3FHWA

Crystal structure of the protein prib from bordetella parapertussis. northeast structural genomics consortium target bpr162.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
100
Chain Sequence
MNTLELSARVLECGAMRHTPAGLPALELLLVHESEVVEAGRRVELTISAVALGDLALLLADTPLGTEMQVQGFLAPARKDSVKVKLHLQQARRIAGSMGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Primosomal replication protein n
publication title Crystal structure of the protein priB from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR162.
rcsb
source organism Bordetella parapertussis
molecule tags Dna binding protein
total genus 15
structure length 100
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3fhwA00
3ER0A 1YIJA 5JEAJ 3CCRA 2UXDL 3J80i 3M85A 4DR5L 4HJ7A 3RN2A 1SFOH 1VQNA 2F4VQ 1CUKA 4DR7Q 2UXBL 1K8AC 1E7ZA 3WWVA 1NMFA 4A3FH 4JCVE 2VS1A 1Q7YC 2I5MX 2E5LQ 2K50A 1EQRA 4R4OA 3TQYA 2OCEA 3I4NH 4BBSG 2KENA 1QVFA 1J6QA 1Y14B 1PFSA 3PF5A 2E5LL 4A3BG 4WJ3M 2MQHA 4AQYQ 2OTLA 2WAQG 3AEVA 3A5ZB 3T1HQ 1NY4A 5JJIA 4L5SA 4DV5L 3ULPA 4HIKA 1VQKA 3KDFB 3HOXG 4MNOA 1E1OA 1WCMH 3FKIG 1Q8KA 1XNQQ 1ASZA 1TWAH 2YYZA 1IXRA 2GVBA 4B3MQ 1TWHH 2L15A 3B6YA 3ZJYC 1YHAA 4GOPB 4A3FG 1KQSA 1XNQL 4NPSA 2ASBA 4BXXG 4DV7Q 1GO3E 1CSPA 4A3JH 1LUZA 5JJKA 4B3ML 2CQOA 3PUZA 2IX1A 3GTPH 3HOZH 3E9IA 4GNXB 1IL2A 3KF8B 1VQGA 4DV7L 4UP9A 2MNAA 4JI2L 2JA6G 3Q8DA 2MO1A 2KHJA 2LXKA 2OWOA 3M7NA 4PZ6A 4DR6L 1LTLA 4X66Q 4K0KQ 2N3SA 1PH7A 1VQ9A 4GN5A 1KAWA 3PSIA 1TWCH 1P8LA 3G71A 3CPWA 2UUBQ 4LFCQ 1X65A 2AKWB 1H95A 3PIPA 1NE3A 1U5KA 4X66L 2F3IA 3TS2A 4K0KL 1Y1WG 1FL0A 1IYJB 1GVPA 3U58A 3UDGA 3PO2H 2IX0A 4LFCL 2QEXA 2UUBL 4X64L 1K8GA 3DLLA 1HZCA 1PYBA 3G4SA 1UWVA 3CW2C 3CCJA 2JA8H 5C0XJ 4C3IH 1PV4A 4LF9L 4YWMA 1EFWA 2VNUD 4Y52H 1LM0A 2AMCB 5M5YH 4DUZL 1EYGA 2A1AA 1EIYB 3HOZG 1VQJA 2R93H 1IBMQ 4FDBA 1E22A 1V43A 2Q2IA 4GKJL 2HIVA 4O0AA 3UE1A 3CP0A 1YJ9A 4LF6Q 5GQOA 1XPUA 3KLWA 2ALYB 2CKZB 5IP9G 2I5HA 2N78A 1IBML 3RZDH 5LMNQ 5HY6A 4HIOA 2IHFA 4DAYB 1KRSA 4DR1Q 4QY7A 2K75A 2PNHA 4XTCS 3K7AH 1VQEA 2E2IH 5LMNL 4DR1L 1YNXA 1WI5A 2HQLA 2WB1E 4JOIC 1L2FA 1Q81C 2DGYA 3KYHC 1Q1BA 4YHHQ 2K5VA 3A0JA 1AE2A 4B3SQ 3GTMH 3H15A 3U4ZA 1DGSA 3M4OH 4JG2A 3TRZA 3PUVA 1PA6A 1Q46A 3CPFA 4YHHL 1I3QH 2OQ0A 1S40A 1WFQA 1G6PA 4A3MG 4B3SL 3GTOH 3GD7A 1L1OC 4JV5Q 1Q82C 3I7FA 5LMUL 3NENA 4JI1Q 3S15H 3STBD 2GVAA 4HJ9A 2RF4A 5M5WH 4HJAA 1N9WA 1EQQA 4JV5L 5JJLA 3CMAA 1Q86C 2VL6A 1VQBA 2N8NA 4L5RC 1A0IA 4JI1L 4J15A 3HOYG 2RHSB 1XMOQ 3KDFA 5LMNW 5C3EH 4IPCA 2JA5H 1XPRA 1X3FA 1VQ6A 2Z6KA 1Q12A 4RMFA 5J3BA 4BA1I 3E0EA 1XMOL 3GTKH 4PG3A 2MO0A 4C3HH 3F1ZA 2R7DA 4IPHA 2JE6I 5FLMH 4LW1A 3RLOA 4TVAB 1QUQA 5GADC 4C3JH 3RZOH 2JEBI 3W1GA 4KI0A 3PO3H 1R9TH 1YJNA 2NZHA 2D0PA 3M4PA 2ZM6L 3RLFA 1VQAA 2UUCL 3PGZA 1QZGA 3PIOA 1GM5A 4GNXA 2B63H 1KXLA 1SRUA 4BBRG 2GN5A 2ID0A 1WYDA 1VQIA 2E8GA 2WB1G 3LGJA 4JI6Q 3CD6A 1XPOA 4DR4L 4KHPQ 3BZCA 4LUOA 4DKAC 3G6EA 3PCOB 3MEFA 2I0QA 3CF5A 5C3EG 4GN3B 1J5EQ 2Q2TA 4P74A 1K3RA 1PH3A 1PHJA 2E2JH 5IYBH 1KC8C 4PMWA 4KHPL 2F4VL 4TQUS 5M3FG 5M3MH 4DR7L 1J5EL 3BZKA 4BY7G 2JJQA 5C44H 1VQFA 3I56A 4Y7NH 4ME3A 1V9PA 2Y0SE 1W2BA 1K73C 3GTLH 3PO3G 3RN5A 4AIMA 1VQ5A 1HNXQ 3HOUH 1VQDA 1UEBA 3CAMA 3NELA 4P73A 1HNZQ 1I50H 4AQYL 3S1MH 5IP7H 3CC2A 3PF4A 4P72A 1K83H 1EOVA 3T1HL 1HNXL 3GTQH 2KHIA 3U4VA 4DK6C 2NN6G 4DPGA 1HNZL 3I55A 1RIPA 5H1SE 1YITA 1BVSA 1YVCA 3CMEA 3OTOQ 1XTDA 1QUQB 4PZ8A 3IRBA 1VQMA 1L1OA 4DR3Q 3HKSA 4JC0A 5JEAG 1M90C 1E24A 3T1YQ 3I4NG 1A63A 4MTNA 4QL5A 3OTOL 1UE6A 2EQSA 2DUDA 4YCVA 3H3VH 4NXNQ 4POGA 4DR3L 4NB3A 4ALPA 3TEHB 3S16H 4IFDI 3HOUG 2KCMA 2JEAI 1M1KC 4R4IA 3HKZE 1SR3A 4A3KH 1X6OA 3S24A 1WCMG 3AQQA 3KF6B 5IP7G 1HZAA 4HJ8A 3HFZB 3J80c 3GO5A 1CKMA 1HZ9A 3J81i 2QGQA 4JBJA 4H02A 5FJ8H 2ZTCA 2K4KA 4A3IH 1B70B 3ULJA 1TXYA 3S1RH 3NBHB 4POFA 1EWIA 4A3JG 4JBKA 1JT8A 1UE7A 2R7ZH 2VUMH 1YBYA 2NN6I 4IJLA 4AYBE 4DV1Q 2Y0SG 4GKKQ 4WJ4A 1NBWA 3K80C 1QZHA 5C4XH 2B29A 2I5LX 3W1BA 4OO1G 2B3GA 4JYAQ 3M4QA 1KHIA 4B3RQ 3EIVA 2CFMA 1CSQA 2OQKA 2R7FA 4RG1A 4LF6L 2D0OA 1OXVA 4UP7A 1L1OB 3RLNA 4JYAL 3JC66 4HJ5A 2KBNA 3PO2G 4B3RL 3DM3A 1TWGH 1XJVA 1O7IA 2BH8A 4JI8Q 4YY3Q 1VQ7A 2IT1A 1S3OA 3M9BA 3D0FA 4UP8A 2JA8G 1NJIC 3MXNB 2R7ZG 3F2DA 1KD1C 5GAEC 4YY3L 3HOWH 4BA2I 2R93G 1VQLA 1C9OA 2JA9A 3JAMi 1VQ4A 1IBKQ 3HKZG 1OTCA 4LF5Q 5C4XG 3SGIA 3AFPA 4GN4B 3EBEA 4LF4Q 4LUVA 4YCUA 1I6HH 1RL2A 1IBKL 3G48A 4LF5L 4A93H 3H3VI 4DR2Q 1KIXA 4QIWE 1X55A 2CCZA 4LFBQ 4LWCA 4OWWB 4OO1I 3F2BA 4EQ5A 2ZJQA 3UE0A 4OWXB 4LFBL 4AYBG 4QJFA 1VS0A 4GLXA 2QA4A 4OX9Q 1V1QA 1YEZA 1Z9FA 4XIGS 2UXCQ 5K36G 2JK8A 1I94Q 1KL9A 2ZJRA 2C35B 4OXPA 