;  4KHZ A;  1R9T H;  2I5H A;  1A62 A;  4NP5 A;  2HIV A;  2IHF A;  2WIN B;  2N3S A;  3M3Y H;  1I50 H;  2CH4 W;  2QF7 A;  4DR2 Q;  3D8G A;  1EU3 A;  4IJL A;  1U4P A;  2L9H A;  1CM9 A;  4A3L H;  1MIU A;  4B08 A;  1Q8K A;  5HGT A;  1SFO H;  1OXU A;  3E9I A;  4DV1 Q;  4JI5 Q;  2F0K A;  3OSO A;  1C7Y A;  1LT4 D;  1XXG A;  3HEJ A;  3VR3 A;  4A4I A;  2JK8 A;  3VYT A;  1WTR A;  1SYD A;  2EOT A;  2XWJ B;  4ID6 A;  4IQZ A;  1TWA B;  4JI0 L;  3D4W A;  4H13 C;  5IT9 L;  4B3M L;  1R9T B;  1I4H A;  1I4R A;  2K5N A;  5HUR A;  3FHW A;  5JOB A;  4HJA A;  4FXG C;  2JA6 G;  4OON A;  1J6Q A;  1G6P A;  3ERQ A;  4NPS A;  2BA0 A;  3M3Y B;  1HA5 A;  1V1P B;  1I50 B;  3FMC A;  3KLS X;  4JV5 L;  2KCM A;  2R6G A;  2YTV A;  1SFO B;  5IGF A;  3TRZ A;  1X3P A;  1MSH A;  1I4P A;  5JJK A;  3SDZ A;  3J81 L;  1XNR L;  5KGU A;  3RLO A;  2PMZ B;  2F0U A;  1Q7Y C;  1H9S A;  2Q8R E;  3WOF A;  1KAB A;  1LTI D;  1IBL L;  5ELD A;  3A8I E;  5D14 A;  2PI2 A;  3IRB A;  3MXN A;  3J7A F;  1EYC A;  2Z1C A;  1EQR A;  1VS0 A;  3UDF A;  4KK7 A;  3CCJ A;  2UXC L;  4IPH A;  2H5X A;  5C5M A;  4C3H G;  2B3G A;  1EWH A;  3K0X A;  2NYZ D;  5JPM C;  5J39 A;  4ME3 A;  1RL2 A;  2F0M A;  3OYY A;  2K4K A;  5J22 A;  4OO1 H;  3P75 A;  4DUY L;  4YIJ A;  2D62 A;  1PRT D;  2DY7 A;  3L9A X;  5C3W A;  1RF2 D;  2MQH A;  1IXR A;  1KXL A;  3S1R H;  5IE8 A;  2L4N A;  5T1I A;  2BDN A;  4Y7N H;  1L1O C;  3SK5 A;  2L11 A;  3HKZ E;  3J80 i;  1BKB A;  1E1O A;  1BBW A;  3VDY A;  4JG2 A;  1HNX Q;  4A3G H;  3RN2 A;  2PQA B;  1ZKO A;  2LFN A;  5H1S E;  2F0W A;  2F0G A;  3G6E A;  1PA6 A;  1L2F A;  4ODG A;  1PH2 A;  1HA6 A;  1RTN A;  4FF4 A;  4HN7 A;  3OTO L;  5EBD A;  3CCR A;  3K8A A;  3FVQ A;  1A0I A;  3VR6 A;  1FD7 D;  4QY7 A;  3S1R B;  2UXD Q;  1KIX A;  4DR4 L;  1JCK B;  4Y7N B;  4N9T A;  1JWS D;  5JJZ A;  1NBW A;  1SJE D;  5C0X H;  3NTH A;  4A3G B;  1P16 A;  1W3S A;  3TP6 A;  1EIH A;  4JBM A;  5JEA J;  4ZUJ A;  4DXF A;  1VQ5 A;  4A3D G;  1PH5 A;  5LMN W;  5LMN L;  3B6Y A;  2HHH L;  3A7A B;  4KTA A;  4PMW A;  4F88 A;  1Y14 B;  2KHS A;  2K75 A;  2JA7 H;  5FLX L;  1EWI A;  3D3R A;  3ND8 A;  4L5T A;  2SEB D;  1F2Y A;  1VQH A;  2JA9 A;  1B50 A;  3FRP B;  2AKW B;  4ZCK A;  4YCU A;  2SOB A;  2L55 A;  4A3E G;  4GNX C;  4PQX A;  4A3I G;  2VUM H;  4K5V A;  3VA5 A;  1SE8 A;  2Y0S G;  3HOW G;  3GTM H;  4DK1 A;  1PTO H;  5I2X A;  4OWX B;  1O7L A;  4JI4 L;  3NWT A;  1N34 L;  4QMG A;  2EY6 A;  5C44 H;  3M9B A;  3PF5 A;  3PCO B;  1K8A C;  4LF4 Q;  1VMP A;  3JAM L;  3R93 A;  3T1H Q;  2JA7 B;  1N33 L;  1Y8P B;  1Q8I A;  4DR1 Q;  2E75 C;  3Q6S A;  4GZY C;  5M9O A;  1DGS A;  1GO3 E;  3I4M G;  1WTP A;  1Q86 C;  1WTW A;  3PO2 G;  3E9H A;  2CWP A;  1CFM A;  4A3K H;  1EY7 A;  2VUM B;  4RGN A;  2Q2U A;  4X66 L;  4UDU C;  5IWA Q;  3F2D A;  4BBS G;  2LXK A;  3GTM B;  4KY6 A;  1PTO B;  3N52 A;  1YHQ A;  1RIP A;  1UE6 A;  2F0V A;  3C1E A;  1S5D D;  1I4Q A;  3EA6 A;  3TDQ A;  4K2K A;  1SEB D;  3ND9 A;  3QJY A;  2N49 A;  5C44 B;  2BH2 A;  4CKC A;  4DV4 Q;  4FF1 A;  1HZB A;  2Z6K C;  4PV1 C;  3CMA