3FHWA

Crystal structure of the protein prib from bordetella parapertussis. northeast structural genomics consortium target bpr162.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
100
Chain Sequence
MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the protein priB from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR162.
rcsb
source organism Bordetella parapertussis
molecule tags Dna binding protein
molecule keywords Primosomal replication protein n
total genus 15
structure length 100
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fhwA00
1K0RA 5H1SE 4A3JG 4DR6L 2E5LL 4B3TQ 3RR5A 1N33Q 1J5EL 2BH8A 1QVGA 2VY3A 4JI6Q 1VQAA 4KLKA 2YV5A 4B3RL 3GDEA 2K5VA 1G51A 2QEXA 1XNQQ 4JI3L 2Z0SA 4NXMQ 1EUJA 5DLQE 1HJPA 5C4XH 2CFMA 4A75A 5FLMG 1Y1WH 1XPRA 1IBLQ 1Q46A 3F8TA 4DUYQ 1RIPA 3U4VA 4OONA 2IX1A 3F2DA 1T9HA 3S1RH 3HOUH 1Q1BA 4DR1Q 2LXJA 3T1HL 3CCLA 1VQLA 2RHQB 1VQIA 2F52A 3GTLH 4DR2Q 4LF9Q 5C0XI 1V43A 4A3GG 4LF8L 3HOWH 2HIXA 4POFA 3AEVA 3OTOQ 1BVSA 1WCMG 4OWWB 1CKNA 2MNAA 4KHPQ 2QA4A 4X62Q 1S3OA 2I5MX 3B6YA 3I2ZA 4JI6L 1WCMH 5M5YH 4A3FG 4MTNA 4A3DH 1GKHA 1UE7A 4R4IA 2NN6I 3STBC 3HOYH 1N32Q 1HR0Q 4IPGA 3I7FA 4GKJQ 1VCIA 2QGQA 5BR8L 4JBWA 4HJ8A 2DGYA 4BA2I 2WAQG 1EFWA 3BZCA 2B29A 4DV4L 3CC7A 3K7AH 5IP7H 5IP9H 1PH3A 1OXUA 4GKKQ 4LUZA 4DV2Q 3H0GH 2UUCQ 3HKSA 5GAEC 3UDIA 4PG3A 5IP9G 2NZOA 1X55A 3RN2A 2Q2HA 4XTCS 2VS1A 2HT1A 5IYCH 5C4JH 4JBMA 1PFSA 1SN8A 2BA1A 1TXYA 1XMQQ 3DLLA 1XMOL 3I4OA 1YJNA 1W3SA 5M3FG 1N34L 2PI2E 1IL2A 4JV5L 4PZ7A 1YNXA 2ZJQA 4GOPA 4OX9Q 2HQLA 2ID0A 4B3MQ 1QZHA 1LYLA 3CC2A 1HNWQ 1S40A 1EOVA 3PSIA 2B63G 3ULJA 4YHHQ 3CCMA 3CCRA 1Q1EA 3HOZH 4IOAA 1VQCA 4DR5Q 4X62L 1E3PA 5C0XJ 2PNHA 1E7ZA 1PH1A 2Y0SE 3ER0A 4KI0A 1O7IA 3LGJA 1IBKQ 1PH6A 4R4QA 3ULPA 4GOPC 1PVOA 1YVCA 4EQ5A 1L1OA 4A3MG 1N8RC 5LMUQ 4DR1L 3T1HQ 3TRZA 4BBSG 1DGSA 1CKMA 5GROA 3BJUA 3PUYA 5IYDG 1QUQA 3UE1A 1XJVA 3E9IA 1NJIC 2CCZA 4AH6A 5ELNA 4R1JA 4L5SA 2WB1E 3S2DH 4DV5Q 2R93G 1KRSA 2RHSB 1N36Q 3GTOH 4WJ3M 1BBUA 4X6AH 3G48A 2EXDA 1XPOA 5JJIA 5GQOA 1BKBA 1VS0A 2AWOA 3S1NH 3PUVA 1EYGA 4A3CG 4QY7A 2NVYH 4A93G 3M4PA 1VQFA 1C7YA 4A76A 3ERSX 3I55A 3PF4A 3UDFA 2E5LQ 4B3TL 3EN2A 1HNXQ 2WAQE 2V1CC 1N33L 4DR6Q 4A93H 4A3CH 1SR3A 3J7A5 2GVAA 4YY3Q 3ICEA 4OX9L 4J15A 1VQOA 4HIDA 3J81i 2VQEL 4P74A 1P8LA 2ZTDA 3CCJA 4DV1L 3GTJH 4L5RC 4DKAC 4R4OA 4YHHL 1KHIA 1JJ2A 2UXCL 1MKHA 2CWAA 1UEBA 3CCVA 2ASBA 2BA0A 2MFIA 3BZKA 1OXVA 4A3IG 4LFAL 3CD6A 1H95A 1HZCA 2UUCL 2K5HA 3T1YQ 2B3GA 3D0FA 1L2FA 4LF7Q 2NVXH 1GVPA 1QZGA 1N34Q 5C3EG 4LF5Q 3PUXA 2E2HH 3S15H 2D62A 2MO1A 3GO5A 1YHBA 5FJ8H 4HJAA 3E0EA 3PF5A 4A3LH 1VQEA 1D7QA 4LF7L 4TVAB 4IFDI 2Q2IA 4Y7NH 2R7ZG 2XTIA 4FDBA 1E22A 5IWAL 3PIOA 2JA5G 4LF4L 4A3LG 1HNZQ 2JQOA 1YJWA 2YTXA 4IFDG 1N32L 4BBRG 1SLJA 2FXQA 3I56A 1XPUA 4UP8A 4DAYB 2JJQA 2VQEQ 1HZ9A 1K8GA 3TS2A 3HOVH 1JJCB 5GAGC 3J80i 2AHOB 3BU2A 5BR8Q 3F2BA 1HR0W 4JI0L 3AFQA 4DR3Q 1OXTA 2CWPA 2F4VL 4LF8Q 2VUMH 4X64L 1I3QH 3OYYA 4O2DA 4OO1G 1LUZA 5IP7G 4RG1A 3DM3A 2KCMA 4LW1A 4AQYL 2JA6G 1CKNB 2EIFA 1XNRQ 2KBNA 5J3BA 3ZJYC 3H0GG 3U4ZA 4K0KL 1VQMA 1GM5A 3VDYA 2OQKA 1PH9A 5JJLA 4R4TA 2I5LX 5AJ3Q 1CSPA 2VQFQ 1CUKA 4POGA 4PZ6A 3I4NH 2IY5B 3M85A 5AJ3L 2C35B 2VQFL 4YCWA 1R9TH 4ME3A 2UUBL 4JI3Q 4KHZA 1FVIA 3KF8B 5K36G 5IT9c 3I4NG 4LUVA 4UPAA 1I6HH 1V9PA 2YYZA 4NXNQ 2IHEA 1J5EQ 3RZOH 2UXBQ 2K5NA 1PH8A 3G6EA 1HH2P 1E1OA 3U50C 4JI1Q 4A3EG 4A4IA 2YTVA 4PZ8A 4DUYL 4C3JH 4DV6L 1KC8C 1ASZA 1JT8A 2EQSA 3FP9A 3CPWA 4DR3L 3CP0A 1M90C 1IBMQ 3RLFA 1Y1VG 2WP8J 4DR5L 4A3EH 1EQQA 1KAWA 1U5KA 2KENA 1I50H 4H02A 2ZTCA 1OTCA 4LF6L 1Q86C 2N49A 4BY1G 3PCOB 1YEZA 1VQPA 1LM0A 1NBWA 1Q8KA 3JAMi 4BY1H 2CQOA 1CSQA 4DK3C 4YCVA 4DNIA 4LFBQ 1X54A 3NENA 2VL6A 1XTDA 4MNOA 1XMOQ 1C9OA 1YBYA 3TQYA 3PIPA 4LFCQ 4GN4B 1YHAA 1EIFA 1D8LA 4BXXH 3K8AA 4IPCA 1AE2A 2I5HA 4ALPA 1I5FA 4PMWA 4GLAC 4A3KH 2N8NA 1UE1A 4NB3A 1C0AA 2K50A 4HJ7A 4BXXG 2MQHA 5IYDH 1JB7A 4JI7Q 3E9HA 4DV4Q 1VQDA 3CXCA 1VQHA 2ZTEA 4YWKA 3RLNA 3S17H 1IBML 4JI2L 3AFPA 3KOJA 1G6PA 2WFWA 3MXNB 5EAYA 4GKJL 1X6OA 4DV6Q 1QVFA 2D0OA 1BBWA 3AYHB 1TWGH 2JE6I 3PO3H 2BH2A 1X3EA 2E8GA 1Y1WG 4A3JH 1A8VA 1Q7YC 1NMFA 3FHWA 1A63A 1HZAA 3CCEA 3HKZG 3HOUG 4IPHA 2ATWA 3PUZA 3S24A 4DR2L 4JI1L 4GLXA 4XIGS 4UP7A 4DR4Q 3HKZE 4A3IH 2UXBL 2ES2A 4NXNL 3PO2H 1SE8A 1JE5A 3K80C 1YZ6A 1K73C 4RMFA 3ULLA 1FL0A 1TWFH 2RCNA 3KDFB 4LNQA 1PV4A 2UUBQ 1MJEA 4IJLA 5FJ8G 4X64Q 1PA6A 1X9NA 2A8VA 4IFDJ 3EIVA 4HJ9A 5LMNL 2F4VQ 4JI0Q 2R7ZH 3FKIH 1MJCA 1PHJA 4NXML 2A1AA 5C0XG 2JK8A 2N78A 2YTYA 3TEHB 3J81c 3GTMH 2WB1G 1EWIA 3MEFA 1TWAH 4JOIC 4IJHA 5JEAJ 4HIMA 4P72A 4AQYQ 1Q12A 5M5XH 4OWTB 4X66Q 1VQ9A 2R7DA 4A3FH 1HNZL 4X65L 4IOCA 1VQ6A 1WOCA 4JCVE 3UDGA 3HOYG 4A3BG 2PQAB 3G71A 3F2CA 4JYAQ 1L1OB 4GS3A 4JI4L 4BY7H 1NMGA 2PI2A 3CC4A 4LF5L 3NELA 4DV0Q 1KQSA 1IXRA 3Q8DA 4AIMA 1KD1C 1EQRA 3GTGH 5LMNW 3I4MH 1SMXA 2GVBA 2N3SA 4O0AA 4UP9A 4GN3B 4AYBG 2JEBI 5M3MG 1VQ5A 4P75A 1I94L 4DR7Q 4C3HH 1J6QA 4GN5A 3PGZA 4DAMA 3CMEA 1KIXA 3T1YL 4YY3L 1OXXK 2B63H 1Y1VH 4JG2A 4TQUS 1L1OC 1VQBA 3KF6A 3W1GA 1EIYB 2DUDA 1HNXL 3WWVA 1QUQB 2PMZE 4DV7Q 4X66L 3HFZB 4LF6Q 2UU9L 4A3BH 2LXKA 1QVCA 2GN5A 4QIWE 3A0JA 4B3SL 4JBJA 4JI5Q 1FGUA 2NZHA 5IYBG 1ASYA 4C3IH 4DV5L 4IPDA 4KHPL 4DK6C 3W1BA 2F3IA 3M7NA 4JI8Q 3JAMc 3L2PA 1IYJB 3CF5A 1Y14B 5FLXc 3KYHC 5M5WH 2Y0SG 3G4SA 4LF9L 4BBSH 1G291 3UDXA 2IHFA 3PUWA 1YIJA 2VNUD 2PQAA 4LWCA 4A3KG 3K7UC 3HOXH 4UY8C 4DV3Q 5IY0A 1LTLA 4DR4L 1X56A 2OCEA 1WFQA 4LUOA 3CPFA 3HOXG 1NY4A 1IBLL 3A5ZB 2K14A 1JMCA 1IZ6A 1U0LA 1UWVA 1X65A 1E24A 2A19A 3KJOA 4K0KQ 1GO3E 3M3YH 3L0OA 2UU9Q 2AMCB 2YU9H 2Q2TA 3AQQA 1V1QA 5GAHC 4DV7L 1HNWL 4JI8L 4BA1I 3KFUA 1K8AC 2L15A 2R7FA 2NVQH 5JJKA 2AKWB 1VQGA 1OXSC 1W2BA 3CCUA 2ZM6Q 2UUAL 3H3VI 3K0XA 1PH2A 1K83H 1HZBA 1XMQL 4B3SQ 3S1MH 1K9MC 3CW2C 4EX5A 3PV0A 4APVA 4L5QA 3PO3G 4R4CA 3M4OH 4YWMA 4HIOA 4AYBE 1Z9FA 1SROA 3CQZH 1MIUA 1A0IA 5C3EH 4JOIA 5IWAQ 1RL2A 4LF4Q 5C4XG 1YHQA 3GTPH 5FLMH 2OWOA 2ALYB 2K4KA 3M9BA 3EBEA 1B7YB 2CKZB 3KLWA 3S1QH 4DR7L 1I94Q 3HOWG 3PO2G 3FKIG 1S72A 4GOPB 4OWXB 3H15A 3J81j 1Q81C 1VQNA 3S16H 1X3GA 2UXCQ 1JJGA 2JA5H 2Q2UA 3HOVG 4A3GH 3TS0A 4A3DG 4DV1Q 3IRBA 2JEAI 3GTQH 5JEAG 2E2JH 4BBRH 2UUAQ 2E2IH 1YJ9A 3RLOA 3L7ZC 2VUMG 1N9WA 3A74A 1KXLA 2HHHQ 1VQJA 3OTOL 2XGTA 3H3VH 4NPSA 2OTLA 2K52A 2KCTA 4JC0A 4L5TA 3RZDH 1M1KC 1HR0L 3GTKH 3K81C 4GNXB 5C44H 5ELOA 1WJJA 2OQ0A 2R92G 2R6GA 1PH7A 1GD7A 3RN5A 3OW2A 3I4MG 5C44G 1VQ4A 4GNXC 4IO9A 3KDFA 1N36L 5IE8A 4DPGA 5HGQA 1Z47A 3CAMA 2JA6H 4MZ9A 3CCSA 2HIVA 5M3MH 2R92H 4BY7G 3CCQA 5LMNQ 5IYCG 3KF6B 1TWHH 4QJFA 2K75A 1KL9A 3NBHB 4DV3L 1NTGA 5M3FH 1XNQL 1PH4A 1YITA 2ZJPA 5LMUL 4WJ4A 4HIKA 2OTJA 3KJPA 3S2HH 5GADC 3JC66 1P16A 3NEMA 3UE0A 1XNRL 3TREA 1CKOA 1YI2A 1NE3A 1SRUA 2KHIA 1WYDA 3STBD 1IBKL 1X3FA 3S14H 3U58A 2Z6KA 4DUZQ 2NN6G 3HOZG 4C2MH 1Q82C 4GNXA 1PYSB 2RF4A 4YWLA 2HHHL 4JI5L 2AWNA 2UXDQ 4Y52H 4B3RQ 4JI7L 1AE3A 1VQ8A 1VQKA 3A5UA 2IX0A 1WI5A 1TWCH 1PH5A 1VQ7A 3SGIA 5IYBH 4B3ML 3M4QA 4A3MH 4JBKA 4JV5Q 1B70B 4JI2Q 4QQBX 2IT1A 3J80c 1FJGQ 1UE6A 1FJGL 2Z6KC 2JA8G 2NVTH 2ZJRA 1AH9A 2LSSA 4HJ5A 1A62A 1E1TA 2JA8H 2R93H 4P73A 5HY6A 3W5OA 2D0PA 1SFOH 3D31A 2JA9A 4GLVB 4LFAQ 4DV2L 1B8AA 1UE5A 2I0QA 2KHJA 2JA7H 4GKKL 4DV0L 4QGUA 3CMAA 4JI4Q 1L0WA 4QL5A 1KRTA 4YCUA 4LFCL 3J7ZC 2JA7G 4JYAL 2UXDL 5E7NA 1K3RA 2MO0A 2ZM6L 2VW9A 3RNUA 3F1ZA 4LFBL 4OO1I 2H5XA 1PYBA 4X65Q 2VZAA 4OXPA 4DUZL 3GD7A 4P71A
chains in the Genus database with same CATH superfamily
3FPPA 1V8QA 5H1SE 1PZKD 4A3EB 2E5LL 1B44D 2VY3A 4RGMA 4B3RL 2K5VA 2KVMA 4QF4A 1HJPA 4A75A 3NTKA 1FR3A 2Q8TA 2A73B 1B3AA 1NR4A 2QILA 4OONA 1ET9A 3S1RH 4RGOS 1RODA 3HOUH 1Q1BA 1STHA 3H0GB 2F52A 1TS2A 2IJ0A 4ULLA 5KIXA 1H9KA 1ONLA 3MAQA 5C0XI 2VXWA 2EDGA 4LF8L 1GHJA 1A2UA 1Y1VB 2PCFB 3OTOQ 4TKOB 4RAUC 3S17B 1SSOA 1H9SA 1A15A 3K7AB 3STBC 1UE7A 2B2WA 3CRKC 1ML0D 3MFYA 3I7FA 2G9HD 3OMGA 4K2KA 4BA2I 5BR8L 2NB0A 2PZUA 3BZCA 2CHBD 3K7AH 3I90A 2K28A 5KNDA 4GKKQ 5K36H 5GAEC 2JA6B 1JCKB 2K32A 2KECA 1PFSA 1SN8A 2F3WA 2A74C 1XMQQ 3I4OA 1LT6D 1YJNA 1W3SA 3FPUB 4PZ7A 1TR5A 3IKJA 1KDBA 2ICIA 2B63G 3S9WA 3S1NB 1PLFA 1SYFA 2RSNA 4YHHQ 1R4QB 4IOAA 2HDMA 1U4MA 4XQJA 1E3PA 2PNHA 1PH1A 3T51B 3ER0A 4DN4M 4R4QA 3MZ5A 2XNAC 4QIWB 1YVCA 4EQ5A 5LMUQ 4DR1L 1LT3D 1CKMA 4WORA 3BJUA 4ZRZA 5IYDG 1QUQA 1QB5D 3E9IA 3U9OA 4N9TA 3VYSA 4AH6A 1WTPA 4R1JA 3S2DH 4X3SA 1N36Q 3G48A 1XPOA 3RZOB 5GQOA 5I9PA 3S1NH 3PUVA 2J7ZA 4A3CG 1I4HA 3I55A 4OGQC 5CV5A 1SR3A 2GVAA 1VQOA 3J81i 1P8LA 5I6YA 1CQVA 3QOJA 2CW0D 3DWPA 4DV1L 4L5RC 1NUCA 2E2DC 2K5QA 2CWAA 1UEBA 2ASBA 2MFIA 1PTOH 3BZKA 1OXVA 3RMHA 1HZCA 4F8MA 4ZKBB 2B2WC 5JVG3 2NVXH 1QZGA 4LF7Q 1N34Q 2E2HH 2MO1A 4HJAA 3GO5A 1YHBA 3PF5A 1D7QA 5JJZA 2Q2IA 4H7BA 1HNZQ 2CH4A 2FXQA 4FYDA 1LLRD 4NP5A 3TBIB 1U9RA 1JJCB 2RA4A 3VR6A 1SJED 3BU2A 4RKLA 1ZEQX 2X6LA 2CWPA 2VUMH 5ELEA 4OO1G 3Q22A 1PFMA 5DAUA 4RG1A 2KCMA 1CKNB 2IL8A 3TZDA 1MI2A 3PQIA 3VDYA 1PYWD 4POGA 5AJ3Q 1CUKA 2WINB 4RH6A 1GUSA 1D5MC 3K5NA 4ME3A 1CHQD 3I4NG 4G7OC 4LUVA 2F0FA 2IHEA 2D5DA 2K5NA 4G4KA 1PH8A 3G6EA 1WD1A 2EJMA 4JI1Q 4A4IA 4OELB 4DUYL 1JT8A 3CPWA 2Z1CA 3CP0A 3IL8A 3RLFA 3SDZA 2WP8J 4C3IG 1TWAB 1U5KA 3FRPB 1WTHA 4H02A 1OTCA 2HCIA 4BY1G 1YEZA 1F2ZA 1NBWA 3SVMA 2CQOA 1XYIA 4RFBA 2VL6A 1NAPA 3TQYA 4LFCQ 2CW0C 3KBXA 3SK6A 4IZ8A 1EIFA 1D8LA 4IPCA 1ENAA 1AE2A 4K5XA 