3GDEA 3L0OA 4YWLA 2F52A 4P71A 5IWAQ 2NVYH 4OX9L 4A3GH 2NVTH 1I5FA 2ZTDA 2K5HA 2UXCL 3S2HH 1I94L 5IYDH 1MKHA 1MJCA 4A3CH 4X65Q 3H0GH 5IWAL 5IY0A 3HOVH 1EIFA 3NEMA 4JI4Q 5C0XI 1PVOA 3F2CA 1ASYA 2HT1A 4X65L 1XMQQ 2R92H 1PH4A 1SROA 4QQBX 3CCSA 2PQAB 4JI4L 4IOAA 2PMZE 1N36Q 4JI5Q 4JI3Q 1IZ6A 3GTJH 1HH2P 5HGQA 1XMQL 1PH6A 2JA5G 4BY1H 3KF6A 4JBMA 4A3LH 4IFDG 2HIXA 4R4QA 4JI6L 1PH2A 4BBSH 1N36L 1UE5A 4JI5L 2Z0SA 1QVCA 2Q2HA 1G291 4UPAA 4JI3L 1JJ2A 3J7A5 4OONA 4A3BH 4A3GG 5FLMG 4IPDA 1X3EA 1K9MC 5IYDG 3A74A 1Q1EA 1CKNB 3H0GG 3OW2A 3S17H 2WFWA 4DV6Q 3KJPA 2UXBQ 3HOXH 1JJGA 4JOIA 1FVIA 2LSSA 3CQZH 3D31A 1OXXK 2RCNA 3FKIH 1T9HA 5FLXc 1N34Q 4APVA 2B63G 2R92G 4DV4Q 4L5QA 3PUXA 4DV6L 3M3YH 5C4JH 4IOCA 1MIUA 4KHZA 4P75A 1OXUA 3KOJA 5GAHC 1G51A 1N34L 2Q2UA 3S2DH 4A3LG 4BY1G 1W3SA 3OYYA 4LUZA 4DV4L 4BXXH 3E9HA 3ERSX 4JBWA 1VQHA 4AH6A 4KLKA 5IYBG 4R4CA 1EUJA 5M3MG 1X9NA 4UY8C 4EX5A 2IY5B 3K81C 4DV5Q 1UE1A 4C2MH 5C44G 3S1QH 2JA6H 3L7ZC 2H5XA 1Y1VH 4DV2Q 4R1JA 1C0AA 3TREA 4LFAQ 1CKOA 2YTYA 5GAGC 3T1YL 5IYCH 1SN8A 1BKBA 3S14H 1E3PA 2ZTEA 1N32Q 2LXJA 3AFQA 4NXNL 4DV2L 3I4OA 3L2PA 3F8TA 1NMGA 4LFAL 4A76A 2R6GA 1Y1WH 3CC4A 1FGUA 1SLJA 3STBC 1N32L 3K8AA 4DUYQ 1GD7A 1N8RC 2CWPA 2HHHQ 4JI2Q 2OTJA 2K52A 1JB7A 4DV0Q 5GROA 2UUAQ 4NXMQ 4IPGA 3CCQA 4DUYL 4DR6Q 3K7UC 1PH9A 4HIDA 2HHHL 2JA7H 1GKHA 4A3EH 1HZBA 3CCUA 4NXML 4DV0L 2UUAL 4L5TA 1Y1VG 3UDFA 3W5OA 4PZ7A 3J7ZC 1JMCA 3RNUA 1XNRQ 1SMXA 1C7YA 3PV0A 5IYCG 3EN2A 5IP9H 2Z6KC 2UU9Q 2ATWA 4A4IA 3U50C 4DV1L 2VW9A 4X64Q 4A3KG 4GKKL 3I2ZA 1HNWQ 1XNRL 5E7NA 3PUYA 4OWTB 2UU9L 4GOPC 4LF9Q 2D62A 3CCVA 5FJ8G 4DUZQ 1HNWL 2BA1A 2VQEQ 4A3IG 4A3DH 1K0RA 2YV5A 1JJCB 3CCEA 3AYHB 1D7QA 1OXTA 4GKJQ 4GNXC 1LYLA 3K0XA 4YWKA 2V1CC 2VUMG 2VQEL 3A5UA 5DLQE 1QVGA 2JA7G 1E1TA 4A75A 4A3EG 2KCTA 4JI8L 3TS0A 1VQCA 2AWOA 2VQFQ 2PQAA 2EIFA 3I4MH 1N33Q 3BJUA 5C0XG 2NVQH 1FJGQ 1YHBA 3RR5A 4DK3C 4IO9A 1JE5A 4A3MH 4X6AH 2VQFL 1N33L 4X62Q 3VDYA 1AE3A 3CCMA 1FJGL 1HR0Q 1D8LA 3J81c 4LF4L 3J81j 4QGUA 1A8VA 1TWFH 1BBWA 1PYSB 1NTGA 1YI2A 4GS3A 2K5NA 4X62L 4LNQA 1VQOA 4GLAC 4A3DG 3HOYH 1HR0L 1CKNA 4DR2L 4GLVB 2PI2A 4O2DA 1HJPA 2ES2A 1VQ8A 2CWAA 2EXDA 1SE8A 3HOWG 1PH5A 3S1NH 1YZ6A 3I4MG 1X3GA 3PUWA 2ZJPA 1B8AA 1P16A 5EAYA 1Z47A 5LMUQ 3FP9A 2A8VA 1VQPA 5IT9c 4YCWA 1OXSC 3UDXA 1X54A 2YU9H 2WAQE 2A19A 3ULLA 2AWNA 3KFUA 4IJHA 4A93G 1AH9A 2VZAA 4JI7Q 4JI0Q 1PH8A 2RHQB 2N49A 4BBRH 5ELOA 1BBUA 4DAMA 2VY3A 2XGTA 4IFDJ 3ICEA 4JI7L 1WJJA 4JI0L 2BH2A 3BU2A 1YHQA 2JQOA 4MZ9A 5ELNA 3CC7A 2NZOA 1B7YB 2IHEA 2WP8J 1IBLQ 5M5XH 2YTVA 1VCIA 4LF7Q 2FXQA 4DV3Q 4LF8Q 3JAMc 5M3FH 1HR0W 3CCLA 4BY7H 3GTGH 2ZM6Q 1U0LA 3FHWA 1YJWA 4DNIA 5BR8Q 5AJ3Q 2K14A 4GOPA 1IBLL 2YTXA 2UUCQ 4B3TQ 4LF8L 4LF7L 4DV3L 2XTIA 2BA0A 4HIMA 1WOCA 3UDIA 1MJEA 4A3CG 1S72A 2NVXH 5AJ3L 2PI2E 5BR8L 4DR4Q 3HOVG 1KRTA 1X56A 4B3TL 1L0WA 3KJOA 4DR5Q 2UXDQ 1PH1A 2AHOB 2MFIA 1A62A 4R4TA 2E2HH 5IE8A 3CXCA
chains in the Genus database with same CATH superfamily
2F0TA 3CCRA 4KTAA 2F4VQ 1HUNA 2VB2X 1J9OA 1E7ZA 1RF2D 4Q0FA 2VS1A 2E5LQ 1EQRA 4PMBA 3TQYA 2KENA 2EYHA 1J6QA 4IUVA 4A3JB 2E75C 5C3WA 1WD1A 3A5ZB 4K2LA 3NXWA 3HOXG 1Q8KA 2E76C 3D3RA 2EY1A 1TWAH 1CQVA 4X3KA 1UUPA 2ASBA 1I4PA 1EY5A 1TQOA 1GO3E 5T1GA 1ET9A 4B3ML 3V96A 3PUZA 1QOHA 3A55A 3GTPH 4IUPA 1IL2A 3KF8B 4JI2L 3VYRA 2MO1A 2KHJA 2OWOA 2PO4A 4X66Q 1HA6A 2N3SA 3DXJC 4JPBW 1EEFD 1VQ9A 1KAWA 3CPWA 1TWCH 4LFCQ 2AKWB 2CQAA 1H95A 2F3IA 1HCZA 1FL0A 3U58A 3UDGA 3PO2H 2QEXA 2Q8TA 4X64L 3V05A 3DLLA 3G4SA 2L12A 3CCJA 2JA8H 3SR1A 3IKJA 4DUZL 1EIYB 2A1AA 1VQJA 1IBMQ 2A6ED 1O80A 4U68A 2P5ZX 1BCPC 1DCZA 1JOOA 5GQOA 1XPUA 2CKZB 5IP9G 2MJ8A 5LMNQ 4HIOA 3EQLC 1HFNA 4QY7A 1JB3A 1K3BC 2PNHA 1JR0D 2B2VC 2AQ3B 1VQEA 4F7XA 2E2IH 3GV3A 2A5HA 3NQTA 3G6JB 5M5WB 2F4IA 4F8MA 2DGYA 4YHHQ 3A0JA 1JOQA 5K36H 1DONA 5JVG3 3NTIA 3U9OA 1H9SA 2EYOA 3M4OH 3TRZA 3PUVA 2ZXRA 1EY7A 4A3GB 4KY5A 1L1OC 1R4QB 4JK1C 1Q82C 3PO3B 4QIWB 1GUSA 3NENA 4DK0A 3S15H 2AQ2B 3STBD 2GVAA 3X3NA 4DAVA 4HJ9A 3ND8A 4JV5L 2VL6A 2XVSA 1A0IA 3BYYB 4J15A 1XMOQ 2MUYA 2JA5H 1VQ6A 3GTJB 3VA5A 5J3BA 5DEHA 2MO0A 3F1ZA 2KEEA 3EJIA 5FLMH 5M3MB 3RZOH 5E4XA 2Q8RE 3W1GA 3AMUA 1H9MA 2NBFA 2ZM6L 3MVVA 1QZGA 3PIOA 3T51B 3VYUA 2GN5A 2XNAC 2HUGA 2WB1G 5CR3A 4DR4L 4KHPQ 3MAQA 4DKAC 1QWYA 3G6EA 1J5EQ 3QIAA 3TZDA 3V2TA 1WTXA 4P74A 1K3RA 3C2PA 1KC8C 2F4VL 2HD3A 2EVBA 3QWNA 3BZKA 1FYCA 1A15A 3K6OA 1UEAB 1T5XD 3LNNA 1VQFA 2KA7A 3PO3G 4DNRB 4AIMA 2PQEA 2HCIA 3S16B 3CAMA 1HNZQ 1M8AA 1LTAD 1LO5D 2KVMA 5IP7H 4P72A 1EOVA 2JXMB 3GTQH 2NN6G 1RIPA 5H1SE 3NP8A 3CMEA 1XTDA 1L1OA 4DR3Q 1Z7TA 4H13C 4MTNA 4CJ0B 1UE6A 4J6HA 