A;  2QDL A;  1C8C A;  4G7H C;  2F03 A;  2WB1 B;  2D0P A;  2O4X A;  1K3R A;  2FXQ A;  2JA5 G;  1AE3 A;  2HT1 A;  4IFD H;  1TS2 A;  2VB2 X;  3G7L A;  3L0O A;  4A3K B;  2E5L L;  5IYC H;  5IP9 G;  1AP0 A;  1ML0 D;  1PZJ D;  5DLQ E;  1WTX A;  2JE6 I;  1O7Y A;  1TII D;  1HNZ Q;  1Y8O B;  4JOI C;  3DXJ C;  4ZK9 B;  1WJJ A;  3KLS A;  1LLR D;  1DD2 A;  4KD3 A;  3U9O A;  1E3P A;  3TZU A;  2K05 A;  5C4H A;  1K0R A;  1R4P B;  1DJR D;  1BDO A;  2F0N A;  3M4Y A;  3H94 A;  3HFZ B;  4LFA L;  2CFM A;  4P72 A;  4LF6 L;  2O5J C;  3BDL A;  1OXV A;  2XTI A;  4AIM A;  3E0J A;  2F0O A;  2L5T A;  2XGT A;  1KC8 C;  1M1K C;  2D5D A;  1CSQ A;  2B63 H;  4LF8 L;  1Y1V G;  3HP3 A;  2DJG C;  1FNW A;  4HCE A;  3H3V I;  2PZT A;  3MFG A;  3R8B A;  4C1N K;  3W2D A;  2A6H C;  4DV2 L;  2D0O A;  2JA8 G;  3CCS A;  1CT1 D;  4B3T L;  5CMD A;  2GA4 B;  3VYU A;  1K28 A;  4AQY Q;  4R8N A;  2B2T A;  4FVM A;  1GUG A;  3A8K E;  3A0J A;  2R61 A;  1LUZ A;  1HNW L;  1T5X D;  3HOV H;  2IWH A;  5K36 G;  2AWO A;  2CH4 A;  1TS4 A;  2LSS A;  2IX3 A;  5FLM G;  2WAQ G;  4X3U A;  1BCP F;  5FJ8 H;  1K83 H;  4HID A;  2B63 B;  1PTO D;  4HIM A;  1VF7 A;  2WKC A;  3HRZ C;  4V19 0;  1KNE A;  2UUA Q;  3BYT B;  3CCV A;  4ZYS A;  2K04 A;  2NZ1 D;  2VB3 X;  1BBU A;  5IT9 E;  4X3T A;  4RHR A;  3A5Z B;  2VW9 A;  1JJ2 A;  1RJT A;  2OQ0 A;  1U9R A;  3S17 H;  1Q1E A;  3U4Z A;  1CZG A;  4QIW E;  3HOV B;  4C3I H;  4EQ5 A;  1EWC A;  1MGS A;  5EQ0 A;  3VA7 A;  2XWB B;  3CQZ H;  4YWK A;  2UUB Q;  5KYL A;  1G91 A;  1FVI A;  1K83 B;  4RCO A;  4XYO A;  1H9J A;  4H02 A;  4TKO B;  5FK9 C;  3J81 E;  2CW0 D;  1X55 A;  2EYM A;  2MHV A;  3CCL A;  3CC4 A;  1NCV A;  4A3L G;  4NXN L;  3SXH A;  4C3H H;  3S1Q H;  1CSP A;  2NZH A;  1NTG A;  2FFK B;  5NUC A;  5IOC A;  1SDF A;  3S17 B;  4QUC A;  1V1P A;  5DEH A;  4C3I B;  3MWY W;  1QVG A;  2N8N A;  4DR5 Q;  3GO5 A;  1PYW D;  3CQZ B;  4DV3 Q;  3BZC A;  1GJX A;  1SNC A;  4HJ5 A;  4BY1 H;  3T13 A;  5AJ3 L;  4HIO A;  1N9W A;  2L15 A;  1Y8N B;  4CKE A;  1X3Q A;  3HOY G;  4ZAI A;  4WOR A;  2UU9 L;  4C3H B;  4DR2 L;  4H0L C;  4OHJ A;  3S1Q B;  1SYC A;  4QQB X;  1K8O A;  1CUK A;  4X64 Q;  5IGE A;  4OGQ C;  1SBB B;  4DR7 Q;  5GAH C;  1EY4 A;  4JI5 L;  4HJ9 A;  1DZ1 A;  1JQY D;  4A75 A;  1N32 Q;  5LMU Q;  4HJ7 A;  2K5W A;  3TP7 A;  1QIL A;  4K0K L;  4FXK C;  5IGG A;  2OTJ A;  4BY1 B;  1Q46 A;  3HKZ B;  1LO5 D;  5ELE A;  3LGJ A;  3PSI A;  2KEE A;  4ZKB B;  4LNQ A;  1PVO A;  3AYH B;  5GAD C;  1HXY D;  4OO1 G;  2EYL A;  1ZXT A;  4DKA C;  4B3R Q;  3K57 A;  4LUV A;  5CV7 A;  3J81 j;  2AQ1 B;  3DHQ A;  3DMU A;  3PUY A;  3V2T A;  2PQA A;  1RKN A;  2JEB I;  2Z4H A;  2JJQ A;  2KCT A;  1BOS A;  1F2Z A;  4QB4 A;  2ASB A;  3GTL H;  1PLF A;  4GOP C;  1PZK D;  2QW7 A;  4G7Z C;  2AUK A;  4DR6 Q;  1U4L A;  5FLX E;  3BVM A;  2BDO A;  2L1B A;  5BR8 Q;  4A3D B;  2KEC A;  1Q12 A;  1G29 1;  4XQJ A;  5JPN C;  3PIP A;  1STB A;  3CF5 A;  3I4M H;  4LWC A;  3PO2 H;  1GD7 A;  3K59 A;  3GTL B;  1D2B A;  5C0X G;  3Q23 A;  1QVC A;  1EYD A;  3JAM E;  2JN4 A;  1HH2 P;  1ICF