1HFNA 1I5FA 1HUNA 3D3RA 4HJ7A 1SYBA 3BS1A 1V1PB 1JB7A 3I73A 1VQDA 5C5LA 1WCMB 3RLNA 4B08A 1D6EC 4JI2L 1X6OA 3J7AV 1NSNS 2D0OA 2XSCA 1BBWA 4RGTA 1QE6A 2BH2A 2E8GA 3H91A 4J8QA 1Y1WG 1SMYC 2O4XA 1HZAA 1STEA 1JWUD 4JI1L 3R2IA 1K0SA 3A54A 4UP7A 4XIGS 4DR4Q 4V190 1WD0A 1XX8A 2JXMB 1FL0A 1TWFH 2RCNA 3VR4A 2R92B 1PV4A 2D9UA 5FJ8G 1PA6A 2A8VA 5M5XB 3DXJC 2F4VQ 2R7ZH 2F0LA 3FKIH 2N78A 2YTYA 3J81c 1PTOC 5IGCA 1E2VA 1LACA 3KF8A 3MEFA 1IYUA 3OMCA 5C0XH 5M5XH 4OWTB 5I6WA 5IGDA 2XRSD 4O1NA 2I46A 3MWYW 1WTRA 5KYLA 4X3UA 3WDNA 4G7HC 3UDGA 5DEHA 1IKLA 2PQAB 3G71A 3BVGA 4MTKA 4LF5L 3CC4A 5JPMC 2EOTA 4CDEC 1TWFB 3HZXA 2HCCA 4H13C 2EYFA 1CA6A 1GUOA 1I94L 1RTOA 1ESFA 4C3HH 2A6HD 3MC0B 1GXDC 1OXXK 2K1BA 1EY0A 3GTPB 1B53A 1EQTA 4ZQ3A 3PO2B 3TDQA 4JBJA 4DV5L 3FEWX 1MD2D 4DA2A 2J0TD 3JAML 5KRUA 4DK6C 4JI8Q 3JAMc 5FKAC 3CF5A 4L5SA 2Y0SG 2PZTA 2NVTB 4BBSH 3BG3A 4XYOA 2IHFA 3UDXA 3M4OB 2PQAA 2O5IC 5IY0A 2ZT9C 1HTPA 3CPFA 4C1NI 3HOXG 4BBSB 5K5PA 2K14A 1FD7D 2BDNA 2F0QA 4MN3A 1H9SB 3K57A 1TY2A 2AMCB 3AQQA 4U68A 4PMBA 3Q0AA 2KUMA 2FMCA 3KBGA 2I07B 1SFOB 1RDPD 1JE4A 3KFUA 2R7FA 5JJKA 1OXSC 4RCOA 3R93A 3S1MH 1CT1D 1HXYD 5BN4A 3S14B 1TS5A 4YWMA 4ID6A 1Z9FA 1SROA 4KKUA 2HD3A 5KEEA 5IWAQ 1RL2A 4IUTA 3S1MB 3TMEA 2OWOA 2K4KA 3M9BA 4Q5VA 2MUYA 2B2YA 1DM0B 3S1QH 1I94Q 2F3VA 1TWCB 3PO2G 3FKIG 1K8OA 1S72A 4EVOA 3MTSA 3J81j 3S16H 1EU3A 4KY6A 3HOVG 1WTWA 4TSSA 4A3DG 3IRBA 1GUWA 2JEAI 2C5CA 3GTQH 5JEAG 1EWCA 3RLOA 3QOLA 4DXFA 4C2MB 2E76C 3H3VH 3GTGB 1I4GA 3EA6A 1HR0L 4A3FB 3K81C 5C44H 3R8BA 2PZWA 1Q3LA 1KNEA 2R92G 1LTTD 4DUZL 3A8IE 3KDFA 5IE8A 2PW5A 1Z47A 1I4PA 2K75A 2NVXB 4DV3L 2LS01 5E3FA 1P16A 2F0IA 3NEMA 3TREA 2KHIA 1WYDA 4XT1B 1IBKL 1CA5A 3V05A 2F0EA 1HA5A 2Z6KA 3HOZG 2KA7A 1PMRA 2RF4A 1BCPB 1AE3A 5IT9L 3A5UA 4A3JB 1STYA 2PPBC 1QG7A 1HRJA 1VQ7A 3SGIA 5IYBH 1SXTA 4DAPA 4JV5Q 3IFTA 4JI2Q 1S5BD 1FJGL 1I4XA 4HJ5A 2JA8H 5HY6A 4ZYSA 1SFOH 2JA9A 2JA7H 3Q23A 1Y8OB 2NVYB 1HQRD 1L0WA 1KRTA 4JYAL 5E7NA 2MO0A 4DFAA 2ZM6L 1II3A 2VW9A 1B9NA 4X65Q 2B2YC 4P71A 2WAQB 2FHTA 4A3JG 4DR6L 4B3TQ 1Q90A 1UNSA 1A6XA 2O2LD 2XRQD 2Q8IB 1S5CD 1QVGA 1VQAA 2EJGC 2TMPA 2YV5A 4KLKA 3R3OA 4N8X1 4CJ2C 2QEXA 2F0UA 2Z4HA 4KN4C 2EXZA 4JI3L 1Y1WH 3PIO3 1Q46A 1G2TA 5CV7A 4MIUA 3C1FA 2EYOA 2IX1A 3OPOA 3F2DA 4DR1Q 2KJXA 3CCLA 4LF9Q 3K5LA 1V43A 1BF4A 3HOWH 2HIXA 1W6JA 1BVSA 4OWWB 4KHPQ 3QG1A 5M5YH 1PTOD 1PXUA 2JSOA 3HOYH 1N32Q 4IPGA 4HSPA 3GV6A 2PMZB 1WTOA 1VCIA 2QGQA 4JBWA 1SNCA 2DGYA 3VYRA 1EIHA 1KDCA 3MXGA 1CM9A 2R61A 3ND9A 1PRTD 1DCZA 5IGEA 3Q24A 4PG3A 5IP9G 3I70A 1X55A 4ZUJA 2Q2HA 3HOWB 1K8MA 4XTCS 5IYCH 4I7AA 1IL2A 2JN4A 2ID0A 1AZPA 2PNRC 1WVLA 3D8GA 3SK4A 1S5ED 5EBCA 2NWGA 3ULJA 1Q1EA 2J4XA 3SE0A 4OIKA 2AUKA 4FF1A 5C0XJ 1J9OA 2SEBD 5KGUA 1IW7C 2K6AA 1EYCA 3T53B 5ELCA 1IL8A 3CHBD 2NTTA 4I7ZC 1YNNC 1OO9B 1N8RC 1NCVA 3T1HQ 4CHTB 4BBSG 3OWEB 3GTLB 3EVQA 2WV6D 4DV5Q 2RKSA 4HEDA 5CGKA 4X6AH 1BBUA 2A6HC 1Z7TA 2IX3A 1G2SA 2F0WA 1C7YA 4A76A 2E5LQ 3K0YA 2V1CC 4QB4A 2R7ZB 4JVZA 3TP5A 4YY3Q 1XTCD 4J15A 1PTOF 4HIDA 2VQEL 4P74A 2ZTDA 3SK8A 3CCJA 4R4OA 4YHHL 2VUMB 4FNFA 1MKHA 3CD6A 4LFAL 2EY1A 2RVLA 3SHLA 5FO7B 2B3GA 5D3IB 4KD3A 4LF5Q 1RCVD 2L55A 2K05A 2QCPX 4LF4L 3HRZC 2F0PA 2JQOA 2L5TA 1SLJA 1XPUA 4UP8A 3HP3A 2VQEQ 1K8GA 3QIAA 3TS2A 3HOVH 1E0BA 5GAGC 4JI0L 1M4VA 2F4VL 2KEDA 5BR8Q 4DR3Q 4X64L 3OYYA 2HQEA 4AQYL 2JA6G 2AQ3B 1GM5A 1PH9A 3P7JA 1S5DD 5KNCA 1CSPA 2VQFQ 3I4NH 2JYOA 2C35B 1R9TH 1EL0A 3NBHA 4JI3Q 5C3XA 1F77A 3KF8B 4UPAA 3TP8A 2B63B 3QJYA 1J5EQ 3I4NB 5JOBA 2KCNA 2YTVA 1ASZA 3MFGA 4DR3L 1YNJD 1Y1VG 1H9RA 2KENA 2NBFA 1I50H 2C9OA 3T13A 4EQOA 4LF6L 4P2CB 5IGGA 2EYMA 2N49A 5I2XA 3D6CA 3JAMi 4HCSA 1CSQA 4YCVA 3S2DB 4LFBQ 1XTDA 1JQYD 1YBYA 1AP0A 5J1ZA 4GN4B 3D4WA 4KN7C 4IUVA 1KAAA 4Y7NB 1CZGA 4DAVA 2BCOA 4BXXG 2B8FA 1DZ1A 2F4IA 1QJOA 4JI7Q 3E9HA 4DV4Q 3J7AF 1V1PA 1IBML 1G6PA 3AFPA 1JOOA 2K5DA 1QVFA 4A3BB 3AYHB 4GZYC 1B3QA 2B2VC 1O7LA 3DHQA 4QMGA 2DNCA 4L63B 4Z9CB 2WACA 4A3JH 1GUTA 1M8AA 1G8ZD 3MVVA 5FO8B 1A63A 3V96A 3CCEA 4ZK9B 3PUZA 1FNVA 5TSSA 1A3UA 4BY7B 4A3IH 2UXBL 2ES2A 4NKLA 4RMFA 1GUNA 1Y8PB 4KKTA 3KDFB 3ULLA 2K01A 4EGVA 5CV6A 3RUZA 4IJLA 1DOKA 1VDZA 3OIPA 3EIVA 4HJ9A 1BDOA 1R4PB 2WKDA 1MJCA 4XT3B 1PHJA 2E2JB 5C0XG 3TEHB 1Q12A 4X66Q 2R7DA 4X65L 1IW7D 4IOCA 4JCVE 3HOYG 4L6TB 4A3BG 4B9XA 1EYDA 2VB2X 3F2CA 1L1OB 4C1NK 4BY7H 1BNZA 1NMGA 2PI2A 3NELA 2K5WA 1HA6A 1EY6A 3NPPA 1IKMA 4K8IA 4AYBG 3A55A 4C3HG 2JEBI 2A6EC 1K83B 2RDGA 2ZXOA 3PO3B 1HCZA 1SE2A 1AEXA 3HGBA 4GN5A 1J8IA 3CQZB 1SBBB 1KNAA 4I65A 2A69D 3S16B 1RF2D 1Y1VH 4TQUS 3W1GA 1L1OC 1VQBA 2DUDA 2B2TA 4PNYA 1VMCA 4DV7Q 4X66L 3HFZB 3X3NA 1BXTA 5M5YB 1I6VC 1EEID 4JI5Q 1FGUA 2NZHA 4IPDA 1U4PA 1D1IA 2D2CC 4LF9L 3KYHC 3G4SA 2KHSA 3PUWA 5JPNC 1YIJA 3M7GA 4LWCA 2R93B 3HOXH 1F9RA 2B2VA 1MSGA 1LTLA 5C3WA 4DV3Q 4LUOA 2Z4IA 5M3FB 3GTKB 3A5ZB 3K5OA 1SNDA 1IZ6A 1E24A 3KJOA 3PIP3 5A2QE 1DJRD 3L0OA 4LAAA 3ONAB 2GA4B 2UU9Q 2YU9H 5GAHC 2L4NA 2L15A 3SK5A 4O42A 1CI3M 1UAPA 1WTXA 1SNOA 1VQGA 1GJXA 3CCUA 2ZM6Q 2UUAL 1TY0A 1PH2A 1HZBA 1XMQL 1F9QA 4B3SQ 4XQQA 2M00A 3PV0A 3PO3G 4L5QA 5CBEE 4HIOA 1MIUA 3TP6A 5C3EH 1O78A 4R8IA 3GTPH 3URYA 2ALYB 4KV6A 1TT2A 3TN2A 3NWTA 4KJNA 3EBEA 5A35A 1B7YB 2KOLA 4DR7L 3ZYYX 1QCBD 1CFMA 4K6DA 5CORA 5AFWA 2IWHA 2X6GA 4GOPB 4KTAA 1X3GA 2UXCQ 3NE5B 2ENBA 4IALA 4A3GH 3TS0A 1PZID 1TIID 1EZ6A 4DK0A 3D4RA 2E2IH 1YJ9A 1KXLA 3L7ZC 3A74A 1VQJA 2Q8RE 1EY8A 3OTOL 1LT4D 1M1KC 4GNXB 4R8NA 2OQ0A 1MGSA 4BWGB 3VA5A 5EPKA 2JA6H 4WJ4A 1SYDA 5HGQA 2RDHA 5J22A 1UEAB 2BE5C 3CCQA 5LL6S 1TWHH 3HKZB 3S1RB 2BOSA 4PMCA 3HOUB 1NTGA 1BOSA 5EKKA 5LMUL 1RJTA 3LX0A 2OTJA 3KJPA 5GADC 4QCLA 1CKOA 1YI2A 1SRUA 3STBD 4JK1C 4DUZQ 4IUUA 1Q82C 5EPJA 1AZQA 2HHHL 3NK9A 1RTNA 5EKLA 2NVQB 4DGZA 5G3LF 1VQ8A 4RWSC 5JVH3 1B1ZA 4B3ML 3Q6SA 1PZJD 1SYCA 3M4QA 4JW0A 1B70B 5BN5A 2JA7B 5D65A 2IT1A 1B4OA 2JA8G 1SE3A 3DEPA 1EOTA 2ZJRA 2EJFC 1CHPD 3W5OA 1AN8A 3OW7A 1V1OA 3D31A 3G7LA 4LFAQ 1ZYRD 1R9TB 4FF2A 4GKKL 1B50A 4DV0L 3K6OA 5IT9E 1C4QA 2R3ZA 4JI4Q 3VYUA 4QL5A 1K3RA 3F1ZA 4LFBL 1CTMA 1PYBA 2VZAA 2DY8A 2DJGC 1N33Q 3RR5A 2IPKD 1PRTB 1O80A 2BH8A 2F0OA 1EY5A 3GDEA 1XNQQ 1EZ8A 1SJHD 4NXMQ 1EUJA 1ET6A 1IBLQ 1VMPA 3F8TA 4HSVA 4KMUC 1RIPA 1SNMA 1LTGD 2RCFA 3DM1A 3U4VA 1ILPA 1T9HA 3T1HL 1KTKA 1HPCA 2LMCB 2DNEA 1VQIA 3S1QB 3GTLH 4DR2Q 4A3GG 5M9OA 1SYGA 4POFA 2SDFA 1CKNA 4FXDA 2QA4A 4X62Q 1S3OA 1MBYA 2I5MX 3DMUA 3VR3A 5C4ZA 3I2ZA 4IFDH 1CQFA 1WCMH 3NQIA 4MTNA 4R4IA 1HR0Q 4JI6Q 2K7VA 2WAQG 1EFWA 1SMYD 2B29A 5IP9H 1PH3A 1OXUA 4CJ1B 1A3VA 2UUCQ 1CZWA 3HKSA 5EGTA 2A6ED 2NZOA 2MGSA 3OWFA 4A3IB 4R9WA 2VS1A 2F0VA 4JBMA 4ABNA 2BA1A 2F0NA 1T5EA 5T1IA 3DLLA 1HHVA 5M3FG 2E2IB 3QWNA 3DWAA 1YNXA 2ZJQA 3SEBA 3TP7A 4B3MQ 1QZHA 2EPBA 1LYLA 1HNWQ 4IQZA 5C4JB 3BDCA 1EOVA 1Y8NB 1S40A 2EYPA 3NQTA 3CCMA 2NN6H 3CCRA 1VQCA 4DR5Q 3GV3A 2N88A 4KI0A 1GOZA 4OHJA 3LGJA 3HOZB 1PH6A 4GOPC 1TU2B 3FDTA 4DAYA 1L1OA 4A3MG 4DU9A 2OEOA 3TRZA 3C1EA 3NBIA 2QEJC 1NJIC 1IHZA 3UE1A 3VA7A 5ELNA 4UAIA 4WJ3M 2R93G 1KRSA 3GTOH 5CBAE 2EXDA 4C3HB 5I4DA 1EYGA 2A5HA 2NVYH 5E4WC 1EFID 3M4PA 4BBRB 3PF4A 4B3TL 5BN3A 4DR6Q 3EN2A 2WAQE 4A93H 3GTOB 1G91A 2AQ1B 4M8AA 5CV4A 5EPLA 1T5XD 3P75A 2UXCL 4XQNA 2BA0A 3J80E 4KD4A 1KLGD 1X3PA 4G7ZC 2UUCL 4UHVA 3T1YQ 3S15H 1GVPA 5C3EG 2D62A 5FJ8H 3E0EA 2HUGA 4LF7L 4AYBB 4IFDI 1I4RA 5FO9B 2R7ZG 1F2LA 4FDBA 1E22A 4A3LG 3WOEA 2YTXA 4IFDG 1EY4A 2ZXRA 5CV8A 4A93B 3I3CA 3I56A 2QDBA 3HEJA 1K3BC 1ZKOA 4IN3A 4EQNA 2AHOB 3F2BA 1HR0W 3AFQA 4K5VA 1OXTA 1BCPD 4LF8Q 1I3QH 4O2DA 2X69A 3DM3A 1BCPF 4LW1A 1XNRQ 2KBNA 5J3BA 5C5MA 2OQKA 5JJLA 3H09A 2I5LX 1EIGA 5ELDA 4ILWA 1BO0A 2EY2A 3T56B 3TZUA 3M85A 2IY5B 5AJ3L 4ZUIA 5K36G 4CKEA 4JPBW 1TVXA 4HTHA 1JWMD 1I6HH 1JOKA 4DF7A 1HH2P 1E1OA 3E6ZX 3U50C 4DV6L 1KC8C 1JB3A 3FP9A 1IBMQ 4DR5L 4A3EH 2F0MA 1KAWA 1EQQA 2KCCA 2RSOA 1FNWA 1PFNA 1C8CA 4PV1C 1X54A 4MNOA 3NENA 1STBA 1ICFB 1YHAA 2XWBB 3FVQA 1EQVA 4BXXH 1I6HB 3K8AA 1ZYRC 4ALPA 3LNNA 4GLAC 4NB3A 1UE1A 2K50A 4CBVA 2P5ZX 5IYDH 4FF3A 3CXCA 1VQHA 3S17H 5A2QL 4XDXA 2WFWA 5EAYA 1TQOA 3NSWA 1TWGH 1X3EA 1RD9D 1Q7YC 2AUJD 1NMFA 3FHWA 4DR2L 4GLXA 3EFXD 3HKZE 2QF7A 3PO2H 1SE8A 1JE5A 3NUCA 5C6AA 1K73C 4LNQA 1CK1A 1JR0D 4TRDA 4X64Q 3I72A 4IFDJ 4JI0Q 4NXML 5LL6X 2JK8A 2PQEA 5E4XA 3GTMH 4JOIC 4DK1A 4IJHA 4RHRA 5JEAJ 1C48A 2FFKB 3CRLC 2IW3A 3HOVB 2G5DA 3EROA 3NTIA 1VQ6A 1F2MA 4EQPA 4JI4L 4DV0Q 4CKBA 2Z6BA 1KD1C 1EQRA 5KNBA 1SMXA 4UP9A 4IUNA 3K59A 2L9HA 3BDOA 4HN7A 1J6QA 1I50B 3CMEA 3GTMB 3T1YL 4YY3L 1XWEA 2LY7A 4JG2A 1EIYB 3KF6A 2L11A 1HNXL 3WWVA 1QUQB 4LF6Q 2UU9L 2LXKA 4QIWE 2Z9HA 2FJ2A 3BZDB 5IYBG 1AW7A 4C3IH 1UUPA 1F9PA 3H6MA 2NTSA 3LWUA 2KQ3A 3W1BA 1PTOB 2F3IA 1IYJB 5FLXc 4ZLTF 2K04A 1LT5D 1ENCA 1PRTC 1Q8IA 2M2LA 3K7UC 3VYTA 3H3VC 4DR4L 1X56A 1WFQA 2Y0SB 3EJIA 4V0BA 1NY4A 1IBLL 5JAVA 2L1BA 5D3DA 5NUCA 2NUCA 4H0LC 1X65A 1UWVA 3KUPA 1LTAD 2A19A 5I9OA 4K0KQ 1GO3E 3K58A 2Q2TA 4DV7L 4HR7B 2SNSA 1EWHA 4JI8L 1JC7A 1TS4A 4IUQA 1K8AC 4N9PA 2F0JA 2AKWB 1W2BA 3H3VI 1X32A 1K83H 4LJZC 4EX5A 1D1KA 1DOMA 2B2UA 3CQZH 3RZDB 2Z8LA 3NTHA 4HAEA 3ND8A 4JOIA 4WFN3 4LF4Q 5C4XG 5ELFA 5FLMH 3SR1A 3ERQA 2CKZB 3HOWG 2HDLA 3A7AB 1LO5D 1Q81C 3H15A 2L0CA 1JJGA 2Q2UA 5DM63 3I91A 2XWJB 2E2JH 2UUAQ 2LKVA 2JP1A 2XN9C 2HHHQ 3HOXB 4KY7A 3E5SA 1EYAA 2EYLA 4NPSA 2EZVA 2K52A 4L5TA 4JC0A 3RZDH 2OTLA 3GTKH 4PQXA 1WJJA 3BDLA 2R6GA 2BDOA 1DYQA 3OW2A 3GQBA 