2EQSA 2R7ZB 1Z6HA 1ZYRC 4NB3A 1G6ZA 3MXNA 4RA8A 3HKZE 1SR3A 4NKLA 4A3KH 1BCPB 2B8FA 1WCMG 3KF6B 1MI2A 4HJ8A 1FNUA 4A3IH 3RD4A 3NBHB 1SYBA 4G4KA 3ITPA 4JBKA 2VUMH 2KUMA 4HSPA 4IJLA 4FF3A 4FF4A 5CMDA 5ELDA 4N8X1 1RDPD 3K80C 1QZHA 3I4MB 1EQVA 2B29A 5FLXE 1LTTD 3W1BA 4CKCA 4NMZA 4OO1G 3T13A 3T53B 3M4QA 4CDEC 1KHIA 2L11A 1OXVA 4UP7A 1L1OB 2EZVA 4O42A 1G91A 1TWGH 1SDFA 1O7IA 4JI8Q 4J8QA 3K58A 2IT1A 4UP8A 1NJIC 3MXNB 2R7ZG 1EIGA 4CHTB 1PLFA 1CHQD 3Q6SA 2KEDA 1U4PA 1IBKQ 5C4XG 4LF5Q 3SGIA 4XT3B 4GN4B 3EBEA 4LF4Q 2NVYB 2H4OA 2NVTB 4XQNA 4NDXA 1A3VA 4HMJA 1B3QA 1LLRD 1X55A 2F0EA 4DAPA 3HOVB 4OWWB 4MHEA 4EQ5A 3UE0A 1LABA 4LFBL 1B44D 2R61A 4XQQA 1V1QA 1Z9FA 1EYCA 2WIIB 2UXCQ 1KL9A 4OXPA 4CKBA 1JWUD 1SYEA 1WTPA 2WKCA 1BDOA 1I5FA 3KBXA 3GTOB 4A3BB 2K5HA 1U9RA 3S2HH 1I94L 4NP5A 2IJ0A 2WAQB 1EZ8A 3H0GH 4HR7B 1HUMA 5CV9A 1UAPA 1LTGD 2CH4W 2R92H 4TKOB 3CCSA 4IOAA 1N36Q 2F1MA 2D9UA 5KNDA 3J81L 5C4JB 1JORA 1ET6A 4K8JA 4A3LH 3QJYA 4MIUA 4JBMA 4IFDG 2HIXA 1PH2A 3L3OC 1QVCA 2Q2HA 1JJ2A 1TS2A 3I91A 4OONA 4C3HG 1D1IA 1BR9A 3A74A 1CKNB 3OW2A 1Y1VB 3K5LA 4RFBA 3HOXH 1ONLA 1JJGA 2KECA 1N34Q 3D31A 2RCNA 5FLXc 1NUCA 1T9HA 4R8NA 4ZUJA 4L5QA 4DV4Q 2WACA 3M3YH 1B9MA 3AB9A 1F77A 1Y1WB 3WOEA 1OXUA 5GAHC 3S2DH 1KNAA 1W3SA 3N52A 3ERSX 4JBWA 1VQHA 1QCBD 5IGEA 4J1MA 3VR2A 1UE1A 5C44G 4DXFA 4K5WA 4DV2Q 3IFTA 4R1JA 1JC7A 1JWSD 2YTYA 4DK1A 5JPNC 3KUPA 4C1NK 3J7YW 2LXJA 3FPUB 3I4OA 3F8TA 1NMGA 1FGUA 2CW0D 4FXKC 1N32L 2QKIC 4CDCC 3JAME 3K5NA 3GP7A 2HHHQ 4LK1C 2G9HD 1A3UA 2UUAQ 4BS9A 4DR6Q 4MN3A 3R3OA 1U4LA 2JA7H 5CV5A 1TIID 1PTOH 1Y1VG 4RCNA 4PZ7A 3M4YA 1I4RA 3RNUA 1XNRQ 1SMXA 3FPPA 5IP9H 5DM73 3C1EA 2VW9A 4G7HC 4A3MB 3I2ZA 3HRZC 5KYLA 4G57A 3HS0C 1RHPA 4RKLA 4TRDA 2D62A 2E2IB 2EYJA 2IWHA 1ZXTA 2VQEQ 2YV5A 1JJCB 1EU3A 4KY7A 5E4WC 2LFNA 1PZKD 4GNXC 1WVLA 4YWKA 3NHHA 3SK8A 1S5ED 4JI8L 2ZXPA 3Q23A 1VQCA 2EIFA 5FK9C 2BE5C 5C0XG 3M4OB 1TVXA 2VQFL 2B2WA 1N33L 4IURA 3VDYA 3F2UA 2YU9B 1FJGL 2A73B 2NB0A 4LF4L 1IW7C 1TWFH 2ICEC 3BDOA 1NTGA 1YI2A 2K5NA 4X62L 4A3DG 2WINB 5I6YA 2Z4HA 4GLVB 4O2DA 4EGVA 4RGTA 2ES2A 2A69D 1VQ8A 2A6HC 1PH5A 2FFKB 3DWQA 4UHVA 1KDCA 5C3XA 3LWEA 3HP3A 5FO9B 2L4NA 3UDXA 1STAA 4PV1C 5LHY1 1JOKA 2RDFA 3KLSX 3ULLA 1Q8IA 2KCCA 1Y69U 1QE6A 3KFUA 4A93G 1EIHA 2F0OA 1E2ZA 3VR6A 4JI0Q 5JOBA 2RHQB 2DY8A 1SYGA 4IFDJ 2O5JC 2XGTA 1BCPF 4JI7L 3OIPA 1EY6A 4BWGB 1SFOB 1B7YB 5C5MA 5E3FA 2YTVA 3W3AA 4LF7Q 4DV3Q 3JAMc 1HR0W 1B9NA 4QMGA 1IBLL 2K14A 4HTHA 2MHVA 2B2UA 3NWSA 1WOCA 3UDIA 1MJEA 4A3CG 4B3TL 4ME5A 4ODGA 2AHOB 2MFIA 2E2HH 3I73A 2NN6H 1EU4A 1KABA 4OELB 4HJ7A 4DR5L 1S5BD 5CV7A 4A3FH 4JCVE 2K50A 3SXHA 2C5CA 5DNFA 2OCEA 1QVFA 3QO2A 4AQYQ 2OTLA 3DWAA 3PQIA 1D5ZC 2Y0SB 3T1HQ 1FD7D 1NY4A 2OT2A 5JJIA 2QCPX 3KDFB 4UDUC 1WCMH 4EQPA 4B9XA 4U673 5CV6A 1ASZA 4ZAIA 3GV6A 2GVBA 4B3MQ 2L15A 1U4MA 1HTLD 4HCEA 5T1IA 1D2BA 1CSPA 1LUZA 5JJKA 1HFGA 2CQOA 2IX1A 1AP0A 3SK4A 4C3IB 3HOZH 3E9IA 4GNXB 2JA6G 2MNAA 3TN2A 2R93B 4PZ6A 4DR6L 1LTLA 4OO1H 2EY5A 3PSIA 3G71A 1P8LA 3RZDB 3PIPA 3TS2A 4K0KL 1JWMD 1CA5A 1CI3M 2IX0A 4KK7A 5FLXL 1SMYD 3OSOA 3GQBA 1UWVA 3E0JA 5C0XJ 4YWMA 1EFWA 2VNUD 4Y52H 1LM0A 5M5YH 2EYFA 4AYBB 1EYGA 4FDBA 4F88A 4O0AA 4LF6Q 2IX3A 4LAAA 5I4DA 1RTOA 1LTSD 3K7AH 2L0CA 4C3IG 2WB1E 4DNTB 5KNBA 5COYA 2F0DA 2A74C 2G5DA 4RAUC 4G7OC 3TDQA 5C3EB 3H15A 1DGSA 1EYAA 1IKMA 1Q46A 5K5PA 1XXGA 2OQ0A 4B3SL 4OGQC 5JJZA 4JV5Q 3I7FA 1ENAA 2RF4A 2B63B 3HOYG 3P75A 2N8NA 3K59A 4JI1L 2RHSB 1X3QA 5ISRA 2F0HA 5LMNW 4LJZC 4IPCA 1X3FA 2Z6KA 1HA5A 4IFDH 1PXUA 3E0EA 1GUOA 2EJFC 1EWCA 5IGGA 4PG3A 5F2DA 4C3HH 2R7DA 4IPHA 4LW1A 3RLOA 4TVAB 1QUQA 2JEBI 4Y7NB 2B2TA 2RKSA 1VQAA 5KIXA 2E74C 4OHJA 1IL8A 3EFXD 3KF8A 1GM5A 1STHA 5CC4A 1X32A 3K0YA 1WYDA 3R8BA 3CD6A 1XPOA 3BZCA 2PMZB 5ELBA 2Q2TA 3T16A 5C3EG 4GN3B 1WTOA 3P20A 1O7LA 1QNUA 5J22A 4TQUS 1F9QA 4EQOA 4BY7G 5C44H 1GUWA 4C3JG 1KAAA 4ME3A 1W2BA 3GTLH 3HOUH 1VQ5A 1MSHA 1SXTA 4P73A 1HQMC 4AQYL 5IGDA 2F0WA 3S1MH 2D2CC 4X3SA 3PF4A 3T1HL 1HNXL 4DK6C 2BOSA 4IZ8A 4DPGA 3I55A 1YITA 1BVSA 1YVCA 3LX0A 1Y8PB 1QUQB 3IRBA 1VQMA 4OIJA 3HKSA 4JC0A 5JEAG 1E24A 4V190 3I4NG 1A63A 3S1RB 4QL5A 3OTOL 2PYKA 3H09A 3H3VH 4RKBA 3JAML 2JA7B 3TEHB 1F9SA 5CORA 4C56C 2L5TA 1S5FD 1X6OA 1STBA 3S24A 3AQQA 1II3A 2BDNA 2N55A 3GO5A 1CKMA 1HQRD 4I7AA 2QGQA 4H02A 1MD2D 1FNWA 2K4KA 1BNZA 1TXYA 4WFN3 1KLUD 1EWIA 4A3JG 4HN7A 3QOJA 1YNJC 4DV1Q 4CJ2C 3HOWB 1NBWA 3I4LA 5C0XH 2I5LX 1K8MA 4L8JA 1BOSA 5HURA 4KV6A 1ICWA 3EIVA 1CSQA 2R7FA 3C46A 4LF6L 1L0XB 5JVH3 4JYAL 3DMUA 4HJ5A 4S3SA 2XWJB 3DM3A 2F0QA 3FMCA 3OW7A 3M7GA 1VQ7A 4FYDA 4BA2I 4QUCA 1BQQT 1RODA 1VQLA 1SNCA 1C9OA 4DU9A 