B;  4BBS H;  1UEB A;  5DNF A;  1A3T A;  1JC7 A;  2QDB A;  3MEF A;  4MTN A;  4XXE A;  2LY7 A;  3ULJ A;  2IY5 B;  5BN5 A;  5EAY A;  1Z6H A;  1PFN A;  3MA2 B;  2JA7 G;  1SNP A;  1XMO L;  3RMH A;  2OTL A;  3X3M A;  3ER0 A;  3F2B A;  1MKH A;  4KJN A;  2JSO A;  3I4M B;  4DK3 C;  3GV6 A;  3BS1 A;  2HD3 A;  3PO2 B;  4AYB E;  4CDD C;  3U58 A;  4KKT A;  2UXD L;  2B2U A;  1QVF A;  3KDF B;  4BBS B;  1U0L A;  4OO1 I;  3AEV A;  3L7Z C;  1L0X B;  2RVL A;  1K73 C;  2OQK A;  4PNY A;  5M5X H;  1X32 A;  4ULL A;  1P8L A;  3PIP 3;  2WB1 G;  2K50 A;  5T1G A;  2SDF A;  2ICE C;  3NQT A;  2NB0 A;  1I94 Q;  4RGT A;  3A74 A;  3PMF A;  3ERO A;  1WI5 A;  1XWE A;  1GUT A;  2PCF B;  2UXB L;  2YU9 H;  4GKK Q;  1WYD A;  1HUM A;  4NXM Q;  4X6A H;  3UI2 A;  3NEN A;  1F2L A;  2A6E D;  3PUZ A;  4L5Q A;  5E1F A;  4V0B A;  1EQQ A;  5M5X B;  3MAQ A;  3KBX A;  1G51 A;  3J7Z C;  3OIQ A;  1SYG A;  1L1O B;  4I7A A;  5C0X I;  4DR1 L;  2JXM B;  4IFD G;  4DV5 Q;  3U4V A;  2H1E A;  3M7G A;  4IAL A;  2R7Z H;  1NUC A;  3BVG A;  1B3Q A;  3KF6 B;  1WD1 A;  1PHJ A;  1B7Y B;  4R4I A;  4OL7 A;  1IW7 D;  2YU9 B;  3NTK A;  5FLM H;  1H95 A;  4JPB W;  3GTJ H;  2K7V A;  1A3V A;  4RGM A;  1YIJ A;  5COY A;  1Y1W H;  4UPA A;  3WDN A;  3K5M A;  4RWS C;  3H6M A;  2B8G A;  1QJO A;  3TS0 A;  4KHP Q;  3MHB A;  2NBF A;  4L5R C;  2J0T D;  5KRU A;  2EXD A;  2Q8I B;  1HTL D;  1Y69 U;  3TRE A;  3AB9 A;  2DGY A;  4IUQ A;  1VQ8 A;  4BXX H;  3PQI A;  5KND A;  2Z6B A;  3V05 A;  2NWG A;  1CKM A;  4HSV A;  4BY7 G;  1TU2 B;  1GUS A;  5E4W C;  5M3F H;  1YJN A;  2WAQ B;  2IX1 A;  3S15 H;  2B63 G;  4L8J A;  3GTJ B;  1JJG A;  1Y1W B;  4RH6 A;  1NJI C;  4P2C B;  3U50 C;  2F0F A;  1CKN B;  2PW5 A;  5LHY 1;  5IIF A;  3A7L A;  1HNZ L;  3SK6 A;  3R2I A;  3D6W A;  3KK7 A;  4DV6 L;  4XTC S;  1DOL A;  1D5Z C;  1XMQ Q;  4GNX B;  1CHP D;  1QCB D;  1VQE A;  1FJG Q;  3SEB A;  5IGC A;  3RLN A;  3HOV G;  5CV6 A;  3MTS A;  1UNS A;  1TT2 A;  3J7Y W;  5FJ8 G;  5M3F B;  3S15 B;  3NSW A;  4QIW B;  1SNM A;  3RD4 A;  1LTR D;  2JEA I;  3CRL C;  1X56 A;  2ICI A;  2TSS A;  1E24 A;  4AH6 A;  3Q8D A;  5I9O A;  5IP7 H;  3HOY H;  1DCZ A;  2XVS A;  3HOZ G;  4DV7 Q;  1SMY C;  4IFD I;  2BE5 D;  1YHA A;  3T16 A;  3CCQ A;  3M85 A;  2PQE A;  5E4X A;  2EY2 A;  3J81 c;  1W2B A;  1CK1 A;  2A69 D;  1RTO A;  2AMC B;  2RQX A;  4C3I G;  4UHV A;  1MJE A;  1F9Q A;  5ELF A;  4DR3 Q;  3HOU H;  3J7A V;  1CQV A;  2PI2 E;  3QIA A;  2KCC A;  5F2D A;  1JB7 A;  1EY9 A;  1NAP A;  2D9U A;  4U68 A;  2KED A;  3HOY B;  2A19 A;  2UUA L;  1EIF A;  1JOO A;  3FEW X;  1VQF A;  3CXC A;  2GVA A;  2JQO A;  3EIV A;  2PW7 A;  2B2V C;  2RDG A;  1R4Q B;  4YWM A;  4ILW A;  2UUC Q;  1QNK A;  1HR0 W;  1HR0 L;  3EVQ A;  4X62 L;  3FKI G;  3HOU B;  4ZLT F;  5GAG C;  3CCM A;  2XRQ D;  2NTS A;  1U5K A;  1K0S A;  4CBV A;  1F9P A;  3SE0 A;  4BY1 G;  1T5E A;  1RD9 D;  2UUB L;  3HKZ G;  2ZTD A;  2KJX A;  2SNM A;  3G4S A;  1IBK Q;  2MO0 A;  2HIX A;  3A5U A;  1VQP A;  2Q8T A;  4QCL A;  3DEO A;  3F2U A;  2BOS A;  1XX8 A;  3DM3 A;  1V8Q A;  2L0C A;  2ZT9 