4IO9A 4DPGA 4MZ9A 2F0TA 1LTSD 4J6HA 5IYCG 3KF6B 1KL9A 3S15B 1JICA 2ZJPA 4HIKA 3J7YW 2B8GA 4CKCA 1XNRL 4KK7A 4CDDC 1Y1WB 3S14H 3UI2A 3U58A 4F87A 1LTID 1F9SA 4FO2A 4GNXA 1PYSB 4YWLA 4JI5L 2AWNA 5E1FA 5ELBA 4B3RQ 1A3TA 4JI7L 3DUZA 3W3AA 5CYUA 1SDFA 1PH5A 1TWCH 4K8JA 4CGYB 1I4QA 4ZKCB 4QUCA 5DM73 4JBKA 5DNFA 4QQBX 1FJGQ 1UE6A 2NVTH 1AH9A 2H1EA 3FMCA 4CDCC 1A62A 1E1TA 2A68D 4DV2L 4GLVB 5EJWA 1UE5A 2KHJA 4HMIA 2B2UC 4QGUA 3FKIB 2PYKA 3IFDA 4LFCL 3J7ZC 2NYZD 5EKIA 4OO1I 5FOBB 3GTQB 5FLXL 2E75C 4L8JA 4OXPA 1HTLD 5C4XB 2M9VA 1U4LA 1K0RA 2K03A 1J5EL 5CR3A 1E2ZA 1G51A 3JAME 3J81L 1S5FD 2Z0SA 5DLQE 5C4XH 1XPRA 2CFMA 5FLMG 4UDUC 1FGBD 4DUYQ 2AQ2B 3BVZA 5COYA 3D6WA 4NW2A 4A3GB 2LXJA 4MHEA 1VQLA 2RHQB 1SYEA 3S2HB 4WRDA 2F03A 5IIFA 3AEVA 1WCMG 2MNAA 2E2HB 3B6YA 4JI6L 2F0KA 4A3FG 4A3DH 1GKHA 2NN6I 3KK7A 2EY5A 3N52A 1TWGB 4XYQA 4K14A 4GKJQ 1SAPA 4HJ8A 1H9MA 4DV4L 4E6IA 3CC7A 4A3DB 5IP7H 4LUZA 4DV2Q 3H0GH 5HURA 3UDIA 3AB9A 2LFNA 4YIJA 4BY1B 3RN2A 2HT1A 3IAYA 5C4JH 2F0SA 1TXYA 1XMOL 3T16A 5IGBA 1N34L 2PI2E 3OIQA 4JV5L 4F88A 4OX9Q 3WOFA 4GOPA 1L0YB 2HQLA 3F2UA 1QILA 3NP8A 1BQQT 4K6LA 4KY5A 1BCPC 3CC2A 3PSIA 2H4OA 3OSOA 2F0GA 1B9MA 4K2LA 3HOZH 4X62L 2XIWA 1E7ZA 4C3JB 1SE4A 3I4LA 3SXHA 2Y0SE 1K28A 1L0XB 3BYTB 4B9WA 1O7IA 1IBKQ 4X3KA 4DNTB 3ULPA 3GTJB 1PVOA 2ICEC 1DGSA 5GROA 3PUYA 1LV9A 1XJVA 3AMUA 2CCZA 4G57A 1MHWC 2WB1E 2N55A 2RHSB 5JJIA 1BKBA 1VS0A 2AWOA 3MA2B 4QY7A 4FP5D 4RA8A 4A93G 1VQFA 3ERSX 3UDFA 1N33L 4A3CH 1HNXQ 4IURA 1Y69U 2B39A 2V4DA 3J7A5 3ICEA 4OX9L 3C46A 1LTRD 1VF5C 3U9SA 1QWYA 4M1UB 1TS3A 2TSSA 3GTJH 4DKAC 1KHIA 1QOHA 1JJ2A 1D5ZC 1KABA 3CCVA 1I3QB 4A3IG 1H95A 3NXWA 3V2TA 1BUVT 1AFPA 2K5HA 3D0FA 1L2FA 2QDLA 2OT2A 4NDXA 3PUXA 1W6KA 3E3XA 4KKSA 4A3LH 1VQEA 4TVAB 4Y7NH 4S3SA 2XTIA 5IWAL 3PIOA 2JA5G 4LK1C 1YJWA 5I2YA 1N32L 1B2TA 3OHXC 4BBRG 3X3MA 4CDFC 4DAYB 2JJQA 3J80L 1HZ9A 5LHY1 3R2TA 4N8FA 3J80i 4A3BH 1Z6HA 3DEOA 1LUZA 5IP7G 4A3MB 2EIFA 2EVBA 3ZJYC 4K0KL 3H0GG 3U4ZA 4OO1H 1VQMA 1STGA 3QO2A 2BE5D 4J1MA 4R4TA 4H44C 4PZ6A 4WJWA 4X3TA 2A68C 2VQFL 4YCWA 2F1MA 3KLSX 4KHZA 1FVIA 2UUBL 5IT9c 3KLSA 2PO4A 1ILQA 1V9PA 2YYZA 4NXNQ 3RZOH 4CJ0B 2UXBQ 4KHVA 3N6RA 4A3KB 3G6JB 4A3EG 4PZ8A 5L37A 4C3JH 1IYVA 3GP7A 2EQSA 1H9JA 1M90C 5G3LD 2SOBA 2MJ8A 2ZTCA 3VR2A 1Q86C 1U4RA 4FF4A 3PCOB 3I8ZA 1VQPA 3VR5A 3HS0C 1LM0A 1Q8KA 1JORA 4BY1H 2EE1A 4DK3C 4DNIA 2L12A 1XMOQ 1STNA 1C9OA 3PIPA 4HMJA 2FINB 2I5HA 2DJFC 5CV9A 1TWHB 1ENFA 2WKCA 4PMWA 2N8NA 4A3KH 1C0AA 2CVRA 3BYYB 3A56A 2MQHA 3L3OC 1EEFD 3ITPA 3H94A 2YU9B 2QKIC 2EYJA 2F0DA 2ZTEA 3NHHA 4YWKA 3KOJA 3MXNB 3PMFA 4GKJL 4DV6Q 1A2TA 1DONA 2JE6I 3PO3H 4C3IB 5D14A 5FLXE 2K33A 3T4AC 1A8VA 1PDQA 3LWEA 3HKZG 3HOUG 4IPHA 2ATWA 4OL7A 3S24A 3MEHA 3P1HA 3J81E 5T1GA 4NXNL 3K80C 1YZ6A 2XVSA 2O5JC 3AU7A 1S4ZA 2UUBQ 1MJEA 3MXPA 1X9NA 3O13A 5LMNL 1SEBD 4KJOA 5EQ0A 4FXGC 2A1AA 1PRTF 1EWIA 2WB1G 1TWAH 4HIMA 4AQYQ 4P72A 1WTVA 1VQ9A 4A3FH 3E0JA 1HNZL 1EY7A 5C4HA 4ZCKA 1WOCA 4JYAQ 4GS3A 2RDFA 1HUMA 4F7XA 1KQSA 1IXRA 3Q8DA 4AIMA 3GTGH 5LMNW 4ODGA 3I4MH 2GVBA 2N3SA 2G9DA 4O0AA 4GN3B 2E74C 1VQ5A 2PW7A 5M3MG 4P75A 1DOLA 4RCNA 4DNRB 1LTBD 4DR7Q 4K5WA 4DAMA 3PGZA 1RKNA 1VF7A 1JWSD 1KIXA 2B63H 1GUGA 1NNXA 2PMZE 5F2DA 3C3LA 5M5WB 1QVCA 2GN5A 4B3SL 3A0JA 1PFBA 4QUFA 1EU4A 1ASYA 1DD2A 4KHPL 3M7NA 4BS9A 1BBXC 2EY6A 1NR2A 4DXGA 3L2PA 1Y14B 3I4MB 5M5WH 1G291 5IODA 2VNUD 4A3KG 2SNMA 4UY8C 1TKWB 2OCEA 3MHBA 3OOCA 2CQAA 3L9AX 1JMCA 1U0LA 1E2WA 4RGNA 5IOCA 3M3YH 1WTQA 1V1QA 5J39A 1HNWL 4BA1I 4U673 1QNUA 4LMQD 2NVQH 1QNKA 3C2PA 5EBDA 1XXGA 3BVMA 3K0XA 1K9MC 3CW2C 3RD4A 4FXKC 1KDAA 4APVA 4R4CA 3M4OH 4AYBE 3EQLC 5HGTA 3TSSA 1A0IA 1LABA 2FMMA 1HQMC 2EYHA 1ICWA 2F0HA 1YHQA 3D4DA 2WIIB 2JA5B 2MHVA 3KLWA 3M4YA 3NWSA 1G6ZA 1KLUD 5ISRA 2NZ1D 4ME5A 4IUPA 2MPMA 2OF1A 1VQNA 4OWXB 1MSHA 1JOQA 3CKIB 2JA5H 4DV1Q 5IGFA 4BBRH 4XXEA 2VUMG 1GHKA 1N9WA 2DY7A 1HFGA 1SNQA 3P20A 2JA8B 1O7YA 5JEAH 2XGTA 4FVMA 2KCTA 5M3MB 1D2BA 3MXUA 3A8KE 5ELOA 4OEMB 1PH7A 1FNUA 4C56C 1GD7A 1X3QA 3RN5A 3I4MG 5C44G 1VQ4A 4GNXC 5FK9C 1N36L 2MP1A 3CAMA 3CCSA 4ZAIA 2HIVA 5M3MH 2R92H 4BY7G 5LMNQ 2DN8A 4QJFA 4HCEA 3QR8A 3NBHB 3CU7A 5M3FH 3KLRA 5CMDA 1XNQL 1PH4A 1O7ZA 2QW7A 1YITA 3S2HH 3JC66 3UE0A 1NE3A 2ZXPA 1X3FA 2NN6G 4C2MH 4RKBA 4OIJA 3A8JE 2UXDQ 4Y52H 4C3JG 4NMZA 1YNND 1EY9A 5C44B 1VQKA 1F2YA 2A69C 5KYIA 2IX0A 1ESRA 1WI5A 1SNPA 4Q0FA 2RBMA 2VB3X 4A3MH 5C3EB 3J80c 1RHPA 5CC4A 1STAA 2RQXA 2Z6KC 3W2DA 1BR9A 3K5MA 2B2TC 3HOYB 3M3YB 2LSSA 2R93H 4P73A 1DXMA 1ZXTA 2D0PA 3MXNA 2I0QA 1B8AA 2OXPA 3HG9A 3A7LA 2WB1B 3CMAA 4RHSA 1FYCA 2JA7G 3QB3A 4YCUA 2UXDL 3RNUA 1D5XC 2H5XA 2CH4W 1YNJC 2KEEA 3GD7A 3DWQA
chains in the Genus database with same CATH topology
1K0RA 5H1SE 4A3JG 4DR6L 2E5LL 4B3TQ 3RR5A 1N33Q 1J5EL 2BH8A 1QVGA 2VY3A 4JI6Q 1VQAA 4KLKA 2YV5A 4B3RL 3GDEA 2K5VA 1G51A 2QEXA 1XNQQ 4JI3L 2Z0SA 4NXMQ 1EUJA 5DLQE 1HJPA 5C4XH 2CFMA 4A75A 5FLMG 1Y1WH 1XPRA 1IBLQ 1Q46A 3F8TA 4DUYQ 1RIPA 3U4VA 4OONA 2IX1A 3F2DA 1T9HA 3S1RH 3HOUH 1Q1BA 4DR1Q 2LXJA 3T1HL 3CCLA 1VQLA 2RHQB 1VQIA 2F52A 3GTLH 4DR2Q 4LF9Q 5C0XI 1V43A 4A3GG 4LF8L 3HOWH 2HIXA 4POFA 3AEVA 3OTOQ 1BVSA 1WCMG 4OWWB 1CKNA 2MNAA 4KHPQ 2QA4A 4X62Q 1S3OA 2I5MX 3B6YA 3I2ZA 4JI6L 1WCMH 5M5YH 4A3FG 4MTNA 4A3DH 1GKHA 1UE7A 4R4IA 2NN6I 3STBC 3HOYH 1N32Q 1HR0Q 4IPGA 3I7FA 4GKJQ 1VCIA 2QGQA 5BR8L 4JBWA 4HJ8A 2DGYA 4BA2I 2WAQG 1EFWA 3BZCA 2B29A 4DV4L 3CC7A 3K7AH 5IP7H 5IP9H 1PH3A 1OXUA 4GKKQ 4LUZA 4DV2Q 3H0GH 2UUCQ 3HKSA 5GAEC 3UDIA 4PG3A 5IP9G 2NZOA 1X55A 3RN2A 2Q2HA 4XTCS 2VS1A 2HT1A 5IYCH 5C4JH 4JBMA 1PFSA 1SN8A 2BA1A 1TXYA 1XMQQ 3DLLA 1XMOL 3I4OA 1YJNA 1W3SA 5M3FG 1N34L 2PI2E 1IL2A 4JV5L 4PZ7A 1YNXA 2ZJQA 4GOPA 4OX9Q 2HQLA 2ID0A 4B3MQ 1QZHA 1LYLA 3CC2A 1HNWQ 1S40A 1EOVA 3PSIA 2B63G 3ULJA 4YHHQ 3CCMA 3CCRA 1Q1EA 3HOZH 4IOAA 1VQCA 4DR5Q 4X62L 1E3PA 5C0XJ 2PNHA 1E7ZA 1PH1A 2Y0SE 3ER0A 4KI0A 1O7IA 3LGJA 1IBKQ 1PH6A 4R4QA 3ULPA 4GOPC 1PVOA 1YVCA 4EQ5A 1L1OA 4A3MG 1N8RC 5LMUQ 4DR1L 3T1HQ 3TRZA 4BBSG 1DGSA 1CKMA 5GROA 3BJUA 3PUYA 5IYDG 1QUQA 3UE1A 1XJVA 3E9IA 1NJIC 2CCZA 4AH6A 5ELNA 4R1JA 4L5SA 2WB1E 3S2DH 4DV5Q 2R93G 1KRSA 2RHSB 1N36Q 3GTOH 4WJ3M 1BBUA 4X6AH 3G48A 2EXDA 1XPOA 5JJIA 5GQOA 1BKBA 1VS0A 2AWOA 3S1NH 3PUVA 1EYGA 4A3CG 4QY7A 2NVYH 4A93G 3M4PA 1VQFA 1C7YA 4A76A 3ERSX 3I55A 3PF4A 3UDFA 2E5LQ 4B3TL 3EN2A 1HNXQ 2WAQE 2V1CC 1N33L 4DR6Q 4A93H 4A3CH 1SR3A 3J7A5 2GVAA 4YY3Q 3ICEA 4OX9L 4J15A 1VQOA 4HIDA 3J81i 2VQEL 4P74A 1P8LA 2ZTDA 3CCJA 4DV1L 3GTJH 4L5RC 4DKAC 4R4OA 4YHHL 1KHIA 1JJ2A 2UXCL 1MKHA 2CWAA 1UEBA 3CCVA 2ASBA 2BA0A 2MFIA 3BZKA 1OXVA 4A3IG 4LFAL 3CD6A 1H95A 1HZCA 2UUCL 2K5HA 3T1YQ 2B3GA 3D0FA 1L2FA 4LF7Q 2NVXH 1GVPA 1QZGA 1N34Q 5C3EG 4LF5Q 3PUXA 2E2HH 3S15H 2D62A 2MO1A 3GO5A 1YHBA 5FJ8H 4HJAA 3E0EA 3PF5A 4A3LH 1VQEA 1D7QA 4LF7L 4TVAB 4IFDI 2Q2IA 4Y7NH 2R7ZG 2XTIA 4FDBA 1E22A 5IWAL 3PIOA 2JA5G 4LF4L 4A3LG 1HNZQ 2JQOA 1YJWA 2YTXA 4IFDG 1N32L 4BBRG 1SLJA 2FXQA 3I56A 1XPUA 4UP8A 4DAYB 2JJQA 2VQEQ 1HZ9A 1K8GA 3TS2A 3HOVH 1JJCB 5GAGC 3J80i 2AHOB 3BU2A 5BR8Q 3F2BA 1HR0W 4JI0L 3AFQA 4DR3Q 1OXTA 2CWPA 2F4VL 4LF8Q 2VUMH 4X64L 1I3QH 3OYYA 4O2DA 4OO1G 1LUZA 5IP7G 4RG1A 3DM3A 2KCMA 4LW1A 4AQYL 2JA6G 1CKNB 2EIFA 1XNRQ 2KBNA 5J3BA 3ZJYC 3H0GG 3U4ZA 4K0KL 1VQMA 1GM5A 3VDYA 2OQKA 1PH9A 5JJLA 4R4TA 2I5LX 5AJ3Q 1CSPA 2VQFQ 1CUKA 4POGA 4PZ6A 3I4NH 2IY5B 3M85A 5AJ3L 2C35B 2VQFL 4YCWA 1R9TH 4ME3A 2UUBL 4JI3Q 4KHZA 1FVIA 3KF8B 5K36G 5IT9c 3I4NG 4LUVA 4UPAA 1I6HH 1V9PA 2YYZA 4NXNQ 2IHEA 1J5EQ 3RZOH 2UXBQ 2K5NA 1PH8A 3G6EA 1HH2P 1E1OA 3U50C 4JI1Q 4A3EG 4A4IA 2YTVA 4PZ8A 4DUYL 4C3JH 4DV6L 1KC8C 1ASZA 1JT8A 2EQSA 3FP9A 3CPWA 4DR3L 3CP0A 1M90C 1IBMQ 3RLFA 1Y1VG 2WP8J 4DR5L 4A3EH 1EQQA 1KAWA 1U5KA 2KENA 1I50H 4H02A 2ZTCA 1OTCA 4LF6L 1Q86C 2N49A 4BY1G 3PCOB 1YEZA 1VQPA 1LM0A 1NBWA 1Q8KA 3JAMi 4BY1H 2CQOA 1CSQA 4DK3C 4YCVA 4DNIA 4LFBQ 1X54A 3NENA 2VL6A 1XTDA 4MNOA 1XMOQ 1C9OA 1YBYA 3TQYA 3PIPA 4LFCQ 4GN4B 1YHAA 1EIFA 1D8LA 4BXXH 3K8AA 4IPCA 1AE2A 2I5HA 4ALPA 1I5FA 4PMWA 4GLAC 4A3KH 2N8NA 1UE1A 4NB3A 1C0AA 2K50A 4HJ7A 4BXXG 2MQHA 5IYDH 1JB7A 4JI7Q 3E9HA 4DV4Q 1VQDA 3CXCA 1VQHA 2ZTEA 4YWKA 3RLNA 3S17H 1IBML 4JI2L 3AFPA 3KOJA 1G6PA 2WFWA 3MXNB 5EAYA 4GKJL 1X6OA 4DV6Q 1QVFA 2D0OA 1BBWA 3AYHB 1TWGH 2JE6I 3PO3H 2BH2A 1X3EA 2E8GA 1Y1WG 4A3JH 1A8VA 1Q7YC 1NMFA 3FHWA 1A63A 1HZAA 3CCEA 3HKZG 3HOUG 4IPHA 2ATWA 3PUZA 3S24A 4DR2L 4JI1L 4GLXA 4XIGS 4UP7A 4DR4Q 3HKZE 4A3IH 2UXBL 2ES2A 4NXNL 3PO2H 1SE8A 1JE5A 3K80C 1YZ6A 1K73C 4RMFA 3ULLA 1FL0A 1TWFH 2RCNA 3KDFB 4LNQA 1PV4A 2UUBQ 1MJEA 4IJLA 5FJ8G 4X64Q 1PA6A 1X9NA 2A8VA 4IFDJ 3EIVA 4HJ9A 5LMNL 2F4VQ 4JI0Q 2R7ZH 3FKIH 1MJCA 1PHJA 4NXML 2A1AA 5C0XG 2JK8A 2N78A 2YTYA 3TEHB 3J81c 3GTMH 2WB1G 1EWIA 3MEFA 1TWAH 4JOIC 4IJHA 5JEAJ 4HIMA 4P72A 4AQYQ 1Q12A 5M5XH 4OWTB 4X66Q 1VQ9A 2R7DA 4A3FH 1HNZL 4X65L 4IOCA 1VQ6A 1WOCA 4JCVE 3UDGA 3HOYG 4A3BG 2PQAB 3G71A 3F2CA 4JYAQ 1L1OB 4GS3A 4JI4L 4BY7H 1NMGA 2PI2A 3CC4A 4LF5L 3NELA 4DV0Q 1KQSA 1IXRA 3Q8DA 4AIMA 1KD1C 1EQRA 3GTGH 5LMNW 3I4MH 1SMXA 2GVBA 2N3SA 4O0AA 4UP9A 4GN3B 4AYBG 2JEBI 5M3MG 1VQ5A 4P75A 1I94L 4DR7Q 4C3HH 1J6QA 4GN5A 3PGZA 4DAMA 3CMEA 1KIXA 3T1YL 4YY3L 1OXXK 2B63H 1Y1VH 4JG2A 4TQUS 1L1OC 1VQBA 3KF6A 3W1GA 1EIYB 2DUDA 1HNXL 3WWVA 1QUQB 2PMZE 4DV7Q 4X66L 3HFZB 4LF6Q 2UU9L 4A3BH 2LXKA 1QVCA 2GN5A 4QIWE 3A0JA 4B3SL 4JBJA 4JI5Q 1FGUA 2NZHA 5IYBG 1ASYA 