3JAMi 1VQ4A 3LWUA 1OTCA 3E3XA 2Z9HA 3AFPA 3HZXA 1RJTA 1STEA 1RL2A 2K5DA 4OEMB 4A93H 5NUCA 1KIXA 1C48A 5G3LF 4LFBQ 2OXPA 4OWXB 3BS1A 3C1FA 2QA4A 1XYIA 3MFYA 1YEZA 4WORA 2JK8A 1I94Q 2A68C 4QCLA 2ZJRA 2C35B 1ZYRD 3L0OA 4BBSB 4OX9L 2OEOA 4IUUA 2SNMA 1E2VA 1MJCA 4A3CH 5IY0A 3VA7A 1EYDA 1KDAA 1PVOA 3CQZB 3FKIB 3NPPA 4QQBX 1ICFB 2PQAB 5KYIA 3NK9A 1SE3A 3MXGA 1LV9A 5M9OA 4BY1H 1PH6A 3K5MA 1K28A 3OPOA 3KF6A 4A3FB 4I7ZC 2X6GA 2L1BA 1UE5A 4JI3L 3D4WA 2N88A 2WV6D 4LMQD 2B2VA 2A6EC 4X3UA 4A3GG 3TP6A 4IPDA 3U9SA 1K9MC 5IYDG 3S1QB 3MEHA 4FXDA 3NBHA 4HSVA 2F0JA 3S17H 2WFWA 3BG3A 4CBVA 2UXBQ 3DUZA 5IT9L 2Z8LA 1OXXK 1EL0A 2FJ2A 2F0FA 3MXUA 3KBGA 4UAIA 4ZKCB 1BXTA 1LT3D 4IOCA 1MIUA 3IFDA 4LUZA 1C4QA 4OIKA 4AH6A 4KLKA 1CZWA 1HRJA 5M3MG 4EX5A 1BF4A 1IKLA 5AFWA 1WTVA 2JA6H 3BVGA 1EY4A 2FINB 4HCSA 3FEWX 1CKOA 5GAGC 2F0VA 1SN8A 4KY6A 3S14H 1N32Q 4KJOA 1ESFA 4LFAL 3A7AB 3OMGA 3STBC 3I90A 3K8AA 4KKSA 1TR5A 1JB7A 1PMRA 3D6CA 2F0NA 3K7UC 1GKHA 4A3EH 4NXML 2L9HA 1C7YA 3PV0A 5IYCG 2ATWA 4A4IA 4DV1L 3T4AC 3BYTB 1SYCA 2UU9L 4GOPC 1ENFA 1PYWD 1DXMA 5FJ8G 3CCVA 1WTRA 3CCEA 1D7QA 3K0XA 3A5UA 4NW2A 4JW0A 5C6AA 4A75A 2VQFQ 2K03A 3S1NB 1N33Q 2FMMA 4KMUC 2NVQH 1FJGQ 3RR5A 3KLSA 2HDLA 5ELFA 4X6AH 2QEJC 4E6IA 5CV8A 4X62Q 2LY7A 3I8ZA 3CCMA 3BDCA 4L6TB 2SNSA 3J81j 4QGUA 1PYSB 4GS3A 4GLAC 4BBRB 3HOYH 3FVQA 1SSOA 1CKNA 1O7ZA 2PI2A 1HJPA 1HXYD 2K6AA 3A7LA 1YZ6A 3I4MG 3PUWA 1RKNA 3EROA 1B8AA 1P16A 5M3FB 2A8VA 1FGBD 2H1EA 1VMPA 1JE4A 1X54A 4EQNA 2A19A 1AH9A 4JI7Q 2NVXB 4X3TA 2KCNA 4CDDC 1BBUA 1KTKA 3NTHA 4DAMA 1O78A 5EBCA 2JQOA 1JQYD 3CC7A 3W2DA 2IHEA 5D3DA 1H9KA 1IBLQ 2M2LA 4K8IA 5M5XH 1NR2A 3WDNA 2FXQA 2KJXA 4BY7H 3GTGH 1U0LA 4GOPA 2YTXA 3SK6A 2SOBA 4B3TQ 4LF8L 4Z9CB 3BVMA 3HGBA 1NCVA 3CKIB 5EPJA 3GTLB 5AJ3L 5BR8L 3HOVG 1KRTA 1DJRD 4DR5Q 1A62A 4R4TA 5IE8A 3S1MB 5IGCA 4RGOS 3CXCA 1YIJA 2UXDL 2Q8IB 3TP5A 1VQNA 3RN2A 4DR7Q 2UXBL 1CUKA 4KHVA 1TWAB 3WWVA 1K8OA 1NMFA 1Q7YC 2I5MX 1D1KA 2HCCA 3I4NH 1PFSA 3PF5A 4A3BG 2F0SA 3AEVA 1M4VA 2BE5D 2WAQG 3GTPB 1CZGA 1I6VC 3NQIA 1VQKA 4HIKA 2JP1A 2KHSA 4MNOA 1E1OA 2M00A 5D65A 1TWCB 1IW7D 4ZCKA 2YYZA 1IXRA 4EVOA 3C3LA 1STGA 1XX8A 1TWHH 3PO2B 1XNQL 4GOPB 4NPSA 3I3CA 4A3JH 2A6HD 2JA8B 5EPKA 3TP7A 1PFNA 2F03A 4DV7L 4UP9A 3J7AF 3M7NA 1AEXA 2D5DA 4K0KQ 3HKZB 4GN5A 1X65A 1NE3A 2NZ1D 1U5KA 2ICIA 2EYMA 1Y1WG 2C9OA 1IYJB 3EA6A 2UUBL 1DOMA 3MC0B 3BDLA 1CT1D 1K8GA 1GUNA 1HZCA 1PYBA 2NUCA 3HEJA 3MWYW 1PV4A 3SVMA 2IW3A 1E22A 1V43A 3CP0A 1K0SA 2RVLA 2K28A 2VB3X 1WTQA 3ND9A 2IHFA 1PRTC 4DAYB 1GXDC 3H6MA 1D6EC 1Y8NB 2K75A 4KN7C 4XTCS 1I4XA 5C5LA 4DR1L 3PIP3 3S15B 4JOIC 1L2FA 1MHWC 3DM1A 3KYHC 1Q1BA 3QB3A 4K5XA 4B3SQ 3GTMH 2JA5B 3U4ZA 1S4ZA 3FRPB 1PA6A 2B2YC 5KGUA 1I3QH 4N8FA 4A3MG 3J80E 1SYFA 3RZOB 1GHJA 4JI1Q 1MBYA 5M5WH 4HJAA 1N9WA 4K14A 3CMAA 4L5RC 4CJ1B 1I4GA 3KDFA 5EKIA 4P2CB 3NE5B 1XPRA 1ZKOA 1Q12A 4BY1B 2XWBB 2QDLA 4BA1I 1QJOA 3GTKH 4HMIA 1TKWB 2K01A 5GADC 1GHKA 1QG7A 3PO3H 1X3PA 3M4PA 3S17B 3PGZA 4GNXA 3D8GA 2EY6A 1F9RA 3CRKC 3LGJA 4JI6Q 2AUJD 3GTQB 4LUOA 2I0QA 3PCOB 2DNCA 1PH3A 1ZEQX 4DR7L 5M3MH 1T5EA 2FHTA 4RHSA 3SHLA 1LTBD 1V9PA 3RN5A 1HNXQ 1NR4A 1UEBA 2SEBD 3DEPA 4KD4A 1RTNA 3S14B 4A3KB 1K83H 2EDGA 2GA4B 1GOZA 5LL6X 5BN5A 1QNKA 2B2YA 3P7JA 1LT4D 3OTOQ 1ILQA 4PZ8A 4A3IB 1M90C 2NYZD 1A3TA 4ABNA 1AZQA 2DUDA 2VUMB 3ONAB 4POGA 1IYVA 2DNEA 5BN3A 1WD0A 3S16H 2KCMA 2JEAI 4IFDI 1M1KC 4TSSA 1W6JA 1YNNC 2F0UA 3QOLA 5IP7G 2E2DC 1HZAA 3J80c 1PRTB 3OMCA 5FJ8H 2ZTCA 3OWFA 4DA2A 3A54A 1FR3A 3ULJA 1TWGB 3QR8A 4POFA 3NWTA 1UE7A 2R7ZH 2Y0SG 1PTOC 2RDGA 5C4XH 5A35A 1V1OA 2B3GA 4JYAQ 4RHRA 1TY2A 2O5IC 3RLNA 3JC66 2KBNA 5J1ZA 4B3RL 3NTKA 5KRUA 5ELEA 1GJXA 2M9VA 4DFAA 3M9BA 1QILA 5DM63 4DXGA 3F2DA 2R93G 4YY3L 4KKUA 4O1NA 2JA9A 5FO8B 2LMCB 1F2ZA 2AQ1B 1OO9B 4LUVA 1I6HH 1SE2A 1SYDA 2RSOA 3G48A 3H3VI 2F0MA 5JPMC 3S2HB 1EY9A 1SNOA 2R3ZA 4QIWE 3H0GB 1Q3LA 4LWCA 4H0LC 4ZUIA 2PW7A 2J0TD 3R93A 2R92B 1LTID 2WKDA 2K33A 4AYBG 1VS0A 4GLXA 3J7AV 5C4HA 4OX9Q 1RD9D 5I2YA 1BO0A 1CTMA 5M5XB 1L0YB 1DD2A 2LKVA 3EVQA 4YWLA 4P71A 2NVYH 1CFMA 2NVTH 2EXZA 4RWSC 1MKHA 5IWAL 3HOVH 1EIFA 1PDQA 1B3AA 5C0XI 4IALA 3HOXB 4X65L 1SROA 1SMYC 2LS01 4M1UB 4JI4L 1UNSA 5EQ0A 4JI3Q 3M3YB 1XMQL 4FP5D 4FF2A 3DEOA 5CGKA 4B08A 3S2DB 4QF4A 4JI6L 2X6LA 4JI5L 2Z0SA 1YNJD 1ESRA 4UPAA 4A3BH 1X3EA 1BCPD 1Q1EA 3J81E 2DY7A 3H0GG 5KNCA 2O2LD 2EY2A 2EJGC 3KJPA 1FVIA 3VR4A 2B63G 2R92G 5EKLA 4ID6A 4DV6L 5C4JH 1BUVT 3PIO3 4KHZA 1MGSA 3KOJA 4P75A 2PZUA 1G51A 3O13A 1DOLA 2VXWA 3DWPA 3K57A 4MTKA 1TWHB 1XTCD 4A3LG 3E9HA 5IYBG 4R4CA 4ZRZA 1X9NA 4UY8C 2IY5B 3K81C 3Q22A 4C2MH 1B1ZA 4DV5Q 3L7ZC 