C;  4S3S A;  3OOC A;  3VR2 A;  2VL6 A;  2BH8 A;  2J4X A;  2C9O A;  3CCE A;  4EQP A;  1O78 A;  4LFB L;  5IYD H;  5CV8 A;  4C3J G;  1F9R A;  1Z7T A;  3STB D;  1S5B D;  1I6H H;  4DV3 L;  4J6H A;  2MO1 A;  5IGD A;  4IUV A;  3S2D H;  2N88 A;  2LKV A;  3CW2 C;  1FL0 A;  2R92 H;  1RDP D;  2A74 C;  5IOD A;  3KLW A;  1TKW B;  1VQO A;  1JR0 D;  5FLX c;  4TVA B;  3DM1 A;  3J7A 5;  4K2L A;  4BBR H;  1PRT C;  1YBY A;  5K5P A;  4CDF C;  1K8M A;  2ES2 A;  1AFP A;  1GKH A;  2NVT H;  4L5S A;  4CDE C;  1VQ4 A;  2N55 A;  1S3O A;  4EVO A;  1N32 L;  5LMU L;  4I7Z C;  1I6H B;  5CV5 A;  5C6A A;  1V43 A;  4OX9 Q;  2F4V L;  3S2D B;  1V9P A;  2TMP A;  4A3M G;  3OMG A;  2ZM6 Q;  2E2H H;  4DUZ Q;  1Q82 C;  2X6G A;  4L63 B;  4FP5 D;  1YNX A;  3TP5 A;  4CDC C;  3TN2 A;  5C3E G;  3JAM c;  4MZ9 A;  3Q22 A;  3UDX A;  3J80 L;  1VQJ A;  2Y0S E;  4Y52 H;  4BS9 A;  4BBR B;  1WCM H;  1NSN S;  1Q81 C;  2ZXP A;  2F1M A;  3JC6 6;  3C2P A;  1Q1B A;  3D4D A;  4QGU A;  4DK6 C;  2NVT B;  4A93 G;  2EJG C;  4K8J A;  1PMR A;  4RAU C;  2ZJP A;  1YJ9 A;  4DGZ A;  1PFB A;  3KYH C;  2EPB A;  4AYB B;  1KDA A;  2CQO A;  4OIK A;  4DR6 L;  2E2H B;  1QWY A;  2ALY B;  2K5D A;  5EPL A;  5BR8 L;  3W5O A;  1NE3 A;  3KDF A;  2E8G A;  4QF4 A;  5A2Q L;  1WCM B;  5D3I B;  5M5W H;  2EZV A;  1I3Q H;  3ERS X;  4B3S Q;  4RHS A;  1SYF A;  2FHT A;  1EEF D;  2A68 D;  4CJ2 C;  1IBM L;  2OT2 A;  5IY0 A;  4XQN A;  4JI7 L;  2E76 C;  3NTI A;  4C2M H;  1S4Z A;  1ESF A;  4YWL A;  2F3I A;  2X6L A;  1BF4 A;  5G3L D;  5JAV A;  4NKL A;  1STH A;  4YHH L;  4WJ4 A;  1GUW A;  1CZW A;  4LF5 Q;  3OW7 A;  2WKD A;  1SRO A;  3IL8 A;  4KJO A;  4IO9 A;  5CR3 A;  4DAV A;  3M7N A;  1L0W A;  5M5W B;  1AW7 A;  1QNU A;  1I3Q B;  3WOE A;  3G48 A;  2K32 A;  1HQR D;  1D5X C;  1QUQ B;  1KLU D;  2KUM A;  4C2M B;  1XNQ L;  4LFC Q;  3IFD A;  4IPG A;  1ROD A;  4LK1 C;  1JWU D;  4BY7 H;  1PH4 A;  2RA4 A;  5EKK A;  1H9K A;  5JJI A;  4UP7 A;  1L1O A;  1WTO A;  3TME A;  3KJP A;  3EQL C;  4RCN A;  4KN4 C;  1D8L A;  1SE3 A;  1KRT A;  4JCV E;  3MFY A;  1LT6 D;  2PPB C;  3KF6 A;  4K6L A;  4B3M Q;  4R4Q A;  4JI2 L;  1SR3 A;  2KOL A;  3I73 A;  1D7Q A;  1EOT A;  4GOP B;  1B70 B;  3K0Y A;  4ZQ3 A;  2AHO B;  2R7Z G;  2K01 A;  4JYA L;  2WV6 D;  4OIJ A;  1VDZ A;  3ONA B;  4IUP A;  3I3C A;  1X65 A;  3KJO A;  4JV5 Q;  2K52 A;  5J3B A;  4BY7 B;  2AUJ D;  1EU4 A;  3TSS A;  1E1T A;  3I72 A;  4QL5 A;  2K6A A;  1Y1W G;  4GLV B;  3UDG A;  4K5W A;  4RG1 A;  4GKK L;  1TWC H;  2RBM A;  2VQE Q;  2OWO A;  3GTG H;  4NXM L;  3I55 A;  1LTA D;  3MEH A;  4QUF A;  4FXD A;  3HOZ H;  3EBE A;  4DK0 A;  1B3A A;  1ENF A;  2B29 A;  2A1A A;  4BXX G;  1BVS A;  1CKN A;  3MC0 B;  4A3B G;  2I0Q A;  2UXC Q;  4DV5 L;  5M3F G;  2ZJR A;  2A8V A;  1D1I A;  3H0G H;  1TS3 A;  3SVM A;  3KF8 B;  4O42 A;  3F8T A;  4DUY Q;  5C4X G;  4GNX A;  1TWC B;  4IZ8 A;  2KHI A;  4O2D A;  3GTG B;  4APV A;  1G6Z A;  1TVX A;  3T1Y Q;  4A3J G;  2NTT A;  4OEL B;  2B2U C;  1D6E C;  2EYO A;  3TP8 A;  3HOZ B;  2IL8 A;  3WWV A;  4P75 A;  3C46 A;  1PXU A;  4CGY B;  