4C3IH 4DV5L 4IPDA 4KHPL 4DK6C 3W1BA 2F3IA 3M7NA 4JI8Q 3JAMc 3L2PA 1IYJB 3CF5A 1Y14B 5FLXc 3KYHC 5M5WH 2Y0SG 3G4SA 4LF9L 4BBSH 1G291 3UDXA 2IHFA 3PUWA 1YIJA 2VNUD 2PQAA 4LWCA 4A3KG 3K7UC 3HOXH 4UY8C 4DV3Q 5IY0A 1LTLA 4DR4L 1X56A 2OCEA 1WFQA 4LUOA 3CPFA 3HOXG 1NY4A 1IBLL 3A5ZB 2K14A 1JMCA 1IZ6A 1U0LA 1UWVA 1X65A 1E24A 2A19A 3KJOA 4K0KQ 1GO3E 3M3YH 3L0OA 2UU9Q 2AMCB 2YU9H 2Q2TA 3AQQA 1V1QA 5GAHC 4DV7L 1HNWL 4JI8L 4BA1I 3KFUA 1K8AC 2L15A 2R7FA 2NVQH 5JJKA 2AKWB 1VQGA 1OXSC 1W2BA 3CCUA 2ZM6Q 2UUAL 3H3VI 3K0XA 1PH2A 1K83H 1HZBA 1XMQL 4B3SQ 3S1MH 1K9MC 3CW2C 4EX5A 3PV0A 4APVA 4L5QA 3PO3G 4R4CA 3M4OH 4YWMA 4HIOA 4AYBE 1Z9FA 1SROA 3CQZH 1MIUA 1A0IA 5C3EH 4JOIA 5IWAQ 1RL2A 4LF4Q 5C4XG 1YHQA 3GTPH 5FLMH 2OWOA 2ALYB 2K4KA 3M9BA 3EBEA 1B7YB 2CKZB 3KLWA 3S1QH 4DR7L 1I94Q 3HOWG 3PO2G 3FKIG 1S72A 4GOPB 4OWXB 3H15A 3J81j 1Q81C 1VQNA 3S16H 1X3GA 2UXCQ 1JJGA 2JA5H 2Q2UA 3HOVG 4A3GH 3TS0A 4A3DG 4DV1Q 3IRBA 2JEAI 3GTQH 5JEAG 2E2JH 4BBRH 2UUAQ 2E2IH 1YJ9A 3RLOA 3L7ZC 2VUMG 1N9WA 3A74A 1KXLA 2HHHQ 1VQJA 3OTOL 2XGTA 3H3VH 4NPSA 2OTLA 2K52A 2KCTA 4JC0A 4L5TA 3RZDH 1M1KC 1HR0L 3GTKH 3K81C 4GNXB 5C44H 5ELOA 1WJJA 2OQ0A 2R92G 2R6GA 1PH7A 1GD7A 3RN5A 3OW2A 3I4MG 5C44G 1VQ4A 4GNXC 4IO9A 3KDFA 1N36L 5IE8A 4DPGA 5HGQA 1Z47A 3CAMA 2JA6H 4MZ9A 3CCSA 2HIVA 5M3MH 2R92H 4BY7G 3CCQA 5LMNQ 5IYCG 3KF6B 1TWHH 4QJFA 2K75A 1KL9A 3NBHB 4DV3L 1NTGA 5M3FH 1XNQL 1PH4A 1YITA 2ZJPA 5LMUL 4WJ4A 4HIKA 2OTJA 3KJPA 3S2HH 5GADC 3JC66 1P16A 3NEMA 3UE0A 1XNRL 3TREA 1CKOA 1YI2A 1NE3A 1SRUA 2KHIA 1WYDA 3STBD 1IBKL 1X3FA 3S14H 3U58A 2Z6KA 4DUZQ 2NN6G 3HOZG 4C2MH 1Q82C 4GNXA 1PYSB 2RF4A 4YWLA 2HHHL 4JI5L 2AWNA 2UXDQ 4Y52H 4B3RQ 4JI7L 1AE3A 1VQ8A 1VQKA 3A5UA 2IX0A 1WI5A 1TWCH 1PH5A 1VQ7A 3SGIA 5IYBH 4B3ML 3M4QA 4A3MH 4JBKA 4JV5Q 1B70B 4JI2Q 4QQBX 2IT1A 3J80c 1FJGQ 1UE6A 1FJGL 2Z6KC 2JA8G 2NVTH 2ZJRA 1AH9A 2LSSA 4HJ5A 1A62A 1E1TA 2JA8H 2R93H 4P73A 5HY6A 3W5OA 2D0PA 1SFOH 3D31A 2JA9A 4GLVB 4LFAQ 4DV2L 1B8AA 1UE5A 2I0QA 2KHJA 2JA7H 4GKKL 4DV0L 4QGUA 3CMAA 4JI4Q 1L0WA 4QL5A 1KRTA 4YCUA 4LFCL 3J7ZC 2JA7G 4JYAL 2UXDL 5E7NA 1K3RA 2MO0A 2ZM6L 2VW9A 3RNUA 3F1ZA 4LFBL 4OO1I 2H5XA 1PYBA 4X65Q 2VZAA 4OXPA 4DUZL 3GD7A 4P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0R A;  5H1S E;  4A3J G;  4DR6 L;  2E5L L;  4B3T Q;  3RR5 A;  1N33 Q;  1J5E L;  2BH8 A;  1QVG A;  2VY3 A;  4JI6 Q;  1VQA A;  4KLK A;  2YV5 A;  4B3R L;  3GDE A;  2K5V A;  1G51 A;  2QEX A;  1XNQ Q;  4JI3 L;  2Z0S A;  4NXM Q;  1EUJ A;  5DLQ E;  1HJP A;  5C4X H;  2CFM A;  4A75 A;  5FLM G;  1Y1W H;  1XPR A;  1IBL Q;  1Q46 A;  3F8T A;  4DUY Q;  1RIP A;  3U4V A;  4OON A;  2IX1 A;  3F2D A;  1T9H A;  3S1R H;  3HOU H;  1Q1B A;  4DR1 Q;  2LXJ A;  3T1H L;  3CCL A;  1VQL A;  2RHQ B;  1VQI A;  2F52 A;  3GTL H;  4DR2 Q;  4LF9 Q;  5C0X I;  1V43 A;  4A3G G;  4LF8 L;  3HOW H;  2HIX A;  4POF A;  3AEV A;  3OTO Q;  1BVS A;  1WCM G;  4OWW B;  1CKN A;  2MNA A;  4KHP Q;  2QA4 A;  4X62 Q;  1S3O A;  2I5M X;  3B6Y A;  3I2Z A;  4JI6 L;  1WCM H;  5M5Y H;  4A3F G;  4MTN A;  4A3D H;  1GKH A;  1UE7 A;  4R4I A;  2NN6 I;  3STB C;  3HOY H;  1N32 Q;  1HR0 Q;  4IPG A;  3I7F A;  4GKJ Q;  1VCI A;  2QGQ A;  5BR8 L;  4JBW A;  4HJ8 A;  2DGY A;  4BA2 I;  2WAQ G;  1EFW A;  3BZC A;  2B29 A;  4DV4 L;  3CC7 A;  3K7A H;  5IP7 H;  5IP9 H;  1PH3 A;  1OXU A;  4GKK Q;  4LUZ A;  4DV2 Q;  3H0G H;  2UUC Q;  3HKS A;  5GAE C;  3UDI A;  4PG3 A;  5IP9 G;  2NZO A;  1X55 A;  3RN2 A;  2Q2H A;  4XTC S;  2VS1 A;  2HT1 A;  5IYC H;  5C4J H;  4JBM A;  1PFS A;  1SN8 A;  2BA1 A;  1TXY A;  1XMQ Q;  3DLL A;  1XMO L;  3I4O A;  1YJN A;  1W3S A;  5M3F G;  1N34 L;  2PI2 E;  1IL2 A;  4JV5 L;  4PZ7 A;  1YNX A;  2ZJQ A;  4GOP A;  4OX9 Q;  2HQL A;  2ID0 A;  4B3M Q;  1QZH A;  1LYL A;  3CC2 A;  1HNW Q;  1S40 A;  1EOV A;  3PSI A;  2B63 G;  3ULJ A;  4YHH Q;  3CCM A;  3CCR A;  1Q1E A;  3HOZ H;  4IOA A;  1VQC A;  4DR5 Q;  4X62 L;  1E3P A;  5C0X J;  2PNH A;  1E7Z A;  1PH1 A;  2Y0S E;  3ER0 A;  4KI0 A;  1O7I A;  3LGJ A;  1IBK Q;  1PH6 A;  4R4Q A;  3ULP A;  4GOP C;  1PVO A;  1YVC A;  4EQ5 A;  1L1O A;  4A3M G;  1N8R C;  5LMU Q;  4DR1 L;  3T1H Q;  3TRZ A;  4BBS G;  1DGS A;  1CKM A;  5GRO A;  3BJU A;  3PUY A;  5IYD G;  1QUQ A;  3UE1 A;  1XJV A;  3E9I A;  1NJI C;  2CCZ A;  4AH6 A;  5ELN A;  4R1J A;  4L5S A;  2WB1 E;  3S2D H;  4DV5 Q;  2R93 G;  1KRS A;  2RHS B;  1N36 Q;  3GTO H;  4WJ3 M;  1BBU A;  4X6A H;  3G48 A;  2EXD A;  1XPO A;  5JJI A;  5GQO A;  1BKB A;  1VS0 A;  2AWO A;  3S1N H;  3PUV A;  1EYG A;  4A3C G;  4QY7 A;  2NVY H;  4A93 G;  3M4P A;  1VQF A;  1C7Y A;  4A76 A;  3ERS X;  3I55 A;  3PF4 A;  3UDF A;  2E5L Q;  4B3T L;  3EN2 A;  1HNX Q;  2WAQ E;  2V1C C;  1N33 L;  4DR6 Q;  4A93 H;  4A3C H;  1SR3 A;  3J7A 5;  2GVA A;  4YY3 Q;  3ICE A;  4OX9 L;  4J15 A;  1VQO A;  4HID A;  3J81 i;  2VQE L;  4P74 A;  1P8L A;  2ZTD A;  3CCJ A;  4DV1 L;  3GTJ H;  4L5R C;  4DKA C;  4R4O A;  4YHH L;  1KHI A;  1JJ2 A;  2UXC L;  1MKH A;  2CWA A;  1UEB A;  3CCV A;  2ASB A;  2BA0 A;  2MFI A;  3BZK A;  1OXV A;  4A3I G;  4LFA L;  3CD6 A;  1H95 A;  1HZC A;  2UUC L;  2K5H A;  3T1Y Q;  2B3G A;  3D0F A;  1L2F A;  4LF7 Q;  2NVX H;  1GVP A;  1QZG A;  1N34 Q;  5C3E G;  4LF5 Q;  3PUX A;  2E2H H;  3S15 H;  2D62 A;  2MO1 A;  3GO5 A;  1YHB A;  5FJ8 H;  4HJA A;  3E0E A;  3PF5 A;  4A3L H;  1VQE A;  1D7Q A;  4LF7 L;  4TVA B;  4IFD I;  2Q2I A;  4Y7N H;  2R7Z G;  2XTI A;  4FDB A;  1E22 A;  5IWA L;  3PIO A;  2JA5 G;  4LF4 L;  4A3L G;  1HNZ Q;  2JQO A;  1YJW A;  2YTX A;  4IFD G;  1N32 L;  4BBR G;  1SLJ A;  2FXQ A;  3I56 A;  1XPU A;  4UP8 A;  4DAY B;  2JJQ A;  2VQE Q;  1HZ9 A;  1K8G A;  3TS2 A;  3HOV H;  1JJC B;  5GAG C;  3J80 i;  2AHO B;  3BU2 A;  5BR8 Q;  3F2B A;  1HR0 W;  4JI0 L;  3AFQ A;  4DR3 Q;  1OXT A;  2CWP A;  2F4V L;  4LF8 Q;  2VUM H;  4X64 L;  1I3Q H;  3OYY A;  4O2D A;  4OO1 G;  1LUZ A;  5IP7 G;  4RG1 A;  3DM3 A;  2KCM A;  4LW1 A;  4AQY L;  2JA6 G;  1CKN B;  2EIF A;  1XNR Q;  2KBN A;  5J3B A;  3ZJY C;  3H0G G;  3U4Z A;  4K0K L;  1VQM A;  1GM5 A;  3VDY A;  2OQK A;  1PH9 A;  5JJL A;  4R4T A;  2I5L X;  5AJ3 Q;  1CSP A;  2VQF Q;  1CUK A;  4POG A;  4PZ6 A;  3I4N H;  2IY5 B;  3M85 A;  5AJ3 L;  2C35 B;  2VQF L;  4YCW A;  1R9T H;  4ME3 A;  2UUB L;  4JI3 Q;  4KHZ A;  1FVI A;  3KF8 B;  5K36 G;  5IT9 c;  3I4N G;  4LUV A;  4UPA A;  1I6H H;  1V9P A;  2YYZ A;  4NXN Q;  2IHE A;  1J5E Q;  3RZO H;  2UXB Q;  2K5N A;  1PH8 A;  3G6E A;  1HH2 P;  1E1O A;  3U50 C;  4JI1 Q;  4A3E G;  4A4I A;  2YTV A;  4PZ8 A;  4DUY L;  4C3J H;  4DV6 L;  1KC8 C;  1ASZ A;  1JT8 A;  2EQS A;  3FP9 A;  3CPW A;  4DR3 L;  3CP0 A;  1M90 C;  1IBM Q;  3RLF A;  1Y1V G;  2WP8 J;  4DR5 L;  4A3E H;  1EQQ A;  1KAW A;  1U5K A;  2KEN A;  1I50 H;  4H02 A;  2ZTC A;  1OTC A;  4LF6 L;  1Q86 C;  2N49 A;  4BY1 G;  3PCO B;  1YEZ A;  1VQP A;  1LM0 A;  1NBW A;  1Q8K A;  3JAM i;  4BY1 H;  2CQO A;  1CSQ A;  4DK3 C;  4YCV A;  4DNI A;  4LFB Q;  1X54 A;  3NEN A;  2VL6 A;  1XTD A;  4MNO A;  1XMO Q;  1C9O A;  1YBY A;  3TQY A;  3PIP A;  4LFC Q;  4GN4 B;  1YHA A;  1EIF A;  1D8L A;  4BXX H;  3K8A A;  4IPC A;  1AE2 A;  2I5H A;  4ALP A;  1I5F A;  4PMW A;  4GLA C;  4A3K H;  2N8N A;  1UE1 A;  4NB3 A;  1C0A A;  2K50 A;  4HJ7 A;  4BXX G;  2MQH A;  5IYD H;  1JB7 A;  4JI7 Q;  3E9H A;  4DV4 Q;  1VQD A;  3CXC A;  1VQH A;  2ZTE A;  4YWK A;  3RLN A;  3S17 H;  1IBM L;  4JI2 L;  3AFP A;  3KOJ A;  1G6P A;  2WFW A;  3MXN B;  5EAY A;  4GKJ L;  1X6O A;  4DV6 Q;  1QVF A;  2D0O A;  1BBW A;  3AYH B;  1TWG H;  2JE6 I;  3PO3 H;  2BH2 A;  1X3E A;  2E8G A;  1Y1W G;  4A3J H;  1A8V A;  1Q7Y C;  1NMF A;  3FHW A;  1A63 A;  1HZA A;  3CCE A;  3HKZ G;  3HOU G;  4IPH A;  2ATW A;  3PUZ A;  3S24 A;  4DR2 L;  4JI1 L;  4GLX A;  4XIG S;  4UP7 A;  4DR4 Q;  3HKZ E;  4A3I H;  2UXB L;  2ES2 A;  4NXN L;  3PO2 H;  1SE8 A;  1JE5 A;  3K80 C;  1YZ6 A;  1K73 C;  4RMF A;  3ULL A;  1FL0 A;  1TWF H;  2RCN A;  3KDF B;  4LNQ A;  1PV4 A;  2UUB Q;  1MJE A;  4IJL A;  5FJ8 G;  4X64 Q;  1PA6 A;  1X9N A;  2A8V A;  4IFD J;  3EIV A;  4HJ9 A;  5LMN L;  2F4V Q;  4JI0 Q;  2R7Z H;  3FKI H;  1MJC A;  1PHJ A;  4NXM L;  2A1A A;  5C0X G;  2JK8 A;  2N78 A;  2YTY A;  3TEH B;  3J81 c;  3GTM H;  2WB1 G;  1EWI A;  3MEF A;  1TWA H;  4JOI C;  4IJH A;  5JEA J;  4HIM A;  4P72 A;  4AQY Q;  1Q12 A;  5M5X H;  4OWT B;  4X66 Q;  1VQ9 A;  2R7D A;  4A3F H;  1HNZ L;  4X65 L;  4IOC A;  1VQ6 A;  1WOC A;  4JCV E;  3UDG A;  3HOY G;  4A3B G;  2PQA B;  3G71 A;  3F2C A;  4JYA Q;  1L1O B;  4GS3 A;  4JI4 L;  4BY7 H;  1NMG A;  2PI2 A;  3CC4 A;  4LF5 L;  3NEL A;  4DV0 Q;  1KQS A;  1IXR A;  3Q8D A;  4AIM A;  1KD1 C;  1EQR A;  3GTG H;  5LMN W;  3I4M H;  1SMX A;  2GVB A;  2N3S A;  4O0A A;  4UP9 A;  4GN3 B;  4AYB G;  2JEB I;  5M3M G;  1VQ5 A;  4P75 A;  1I94 L;  4DR7 Q;  4C3H H;  1J6Q A;  4GN5 A;  3PGZ A;  4DAM A;  3CME A;  1KIX A;  3T1Y L;  4YY3 L;  1OXX K;  2B63 H;  1Y1V H;  4JG2 A;  4TQU S;  1L1O C;  1VQB A;  3KF6 A;  3W1G A;  1EIY B;  2DUD A;  1HNX L;  3WWV A;  1QUQ B;  2PMZ E;  4DV7 Q;  4X66 L;  3HFZ B;  4LF6 Q;  2UU9 L;  4A3B H;  2LXK A;  1QVC A;  2GN5 A;  4QIW E;  3A0J A;  4B3S L;  4JBJ A;  4JI5 Q;  1FGU A;  2NZH A;  5IYB G;  1ASY A;  4C3I H;  4DV5 L;  4IPD A;  4KHP L;  4DK6 C;  3W1B A;  2F3I A;  3M7N A;  4JI8 Q;  3JAM c;  3L2P A;  1IYJ B;  3CF5 A;  1Y14 B;  5FLX c;  