3OHXC 2H5XA 1Y1VH 3TREA 4LFAQ 1IYUA 3Q0AA 1GUGA 1PTOB 1BKBA 4CDFC 1NSNS 1STNA 2PCFB 3L2PA 4A76A 2R6GA 1FNVA 2K7VA 2RBMA 1Y1WH 1SLJA 1SEBD 3MTSA 4R9WA 1XWEA 1SNMA 4HEDA 4K6LA 2CWPA 2OTJA 4NXMQ 5GROA 4IPGA 4DUYL 1PH9A 2A68D 2KQ3A 1J8IA 3CCUA 4DV0L 3W5OA 3UDFA 1PFBA 2O4XA 3EN2A 2ZXOA 2KOLA 2UU9Q 1TS5A 1LACA 1LT5D 1VF5C 1TT2A 3MZ5A 1A6XA 3PUYA 2I07B 3URYA 2Z4IA 4LF9Q 1F2MA 1HNWL 5C4ZA 2BA1A 4A3DH 1K0RA 1TWFB 1LTRD 2TMPA 3AYHB 1OXTA 4GKJQ 1W6KA 1ML0D 3TZUA 4M8AA 1E1TA 3K5OA 2JA7G 2KCTA 3A8JE 3TS0A 1QB5D 2PQAA 3GTMB 3BJUA 2BDOA 2EJMA 4A3MH 2AUKA 1I3QB 3OWEB 1JCKB 3VR3A 1D8LA 3J81c 1A8VA 1BBWA 2PNRC 3IL8A 4LNQA 1VQOA 2FMCA 1HR0L 3J80L 5EJWA 1KNEA 1STYA 3MXPA 2WB1B 3HG9A 5FOBB 2DJGC 2NTSA 2F0LA 2QILA 2CWAA 2EXDA 5IOCA 3HOWG 2HQEA 1X3GA 3GTKB 1Z47A 5LMUQ 4FO2A 1VQPA 1G2TA 2YU9H 2WAQE 2AWNA 4IJHA 2VZAA 3VYTA 1PH8A 4RGNA 1CHPD 5ELOA 2B8GA 2VY3A 5EBDA 5A2QE 3ICEA 2E2HB 1DM0B 1SNPA 3BU2A 4OL7A 4MZ9A 5ELNA 2NZOA 3R2TA 4PQXA 1PRTF 2RCFA 1VCIA 4LF8Q 2IPKD 1F9PA 3CCLA 2TSSA 1WTHA 2I46A 2XN9C 5AJ3Q 5BR8Q 2UUCQ 2XTIA 4ZLTF 1S72A 2PI2E 2UXDQ 3KJOA 3D4DA 4PMCA 1PH1A 2QDBA 3ER0A 1WCMB 5JEAJ 1K83B 3J80i 3M85A 1SFOH 1H9SB 2ZT9C 1K8AC 2PZTA 3SK5A 4R4OA 4BBSG 1SNQA 4V0BA 1Y14B 5EKKA 3X3MA 2E5LL 4WJ3M 2MQHA 3HOZB 3D6WA 5EPLA 1CM9A 2PPBC 4L5SA 1B2TA 4DV5L 3ULPA 2F0GA 3FKIG 4KD3A 1XNQQ 4K6DA 2PW5A 1DOKA 2EPBA 4XYQA 3B6YA 4A3FG 3ZJYC 1YHAA 1KQSA 4BXXG 4DV7Q 1NNXA 4PNYA 5J39A 3H3VC 5M5YB 1VQGA 2RSNA 3Q8DA 2HDMA 3MHBA 2LXKA 1V8QA 1PH7A 2JN4A 4R8IA 5C4XB 5IODA 2Z1CA 2J7ZA 2UUBQ 4IN3A 3AU7A 5FKAC 4X66L 2XIWA 1GVPA 3K7AB 4LFCL 3MA2B 3CW2C 1B50A 3TP8A 4C3IH 5IGFA 4LF9L 2AMCB 4WJWA 3HOZG 2R93H 1BBXC 1V1PA 1A2TA 3G7LA 2Q2IA 4GKJL 2HIVA 3UE1A 1YJ9A 3KLWA 5CBAE 2ALYB 2I5HA 2N78A 1IBML 3RZDH 4ZYSA 2X69A 5HY6A 3FDTA 4DR1Q 1KRSA 1I6HB 1B53A 3DHQA 5LMNL 4XQJA 3NSWA 1SBBB 1EZ6A 1YNXA 1WI5A 1D5MC 2HQLA 1Q81C 2K5VA 2JYOA 1AE2A 4QUFA 4WRDA 4JG2A 2ENBA 3CPFA 4YHHL 1S40A 4C3HB 1WFQA 1TY0A 1G6PA 3GD7A 1PZJD 1PFMA 2F0IA 5LMUL 3E6ZX 2EYPA 1PTOF 1EQQA 1V1PB 5JJLA 1Q86C 1VQBA 1I4HA 1AZPA 2DJFC 2L55A 3NBIA 3N6RA 4C1NI 5C3EH 1E2WA 4RMFA 1G8ZD 4ILWA 4RCOA 1U4RA 5G3LD 1XMOL 1AN8A 3D4RA 2JE6I 4N9TA 1EWHA 5I9OA 4C3JH 5C44B 4KI0A 1R9TH 1YJNA 5EGTA 2NZHA 2D0PA 3RLFA 2UUCL 1AFPA 3HOUB 2B63H 1KXLA 1SRUA 3CHBD 4BBRG 5TSSA 2ID0A 2RQXA 1VQIA 2E8GA 2RA4A 4I65A 4G7ZC 1A2UA 3MEFA 3CF5A 1E0BA 3UI2A 1PHJA 2E2JH 2CVRA 5IYBH 4KHPL 4PMWA 4H44C 1GUTA 5JEAH 5M3FG 1H9JA 4XT1B 1J5EL 2JJQA 1LT6D 3SEBA 3I56A 4IUQA 4Y7NH 4C2MB 4RH6A 2Y0SE 1K73C 2F3WA 1VF7A 1PRTD 1VQDA 3NELA 1I50H 2V4DA 3WOFA 5KEEA 3CC2A 2F0KA 2MP1A 4DF7A 2KHIA 3U4VA 1HNZL 5CBEE 2PZWA 4ZQ3A 3BVZA 2B2WC 4DAYA 5CV4A 2CHBD 1IHZA 4XDXA 5HGTA 3T1YQ 2DN8A 5JAVA 2QW7A 4YCVA 4NXNQ 3Q24A 5IIFA 4DR3L 4ALPA 3HOUG 4R4IA 4XXEA 4CKEA 5DAUA 3HFZB 1HZ9A 3J81i 4JBJA 2NTTA 1B70B 1EFID 4A3DB 3S1RH 5I2XA 4QB4A 1JT8A 3TSSA 1YBYA 2NN6I 4AYBE 3E5SA 3S9WA 1F2LA 4F87A 4GKKQ 4WJ4A 2CH4A 1SE4A 1S5CD 1SJED 2EE1A 4B3RQ 2CFMA 1VMCA 2OQKA 4RG1A 2D0OA 3KLRA 4A93B 3PO2G 2B2UC 3RUZA 1XJVA 1CA6A 2BH8A 4YY3Q 1O7YA 1JICA 1S3OA 2JA8G 3D0FA 3ERQA 4IUTA 5I6WA 1KD1C 5GAEC 3HOWH 4FVMA 3HKZG 2B39A 4DN4M 4YCUA 1G2SA 5E1FA 1IBKL 3VR5A 4LF5L 4DR2Q 4ZKBB 3MFGA 2MPMA 2CCZA 1DZ1A 2J4XA 2CW0C 3TBIB 4OO1I 3F2BA 2ZJQA 3L9AX 4QJFA 3VYSA 5I9PA 1ILPA 4XIGS 5D3IB 5K36G 5A2QL 3GDEA 4YIJA 2F52A 5IWAQ 4A3GH 4ULLA 2ZTDA 4B9WA 2UXCL 5IYDH 4X65Q 1YNND 1SNDA 1NAPA 5LL6S 3NEMA 4JI4Q 1I4QA 5ELCA 3F2CA 1ASYA 1XMQQ 2HT1A 1PH4A 3A56A 2PMZE 4JI5Q 4ZK9B 1IZ6A 3OOCA 1HH2P 4CGYB 5HGQA 3GTJH 2JA5G 4HAEA 4R4QA 4H7BA 4BBSH 1N36L 3CRLC 3J7A5 1G291 1PTOD 1TS4A 5FLMG 4RGMA 2MGSA 3NUCA 2JA6B 1Y8OB 4DV6Q 1SJHD 4JOIA 2EOTA 2IL8A 3FKIH 2LSSA 3CQZH 3QG1A 4KJNA 4APVA 3PUXA 1D5XC 4KN4C 3RMHA 2K5WA 1N34L 2Q2UA 3SDZA 1H9RA 4FXGC 1HTPA 3OYYA 4BY1G 4DV4L 4BXXH 2A69C 2RDHA 5IT9E 1TU2B 1EUJA 2K32A 1HHVA 3S1QH 3R2IA 4L63B 4A3EB 1C0AA 3OIQA 2EYLA 2QF7A 3TMEA 3T1YL 5IYCH 1R4PB 2F3VA 1E3PA 2ZTEA 3AFQA 3BZDB 4NXNL 4DV2L 3CC4A 5BN4A 3KK7A 4DUYQ 1GD7A 1N8RC 4JI2Q 2K52A 4DV0Q 3CCQA 2K5QA 1HPCA 1VDZA 4HIDA 2HHHL 1MSGA 1HZBA 2UUAL 4L5TA 3J7ZC 1JMCA 5D14A 2Z6KC 1CQFA 2XSCA 3U50C 4K5VA 2NVQB 4A3KG 4X64Q 4FF1A 4GKKL 1HNWQ 1Q90A 1XNRL 1EY8A 4XYOA 5E7NA 4OWTB 1SAPA 1RCVD 1EQTA 4DUZQ 2B2TC 1S5DD 4A3IG 4FNFA 5L37A 3I70A 3HOYB 1LYLA 3H94A 1PZID 2V1CC 2VUMG 2VQEL 5DLQE 1QVGA 1WTWA 4A3EG 2Z6BA 1C8CA 2AWOA 3I4MH 1YHBA 3SE0A 2F0PA 4DK3C 1JE5A 3I72A 5IGBA 4IO9A 4Q5VA 3IAYA 1AE3A 4GZYC 4N9PA 1DYQA 1HR0Q 4JVZA 2K1BA 4IUNA 1F2YA 3PMFA 2JSOA 4DR2L 5FO7B 3CU7A 1AW7A 1SE8A 3H91A 3S1NH 1KDBA 2ZJPA 5EAYA 2K04A 3FP9A 5IT9c 4BY7B 4YCWA 3GTGB 1OXSC 1TS3A 4C3JB 4K2KA 1EOTA 3A8IE 3T56B 1R9TB 4IQZA 1ENCA 2N49A 4BBRH 1B4OA 1EEID 2NWGA 1WJJA 2XRSD 4JI0L 2BH2A 1EY0A 2OF1A 1CK1A 1YHQA 3P1HA 2WP8J 2SDFA 4DGZA 5M3FH 2E2JB 4KKTA 3ZYYX 2ZM6Q 3FHWA 1YJWA 4DNIA 3GTOH 3I4NB 2XRQD 4LF7L 2K05A 4DV3L 2BA0A 4HIMA 2BCOA 2G9DA 3A8KE 2NVXH 4DR4Q 1X56A 5CYUA 1L0WA 1I50B 1KLGD