1IYU A;  4FF2 A;  2ZJQ A;  3QR8 A;  3GTQ H;  4CJ1 B;  3EN2 A;  4MHE A;  3LNN A;  5C4Z A;  2G9H D;  1L0Y B;  3GDE A;  1UE7 A;  3KFU A;  3FKI H;  1AZQ A;  5LL6 X;  2BA1 A;  1HFG A;  3I8Z A;  3OTO Q;  3H0G B;  2OF1 A;  2OCE A;  1PTO C;  2EYP A;  3C3L A;  2VY3 A;  4R4C A;  1DON A;  1STN A;  5GAE C;  2KA7 A;  5IGB A;  1VMC A;  1CHQ D;  3QB3 A;  4OXP A;  4F87 A;  5IP7 G;  4HR7 B;  3T53 B;  3MXP A;  4PZ6 A;  1MHW C;  4DR4 Q;  2O2L D;  3X3N A;  1EY5 A;  1KNA A;  1GHJ A;  5EPK A;  3BYY B;  3GTQ B;  3BZK A;  2ID0 A;  4DV1 L;  1IYJ B;  4X65 Q;  1QOH A;  1XMQ L;  1K8G A;  4R4O A;  1S72 A;  2Z6K A;  3HOU G;  1FJG L;  1B9M A;  2F0E A;  3FKI B;  5JEA H;  3BDC A;  3I4O A;  3LX0 A;  5LMN Q;  1Q3L A;  2HHH Q;  4O0A A;  3E0E A;  1EFI D;  4C3J H;  1G2S A;  2F3W A;  2DUD A;  1A2U A;  4A76 A;  3TS2 A;  2F0D A;  1B9N A;  4XT3 B;  2E2J H;  2F0J A;  2CW0 C;  3P7J A;  1PDQ A;  2F0Q A;  2YYZ A;  1N36 Q;  4CKB A;  3M4O H;  1CTM A;  2Z9H A;  4JI6 Q;  2EYF A;  4JOI A;  2F0S A;  3NEM A;  4DN4 M;  5JJL A;  4DV7 L;  1OXS C;  1QE6 A;  5CV4 A;  3FDT A;  2R93 G;  4RKL A;  4JI4 Q;  4JC0 A;  4X3S A;  1N34 Q;  3I4N H;  1Q90 A;  4C3J B;  4F7X A;  3UE0 A;  4DR3 L;  1SSO A;  1B44 D;  2K1B A;  3AFQ A;  1A63 A;  2FJ2 A;  2I5L X;  2E2J B;  1YNJ D;  1QZH A;  1WVL A;  5ELB A;  5ELO A;  1HZ9 A;  4A3M H;  4DNI A;  3M4O B;  3C1F A;  5CBA E;  1JB3 A;  1VQ7 A;  5C3E H;  3G6J B;  1BCP B;  2QEX A;  4HSP A;  3MZ5 A;  1T9H A;  1S5F D;  3HGB A;  3PV0 A;  4GN4 B;  1OXT A;  1AZP A;  4R4T A;  2NVQ H;  1LTB D;  1ET9 A;  1S5C D;  3NEL A;  2UUC L;  3OIP A;  5IYD G;  2WFW A;  3K81 C;  2ZXR A;  4A93 H;  1IKL A;  1PRT F;  1ENA A;  1E2W A;  2ZXO A;  4IUN A;  1I5F A;  3J80 E;  5BN4 A;  2KCN A;  3URY A;  1FGB D;  2R92 G;  1HNX L;  4A3M B;  1ZYR D;  2IPK D;  1SNO A;  2MPM A;  5C3E B;  2Z8L A;  4PMB A;  2Z4I A;  4BBR G;  4ZRZ A;  1LTT D;  4LUO A;  3DUZ A;  3S9W A;  2NVQ B;  1UAP A;  2F0I A;  1BR9 A;  5HY6 A;  2V1C C;  2C5C A;  2MGS A;  5EJW A;  4PZ8 A;  4A93 B;  1M90 C;  2HQL A;  1YNN D;  3I56 A; 
#chains in the Genus database with same CATH homology
 1X6O A;  2NZO A;  3K7U C;  3HOY H;  1TWG H;  1DGS A;  1GO3 E;  3I4M G;  4AYB G;  3HOZ G;  1Q86 C;  4DV7 Q;  3PO2 G;  4IFD I;  3PO3 H;  1YHA A;  3D31 A;  3E9H A;  3CCQ A;  4IOA A;  1X3E A;  2CWP A;  1XJV A;  4A3K H;  3PUX A;  3J81 c;  3M85 A;  1XPR A;  1W2B A;  2Q2U A;  4X66 L;  5IWA Q;  3F2D A;  4BBS G;  2LXK A;  3OW2 A;  4MNO A;  2AMC B;  1LYL A;  1LM0 A;  1YHQ A;  4IOC A;  1RIP A;  1UE6 A;  2PMZ E;  3BJU A;  1WCM G;  1MJE A;  4DR3 Q;  3HOU H;  3MXN B;  2PI2 E;  1Z9F A;  2N49 A;  1KQS A;  2IHE A;  3M4P A;  1J5E Q;  4LF8 Q;  2BH2 A;  1B8A A;  4LFB Q;  1JB7 A;  4DV4 Q;  2GN5 A;  4P73 A;  3RZO H;  2KBN A;  4A3C H;  2VNU D;  1HZB A;  2Z6K C;  3CMA A;  4DV2 Q;  2VQF L;  2A19 A;  2UUA L;  2D0P A;  2RF4 A;  1EIF A;  3CAM A;  1JT8 A;  5IYB G;  1K3R A;  1KRS A;  1VQF A;  1WFQ A;  2FXQ A;  3D0F A;  2JA5 G;  2WB1 E;  1AE3 A;  3CXC A;  2HT1 A;  2GVA A;  2JQO A;  5M5Y H;  3EIV A;  2E5L L;  3L0O A;  1SMX A;  5IYC H;  1HZA A;  