3KYH C;  5M5W H;  2Y0S G;  3G4S A;  4LF9 L;  4BBS H;  1G29 1;  3UDX A;  2IHF A;  3PUW A;  1YIJ A;  2VNU D;  2PQA A;  4LWC A;  4A3K G;  3K7U C;  3HOX H;  4UY8 C;  4DV3 Q;  5IY0 A;  1LTL A;  4DR4 L;  1X56 A;  2OCE A;  1WFQ A;  4LUO A;  3CPF A;  3HOX G;  1NY4 A;  1IBL L;  3A5Z B;  2K14 A;  1JMC A;  1IZ6 A;  1U0L A;  1UWV A;  1X65 A;  1E24 A;  2A19 A;  3KJO A;  4K0K Q;  1GO3 E;  3M3Y H;  3L0O A;  2UU9 Q;  2AMC B;  2YU9 H;  2Q2T A;  3AQQ A;  1V1Q A;  5GAH C;  4DV7 L;  1HNW L;  4JI8 L;  4BA1 I;  3KFU A;  1K8A C;  2L15 A;  2R7F A;  2NVQ H;  5JJK A;  2AKW B;  1VQG A;  1OXS C;  1W2B A;  3CCU A;  2ZM6 Q;  2UUA L;  3H3V I;  3K0X A;  1PH2 A;  1K83 H;  1HZB A;  1XMQ L;  4B3S Q;  3S1M H;  1K9M C;  3CW2 C;  4EX5 A;  3PV0 A;  4APV A;  4L5Q A;  3PO3 G;  4R4C A;  3M4O H;  4YWM A;  4HIO A;  4AYB E;  1Z9F A;  1SRO A;  3CQZ H;  1MIU A;  1A0I A;  5C3E H;  4JOI A;  5IWA Q;  1RL2 A;  4LF4 Q;  5C4X G;  1YHQ A;  3GTP H;  5FLM H;  2OWO A;  2ALY B;  2K4K A;  3M9B A;  3EBE A;  1B7Y B;  2CKZ B;  3KLW A;  3S1Q H;  4DR7 L;  1I94 Q;  3HOW G;  3PO2 G;  3FKI G;  1S72 A;  4GOP B;  4OWX B;  3H15 A;  3J81 j;  1Q81 C;  1VQN A;  3S16 H;  1X3G A;  2UXC Q;  1JJG A;  2JA5 H;  2Q2U A;  3HOV G;  4A3G H;  3TS0 A;  4A3D G;  4DV1 Q;  3IRB A;  2JEA I;  3GTQ H;  5JEA G;  2E2J H;  4BBR H;  2UUA Q;  2E2I H;  1YJ9 A;  3RLO A;  3L7Z C;  2VUM G;  1N9W A;  3A74 A;  1KXL A;  2HHH Q;  1VQJ A;  3OTO L;  2XGT A;  3H3V H;  4NPS A;  2OTL A;  2K52 A;  2KCT A;  4JC0 A;  4L5T A;  3RZD H;  1M1K C;  1HR0 L;  3GTK H;  3K81 C;  4GNX B;  5C44 H;  5ELO A;  1WJJ A;  2OQ0 A;  2R92 G;  2R6G A;  1PH7 A;  1GD7 A;  3RN5 A;  3OW2 A;  3I4M G;  5C44 G;  1VQ4 A;  4GNX C;  4IO9 A;  3KDF A;  1N36 L;  5IE8 A;  4DPG A;  5HGQ A;  1Z47 A;  3CAM A;  2JA6 H;  4MZ9 A;  3CCS A;  2HIV A;  5M3M H;  2R92 H;  4BY7 G;  3CCQ A;  5LMN Q;  5IYC G;  3KF6 B;  1TWH H;  4QJF A;  2K75 A;  1KL9 A;  3NBH B;  4DV3 L;  1NTG A;  5M3F H;  1XNQ L;  1PH4 A;  1YIT A;  2ZJP A;  5LMU L;  4WJ4 A;  4HIK A;  2OTJ A;  3KJP A;  3S2H H;  5GAD C;  3JC6 6;  1P16 A;  3NEM A;  3UE0 A;  1XNR L;  3TRE A;  1CKO A;  1YI2 A;  1NE3 A;  1SRU A;  2KHI A;  1WYD A;  3STB D;  1IBK L;  1X3F A;  3S14 H;  3U58 A;  2Z6K A;  4DUZ Q;  2NN6 G;  3HOZ G;  4C2M H;  1Q82 C;  4GNX A;  1PYS B;  2RF4 A;  4YWL A;  2HHH L;  4JI5 L;  2AWN A;  2UXD Q;  4Y52 H;  4B3R Q;  4JI7 L;  1AE3 A;  1VQ8 A;  1VQK A;  3A5U A;  2IX0 A;  1WI5 A;  1TWC H;  1PH5 A;  1VQ7 A;  3SGI A;  5IYB H;  4B3M L;  3M4Q A;  4A3M H;  4JBK A;  4JV5 Q;  1B70 B;  4JI2 Q;  4QQB X;  2IT1 A;  3J80 c;  1FJG Q;  1UE6 A;  1FJG L;  2Z6K C;  2JA8 G;  2NVT H;  2ZJR A;  1AH9 A;  2LSS A;  4HJ5 A;  1A62 A;  1E1T A;  2JA8 H;  2R93 H;  4P73 A;  5HY6 A;  3W5O A;  2D0P A;  1SFO H;  3D31 A;  2JA9 A;  4GLV B;  4LFA Q;  4DV2 L;  1B8A A;  1UE5 A;  2I0Q A;  2KHJ A;  2JA7 H;  4GKK L;  4DV0 L;  4QGU A;  3CMA A;  4JI4 Q;  1L0W A;  4QL5 A;  1KRT A;  4YCU A;  4LFC L;  3J7Z C;  2JA7 G;  4JYA L;  2UXD L;  5E7N A;  1K3R A;  2MO0 A;  2ZM6 L;  2VW9 A;  3RNU A;  3F1Z A;  4LFB L;  4OO1 I;  2H5X A;  1PYB A;  4X65 Q;  2VZA A;  4OXP A;  4DUZ L;  3GD7 A;  4P71 A; 
#chains in the Genus database with same CATH topology
 3FPP A;  1V8Q A;  5H1S E;  1PZK D;  4A3E B;  2E5L L;  1B44 D;  2VY3 A;  4RGM A;  4B3R L;  2K5V A;  2KVM A;  4QF4 A;  1HJP A;  4A75 A;  3NTK A;  1FR3 A;  2Q8T A;  2A73 B;  1B3A A;  1NR4 A;  2QIL A;  4OON A;  1ET9 A;  3S1R H;  4RGO S;  1ROD A;  3HOU H;  1Q1B A;  1STH A;  3H0G B;  2F52 A;  1TS2 A;  2IJ0 A;  4ULL A;  5KIX A;  1H9K A;  1ONL A;  3MAQ A;  5C0X I;  2VXW A;  2EDG A;  4LF8 L;  1GHJ A;  1A2U A;  1Y1V B;  2PCF B;  3OTO Q;  4TKO B;  4RAU C;  3S17 B;  1SSO A;  1H9S A;  1A15 A;  3K7A B;  3STB C;  1UE7 A;  2B2W A;  3CRK C;  1ML0 D;  3MFY A;  3I7F A;  2G9H D;  3OMG A;  4K2K A;  4BA2 I;  5BR8 L;  2NB0 A;  2PZU A;  3BZC A;  2CHB D;  3K7A H;  3I90 A;  2K28 A;  5KND A;  4GKK Q;  5K36 H;  5GAE C;  2JA6 B;  1JCK B;  2K32 A;  2KEC A;  1PFS A;  1SN8 A;  2F3W A;  2A74 C;  1XMQ Q;  3I4O A;  1LT6 D;  1YJN A;  1W3S A;  3FPU B;  4PZ7 A;  1TR5 A;  3IKJ A;  1KDB A;  2ICI A;  2B63 G;  3S9W A;  3S1N B;  1PLF A;  1SYF A;  2RSN A;  4YHH Q;  1R4Q B;  4IOA A;  2HDM A;  1U4M A;  4XQJ A;  1E3P A;  2PNH A;  1PH1 A;  3T51 B;  3ER0 A;  4DN4 M;  4R4Q A;  3MZ5 A;  2XNA C;  4QIW B;  1YVC A;  4EQ5 A;  5LMU Q;  4DR1 L;  1LT3 D;  1CKM A;  4WOR A;  3BJU A;  4ZRZ A;  5IYD G;  1QUQ A;  1QB5 D;  3E9I A;  3U9O A;  4N9T A;  3VYS A;  4AH6 A;  1WTP A;  4R1J A;  3S2D H;  4X3S A;  1N36 Q;  3G48 A;  1XPO A;  3RZO B;  5GQO A;  5I9P A;  3S1N H;  3PUV A;  2J7Z A;  4A3C G;  1I4H A;  3I55 A;  4OGQ C;  5CV5 A;  1SR3 A;  2GVA A;  1VQO A;  3J81 i;  1P8L A;  5I6Y A;  1CQV A;  3QOJ A;  2CW0 D;  3DWP A;  4DV1 L;  4L5R C;  1NUC A;  2E2D C;  2K5Q A;  2CWA A;  1UEB A;  2ASB A;  2MFI A;  1PTO H;  3BZK A;  1OXV A;  3RMH A;  1HZC A;  4F8M A;  4ZKB B;  2B2W C;  5JVG 3;  2NVX H;  1QZG A;  4LF7 Q;  1N34 Q;  2E2H H;  2MO1 A;  4HJA A;  3GO5 A;  1YHB A;  3PF5 A;  1D7Q A;  5JJZ A;  2Q2I A;  4H7B A;  1HNZ Q;  2CH4 A;  2FXQ A;  4FYD A;  1LLR D;  4NP5 A;  3TBI B;  1U9R A;  1JJC B;  2RA4 A;  3VR6 A;  1SJE D;  3BU2 A;  4RKL A;  1ZEQ X;  2X6L A;  2CWP A;  2VUM H;  5ELE A;  4OO1 G;  3Q22 A;  1PFM A;  5DAU A;  4RG1 A;  2KCM A;  1CKN B;  2IL8 A;  3TZD A;  1MI2 A;  3PQI A;  3VDY A;  1PYW D;  4POG A;  5AJ3 Q;  1CUK A;  2WIN B;  4RH6 A;  1GUS A;  1D5M C;  3K5N A;  4ME3 A;  1CHQ D;  3I4N G;  4G7O C;  4LUV A;  2F0F A;  2IHE A;  2D5D A;  2K5N A;  4G4K A;  1PH8 A;  3G6E A;  1WD1 A;  2EJM A;  4JI1 Q;  4A4I A;  4OEL B;  4DUY L;  1JT8 A;  3CPW A;  2Z1C A;  3CP0 A;  3IL8 A;  3RLF A;  3SDZ A;  2WP8 J;  4C3I G;  1TWA B;  1U5K A;  3FRP B;  1WTH A;  4H02 A;  1OTC A;  2HCI A;  4BY1 G;  1YEZ A;  1F2Z A;  1NBW A;  3SVM A;  2CQO A;  1XYI A;  4RFB A;  2VL6 A;  1NAP A;  3TQY A;  4LFC Q;  2CW0 C;  3KBX A;  3SK6 A;  4IZ8 A;  1EIF A;  1D8L A;  4IPC A;  1ENA A;  1AE2 A;  4K5X A;  1HFN A;  1I5F A;  1HUN A;  3D3R A;  4HJ7 A;  1SYB A;  3BS1 A;  1V1P B;  1JB7 A;  3I73 A;  1VQD A;  5C5L A;  1WCM B;  3RLN A;  4B08 A;  1D6E C;  4JI2 L;  1X6O A;  3J7A V;  1NSN S;  2D0O A;  2XSC A;  1BBW A;  4RGT A;  1QE6 A;  2BH2 A;  2E8G A;  3H91 A;  4J8Q A;  1Y1W G;  1SMY C;  2O4X A;  1HZA A;  1STE A;  1JWU D;  4JI1 L;  3R2I A;  1K0S A;  3A54 A;  4UP7 A;  4XIG S;  4DR4 Q;  4V19 0;  1WD0 A;  1XX8 A;  2JXM B;  1FL0 A;  1TWF H;  2RCN A;  3VR4 A;  2R92 B;  1PV4 A;  2D9U A;  5FJ8 G;  1PA6 A;  2A8V A;  5M5X B;  3DXJ C;  2F4V Q;  2R7Z H;  2F0L A;  3FKI H;  2N78 A;  2YTY A;  3J81 c;  1PTO C;  5IGC A;  1E2V A;  1LAC A;  3KF8 A;  3MEF A;  1IYU A;  3OMC A;  5C0X H;  5M5X H;  4OWT B;  5I6W A;  5IGD A;  2XRS D;  4O1N A;  2I46 A;  3MWY W;  1WTR A;  5KYL A;  4X3U A;  3WDN A;  4G7H C;  3UDG A;  5DEH A;  1IKL A;  2PQA B;  3G71 A;  3BVG A;  4MTK A;  4LF5 L;  3CC4 A;  5JPM C;  2EOT A;  4CDE C;  1TWF B;  3HZX A;  2HCC A;  4H13 C;  2EYF A;  1CA6 A;  1GUO A;  1I94 L;  1RTO A;  1ESF A;  4C3H H;  2A6H D;  3MC0 B;  1GXD C;  1OXX K;  2K1B A;  1EY0 A;  3GTP B;  1B53 A;  1EQT A;  4ZQ3 A;  3PO2 B;  3TDQ A;  4JBJ A;  4DV5 L;  3FEW X;  1MD2 D;  4DA2 A;  2J0T D;  3JAM L;  5KRU A;  4DK6 C;  4JI8 Q;  3JAM c;  5FKA C;  3CF5 A;  4L5S A;  2Y0S G;  2PZT A;  2NVT B;  4BBS H;  3BG3 A;  4XYO A;  2IHF A;  3UDX A;  3M4O B;  2PQA A;  2O5I C;  5IY0 A;  2ZT9 C;  1HTP A;  3CPF A;  4C1N I;  3HOX G;  4BBS B;  5K5P A;  2K14 A;  1FD7 D;  2BDN A;  2F0Q A;  4MN3 A;  1H9S B;  3K57 A;  1TY2 A;  2AMC B;  3AQQ A;  4U68 A;  4PMB A;  3Q0A A;  2KUM A;  2FMC A;  3KBG A;  2I07 B;  1SFO B;  1RDP D;  1JE4 A;  3KFU A;  2R7F A;  5JJK A;  1OXS C;  4RCO A;  3R93 A;  3S1M H;  1CT1 D;  1HXY D;  5BN4 A;  3S14 B;  1TS5 A;  4YWM A;  4ID6 A;  1Z9F A;  1SRO A;  4KKU A;  2HD3 A;  5KEE A;  5IWA Q;  1RL2 A;  4IUT A;  3S1M B;  3TME A;  2OWO A;  2K4K A;  3M9B A;  4Q5V A;  2MUY A;  2B2Y A;  1DM0 B;  3S1Q H;  1I94 Q;  2F3V A;  1TWC B;  3PO2 G;  3FKI G;  1K8O A;  1S72 A;  4EVO A;  3MTS A;  3J81 j;  3S16 H;  1EU3 A;  4KY6 A;  3HOV G;  1WTW A;  4TSS A;  4A3D G;  3IRB A;  1GUW A;  2JEA I;  2C5C A;  3GTQ H;  5JEA G;  1EWC A;  3RLO A;  3QOL A;  4DXF A;  4C2M B;  2E76 C;  3H3V H;  3GTG B;  1I4G A;  3EA6 A;  1HR0 L;  4A3F B;  3K81 C;  5C44 H;  3R8B A;  2PZW A;  1Q3L A;  1KNE A;  2R92 G;  1LTT D;  4DUZ L;  3A8I E;  3KDF A;  5IE8 A;  2PW5 A;  1Z47 A;  1I4P A;  2K75 A;  2NVX B;  4DV3 L;  2LS0 1;  5E3F A;  1P16 A;  2F0I A;  3NEM A;  3TRE A;  2KHI A;  1WYD A;  4XT1 B;  1IBK L;  1CA5 A;  3V05 A;  2F0E A;  1HA5 A;  2Z6K A;  3HOZ G;  2KA7 A;  1PMR A;  2RF4 A;  1BCP B;  1AE3 A;  5IT9 L;  3A5U A;  4A3J B;  1STY A;  2PPB C;  1QG7 A;  1HRJ A;  1VQ7 A;  3SGI A;  5IYB H;  1SXT A;  4DAP A;  4JV5 Q;  3IFT A;  4JI2 Q;  1S5B D;  1FJG L;  1I4X A;  4HJ5 A;  2JA8 H;  5HY6 A;  4ZYS A;  1SFO H;  2JA9 A;  2JA7 H;  3Q23 A;  1Y8O B;  2NVY B;  1HQR D;  1L0W A;  1KRT A;  4JYA L;  5E7N A;  2MO0 A;  4DFA A;  2ZM6 L;  1II3 A;  2VW9 A;  1B9N A;  4X65 Q;  2B2Y C;  4P71 A;  2WAQ B;  2FHT A;  4A3J G;  4DR6 L;  4B3T Q;  1Q90 A;  1UNS A;  1A6X A;  2O2L D;  2XRQ D;  2Q8I B;  1S5C D;  1QVG A;  1VQA A;  2EJG C;  2TMP A;  2YV5 A;  4KLK A;  3R3O A;  4N8X 1;  4CJ2 C;  2QEX A;  2F0U A;  2Z4H A;  4KN4 C;  2EXZ A;  4JI3 L;  1Y1W H;  