chains in the Genus database with same CATH topology
3ER0A 1YIJA 5JEAJ 3CCRA 2UXDL 3J80i 3M85A 4DR5L 4HJ7A 3RN2A 1SFOH 1VQNA 2F4VQ 1CUKA 4DR7Q 2UXBL 1K8AC 1E7ZA 3WWVA 1NMFA 4A3FH 4JCVE 2VS1A 1Q7YC 2I5MX 2E5LQ 2K50A 1EQRA 4R4OA 3TQYA 2OCEA 3I4NH 4BBSG 2KENA 1QVFA 1J6QA 1Y14B 1PFSA 3PF5A 2E5LL 4A3BG 4WJ3M 2MQHA 4AQYQ 2OTLA 2WAQG 3AEVA 3A5ZB 3T1HQ 1NY4A 5JJIA 4L5SA 4DV5L 3ULPA 4HIKA 1VQKA 3KDFB 3HOXG 4MNOA 1E1OA 1WCMH 3FKIG 1Q8KA 1XNQQ 1ASZA 1TWAH 2YYZA 1IXRA 2GVBA 4B3MQ 1TWHH 2L15A 3B6YA 3ZJYC 1YHAA 4GOPB 4A3FG 1KQSA 1XNQL 4NPSA 2ASBA 4BXXG 4DV7Q 1GO3E 1CSPA 4A3JH 1LUZA 5JJKA 4B3ML 2CQOA 3PUZA 2IX1A 3GTPH 3HOZH 3E9IA 4GNXB 1IL2A 3KF8B 1VQGA 4DV7L 4UP9A 2MNAA 4JI2L 2JA6G 3Q8DA 2MO1A 2KHJA 2LXKA 2OWOA 3M7NA 4PZ6A 4DR6L 1LTLA 4X66Q 4K0KQ 2N3SA 1PH7A 1VQ9A 4GN5A 1KAWA 3PSIA 1TWCH 1P8LA 3G71A 3CPWA 2UUBQ 4LFCQ 1X65A 2AKWB 1H95A 3PIPA 1NE3A 1U5KA 4X66L 2F3IA 3TS2A 4K0KL 1Y1WG 1FL0A 1IYJB 1GVPA 3U58A 3UDGA 3PO2H 2IX0A 4LFCL 2QEXA 2UUBL 4X64L 1K8GA 3DLLA 1HZCA 1PYBA 3G4SA 1UWVA 3CW2C 3CCJA 2JA8H 5C0XJ 4C3IH 1PV4A 4LF9L 4YWMA 1EFWA 2VNUD 4Y52H 1LM0A 2AMCB 5M5YH 4DUZL 1EYGA 2A1AA 1EIYB 3HOZG 1VQJA 2R93H 1IBMQ 4FDBA 1E22A 1V43A 2Q2IA 4GKJL 2HIVA 4O0AA 3UE1A 3CP0A 1YJ9A 4LF6Q 5GQOA 1XPUA 3KLWA 2ALYB 2CKZB 5IP9G 2I5HA 2N78A 1IBML 3RZDH 5LMNQ 5HY6A 4HIOA 2IHFA 4DAYB 1KRSA 4DR1Q 4QY7A 2K75A 2PNHA 4XTCS 3K7AH 1VQEA 2E2IH 5LMNL 4DR1L 1YNXA 1WI5A 2HQLA 2WB1E 4JOIC 1L2FA 1Q81C 2DGYA 3KYHC 1Q1BA 4YHHQ 2K5VA 3A0JA 1AE2A 4B3SQ 3GTMH 3H15A 3U4ZA 1DGSA 3M4OH 4JG2A 3TRZA 3PUVA 1PA6A 1Q46A 3CPFA 4YHHL 1I3QH 2OQ0A 1S40A 1WFQA 1G6PA 4A3MG 4B3SL 3GTOH 3GD7A 1L1OC 4JV5Q 1Q82C 3I7FA 5LMUL 3NENA 4JI1Q 3S15H 3STBD 2GVAA 4HJ9A 2RF4A 5M5WH 4HJAA 1N9WA 1EQQA 4JV5L 5JJLA 3CMAA 1Q86C 2VL6A 1VQBA 2N8NA 4L5RC 1A0IA 4JI1L 4J15A 3HOYG 2RHSB 1XMOQ 3KDFA 5LMNW 5C3EH 4IPCA 2JA5H 1XPRA 1X3FA 1VQ6A 2Z6KA 1Q12A 4RMFA 5J3BA 4BA1I 3E0EA 1XMOL 3GTKH 4PG3A 2MO0A 4C3HH 3F1ZA 2R7DA 4IPHA 2JE6I 5FLMH 4LW1A 3RLOA 4TVAB 1QUQA 5GADC 4C3JH 3RZOH 2JEBI 3W1GA 4KI0A 3PO3H 1R9TH 1YJNA 2NZHA 2D0PA 3M4PA 2ZM6L 3RLFA 1VQAA 2UUCL 3PGZA 1QZGA 3PIOA 1GM5A 4GNXA 2B63H 1KXLA 1SRUA 4BBRG 2GN5A 2ID0A 1WYDA 1VQIA 2E8GA 2WB1G 3LGJA 4JI6Q 3CD6A 1XPOA 4DR4L 4KHPQ 3BZCA 4LUOA 4DKAC 3G6EA 3PCOB 3MEFA 2I0QA 3CF5A 5C3EG 4GN3B 1J5EQ 2Q2TA 4P74A 1K3RA 1PH3A 1PHJA 2E2JH 5IYBH 1KC8C 4PMWA 4KHPL 2F4VL 4TQUS 5M3FG 5M3MH 4DR7L 1J5EL 3BZKA 4BY7G 2JJQA 5C44H 1VQFA 3I56A 4Y7NH 4ME3A 1V9PA 2Y0SE 1W2BA 1K73C 3GTLH 3PO3G 3RN5A 4AIMA 1VQ5A 1HNXQ 3HOUH 1VQDA 1UEBA 3CAMA 3NELA 4P73A 1HNZQ 1I50H 4AQYL 3S1MH 5IP7H 3CC2A 3PF4A 4P72A 1K83H 1EOVA 3T1HL 1HNXL 3GTQH 2KHIA 3U4VA 4DK6C 2NN6G 4DPGA 1HNZL 3I55A 1RIPA 5H1SE 1YITA 1BVSA 1YVCA 3CMEA 3OTOQ 1XTDA 1QUQB 4PZ8A 3IRBA 1VQMA 1L1OA 4DR3Q 3HKSA 4JC0A 5JEAG 1M90C 1E24A 3T1YQ 3I4NG 1A63A 4MTNA 4QL5A 3OTOL 1UE6A 2EQSA 2DUDA 4YCVA 3H3VH 4NXNQ 4POGA 4DR3L 4NB3A 4ALPA 3TEHB 3S16H 4IFDI 3HOUG 2KCMA 2JEAI 1M1KC 4R4IA 3HKZE 1SR3A 4A3KH 1X6OA 3S24A 1WCMG 3AQQA 3KF6B 5IP7G 1HZAA 4HJ8A 3HFZB 3J80c 3GO5A 1CKMA 1HZ9A 3J81i 2QGQA 4JBJA 4H02A 5FJ8H 2ZTCA 2K4KA 4A3IH 1B70B 3ULJA 1TXYA 3S1RH 3NBHB 4POFA 1EWIA 4A3JG 4JBKA 1JT8A 1UE7A 2R7ZH 2VUMH 1YBYA 2NN6I 4IJLA 4AYBE 4DV1Q 2Y0SG 4GKKQ 4WJ4A 1NBWA 3K80C 1QZHA 5C4XH 2B29A 2I5LX 3W1BA 4OO1G 2B3GA 4JYAQ 3M4QA 1KHIA 4B3RQ 3EIVA 2CFMA 1CSQA 2OQKA 2R7FA 4RG1A 4LF6L 2D0OA 1OXVA 4UP7A 1L1OB 3RLNA 4JYAL 3JC66 4HJ5A 2KBNA 3PO2G 4B3RL 3DM3A 1TWGH 1XJVA 1O7IA 2BH8A 4JI8Q 4YY3Q 1VQ7A 2IT1A 1S3OA 3M9BA 3D0FA 4UP8A 2JA8G 1NJIC 3MXNB 2R7ZG 3F2DA 1KD1C 5GAEC 4YY3L 3HOWH 4BA2I 2R93G 1VQLA 1C9OA 2JA9A 3JAMi 1VQ4A 1IBKQ 3HKZG 1OTCA 4LF5Q 5C4XG 3SGIA 3AFPA 4GN4B 3EBEA 4LF4Q 4LUVA 4YCUA 1I6HH 1RL2A 1IBKL 3G48A 4LF5L 4A93H 3H3VI 4DR2Q 1KIXA 4QIWE 1X55A 2CCZA 4LFBQ 4LWCA 4OWWB 4OO1I 3F2BA 4EQ5A 2ZJQA 3UE0A 4OWXB 4LFBL 4AYBG 4QJFA 1VS0A 4GLXA 2QA4A 4OX9Q 1V1QA 1YEZA 1Z9FA 4XIGS 2UXCQ 5K36G 2JK8A 1I94Q 1KL9A 2ZJRA 2C35B 4OXPA 3GDEA 3L0OA 4YWLA 2F52A 4P71A 5IWAQ 2NVYH 4OX9L 4A3GH 2NVTH 1I5FA 2ZTDA 2K5HA 2UXCL 3S2HH 1I94L 5IYDH 1MKHA 1MJCA 4A3CH 4X65Q 3H0GH 5IWAL 5IY0A 3HOVH 1EIFA 3NEMA 4JI4Q 5C0XI 1PVOA 3F2CA 1ASYA 2HT1A 4X65L 1XMQQ 2R92H 1PH4A 1SROA 4QQBX 3CCSA 2PQAB 4JI4L 4IOAA 2PMZE 1N36Q 4JI5Q 4JI3Q 1IZ6A 3GTJH 1HH2P 5HGQA 