4YWM A;  5IP9 G;  2UUC Q;  1HR0 W;  4UP9 A;  2ZM6 L;  1HR0 L;  5DLQ E;  2JE6 I;  2YTX A;  4DV0 L;  3H15 A;  4X62 L;  1VQA A;  3FKI G;  4LF4 L;  1HNZ Q;  2NN6 G;  5GAG C;  4JOI C;  3CCM A;  3T1H L;  1U5K A;  1XPU A;  1GVP A;  1WJJ A;  3GTO H;  1CKO A;  3AQQ A;  4BY1 G;  2UUB L;  1LTL A;  1E3P A;  3HKZ G;  1K0R A;  2ZTD A;  4BA2 I;  1VQC A;  3G4S A;  3CP0 A;  1VQB A;  1IBK Q;  2MO0 A;  4GKJ Q;  3HFZ B;  2HIX A;  2F4V Q;  4LFA L;  3A5U A;  1VQP A;  2CFM A;  4P72 A;  2Q2I A;  4LF6 L;  1KL9 A;  1X3G A;  5IWA L;  1OXV A;  3S2H H;  1EUJ A;  3PF4 A;  3GTP H;  3DM3 A;  1XTD A;  2XTI A;  4AIM A;  2R7F A;  2XGT A;  1KC8 C;  4XIG S;  2VL6 A;  2BH8 A;  1M1K C;  3ZJY C;  3L2P A;  1QUQ A;  3CCE A;  1N33 Q;  4A3D H;  5ELN A;  1CSQ A;  2B63 H;  1PH9 A;  4LF8 L;  1Y1V G;  2N78 A;  4LFB L;  5IYD H;  5M3M G;  4DV4 L;  4ALP A;  2PNH A;  3STB D;  3H3V I;  3CC7 A;  2CKZ B;  4DV2 L;  4KI0 A;  4DV3 L;  1I6H H;  2D0O A;  2JA8 G;  2MO1 A;  4IFD J;  3CCS A;  3TQY A;  4B3T L;  3S2D H;  3J81 i;  1EYG A;  1N8R C;  1WOC A;  4X66 Q;  3CW2 C;  1PH3 A;  4LF9 L;  1FL0 A;  4AQY Q;  4NXN Q;  2R92 H;  4A3B H;  4A3E H;  5GRO A;  3M4Q A;  4A3G G;  4A3I H;  2MFI A;  3KLW A;  2UXC Q;  3A0J A;  1VQO A;  1LUZ A;  3DLL A;  1HNW L;  2IX0 A;  4JI1 L;  3HOW H;  3HOV H;  5FLX c;  1VQG A;  3CPF A;  5C4X H;  2AWO A;  4GOP A;  5K36 G;  4TVA B;  3CCU A;  3J7A 5;  2LSS A;  4BBR H;  5FLM G;  2WAQ G;  1PYB A;  3S24 A;  5FJ8 H;  1YBY A;  4EX5 A;  2RCN A;  4A3J H;  1VCI A;  1K83 H;  4HID A;  2ES2 A;  1TXY A;  4HIM A;  4LF5 L;  1GKH A;  1VQ9 A;  2NVT H;  4L5S A;  3K7A H;  2Z0S A;  2VQF Q;  4LUZ A;  4QJF A;  1VQ4 A;  2UUA Q;  5E7N A;  1S3O A;  3CCV A;  4PG3 A;  4IPD A;  3H3V H;  3F1Z A;  1E22 A;  1IBM Q;  2R7D A;  1N32 L;  5LMU L;  1IBK L;  5AJ3 Q;  1V43 A;  1BBU A;  1UE1 A;  3HOX H;  4JI7 Q;  4OX9 Q;  2E5L Q;  2F4V L;  5IT9 c;  1V9P A;  4A3M G;  1EFW A;  2ZM6 Q;  2E2H H;  1SLJ A;  2UU9 Q;  3A5Z B;  2VW9 A;  4DUZ Q;  1YZ6 A;  1JJ2 A;  1SFO H;  2OQ0 A;  4DV0 Q;  1Q82 C;  1YNX A;  2ATW A;  4LFC L;  5C3E G;  3JAM c;  1Q1E A;  3UDI A;  1FGU A;  4MZ9 A;  3U4Z A;  3S17 H;  3UDX A;  4QIW E;  3UE1 A;  3PUW A;  4YHH Q;  4BA1 I;  4C3I H;  4EQ5 A;  1E7Z A;  1VQJ A;  2Y0S E;  2ZTC A;  5HGQ A;  1K9M C;  4Y52 H;  1WCM H;  1NMG A;  3CQZ H;  4YWK A;  2NN6 I;  3JC6 6;  4UP8 A;  5C0X J;  3ULP A;  1Q81 C;  2UUB Q;  1Q1B A;  1FVI A;  4QGU A;  1ASZ A;  2C35 B;  3CME A;  4DK6 C;  4H02 A;  1PH1 A;  1V1Q A;  4A93 G;  1PFS A;  3PUV A;  4YCW A;  2ZJP A;  1X55 A;  4K0K Q;  2F52 A;  2ZTE A;  4LFA Q;  1YJ9 A;  1O7I A;  4LF6 Q;  3KYH C;  1MJC A;  4GLA C;  2CCZ A;  3CCL A;  3CC4 A;  4AQY L;  4A3L G;  4NXN L;  3BU2 A;  4HIK A;  4C3H H;  1VQ6 A;  2NVX H;  3S1Q H;  2RHQ B;  2CQO A;  2JA5 H;  1XNQ Q;  4DR6 L;  1CSP A;  2ALY B;  2NZH A;  2VUM G;  3RR5 A;  1NTG A;  2WP8 J;  3H0G G;  3S1N H;  5IP9 H;  1X3F A;  4JI8 L;  2K5H A;  5BR8 L;  3W5O A;  1IL2 A;  2EIF A;  1NE3 A;  2N8N A;  3KDF A;  2E8G A;  4DR5 Q;  1QVG A;  1PH8 A;  3GO5 A;  4DV3 Q;  5M5W H;  4GS3 A;  1EIY B;  1I3Q H;  1UE5 A;  