3PIO 3;  1Q46 A;  1G2T A;  5CV7 A;  4MIU A;  3C1F A;  2EYO A;  2IX1 A;  3OPO A;  3F2D A;  4DR1 Q;  2KJX A;  3CCL A;  4LF9 Q;  3K5L A;  1V43 A;  1BF4 A;  3HOW H;  2HIX A;  1W6J A;  1BVS A;  4OWW B;  4KHP Q;  3QG1 A;  5M5Y H;  1PTO D;  1PXU A;  2JSO A;  3HOY H;  1N32 Q;  4IPG A;  4HSP A;  3GV6 A;  2PMZ B;  1WTO A;  1VCI A;  2QGQ A;  4JBW A;  1SNC A;  2DGY A;  3VYR A;  1EIH A;  1KDC A;  3MXG A;  1CM9 A;  2R61 A;  3ND9 A;  1PRT D;  1DCZ A;  5IGE A;  3Q24 A;  4PG3 A;  5IP9 G;  3I70 A;  1X55 A;  4ZUJ A;  2Q2H A;  3HOW B;  1K8M A;  4XTC S;  5IYC H;  4I7A A;  1IL2 A;  2JN4 A;  2ID0 A;  1AZP A;  2PNR C;  1WVL A;  3D8G A;  3SK4 A;  1S5E D;  5EBC A;  2NWG A;  3ULJ A;  1Q1E A;  2J4X A;  3SE0 A;  4OIK A;  2AUK A;  4FF1 A;  5C0X J;  1J9O A;  2SEB D;  5KGU A;  1IW7 C;  2K6A A;  1EYC A;  3T53 B;  5ELC A;  1IL8 A;  3CHB D;  2NTT A;  4I7Z C;  1YNN C;  1OO9 B;  1N8R C;  1NCV A;  3T1H Q;  4CHT B;  4BBS G;  3OWE B;  3GTL B;  3EVQ A;  2WV6 D;  4DV5 Q;  2RKS A;  4HED A;  5CGK A;  4X6A H;  1BBU A;  2A6H C;  1Z7T A;  2IX3 A;  1G2S A;  2F0W A;  1C7Y A;  4A76 A;  2E5L Q;  3K0Y A;  2V1C C;  4QB4 A;  2R7Z B;  4JVZ A;  3TP5 A;  4YY3 Q;  1XTC D;  4J15 A;  1PTO F;  4HID A;  2VQE L;  4P74 A;  2ZTD A;  3SK8 A;  3CCJ A;  4R4O A;  4YHH L;  2VUM B;  4FNF A;  1MKH A;  3CD6 A;  4LFA L;  2EY1 A;  2RVL A;  3SHL A;  5FO7 B;  2B3G A;  5D3I B;  4KD3 A;  4LF5 Q;  1RCV D;  2L55 A;  2K05 A;  2QCP X;  4LF4 L;  3HRZ C;  2F0P A;  2JQO A;  2L5T A;  1SLJ A;  1XPU A;  4UP8 A;  3HP3 A;  2VQE Q;  1K8G A;  3QIA A;  3TS2 A;  3HOV H;  1E0B A;  5GAG C;  4JI0 L;  1M4V A;  2F4V L;  2KED A;  5BR8 Q;  4DR3 Q;  4X64 L;  3OYY A;  2HQE A;  4AQY L;  2JA6 G;  2AQ3 B;  1GM5 A;  1PH9 A;  3P7J A;  1S5D D;  5KNC A;  1CSP A;  2VQF Q;  3I4N H;  2JYO A;  2C35 B;  1R9T H;  1EL0 A;  3NBH A;  4JI3 Q;  5C3X A;  1F77 A;  3KF8 B;  4UPA A;  3TP8 A;  2B63 B;  3QJY A;  1J5E Q;  3I4N B;  5JOB A;  2KCN A;  2YTV A;  1ASZ A;  3MFG A;  4DR3 L;  1YNJ D;  1Y1V G;  1H9R A;  2KEN A;  2NBF A;  1I50 H;  2C9O A;  3T13 A;  4EQO A;  4LF6 L;  4P2C B;  5IGG A;  2EYM A;  2N49 A;  5I2X A;  3D6C A;  3JAM i;  4HCS A;  1CSQ A;  4YCV A;  3S2D B;  4LFB Q;  1XTD A;  1JQY D;  1YBY A;  1AP0 A;  5J1Z A;  4GN4 B;  3D4W A;  4KN7 C;  4IUV A;  1KAA A;  4Y7N B;  1CZG A;  4DAV A;  2BCO A;  4BXX G;  2B8F A;  1DZ1 A;  2F4I A;  1QJO A;  4JI7 Q;  3E9H A;  4DV4 Q;  3J7A F;  1V1P A;  1IBM L;  1G6P A;  3AFP A;  1JOO A;  2K5D A;  1QVF A;  4A3B B;  3AYH B;  4GZY C;  1B3Q A;  2B2V C;  1O7L A;  3DHQ A;  4QMG A;  2DNC A;  4L63 B;  4Z9C B;  2WAC A;  4A3J H;  1GUT A;  1M8A A;  1G8Z D;  3MVV A;  5FO8 B;  1A63 A;  3V96 A;  3CCE A;  4ZK9 B;  3PUZ A;  1FNV A;  5TSS A;  1A3U A;  4BY7 B;  4A3I H;  2UXB L;  2ES2 A;  4NKL A;  4RMF A;  1GUN A;  1Y8P B;  4KKT A;  3KDF B;  3ULL A;  2K01 A;  4EGV A;  5CV6 A;  3RUZ A;  4IJL A;  1DOK A;  1VDZ A;  3OIP A;  3EIV A;  4HJ9 A;  1BDO A;  1R4P B;  2WKD A;  1MJC A;  4XT3 B;  1PHJ A;  2E2J B;  5C0X G;  3TEH B;  1Q12 A;  4X66 Q;  2R7D A;  4X65 L;  1IW7 D;  4IOC A;  4JCV E;  3HOY G;  4L6T B;  4A3B G;  4B9X A;  1EYD A;  2VB2 X;  3F2C A;  1L1O B;  4C1N K;  4BY7 H;  1BNZ A;  1NMG A;  2PI2 A;  3NEL A;  2K5W A;  1HA6 A;  1EY6 A;  3NPP A;  1IKM A;  4K8I A;  4AYB G;  3A55 A;  4C3H G;  2JEB I;  2A6E C;  1K83 B;  2RDG A;  2ZXO A;  3PO3 B;  1HCZ A;  1SE2 A;  1AEX A;  3HGB A;  4GN5 A;  1J8I A;  3CQZ B;  1SBB B;  1KNA A;  4I65 A;  2A69 D;  3S16 B;  1RF2 D;  1Y1V H;  4TQU S;  3W1G A;  1L1O C;  1VQB A;  2DUD A;  2B2T A;  4PNY A;  1VMC A;  4DV7 Q;  4X66 L;  3HFZ B;  3X3N A;  1BXT A;  5M5Y B;  1I6V C;  1EEI D;  4JI5 Q;  1FGU A;  2NZH A;  4IPD A;  1U4P A;  1D1I A;  2D2C C;  4LF9 L;  3KYH C;  3G4S A;  2KHS A;  3PUW A;  5JPN C;  1YIJ A;  3M7G A;  4LWC A;  2R93 B;  3HOX H;  1F9R A;  2B2V A;  1MSG A;  1LTL A;  5C3W A;  4DV3 Q;  4LUO A;  2Z4I A;  5M3F B;  3GTK B;  3A5Z B;  3K5O A;  1SND A;  1IZ6 A;  1E24 A;  3KJO A;  3PIP 3;  5A2Q E;  1DJR D;  3L0O A;  4LAA A;  3ONA B;  2GA4 B;  2UU9 Q;  2YU9 H;  5GAH C;  2L4N A;  2L15 A;  3SK5 A;  4O42 A;  1CI3 M;  1UAP A;  1WTX A;  1SNO A;  1VQG A;  1GJX A;  3CCU A;  2ZM6 Q;  2UUA L;  1TY0 A;  1PH2 A;  1HZB A;  1XMQ L;  1F9Q A;  4B3S Q;  4XQQ A;  2M00 A;  3PV0 A;  3PO3 G;  4L5Q A;  5CBE E;  4HIO A;  1MIU A;  3TP6 A;  5C3E H;  1O78 A;  4R8I A;  3GTP H;  3URY A;  2ALY B;  4KV6 A;  1TT2 A;  3TN2 A;  3NWT A;  4KJN A;  3EBE A;  5A35 A;  1B7Y B;  2KOL A;  4DR7 L;  3ZYY X;  1QCB D;  1CFM A;  4K6D A;  5COR A;  5AFW A;  2IWH A;  2X6G A;  4GOP B;  4KTA A;  1X3G A;  2UXC Q;  3NE5 B;  2ENB A;  4IAL A;  4A3G H;  3TS0 A;  1PZI D;  1TII D;  1EZ6 A;  4DK0 A;  3D4R A;  2E2I H;  1YJ9 A;  1KXL A;  3L7Z C;  3A74 A;  1VQJ A;  2Q8R E;  1EY8 A;  3OTO L;  1LT4 D;  1M1K C;  4GNX B;  4R8N A;  2OQ0 A;  1MGS A;  4BWG B;  3VA5 A;  5EPK A;  2JA6 H;  4WJ4 A;  1SYD A;  5HGQ A;  2RDH A;  5J22 A;  1UEA B;  2BE5 C;  3CCQ A;  5LL6 S;  1TWH H;  3HKZ B;  3S1R B;  2BOS A;  4PMC A;  3HOU B;  1NTG A;  1BOS A;  5EKK A;  5LMU L;  1RJT A;  3LX0 A;  2OTJ A;  3KJP A;  5GAD C;  4QCL A;  1CKO A;  1YI2 A;  1SRU A;  3STB D;  4JK1 C;  4DUZ Q;  4IUU A;  1Q82 C;  5EPJ A;  1AZQ A;  2HHH L;  3NK9 A;  1RTN A;  5EKL A;  2NVQ B;  4DGZ A;  5G3L F;  1VQ8 A;  4RWS C;  5JVH 3;  1B1Z A;  4B3M L;  3Q6S A;  1PZJ D;  1SYC A;  3M4Q A;  4JW0 A;  1B70 B;  5BN5 A;  2JA7 B;  5D65 A;  2IT1 A;  1B4O A;  2JA8 G;  1SE3 A;  3DEP A;  1EOT A;  2ZJR A;  2EJF C;  1CHP D;  3W5O A;  1AN8 A;  3OW7 A;  1V1O A;  3D31 A;  3G7L A;  4LFA Q;  1ZYR D;  1R9T B;  4FF2 A;  4GKK L;  1B50 A;  4DV0 L;  3K6O A;  5IT9 E;  1C4Q A;  2R3Z A;  4JI4 Q;  3VYU A;  4QL5 A;  1K3R A;  3F1Z A;  4LFB L;  1CTM A;  1PYB A;  2VZA A;  2DY8 A;  2DJG C;  1N33 Q;  3RR5 A;  2IPK D;  1PRT B;  1O80 A;  2BH8 A;  2F0O A;  1EY5 A;  3GDE A;  1XNQ Q;  1EZ8 A;  1SJH D;  4NXM Q;  1EUJ A;  1ET6 A;  1IBL Q;  1VMP A;  3F8T A;  4HSV A;  4KMU C;  1RIP A;  1SNM A;  1LTG D;  2RCF A;  3DM1 A;  3U4V A;  1ILP A;  1T9H A;  3T1H L;  1KTK A;  1HPC A;  2LMC B;  2DNE A;  1VQI A;  3S1Q B;  3GTL H;  4DR2 Q;  4A3G G;  5M9O A;  1SYG A;  4POF A;  2SDF A;  1CKN A;  4FXD A;  2QA4 A;  4X62 Q;  1S3O A;  1MBY A;  2I5M X;  3DMU A;  3VR3 A;  5C4Z A;  3I2Z A;  4IFD H;  1CQF A;  1WCM H;  3NQI A;  4MTN A;  4R4I A;  1HR0 Q;  4JI6 Q;  2K7V A;  2WAQ G;  1EFW A;  1SMY D;  2B29 A;  5IP9 H;  1PH3 A;  1OXU A;  4CJ1 B;  1A3V A;  2UUC Q;  1CZW A;  3HKS A;  5EGT A;  2A6E D;  2NZO A;  2MGS A;  3OWF A;  4A3I B;  4R9W A;  2VS1 A;  2F0V A;  4JBM A;  4ABN A;  2BA1 A;  2F0N A;  1T5E A;  5T1I A;  3DLL A;  1HHV A;  5M3F G;  2E2I B;  3QWN A;  3DWA A;  1YNX A;  2ZJQ A;  3SEB A;  3TP7 A;  4B3M Q;  1QZH A;  2EPB A;  1LYL A;  1HNW Q;  4IQZ A;  5C4J B;  3BDC A;  1EOV A;  1Y8N B;  1S40 A;  2EYP A;  3NQT A;  3CCM A;  2NN6 H;  3CCR A;  1VQC A;  4DR5 Q;  3GV3 A;  2N88 A;  4KI0 A;  1GOZ A;  4OHJ A;  3LGJ A;  3HOZ B;  1PH6 A;  4GOP C;  1TU2 B;  3FDT A;  4DAY A;  1L1O A;  4A3M G;  4DU9 A;  2OEO A;  3TRZ A;  3C1E A;  3NBI A;  2QEJ C;  1NJI C;  1IHZ A;  3UE1 A;  3VA7 A;  5ELN A;  4UAI A;  4WJ3 M;  2R93 G;  1KRS A;  3GTO H;  5CBA E;  2EXD A;  4C3H B;  5I4D A;  1EYG A;  2A5H A;  2NVY H;  5E4W C;  1EFI D;  3M4P A;  4BBR B;  3PF4 A;  4B3T L;  5BN3 A;  4DR6 Q;  3EN2 A;  2WAQ E;  4A93 H;  3GTO B;  1G91 A;  2AQ1 B;  4M8A A;  5CV4 A;  5EPL A;  1T5X D;  3P75 A;  2UXC L;  4XQN A;  2BA0 A;  3J80 E;  4KD4 A;  1KLG D;  1X3P A;  4G7Z C;  2UUC L;  4UHV A;  3T1Y Q;  3S15 H;  1GVP A;  5C3E G;  2D62 A;  5FJ8 H;  3E0E A;  2HUG A;  4LF7 L;  4AYB B;  4IFD I;  1I4R A;  5FO9 B;  2R7Z G;  1F2L A;  4FDB A;  1E22 A;  4A3L G;  3WOE A;  2YTX A;  4IFD G;  1EY4 A;  2ZXR A;  5CV8 A;  4A93 B;  3I3C A;  3I56 A;  2QDB A;  3HEJ A;  1K3B C;  1ZKO A;  4IN3 A;  4EQN A;  2AHO B;  3F2B A;  1HR0 W;  3AFQ A;  4K5V A;  1OXT A;  1BCP D;  4LF8 Q;  1I3Q H;  4O2D A;  2X69 A;  3DM3 A;  1BCP F;  4LW1 A;  1XNR Q;  2KBN A;  5J3B A;  5C5M A;  2OQK A;  5JJL A;  3H09 A;  2I5L X;  1EIG A;  5ELD A;  4ILW A;  1BO0 A;  2EY2 A;  3T56 B;  3TZU A;  3M85 A;  2IY5 B;  5AJ3 L;  4ZUI A;  5K36 G;  4CKE A;  4JPB W;  1TVX A;  4HTH A;  1JWM D;  1I6H H;  1JOK A;  4DF7 A;  1HH2 P;  1E1O A;  3E6Z X;  3U50 C;  4DV6 L;  1KC8 C;  1JB3 A;  3FP9 A;  1IBM Q;  4DR5 L;  4A3E H;  2F0M A;  1KAW A;  1EQQ A;  2KCC A;  2RSO A;  1FNW A;  1PFN A;  1C8C A;  4PV1 C;  1X54 A;  4MNO A;  3NEN A;  1STB A;  1ICF B;  1YHA A;  2XWB B;  3FVQ A;  1EQV A;  4BXX H;  1I6H B;  3K8A A;  1ZYR C;  4ALP A;  3LNN A;  4GLA C;  4NB3 A;  1UE1 A;  2K50 A;  4CBV A;  2P5Z X;  5IYD H;  4FF3 A;  3CXC A;  1VQH A;  3S17 H;  5A2Q L;  4XDX A;  2WFW A;  5EAY A;  1TQO A;  3NSW A;  1TWG H;  1X3E A;  1RD9 D;  1Q7Y C;  2AUJ D;  1NMF A;  3FHW A;  4DR2 L;  4GLX A;  3EFX D;  3HKZ E;  2QF7 A;  3PO2 H;  1SE8 A;  1JE5 A;  3NUC A;  5C6A A;  1K73 C;  4LNQ A;  1CK1 A;  1JR0 D;  4TRD A;  4X64 Q;  3I72 A;  4IFD J;  4JI0 Q;  4NXM L;  5LL6 X;  2JK8 A;  2PQE A;  5E4X A;  3GTM H;  4JOI C;  4DK1 A;  4IJH A;  4RHR A;  5JEA J;  1C48 A;  2FFK B;  3CRL C;  2IW3 A;  3HOV B;  2G5D A;  3ERO A;  3NTI A;  1VQ6 A;  1F2M A;  4EQP A;  4JI4 L;  4DV0 Q;  4CKB A;  2Z6B A;  1KD1 C;  1EQR A;  5KNB A;  1SMX A;  4UP9 A;  4IUN A;  3K59 A;  2L9H A;  3BDO A;  4HN7 A;  1J6Q A;  1I50 B;  3CME A;  3GTM B;  3T1Y