1XMQL 1PH6A 2JA5G 4BY1H 3KF6A 4JBMA 4A3LH 4IFDG 2HIXA 4R4QA 4JI6L 1PH2A 4BBSH 1N36L 1UE5A 4JI5L 2Z0SA 1QVCA 2Q2HA 1G291 4UPAA 4JI3L 1JJ2A 3J7A5 4OONA 4A3BH 4A3GG 5FLMG 4IPDA 1X3EA 1K9MC 5IYDG 3A74A 1Q1EA 1CKNB 3H0GG 3OW2A 3S17H 2WFWA 4DV6Q 3KJPA 2UXBQ 3HOXH 1JJGA 4JOIA 1FVIA 2LSSA 3CQZH 3D31A 1OXXK 2RCNA 3FKIH 1T9HA 5FLXc 1N34Q 4APVA 2B63G 2R92G 4DV4Q 4L5QA 3PUXA 4DV6L 3M3YH 5C4JH 4IOCA 1MIUA 4KHZA 4P75A 1OXUA 3KOJA 5GAHC 1G51A 1N34L 2Q2UA 3S2DH 4A3LG 4BY1G 1W3SA 3OYYA 4LUZA 4DV4L 4BXXH 3E9HA 3ERSX 4JBWA 1VQHA 4AH6A 4KLKA 5IYBG 4R4CA 1EUJA 5M3MG 1X9NA 4UY8C 4EX5A 2IY5B 3K81C 4DV5Q 1UE1A 4C2MH 5C44G 3S1QH 2JA6H 3L7ZC 2H5XA 1Y1VH 4DV2Q 4R1JA 1C0AA 3TREA 4LFAQ 1CKOA 2YTYA 5GAGC 3T1YL 5IYCH 1SN8A 1BKBA 3S14H 1E3PA 2ZTEA 1N32Q 2LXJA 3AFQA 4NXNL 4DV2L 3I4OA 3L2PA 3F8TA 1NMGA 4LFAL 4A76A 2R6GA 1Y1WH 3CC4A 1FGUA 1SLJA 3STBC 1N32L 3K8AA 4DUYQ 1GD7A 1N8RC 2CWPA 2HHHQ 4JI2Q 2OTJA 2K52A 1JB7A 4DV0Q 5GROA 2UUAQ 4NXMQ 4IPGA 3CCQA 4DUYL 4DR6Q 3K7UC 1PH9A 4HIDA 2HHHL 2JA7H 1GKHA 4A3EH 1HZBA 3CCUA 4NXML 4DV0L 2UUAL 4L5TA 1Y1VG 3UDFA 3W5OA 4PZ7A 3J7ZC 1JMCA 3RNUA 1XNRQ 1SMXA 1C7YA 3PV0A 5IYCG 3EN2A 5IP9H 2Z6KC 2UU9Q 2ATWA 4A4IA 3U50C 4DV1L 2VW9A 4X64Q 4A3KG 4GKKL 3I2ZA 1HNWQ 1XNRL 5E7NA 3PUYA 4OWTB 2UU9L 4GOPC 4LF9Q 2D62A 3CCVA 5FJ8G 4DUZQ 1HNWL 2BA1A 2VQEQ 4A3IG 4A3DH 1K0RA 2YV5A 1JJCB 3CCEA 3AYHB 1D7QA 1OXTA 4GKJQ 4GNXC 1LYLA 3K0XA 4YWKA 2V1CC 2VUMG 2VQEL 3A5UA 5DLQE 1QVGA 2JA7G 1E1TA 4A75A 4A3EG 2KCTA 4JI8L 3TS0A 1VQCA 2AWOA 2VQFQ 2PQAA 2EIFA 3I4MH 1N33Q 3BJUA 5C0XG 2NVQH 1FJGQ 1YHBA 3RR5A 4DK3C 4IO9A 1JE5A 4A3MH 4X6AH 2VQFL 1N33L 4X62Q 3VDYA 1AE3A 3CCMA 1FJGL 1HR0Q 1D8LA 3J81c 4LF4L 3J81j 4QGUA 1A8VA 1TWFH 1BBWA 1PYSB 1NTGA 1YI2A 4GS3A 2K5NA 4X62L 4LNQA 1VQOA 4GLAC 4A3DG 3HOYH 1HR0L 1CKNA 4DR2L 4GLVB 2PI2A 4O2DA 1HJPA 2ES2A 1VQ8A 2CWAA 2EXDA 1SE8A 3HOWG 1PH5A 3S1NH 1YZ6A 3I4MG 1X3GA 3PUWA 2ZJPA 1B8AA 1P16A 5EAYA 1Z47A 5LMUQ 3FP9A 2A8VA 1VQPA 5IT9c 4YCWA 1OXSC 3UDXA 1X54A 2YU9H 2WAQE 2A19A 3ULLA 2AWNA 3KFUA 4IJHA 4A93G 1AH9A 2VZAA 4JI7Q 4JI0Q 1PH8A 2RHQB 2N49A 4BBRH 5ELOA 1BBUA 4DAMA 2VY3A 2XGTA 4IFDJ 3ICEA 4JI7L 1WJJA 4JI0L 2BH2A 3BU2A 1YHQA 2JQOA 4MZ9A 5ELNA 3CC7A 2NZOA 1B7YB 2IHEA 2WP8J 1IBLQ 5M5XH 2YTVA 1VCIA 4LF7Q 2FXQA 4DV3Q 4LF8Q 3JAMc 5M3FH 1HR0W 3CCLA 4BY7H 3GTGH 2ZM6Q 1U0LA 3FHWA 1YJWA 4DNIA 5BR8Q 5AJ3Q 2K14A 4GOPA 1IBLL 2YTXA 2UUCQ 4B3TQ 4LF8L 4LF7L 4DV3L 2XTIA 2BA0A 4HIMA 1WOCA 3UDIA 1MJEA 4A3CG 1S72A 2NVXH 5AJ3L 2PI2E 5BR8L 4DR4Q 3HOVG 1KRTA 1X56A 4B3TL 1L0WA 3KJOA 4DR5Q 2UXDQ 1PH1A 2AHOB 2MFIA 1A62A 4R4TA 2E2HH 5IE8A 3CXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER0 A;  1YIJ A;  5JEA J;  3CCR A;  2UXD L;  3J80 i;  3M85 A;  4DR5 L;  4HJ7 A;  3RN2 A;  1SFO H;  1VQN A;  2F4V Q;  1CUK A;  4DR7 Q;  2UXB L;  1K8A C;  1E7Z A;  3WWV A;  1NMF A;  4A3F H;  4JCV E;  2VS1 A;  1Q7Y C;  2I5M X;  2E5L Q;  2K50 A;  1EQR A;  4R4O A;  3TQY A;  2OCE A;  3I4N H;  4BBS G;  2KEN A;  1QVF A;  1J6Q A;  1Y14 B;  1PFS A;  3PF5 A;  2E5L L;  4A3B G;  4WJ3 M;  2MQH A;  4AQY Q;  2OTL A;  2WAQ G;  3AEV A;  3A5Z B;  3T1H Q;  1NY4 A;  5JJI A;  4L5S A;  4DV5 L;  3ULP A;  4HIK A;  1VQK A;  3KDF B;  3HOX G;  4MNO A;  1E1O A;  1WCM H;  3FKI G;  1Q8K A;  1XNQ Q;  1ASZ A;  1TWA H;  2YYZ A;  1IXR A;  2GVB A;  4B3M Q;  1TWH H;  2L15 A;  3B6Y A;  3ZJY C;  1YHA A;  4GOP B;  4A3F G;  1KQS A;  1XNQ L;  4NPS A;  2ASB A;  4BXX G;  4DV7 Q;  1GO3 E;  1CSP A;  4A3J H;  1LUZ A;  5JJK A;  4B3M L;  2CQO A;  3PUZ A;  2IX1 A;  3GTP H;  3HOZ H;  3E9I A;  4GNX B;  1IL2 A;  3KF8 B;  1VQG A;  4DV7 L;  4UP9 A;  2MNA A;  4JI2 L;  2JA6 G;  3Q8D A;  2MO1 A;  2KHJ A;  2LXK A;  2OWO A;  3M7N A;  4PZ6 A;  4DR6 L;  1LTL A;  4X66 Q;  4K0K Q;  2N3S A;  1PH7 A;  1VQ9 A;  4GN5 A;  1KAW A;  3PSI A;  1TWC H;  1P8L A;  3G71 A;  3CPW A;  2UUB Q;  4LFC Q;  1X65 A;  2AKW B;  1H95 A;  3PIP A;  1NE3 A;  1U5K A;  4X66 L;  2F3I A;  3TS2 A;  4K0K L;  1Y1W G;  1FL0 A;  1IYJ B;  1GVP A;  3U58 A;  3UDG A;  3PO2 H;  2IX0 A;  4LFC L;  2QEX A;  2UUB L;  4X64 L;  1K8G A;  3DLL A;  1HZC A;  1PYB A;  3G4S A;  1UWV A;  3CW2 C;  3CCJ A;  2JA8 H;  5C0X J;  4C3I H;  1PV4 A;  4LF9 L;  4YWM A;  1EFW A;  2VNU D;  4Y52 H;  1LM0 A;  2AMC B;  5M5Y H;  4DUZ L;  1EYG A;  2A1A A;  1EIY B;  3HOZ G;  1VQJ A;  2R93 H;  1IBM Q;  4FDB A;  1E22 A;  1V43 A;  2Q2I A;  4GKJ L;  2HIV A;  4O0A A;  3UE1 A;  3CP0 A;  1YJ9 A;  4LF6 Q;  5GQO A;  1XPU A;  3KLW A;  2ALY B;  2CKZ B;  5IP9 G;  2I5H A;  2N78 A;  1IBM L;  3RZD H;  5LMN Q;  5HY6 A;  4HIO A;  2IHF A;  4DAY B;  1KRS A;  4DR1 Q;  4QY7 A;  2K75 A;  