1YHB A;  3ERS X;  5C44 G;  2VQE L;  4B3S Q;  4JBW A;  3M4O H;  4B3T Q;  3BZC A;  4RMF A;  4YCV A;  4HJ5 A;  1IBM L;  4A3F H;  4B3R L;  5IY0 A;  4BY1 H;  4LF9 Q;  4JI2 Q;  2UXB Q;  5AJ3 L;  2EQS A;  4JI7 L;  4HIO A;  4OX9 L;  1N9W A;  2L15 A;  1C9O A;  4C2M H;  3RNU A;  3HOY G;  4YWL A;  2F3I A;  1HNW Q;  4JI1 Q;  2UU9 L;  4JYA Q;  1KHI A;  4DUZ L;  4DR2 L;  3ICE A;  4JBK A;  1VQN A;  3PO3 G;  2R93 H;  4QQB X;  2K5V A;  1S40 A;  1CUK A;  4X64 Q;  4A3K G;  2Q2H A;  1YJW A;  4YHH L;  4WJ4 A;  3FP9 A;  2Q2T A;  1OTC A;  4DR7 Q;  5GAH C;  4LF5 Q;  4JI5 L;  4HJ9 A;  3K80 C;  1SRO A;  2YTY A;  4UY8 C;  4IO9 A;  4A75 A;  3M7N A;  4R1J A;  1JJC B;  2AWN A;  4OWT B;  4IJH A;  2VS1 A;  1N32 Q;  1L0W A;  3TEH B;  5LMU Q;  4HJ7 A;  3S16 H;  1Y1V H;  1X9N A;  4GN5 A;  4K0K L;  3G48 A;  1UWV A;  2OTJ A;  3T1Y L;  4JI3 L;  2VZA A;  4DPG A;  3GD7 A;  4A3C G;  2JA8 H;  1QUQ B;  4LF7 L;  1Q46 A;  3LGJ A;  1XNQ L;  4LFC Q;  1OXX K;  3PSI A;  4LNQ A;  4IPG A;  3JAM i;  3S1M H;  3AYH B;  1PVO A;  5GAD C;  4BY7 H;  1EOV A;  1PH4 A;  4OO1 G;  1VQK A;  4DKA C;  5JEA G;  4UP7 A;  4B3R Q;  5JJI A;  1HZC A;  4LUV A;  3J81 j;  1L1O A;  4HJ8 A;  5IYC G;  2K14 A;  3KJP A;  4P71 A;  1X54 A;  4DAM A;  2YV5 A;  1D8L A;  1KRT A;  1C0A A;  4JCV E;  3PUY A;  4DR5 L;  4GKK Q;  2PQA A;  2JEB I;  4GN3 B;  2JJQ A;  2KCT A;  3KF6 A;  1KD1 C;  4B3S L;  4B3M Q;  1XMO Q;  2LXJ A;  4YY3 L;  4LW1 A;  4TQU S;  4R4Q A;  1KAW A;  1SR3 A;  4JI2 L;  2ASB A;  3GTL H;  2MNA A;  4GOP C;  1D7Q A;  4GOP B;  1B70 B;  4DR6 Q;  2AHO B;  2R7Z G;  1Z47 A;  4JYA L;  1PV4 A;  4OWW B;  1X65 A;  3KJO A;  4JV5 Q;  4IPC A;  4JI8 Q;  1TWH H;  4X64 L;  2K52 A;  5J3B A;  5BR8 Q;  1AH9 A;  1E1T A;  4QL5 A;  1Y1W G;  3I4N G;  4GLV B;  4DR7 L;  4WJ3 M;  1HJP A;  3UDG A;  4X65 L;  4RG1 A;  1Q12 A;  1G29 1;  3W1B A;  4GKK L;  1TWC H;  1TWA H;  3PGZ A;  2VQE Q;  1A8V A;  4JBJ A;  2OWO A;  3SGI A;  3PIP A;  3GTG H;  4NXM L;  2E2I H;  4KHZ A;  1R9T H;  2IT1 A;  3I55 A;  2I5H A;  1VQL A;  1A62 A;  1VQM A;  2HIV A;  3CF5 A;  3I4M H;  4LWC A;  3HOZ H;  2IHF A;  3EBE A;  2N3S A;  3M3Y H;  3PO2 H;  1GD7 A;  1I50 H;  5C0X G;  2B29 A;  1QVC A;  4DR2 Q;  2A1A A;  4IJL A;  4BXX G;  1HH2 P;  4BBS H;  1VQD A;  3J80 c;  1N36 L;  4A3L H;  1MIU A;  1UEB A;  1BVS A;  1CKN A;  4A3B G;  1Q8K A;  1PYS B;  3MEF A;  1OXU A;  4MTN A;  4DAY B;  2ZJR A;  3E9I A;  5M3F G;  3ULJ A;  4DV1 Q;  4DV5 L;  4KLK A;  3G71 A;  1C7Y A;  4JI5 Q;  2A8V A;  2IY5 B;  1XPO A;  5EAY A;  1YEZ A;  3H0G H;  4A4I A;  2JK8 A;  3S14 H;  3KF8 B;  3F8T A;  4DUY Q;  2JA7 G;  5C4X G;  2I5M X;  5C4J H;  4GNX A;  4JI0 L;  4B3M L;  1XMO L;  2KHI A;  4O2D A;  2OTL A;  4APV A;  3STB C;  3T1Y Q;  4JI3 Q;  2K5N A;  3ER0 A;  3FHW A;  3F2B A;  2QA4 A;  4HJA A;  4A3J G;  1MKH A;  1GM5 A;  2JA6 G;  4LF7 Q;  4OON A;  1J6Q A;  5IYB H;  2QGQ A;  3W1G A;  4NPS A;  3WWV A;  4DK3 C;  2BA0 A;  1G6P A;  4P75 A;  4GLX A;  4AYB E;  3U58 A;  2ZJQ A;  2UXD L;  2GVB A;  3GTQ H;  3HOX G;  3KDF B;  1QVF A;  4JV5 L;  3EN2 A;  1U0L A;  2KCM