L;  4YY3 L;  1XWE A;  2LY7 A;  4JG2 A;  1EIY B;  3KF6 A;  2L11 A;  1HNX L;  3WWV A;  1QUQ B;  4LF6 Q;  2UU9 L;  2LXK A;  4QIW E;  2Z9H A;  2FJ2 A;  3BZD B;  5IYB G;  1AW7 A;  4C3I H;  1UUP A;  1F9P A;  3H6M A;  2NTS A;  3LWU A;  2KQ3 A;  3W1B A;  1PTO B;  2F3I A;  1IYJ B;  5FLX c;  4ZLT F;  2K04 A;  1LT5 D;  1ENC A;  1PRT C;  1Q8I A;  2M2L A;  3K7U C;  3VYT A;  3H3V C;  4DR4 L;  1X56 A;  1WFQ A;  2Y0S B;  3EJI A;  4V0B A;  1NY4 A;  1IBL L;  5JAV A;  2L1B A;  5D3D A;  5NUC A;  2NUC A;  4H0L C;  1X65 A;  1UWV A;  3KUP A;  1LTA D;  2A19 A;  5I9O A;  4K0K Q;  1GO3 E;  3K58 A;  2Q2T A;  4DV7 L;  4HR7 B;  2SNS A;  1EWH A;  4JI8 L;  1JC7 A;  1TS4 A;  4IUQ A;  1K8A C;  4N9P A;  2F0J A;  2AKW B;  1W2B A;  3H3V I;  1X32 A;  1K83 H;  4LJZ C;  4EX5 A;  1D1K A;  1DOM A;  2B2U A;  3CQZ H;  3RZD B;  2Z8L A;  3NTH A;  4HAE A;  3ND8 A;  4JOI A;  4WFN 3;  4LF4 Q;  5C4X G;  5ELF A;  5FLM H;  3SR1 A;  3ERQ A;  2CKZ B;  3HOW G;  2HDL A;  3A7A B;  1LO5 D;  1Q81 C;  3H15 A;  2L0C A;  1JJG A;  2Q2U A;  5DM6 3;  3I91 A;  2XWJ B;  2E2J H;  2UUA Q;  2LKV A;  2JP1 A;  2XN9 C;  2HHH Q;  3HOX B;  4KY7 A;  3E5S A;  1EYA A;  2EYL A;  4NPS A;  2EZV A;  2K52 A;  4L5T A;  4JC0 A;  3RZD H;  2OTL A;  3GTK H;  4PQX A;  1WJJ A;  3BDL A;  2R6G A;  2BDO A;  1DYQ A;  3OW2 A;  3GQB A;  4IO9 A;  4DPG A;  4MZ9 A;  2F0T A;  1LTS D;  4J6H A;  5IYC G;  3KF6 B;  1KL9 A;  3S15 B;  1JIC A;  2ZJP A;  4HIK A;  3J7Y W;  2B8G A;  4CKC A;  1XNR L;  4KK7 A;  4CDD C;  1Y1W B;  3S14 H;  3UI2 A;  3U58 A;  4F87 A;  1LTI D;  1F9S A;  4FO2 A;  4GNX A;  1PYS B;  4YWL A;  4JI5 L;  2AWN A;  5E1F A;  5ELB A;  4B3R Q;  1A3T A;  4JI7 L;  3DUZ A;  3W3A A;  5CYU A;  1SDF A;  1PH5 A;  1TWC H;  4K8J A;  4CGY B;  1I4Q A;  4ZKC B;  4QUC A;  5DM7 3;  4JBK A;  5DNF A;  4QQB X;  1FJG Q;  1UE6 A;  2NVT H;  1AH9 A;  2H1E A;  3FMC A;  4CDC C;  1A62 A;  1E1T A;  2A68 D;  4DV2 L;  4GLV B;  5EJW A;  1UE5 A;  2KHJ A;  4HMI A;  2B2U C;  4QGU A;  3FKI B;  2PYK A;  3IFD A;  4LFC L;  3J7Z C;  2NYZ D;  5EKI A;  4OO1 I;  5FOB B;  3GTQ B;  5FLX L;  2E75 C;  4L8J A;  4OXP A;  1HTL D;  5C4X B;  2M9V A;  1U4L A;  1K0R A;  2K03 A;  1J5E L;  5CR3 A;  1E2Z A;  1G51 A;  3JAM E;  3J81 L;  1S5F D;  2Z0S A;  5DLQ E;  5C4X H;  1XPR A;  2CFM A;  5FLM G;  4UDU C;  1FGB D;  4DUY Q;  2AQ2 B;  3BVZ A;  5COY A;  3D6W A;  4NW2 A;  4A3G B;  2LXJ A;  4MHE A;  1VQL A;  2RHQ B;  1SYE A;  3S2H B;  4WRD A;  2F03 A;  5IIF A;  3AEV A;  1WCM G;  2MNA A;  2E2H B;  3B6Y A;  4JI6 L;  2F0K A;  4A3F G;  4A3D H;  1GKH A;  2NN6 I;  3KK7 A;  2EY5 A;  3N52 A;  1TWG B;  4XYQ A;  4K14 A;  4GKJ Q;  1SAP A;  4HJ8 A;  1H9M A;  4DV4 L;  4E6I A;  3CC7 A;  4A3D B;  5IP7 H;  4LUZ A;  4DV2 Q;  3H0G H;  5HUR A;  3UDI A;  3AB9 A;  2LFN A;  4YIJ A;  4BY1 B;  3RN2 A;  2HT1 A;  3IAY A;  5C4J H;  2F0S A;  1TXY A;  1XMO L;  3T16 A;  5IGB A;  1N34 L;  2PI2 E;  3OIQ A;  4JV5 L;  4F88 A;  4OX9 Q;  3WOF A;  4GOP A;  1L0Y B;  2HQL A;  3F2U A;  1QIL A;  3NP8 A;  1BQQ T;  4K6L A;  4KY5 A;  1BCP C;  3CC2 A;  3PSI A;  2H4O A;  3OSO A;  2F0G A;  1B9M A;  4K2L A;  3HOZ H;  4X62 L;  2XIW A;  1E7Z A;  4C3J B;  1SE4 A;  3I4L A;  3SXH A;  2Y0S E;  1K28 A;  1L0X B;  3BYT B;  4B9W A;  1O7I A;  1IBK Q;  4X3K A;  4DNT B;  3ULP A;  3GTJ B;  1PVO A;  2ICE C;  1DGS A;  5GRO A;  3PUY A;  1LV9 A;  1XJV A;  3AMU A;  2CCZ A;  4G57 A;  1MHW C;  2WB1 E;  2N55 A;  2RHS B;  5JJI A;  1BKB A;  1VS0 A;  2AWO A;  3MA2 B;  4QY7 A;  4FP5 D;  4RA8 A;  4A93 G;  1VQF A;  3ERS X;  3UDF A;  1N33 L;  4A3C H;  1HNX Q;  4IUR A;  1Y69 U;  2B39 A;  2V4D A;  3J7A 5;  3ICE A;  4OX9 L;  3C46 A;  1LTR D;  1VF5 C;  3U9S A;  1QWY A;  4M1U B;  1TS3 A;  2TSS A;  3GTJ H;  4DKA C;  1KHI A;  1QOH A;  1JJ2 A;  1D5Z C;  1KAB A;  3CCV A;  1I3Q B;  4A3I G;  1H95 A;  3NXW A;  3V2T A;  1BUV T;  1AFP A;  2K5H A;  3D0F A;  1L2F A;  2QDL A;  2OT2 A;  4NDX A;  3PUX A;  1W6K A;  3E3X A;  4KKS A;  4A3L H;  1VQE A;  4TVA B;  4Y7N H;  4S3S A;  2XTI A;  5IWA L;  3PIO A;  2JA5 G;  4LK1 C;  1YJW A;  5I2Y A;  1N32 L;  1B2T A;  3OHX C;  4BBR G;  3X3M A;  4CDF C;  4DAY B;  2JJQ A;  3J80 L;  1HZ9 A;  5LHY 1;  3R2T A;  4N8F A;  3J80 i;  4A3B H;  1Z6H A;  3DEO A;  1LUZ A;  5IP7 G;  4A3M B;  2EIF A;  2EVB A;  3ZJY C;  4K0K L;  3H0G G;  3U4Z A;  4OO1 H;  1VQM A;  1STG A;  3QO2 A;  2BE5 D;  4J1M A;  4R4T A;  4H44 C;  4PZ6 A;  4WJW A;  4X3T A;  2A68 C;  2VQF L;  4YCW A;  2F1M A;  3KLS X;  4KHZ A;  1FVI A;  2UUB L;  5IT9 c;  3KLS A;  2PO4 A;  1ILQ A;  1V9P A;  2YYZ A;  4NXN Q;  3RZO H;  4CJ0 B;  2UXB Q;  4KHV A;  3N6R A;  4A3K B;  3G6J B;  4A3E G;  4PZ8 A;  5L37 A;  4C3J H;  1IYV A;  3GP7 A;  2EQS A;  1H9J A;  1M90 C;  5G3L D;  2SOB A;  2MJ8 A;  2ZTC A;  3VR2 A;  1Q86 C;  1U4R A;  4FF4 A;  3PCO B;  3I8Z A;  1VQP A;  3VR5 A;  3HS0 C;  1LM0 A;  1Q8K A;  1JOR A;  4BY1 H;  2EE1 A;  4DK3 C;  4DNI A;  2L12 A;  1XMO Q;  1STN A;  1C9O A;  3PIP A;  4HMJ A;  2FIN B;  2I5H A;  2DJF C;  5CV9 A;  1TWH B;  1ENF A;  2WKC A;  4PMW A;  2N8N A;  4A3K H;  1C0A A;  2CVR A;  3BYY B;  3A56 A;  2MQH A;  3L3O C;  1EEF D;  3ITP A;  3H94 A;  2YU9 B;  2QKI C;  2EYJ A;  2F0D A;  2ZTE A;  3NHH A;  4YWK A;  3KOJ A;  3MXN B;  3PMF A;  4GKJ L;  4DV6 Q;  1A2T A;  1DON A;  2JE6 I;  3PO3 H;  4C3I B;  5D14 A;  5FLX E;  2K33 A;  3T4A C;  1A8V A;  1PDQ A;  3LWE A;  3HKZ G;  3HOU G;  4IPH A;  2ATW A;  4OL7 A;  3S24 A;  3MEH A;  3P1H A;  3J81 E;  5T1G A;  4NXN L;  3K80 C;  1YZ6 A;  2XVS A;  2O5J C;  3AU7 A;  1S4Z A;  2UUB Q;  1MJE A;  3MXP A;  1X9N A;  3O13 A;  5LMN L;  1SEB D;  4KJO A;  5EQ0 A;  4FXG C;  2A1A A;  1PRT F;  1EWI A;  2WB1 G;  1TWA H;  4HIM A;  4AQY Q;  4P72 A;  1WTV A;  1VQ9 A;  4A3F H;  3E0J A;  1HNZ L;  1EY7 A;  5C4H A;  4ZCK A;  1WOC A;  4JYA Q;  4GS3 A;  2RDF A;  1HUM A;  4F7X A;  1KQS A;  1IXR A;  3Q8D A;  4AIM A;  3GTG H;  5LMN W;  4ODG A;  3I4M H;  2GVB A;  2N3S A;  2G9D A;  4O0A A;  4GN3 B;  2E74 C;  1VQ5 A;  2PW7 A;  5M3M G;  4P75 A;  1DOL A;  4RCN A;  4DNR B;  1LTB D;  4DR7 Q;  4K5W A;  4DAM A;  3PGZ A;  1RKN A;  1VF7 A;  1JWS D;  1KIX A;  2B63 H;  1GUG A;  1NNX A;  2PMZ E;  5F2D A;  3C3L A;  5M5W B;  1QVC A;  2GN5 A;  4B3S L;  3A0J A;  1PFB A;  4QUF A;  1EU4 A;  1ASY A;  1DD2 A;  4KHP L;  3M7N A;  4BS9 A;  1BBX C;  2EY6 A;  1NR2 A;  4DXG A;  3L2P A;  1Y14 B;  3I4M B;  5M5W H;  1G29 1;  5IOD A;  2VNU D;  4A3K G;  2SNM A;  4UY8 C;  1TKW B;  2OCE A;  3MHB A;  3OOC A;  2CQA A;  3L9A X;  1JMC A;  1U0L A;  1E2W A;  4RGN A;  5IOC A;  3M3Y H;  1WTQ A;  1V1Q A;  5J39 A;  1HNW L;  4BA1 I;  4U67 3;  1QNU A;  4LMQ D;  2NVQ H;  1QNK A;  3C2P A;  5EBD A;  1XXG A;  3BVM A;  3K0X A;  1K9M C;  3CW2 C;  3RD4 A;  4FXK C;  1KDA A;  4APV A;  4R4C A;  3M4O H;  4AYB E;  3EQL C;  5HGT A;  3TSS A;  1A0I A;  1LAB A;  2FMM A;  1HQM C;  2EYH A;  1ICW A;  2F0H A;  1YHQ A;  3D4D A;  2WII B;  2JA5 B;  2MHV A;  3KLW A;  3M4Y A;  3NWS A;  1G6Z A;  1KLU D;  5ISR A;  2NZ1 D;  4ME5 A;  4IUP A;  2MPM A;  2OF1 A;  1VQN A;  4OWX B;  1MSH A;  1JOQ A;  3CKI B;  2JA5 H;  4DV1 Q;  5IGF A;  4BBR H;  4XXE A;  2VUM G;  1GHK A;  1N9W A;  2DY7 A;  1HFG A;  1SNQ A;  3P20 A;  2JA8 B;  1O7Y A;  5JEA H;  2XGT A;  4FVM A;  2KCT A;  5M3M B;  1D2B A;  3MXU A;  3A8K E;  5ELO A;  4OEM B;  1PH7 A;  1FNU A;  4C56 C;  1GD7 A;  1X3Q A;  3RN5 A;  3I4M G;  5C44 G;  1VQ4 A;  4GNX C;  5FK9 C;  1N36 L;  2MP1 A;  3CAM A;  3CCS A;  4ZAI A;  2HIV A;  5M3M H;  2R92 H;  4BY7 G;  5LMN Q;  2DN8 A;  4QJF A;  4HCE A;  3QR8 A;  3NBH B;  3CU7 A;  5M3F H;  3KLR A;  5CMD A;  1XNQ L;  1PH4 A;  1O7Z A;  2QW7 A;  1YIT A;  3S2H H;  3JC6 6;  3UE0 A;  1NE3 A;  2ZXP A;  1X3F A;  2NN6 G;  4C2M H;  4RKB A;  4OIJ A;  3A8J E;  2UXD Q;  4Y52 H;  4C3J G;  4NMZ A;  1YNN D;  1EY9 A;  5C44 B;  1VQK A;  1F2Y A;  2A69 C;  5KYI A;  2IX0 A;  1ESR A;  1WI5 A;  1SNP A;  4Q0F A;  2RBM A;  2VB3 X;  4A3M H;  5C3E B;  3J80 c;  1RHP A;  5CC4 A;  1STA A;  2RQX A;  2Z6K C;  3W2D A;  1BR9 A;  3K5M A;  2B2T C;  3HOY B;  3M3Y B;  2LSS A;  2R93 H;  4P73 A;  1DXM A;  1ZXT A;  2D0P A;  3MXN A;  2I0Q A;  1B8A A;  2OXP A;  3HG9 A;  3A7L A;  2WB1 B;  3CMA A;  4RHS A;  1FYC A;  2JA7 G;  3QB3 A;  4YCU A;  2UXD L;  3RNU A;  1D5X C;  2H5X A;  2CH4 W;  1YNJ C;  2KEE A;  3GD7 A;  3DWQ A; 
#chains in the Genus database with same CATH homology
 1K0R A;  5H1S E;  4A3J G;  4DR6 L;  2E5L L;  4B3T Q;  3RR5 A;  1N33 Q;  1J5E L;  2BH8 A;  1QVG A;  2VY3 A;  4JI6 Q;  1VQA A;  4KLK A;  2YV5 A;  4B3R L;  3GDE A;  2K5V A;  1G51 A;  2QEX A;  1XNQ Q;  4JI3 L;  2Z0S A;  4NXM Q;  1EUJ A;  5DLQ E;  1HJP A;  5C4X H;  2CFM A;  4A75 A;  5FLM G;  1Y1W H;  1XPR A;  1IBL Q;  1Q46 A;  3F8T A;  4DUY Q;  1RIP A;  3U4V A;  4OON A;  2IX1 A;  3F2D A;  1T9H A;  3S1R H;  3HOU H;  1Q1B A;  4DR1 Q;  2LXJ A;  3T1H L;  3CCL A;  1VQL A;  2RHQ B;  1VQI A;  2F52 A;  3GTL H;  4DR2 Q;  4LF9 Q;  5C0X I;  1V43 A;  4A3G G;  4LF8 L;  3HOW H;  2HIX A;  4POF A;  3AEV A;  3OTO Q;  1BVS A;  1WCM G;  4OWW B;  1CKN A;  2MNA A;  4KHP Q;  2QA4 A;  4X62 Q;  1S3O A;  2I5M X;  3B6Y A;  3I2Z A;  4JI6 L;  1WCM H;  5M5Y H;  4A3F G;  4MTN A;  4A3D H;  1GKH A;  1UE7 A;  4R4I A;  2NN6 I;  3STB C;  3HOY H;  1N32 Q;  1HR0 Q;  4IPG A;  3I7F A;  4GKJ Q;  1VCI A;  2QGQ A;  5BR8 L;  4JBW A;  4HJ8 A;  2DGY A;  4BA2 I;  2WAQ G;  1EFW A;  3BZC A;  2B29 A;  4DV4 L;  3CC7 A;  3K7A H;  5IP7 H;  5IP9 H;  1PH3 A;  1OXU A;  4GKK Q;  4LUZ A;  4DV2 Q;  3H0G H;  2UUC Q;  3HKS A;  5GAE C;  3UDI A;  4PG3 A;  5IP9 G;  2NZO A;  1X55 A;  3RN2 A;  2Q2H A;  4XTC S;  2VS1 A;  2HT1 A;  5IYC H;  5C4J H;  4JBM A;  1PFS A;  1SN8 A;  2BA1 A;  1TXY A;  1XMQ Q;  3DLL A;  1XMO L;  3I4O A;  1YJN A;  1W3S A;  5M3F G;  1N34 L;  2PI2 E;  1IL2 A;  4JV5 L;  4PZ7 A;  1YNX A;  2ZJQ A;  4GOP A;  4OX9 Q;  2HQL A;  2ID0 A;  4B3M Q;  1QZH A;  1LYL A;  3CC2 A;  1HNW Q;  1S40 A;  1EOV A;  3PSI A;  2B63 G;  3ULJ A;  4YHH Q;  3CCM A;  3CCR A;  1Q1E A;  3HOZ H;  4IOA A;  1VQC A;  4DR5 Q;  4X62 L;  1E3P A;  5C0X J;  2PNH A;  1E7Z A;  1PH1 A;  2Y0S E;  3ER0 A;  4KI0 A;  1O7I A;  3LGJ A;  1IBK Q;  1PH6 A;  4R4Q A;  3ULP A;  4GOP C;  1PVO A;  1YVC A;  4EQ5 A;  1L1O A;  4A3M G;  1N8R C;  5LMU Q;  4DR1 L;  3T1H Q;  3TRZ A;  4BBS G;  1DGS A;  1CKM A;  5GRO A;  3BJU A;  3PUY A;  5IYD G;  1QUQ A;  3UE1 A;  1XJV A;  3E9I A;  1NJI C;  2CCZ A;  4AH6 A;  5ELN A;  4R1J A;  4L5S A;  2WB1 E;  3S2D H;  4DV5 Q;  2R93 G;  1KRS A;  2RHS B;  1N36 Q;  3GTO H;  4WJ3 M;  1BBU A;  4X6A H;  3G48 A;  2EXD A;  1XPO A;  5JJI A;  5GQO A;  1BKB A;  1VS0 A;  2AWO A;  3S1N H;  3PUV A;  1EYG A;  4A3C G;  4QY7 A;  2NVY H;  4A93 G;  3M4P A;  1VQF A;  1C7Y A;  4A76 A;  3ERS X;  3I55 A;  3PF4 A;  3UDF A;  2E5L Q;  4B3T L;  3EN2 A;  1HNX Q;  2WAQ E;  2V1C C;  1N33 L;  4DR6 Q;  4A93 H;  4A3C H;  1SR3 A;  3J7A 5;  2GVA A;  4YY3 Q;  3ICE A;  4OX9 L;  4J15 A;  1VQO A;  4HID A;  3J81 i;  2VQE L;  4P74 A;  1P8L A;  2ZTD A;  3CCJ A;  4DV1 L;  3GTJ H;  4L5R C;  4DKA C;  4R4O A;  4YHH L;  1KHI A;  1JJ2 A;  2UXC L;  1MKH A;  2CWA A;  1UEB A;  3CCV A;  2ASB A;  2BA0 A;  2MFI A;  3BZK A;  1OXV A;  4A3I G;  4LFA L;  3CD6 A;  1H95 A;  1HZC A;  2UUC L;  2K5H A;  3T1Y Q;  2B3G A;  3D0F A;  1L2F A;  4LF7 Q;  2NVX H;  1GVP A;  1QZG A;  1N34 Q;  5C3E G;  4LF5 Q;  3PUX A;  2E2H H;  3S15 H;  2D62 A;  2MO1 A;  3GO5 A;  1YHB A;  5FJ8 H;  4HJA A;  3E0E A;  3PF5 A;  4A3L H;  1VQE A;  1D7Q A;  4LF7 L;  4TVA B;  4IFD I;  2Q2I A;  4Y7N H;  2R7Z G;  2XTI A;  4FDB A;  1E22 A;  5IWA L;  3PIO A;  2JA5 G;  4LF4 L;  4A3L G;  1HNZ Q;  2JQO A;  1YJW A;  2YTX A;  4IFD G;  1N32 L;  4BBR G;  1SLJ A;  2FXQ A;  3I56 A;  1XPU A;  4UP8 A;  4DAY B;  2JJQ A;  2VQE Q;  1HZ9 A;  1K8G A;  3TS2 A;  3HOV H;  1JJC B;  5GAG C;  3J80 i;  2AHO B;  3BU2 A;  5BR8 Q;  3F2B A;  1HR0 W;  4JI0 L;  3AFQ A;  4DR3 Q;  1OXT A;  2CWP A;  2F4V L;  4LF8 Q;  2VUM H;  4X64 L;  1I3Q H;  3OYY A;  4O2D A;  4OO1 G;  1LUZ A;  5IP7 G;  4RG1 A;  3DM3 A;  2KCM A;  4LW1 A;  4AQY L;  2JA6 G;  1CKN B;  2EIF A;  1XNR Q;  2KBN A;  5J3B A;  3ZJY C;  3H0G G;  3U4Z A;  4K0K L;  1VQM A;  1GM5 A;  3VDY A;  2OQK A;  1PH9 A;  5JJL A;  4R4T A;  2I5L X;  5AJ3 Q;  1CSP A;  2VQF Q;  1CUK A;  4POG A;  4PZ6 A;  3I4N H;  2IY5 B;  3M85 A;  5AJ3 L;  2C35 B;  2VQF L;  4YCW A;  1R9T H;  4ME3 A;  2UUB L;  4JI3 Q;  4KHZ A;  1FVI A;  3KF8 B;  5K36 G;  5IT9 c;  3I4N G;  4LUV A;  4UPA A;  1I6H H;  1V9P A;  2YYZ A;  4NXN Q;  2IHE A;  1J5E Q;  3RZO H;  2UXB Q;  2K5N A;  1PH8 A;  3G6E A;  1HH2 P;  1E1O A;  3U50 C;  4JI1 Q;  4A3E G;  4A4I A;  2YTV A;  4PZ8 A;  4DUY L;  4C3J H;  4DV6 L;  1KC8 C;  1ASZ A;  1JT8 A;  2EQS A;  3FP9 A;  3CPW A;  4DR3 L;  3CP0 A;  1M90 C;  1IBM Q;  3RLF A;  1Y1V G;  2WP8 J;  4DR5 L;  4A3E H;  1EQQ A;  1KAW A;  1U5K A;  2KEN A;  1I50 H;  4H02 A;  2ZTC A;  1OTC A;  4LF6 L;  1Q86 C;  2N49 A;  4BY1 G;  3PCO B;  1YEZ A;  1VQP A;  1LM0 A;  1NBW A;  1Q8K A;  3JAM i;  4BY1 H;  2CQO A;  1CSQ A;  4DK3 C;  4YCV A;  4DNI A;  4LFB Q;  1X54 A;  3NEN A;  2VL6 A;  1XTD A;  4MNO A;  1XMO Q;  1C9O A;  1YBY A;  3TQY A;  3PIP A;  4LFC Q;  4GN4 B;  1YHA A;  1EIF A;  1D8L A;  4BXX H;  3K8A A;  4IPC A;  1AE2 A;  2I5H A;  4ALP A;  1I5F A;  4PMW A;  4GLA C;  4A3K H;  2N8N A;  1UE1 A;  4NB3 A;  1C0A A;  2K50 A;  4HJ7 A;  4BXX G;  2MQH A;  5IYD H;  1JB7 A;  4JI7 Q;  3E9H A;  4DV4 Q;  1VQD A;  3CXC A;  1VQH A;  2ZTE A;  4YWK A;  3RLN A;  3S17 H;  1IBM L;  4JI2 L;  3AFP A;  3KOJ A;  1G6P A;  2WFW A;  3MXN B;  5EAY A;  4GKJ L;  1X6O A;  4DV6 Q;  1QVF A;  2D0O A;  1BBW A;  3AYH B;  1TWG H;  2JE6 I;  3PO3 H;  2BH2 A;  1X3E A;  2E8G A;  1Y1W G;  4A3J H;  1A8V A;  1Q7Y C;  1NMF A;  3FHW A;  1A63 A;  1HZA A;  3CCE A;  3HKZ G;  3HOU G;  4IPH A;  2ATW A;  3PUZ A;  3S24 A;  4DR2 L;  4JI1 L;  4GLX A;  4XIG S;  4UP7 A;  4DR4 Q;  3HKZ E;  4A3I H;  2UXB L;  2ES2 A;  4NXN L;  3PO2 H;  1SE8 A;  1JE5 A;  3K80 C;  1YZ6 A;  1K73 C;  4RMF A;  3ULL A;  1FL0 A;  1TWF H;  2RCN A;  3KDF B;  4LNQ A;  1PV4 A;  2UUB Q;  1MJE A;  4IJL A;  5FJ8 G;  4X64 Q;  1PA6 A;  1X9N A;  2A8V A;  4IFD J;  3EIV A;  4HJ9 A;  5LMN L;  2F4V Q;  4JI0 Q;  2R7Z H;  3FKI H;  1MJC A;  1PHJ A;  4NXM L;  2A1A A;  5C0X G;  2JK8 A;  2N78 A;  2YTY A;  3TEH B;  3J81 c;  3GTM H;  2WB1 G;  1EWI A;  3MEF A;  1TWA H;  4JOI C;  4IJH A;  5JEA J;  4HIM A;  4P72 A;  4AQY Q;  1Q12 A;  5M5X H;  4OWT B;  4X66 Q;  1VQ9 A;  2R7D A;  4A3F H;  1HNZ L;  4X65 L;  4IOC A;  1VQ6 A;  1WOC A;  4JCV E;  3UDG A;  3HOY G;  4A3B G;  2PQA B;  3G71 A;  3F2C A;  4JYA Q;  1L1O B;  4GS3 A;  4JI4 L;  4BY7 H;  1NMG A;  2PI2 A;  3CC4 A;  4LF5 L;  3NEL A;  4DV0 Q;  1KQS A;  1IXR A;  3Q8D A;  4AIM A;  1KD1 C;  1EQR A;  3GTG H;  5LMN W;  3I4M H;  1SMX A;  2GVB A;  2N3S A;  4O0A A;  4UP9 A;  4GN3 B;  4AYB G;  2JEB I;  5M3M G;  1VQ5 A;  4P75 A;  1I94 L;  4DR7 Q;  4C3H H;  1J6Q A;  4GN5 A;  3PGZ A;  4DAM A;  3CME A;  1KIX A;  3T1Y L;  4YY3 L;  1OXX K;  2B63 H;  1Y1V H;  4JG2 A;  4TQU S;  1L1O C;  1VQB A;  3KF6 A;  3W1G A;  1EIY B;  2DUD A;  1HNX L;  3WWV A;  1QUQ B;  2PMZ E;  4DV7 Q;  4X66 L;  3HFZ B;  4LF6 Q;  2UU9 L;  4A3B H;  2LXK A;  1QVC A;  2GN5 A;  4QIW E;  3A0J A;  4B3S L;  4JBJ A;  4JI5 Q;  1FGU A;  2NZH A;  5IYB G;  1ASY A;  4C3I H;  4DV5 L;  4IPD A;  4KHP L;  4DK6 C;  3W1B A;  2F3I A;  3M7N A;  4JI8 Q;  3JAM c;  3L2P A;  1IYJ B;  3CF5 A;  1Y14 B;  5FLX c;  3KYH C;  5M5W H;  2Y0S G;  3G4S A;  4LF9 L;  4BBS H;  1G29 1;  3UDX A;  2IHF A;  3PUW A;  1YIJ A;  2VNU D;  2PQA A;  4LWC A;  4A3K G;  3K7U C;  3HOX H;  4UY8 C;  4DV3 Q;  5IY0 A;  1LTL A;  4DR4 L;  1X56 A;  2OCE A;  1WFQ A;  4LUO A;  3CPF A;  3HOX G;  1NY4 A;  1IBL L;  3A5Z B;  2K14 A;  1JMC A;  1IZ6 A;  1U0L A;  1UWV A;  1X65 A;  1E24 A;  2A19 A;  3KJO A;  4K0K Q;  1GO3 E;  3M3Y H;  3L0O A;  2UU9 Q;  2AMC B;  2YU9 H;  2Q2T A;  3AQQ A;  1V1Q A;  5GAH C;  4DV7 L;  1HNW L;  4JI8 L;  4BA1 I;  3KFU A;  1K8A C;  2L15 A;  2R7F A;  2NVQ H;  5JJK A;  2AKW B;  1VQG A;  1OXS C;  1W2B A;  3CCU A;  2ZM6 Q;  2UUA L;  3H3V I;  3K0X A;  1PH2 A;  1K83 H;  1HZB A;  1XMQ L;  4B3S Q;  3S1M H;  1K9M C;  3CW2 C;  4EX5 A;  3PV0 A;  4APV A;  4L5Q A;  3PO3 G;  4R4C A;  3M4O H;  4YWM A;  4HIO A;  4AYB E;  1Z9F A;  1SRO A;  3CQZ H;  1MIU A;  1A0I A;  5C3E H;  4JOI A;  5IWA Q;  1RL2 A;  4LF4 Q;  5C4X G;  1YHQ A;  3GTP H;  5FLM H;  2OWO A;  2ALY B;  2K4K A;  3M9B A;  3EBE A;  1B7Y B;  2CKZ B;  3KLW A;  3S1Q H;  4DR7 L;  1I94 Q;  3HOW G;  3PO2 G;  3FKI G;  1S72 A;  4GOP B;  4OWX B;  3H15 A;  3J81 j;  1Q81 C;  1VQN A;  3S16 H;  1X3G A;  2UXC Q;  1JJG A;  2JA5 H;  2Q2U A;  3HOV G;  4A3G H;  3TS0 A;  4A3D G;  4DV1 Q;  3IRB A;  2JEA I;  3GTQ H;  5JEA G;  2E2J H;  4BBR H;  2UUA Q;  2E2I H;  1YJ9 A;  3RLO A;  3L7Z C;  2VUM G;  1N9W A;  3A74 A;  1KXL A;  2HHH Q;  1VQJ A;  3OTO L;  2XGT A;  3H3V H;  4NPS A;  2OTL A;  2K52 A;  2KCT A;  4JC0 A;  4L5T A;  3RZD H;  1M1K C;  1HR0 L;  3GTK H;  3K81 C;  4GNX B;  5C44 H;  5ELO A;  1WJJ A;  2OQ0 A;  2R92 G;  2R6G A;  1PH7 A;  1GD7 A;  3RN5 A;  3OW2 A;  3I4M G;  5C44 G;  1VQ4 A;  4GNX C;  4IO9 A;  3KDF A;  1N36 L;  5IE8 A;  4DPG A;  5HGQ A;  1Z47 A;  3CAM A;  2JA6 H;  4MZ9 A;  3CCS A;  2HIV A;  5M3M H;  2R92 H;  4BY7 G;  3CCQ A;  5LMN Q;  5IYC G;  3KF6 B;  1TWH H;  4QJF A;  2K75 A;  1KL9 A;  3NBH B;  4DV3 L;  1NTG A;  5M3F H;  1XNQ L;  1PH4 A;  1YIT A;  2ZJP A;  5LMU L;  4WJ4 A;  4HIK A;  2OTJ A;  3KJP A;  3S2H H;  5GAD C;  3JC6 6;  1P16 A;  3NEM A;  3UE0 A;  1XNR L;  3TRE A;  1CKO A;  1YI2 A;  1NE3 A;  1SRU A;  2KHI A;  1WYD A;  3STB D;  1IBK L;  1X3F A;  3S14 H;  3U58 A;  2Z6K A;  4DUZ Q;  2NN6 G;  3HOZ G;  4C2M H;  1Q82 C;  4GNX A;  1PYS B;  2RF4 A;  4YWL A;  2HHH L;  4JI5 L;  2AWN A;  2UXD Q;  4Y52 H;  4B3R Q;  4JI7 L;  1AE3 A;  1VQ8 A;  1VQK A;  3A5U A;  2IX0 A;  1WI5 A;  1TWC H;  1PH5 A;  1VQ7 A;  3SGI A;  5IYB H;  4B3M L;  3M4Q A;  4A3M H;  4JBK A;  4JV5 Q;  1B70 B;  4JI2 Q;  4QQB X;  2IT1 A;  3J80 c;  1FJG Q;  1UE6 A;  1FJG L;  2Z6K C;  2JA8 G;  2NVT H;  2ZJR A;  1AH9 A;  2LSS A;  4HJ5 A;  1A62 A;  1E1T A;  2JA8 H;  2R93 H;  4P73 A;  5HY6 A;  3W5O A;  2D0P A;  1SFO H;  3D31 A;  2JA9 A;  4GLV B;  4LFA Q;  4DV2 L;  1B8A A;  1UE5 A;  2I0Q A;  2KHJ A;  2JA7 H;  4GKK L;  4DV0 L;  4QGU A;  3CMA A;  4JI4 Q;  1L0W A;  4QL5 A;  1KRT A;  4YCU A;  4LFC L;  3J7Z C;  2JA7 G;  4JYA L;  2UXD L;  5E7N A;  1K3R A;  2MO0 A;  2ZM6 L;  2VW9 A;  3RNU A;  3F1Z A;  4LFB L;  4OO1 I;  2H5X A;  1PYB A;  4X65 Q;  2VZA A;  4OXP A;  4DUZ L;  3GD7 A;  4P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...