A;  2R6G A;  4OO1 I;  2YTV A;  3ULL A;  3GDE A;  3NBH B;  1UE7 A;  3AEV A;  3KFU A;  3FKI H;  3L7Z C;  3TRZ A;  5JJK A;  2BA1 A;  1K73 C;  3OTO Q;  1XNR L;  2OQK A;  3RLO A;  1ASY A;  4YY3 Q;  5M5X H;  1Q7Y C;  2OCE A;  2VY3 A;  2KEN A;  4R4C A;  5GAE C;  1P8L A;  1IBL L;  4PZ7 A;  4OXP A;  1VQI A;  5IP7 G;  2WB1 G;  2I0Q A;  2K50 A;  1JMC A;  2PI2 A;  4PZ6 A;  3CD6 A;  3IRB A;  1I94 Q;  4DR4 Q;  3A74 A;  4J15 A;  1EQR A;  1WI5 A;  1VS0 A;  3UDF A;  3CCJ A;  2UXC L;  4IPH A;  3RZD H;  3BZK A;  2H5X A;  2UXB L;  2ID0 A;  4DV1 L;  1IYJ B;  4X65 Q;  3PIO A;  2B3G A;  2KHJ A;  3HKS A;  1XMQ L;  4R4O A;  3KOJ A;  3RLF A;  1S72 A;  1K8G A;  1WYD A;  2YU9 H;  2Z6K A;  3K0X A;  3HOU G;  4NXM Q;  4ME3 A;  1RL2 A;  3OYY A;  1FJG L;  2K4K A;  3NEN A;  4X6A H;  3PUZ A;  3I4O A;  4DUY L;  5LMN Q;  2HHH Q;  4O0A A;  3E0E A;  5M3M H;  4C3J H;  2D62 A;  4L5Q A;  4P74 A;  1EQQ A;  2DUD A;  4A76 A;  3TS2 A;  2MQH A;  1IXR A;  3I2Z A;  1KXL A;  3S1R H;  3CPW A;  5GQO A;  2E2J H;  5IE8 A;  1G51 A;  3J7Z C;  3GTK H;  2YYZ A;  4Y7N H;  1L1O C;  3HKZ E;  1L1O B;  3J80 i;  1BKB A;  1E1O A;  4POF A;  1N36 Q;  1BBW A;  5C0X I;  4DV6 Q;  4DR1 L;  3VDY A;  4JG2 A;  4A3F G;  4IFD G;  4DV5 Q;  3U4V A;  1HNX Q;  4JI6 Q;  4A3G H;  3RN2 A;  4JOI A;  2PQA B;  3NEM A;  2R7Z H;  5H1S E;  5JJL A;  3KF6 B;  4DV7 L;  1OXS C;  1IZ6 A;  1PHJ A;  1B7Y B;  3G6E A;  4R4I A;  1L2F A;  1NMF A;  1PA6 A;  1PH2 A;  5FLM H;  1QZG A;  2R93 G;  4JI0 Q;  1H95 A;  3GTJ H;  3OTO L;  4JI4 Q;  4JC0 A;  1YIJ A;  1N34 Q;  1Y1W H;  4UPA A;  3I4N H;  3UE0 A;  3CC2 A;  4DR3 L;  3TS0 A;  3CCR A;  4KHP Q;  3K8A A;  3AFQ A;  1A0I A;  1A63 A;  4L5R C;  4QY7 A;  1SRU A;  2I5L X;  2UXD Q;  1J5E L;  1QZH A;  2EXD A;  1KIX A;  1I94 L;  4DR4 L;  5ELO A;  1HZ9 A;  4A3M H;  2CWA A;  4DNI A;  1NBW A;  3I7F A;  2NVY H;  3AFP A;  3TRE A;  2DGY A;  1P16 A;  1VQ8 A;  1W3S A;  4NB3 A;  5C3E H;  1VQ7 A;  4BXX H;  2QEX A;  4JBM A;  5JEA J;  1SN8 A;  1T9H A;  1XNR Q;  4JI6 L;  1CKM A;  3PV0 A;  1OXT A;  4GN4 B;  4BY7 G;  4R4T A;  5M3F H;  1VQ5 A;  2NVQ H;  4A3D G;  1PH5 A;  5LMN W;  5LMN L;  3B6Y A;  1YJN A;  3NEL A;  1PH7 A;  2HHH L;  2IX1 A;  2B63 G;  1YIT A;  1IBL Q;  4PMW A;  2UUC L;  3S15 H;  1JJG A;  2WAQ E;  2WFW A;  1Y14 B;  5IYD G;  3K81 C;  1NJI C;  2K75 A;  4A93 H;  2JA7 H;  3U50 C;  1AE2 A;  3F2C A;  1EWI A;  1CKN B;  4L5T A;  1I5F A;  1HNZ L;  1NY4 A;  1VQH A;  2JA9 A;  1YVC A;  2JA6 H;  4DV6 L;  2AKW B;  4XTC S;  4YCU A;  2R92 G;  1HNX L;  4A3E G;  4FDB A;  4GNX C;  1TWF H;  1XMQ Q;  4GNX B;  4A3I G;  2VUM H;  1VQE A;  1FJG Q;  1SE8 A;  2Y0S G;  3HOW G;  3RLN A;  3HOV G;  4GKJ L;  3GTM H;  4OWX B;  4JI4 L;  4BBR G;  4LUO A;  1HR0 Q;  1N34 L;  2RHS B;  5FJ8 G;  1YI2 A;  1JE5 A;  5HY6 A;  5C44 H;  4X62 Q;  3M9B A;  2V1C C;  3PF5 A;  3PCO B;  1K8A C;  4LF4 Q;  1PH6 A;  2JEA I;  3T1H Q;  4KHP L;  4PZ8 A;  1M90 C;  1N33 L;  1X56 A;  2HQL A;  3RN5 A;  4DR1 Q;  1E24 A;  4POG A;  4AH6 A;  3I56 A;  3Q8D A;  5IP7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...