2PNH A;  4XTC S;  3K7A H;  1VQE A;  2E2I H;  5LMN L;  4DR1 L;  1YNX A;  1WI5 A;  2HQL A;  2WB1 E;  4JOI C;  1L2F A;  1Q81 C;  2DGY A;  3KYH C;  1Q1B A;  4YHH Q;  2K5V A;  3A0J A;  1AE2 A;  4B3S Q;  3GTM H;  3H15 A;  3U4Z A;  1DGS A;  3M4O H;  4JG2 A;  3TRZ A;  3PUV A;  1PA6 A;  1Q46 A;  3CPF A;  4YHH L;  1I3Q H;  2OQ0 A;  1S40 A;  1WFQ A;  1G6P A;  4A3M G;  4B3S L;  3GTO H;  3GD7 A;  1L1O C;  4JV5 Q;  1Q82 C;  3I7F A;  5LMU L;  3NEN A;  4JI1 Q;  3S15 H;  3STB D;  2GVA A;  4HJ9 A;  2RF4 A;  5M5W H;  4HJA A;  1N9W A;  1EQQ A;  4JV5 L;  5JJL A;  3CMA A;  1Q86 C;  2VL6 A;  1VQB A;  2N8N A;  4L5R C;  1A0I A;  4JI1 L;  4J15 A;  3HOY G;  2RHS B;  1XMO Q;  3KDF A;  5LMN W;  5C3E H;  4IPC A;  2JA5 H;  1XPR A;  1X3F A;  1VQ6 A;  2Z6K A;  1Q12 A;  4RMF A;  5J3B A;  4BA1 I;  3E0E A;  1XMO L;  3GTK H;  4PG3 A;  2MO0 A;  4C3H H;  3F1Z A;  2R7D A;  4IPH A;  2JE6 I;  5FLM H;  4LW1 A;  3RLO A;  4TVA B;  1QUQ A;  5GAD C;  4C3J H;  3RZO H;  2JEB I;  3W1G A;  4KI0 A;  3PO3 H;  1R9T H;  1YJN A;  2NZH A;  2D0P A;  3M4P A;  2ZM6 L;  3RLF A;  1VQA A;  2UUC L;  3PGZ A;  1QZG A;  3PIO A;  1GM5 A;  4GNX A;  2B63 H;  1KXL A;  1SRU A;  4BBR G;  2GN5 A;  2ID0 A;  1WYD A;  1VQI A;  2E8G A;  2WB1 G;  3LGJ A;  4JI6 Q;  3CD6 A;  1XPO A;  4DR4 L;  4KHP Q;  3BZC A;  4LUO A;  4DKA C;  3G6E A;  3PCO B;  3MEF A;  2I0Q A;  3CF5 A;  5C3E G;  4GN3 B;  1J5E Q;  2Q2T A;  4P74 A;  1K3R A;  1PH3 A;  1PHJ A;  2E2J H;  5IYB H;  1KC8 C;  4PMW A;  4KHP L;  2F4V L;  4TQU S;  5M3F G;  5M3M H;  4DR7 L;  1J5E L;  3BZK A;  4BY7 G;  2JJQ A;  5C44 H;  1VQF A;  3I56 A;  4Y7N H;  4ME3 A;  1V9P A;  2Y0S E;  1W2B A;  1K73 C;  3GTL H;  3PO3 G;  3RN5 A;  4AIM A;  1VQ5 A;  1HNX Q;  3HOU H;  1VQD A;  1UEB A;  3CAM A;  3NEL A;  4P73 A;  1HNZ Q;  1I50 H;  4AQY L;  3S1M H;  5IP7 H;  3CC2 A;  3PF4 A;  4P72 A;  1K83 H;  1EOV A;  3T1H L;  1HNX L;  3GTQ H;  2KHI A;  3U4V A;  4DK6 C;  2NN6 G;  4DPG A;  1HNZ L;  3I55 A;  1RIP A;  5H1S E;  1YIT A;  1BVS A;  1YVC A;  3CME A;  3OTO Q;  1XTD A;  1QUQ B;  4PZ8 A;  3IRB A;  1VQM A;  1L1O A;  4DR3 Q;  3HKS A;  4JC0 A;  5JEA G;  1M90 C;  1E24 A;  3T1Y Q;  3I4N G;  1A63 A;  4MTN A;  4QL5 A;  3OTO L;  1UE6 A;  2EQS A;  2DUD A;  4YCV A;  3H3V H;  4NXN Q;  4POG A;  4DR3 L;  4NB3 A;  4ALP A;  3TEH B;  3S16 H;  4IFD I;  3HOU G;  2KCM A;  2JEA I;  1M1K C;  4R4I A;  3HKZ E;  1SR3 A;  4A3K H;  1X6O A;  3S24 A;  1WCM G;  3AQQ A;  3KF6 B;  5IP7 G;  1HZA A;  4HJ8 A;  3HFZ B;  3J80 c;  3GO5 A;  1CKM A;  1HZ9 A;  3J81 i;  2QGQ A;  4JBJ A;  4H02 A;  5FJ8 H;  2ZTC A;  2K4K A;  4A3I H;  1B70 B;  3ULJ A;  1TXY A;  3S1R H;  3NBH B;  4POF A;  1EWI A;  4A3J G;  4JBK A;  1JT8 A;  1UE7 A;  2R7Z H;  2VUM H;  1YBY A;  2NN6 I;  4IJL A;  4AYB E;  4DV1 Q;  2Y0S G;  4GKK Q;  4WJ4 A;  1NBW A;  3K80 C;  1QZH A;  5C4X H;  2B29 A;  2I5L X;  3W1B A;  4OO1 G;  2B3G A;  4JYA Q;  3M4Q A;  1KHI A;  4B3R Q;  3EIV A;  2CFM A;  1CSQ A;  2OQK A;  2R7F A;  4RG1 A;  4LF6 L;  2D0O A;  1OXV A;  4UP7 A;  1L1O B;  3RLN A;  4JYA L;  3JC6 6;  4HJ5 A;  2KBN A;  3PO2 G;  4B3R L;  3DM3 A;  1TWG H;  1XJV A;  1O7I A;  2BH8 A;  4JI8 Q;  4YY3 Q;  1VQ7 A;  2IT1 A;  1S3O A;  3M9B A;  3D0F A;  4UP8 A;  2JA8 G;  1NJI C;  3MXN B;  2R7Z G;  3F2D A;  1KD1 C;  5GAE C;  4YY3 L;  3HOW H;  4BA2 I;  2R93 G;  1VQL A;  1C9O A;  2JA9 A;  3JAM i;  1VQ4 A;  1IBK Q;  3HKZ G;  1OTC A;  4LF5 Q;  5C4X G;  3SGI A;  3AFP A;  4GN4 B;  3EBE A;  4LF4 Q;  4LUV A;  4YCU A;  1I6H H;  1RL2 A;  1IBK L;  3G48 A;  4LF5 L;  4A93 H;  3H3V I;  4DR2 Q;  1KIX A;  4QIW E;  1X55 A;  2CCZ A;  4LFB Q;  4LWC A;  4OWW B;  4OO1 I;  3F2B A;  4EQ5 A;  2ZJQ A;  3UE0 A;  4OWX B;  4LFB L;  4AYB G;  4QJF A;  1VS0 A;  4GLX A;  2QA4 A;  4OX9 Q;  1V1Q A;  1YEZ A;  1Z9F A;  4XIG S;  2UXC Q;  5K36 G;  2JK8 A;  1I94 Q;  1KL9 A;  2ZJR A;  2C35 B;  4OXP A;  3GDE A;  3L0O A;  4YWL A;  2F52 A;  4P71 A;  5IWA Q;  2NVY H;  4OX9 L;  4A3G H;  2NVT H;  1I5F A;  2ZTD A;  2K5H A;  2UXC L;  3S2H H;  1I94 L;  5IYD H;  1MKH A;  1MJC A;  4A3C H;  4X65 Q;  3H0G H;  5IWA L;  5IY0 A;  3HOV H;  1EIF A;  3NEM A;  4JI4 Q;  5C0X I;  1PVO A;  3F2C A;  1ASY A;  2HT1 A;  4X65 L;  1XMQ Q;  2R92 H;  1PH4 A;  1SRO A;  4QQB X;  3CCS A;  2PQA B;  4JI4 L;  4IOA A;  2PMZ E;  1N36 Q;  4JI5 Q;  4JI3 Q;  1IZ6 A;  3GTJ H;  1HH2 P;  5HGQ A;  1XMQ L;  1PH6 A;  2JA5 G;  4BY1 H;  3KF6 A;  4JBM A;  4A3L H;  4IFD G;  2HIX A;  4R4Q A;  4JI6 L;  1PH2 A;  4BBS H;  1N36 L;  1UE5 A;  4JI5 L;  2Z0S A;  1QVC A;  2Q2H A;  1G29 1;  4UPA A;  4JI3 L;  1JJ2 A;  3J7A 5;  4OON A;  4A3B H;  4A3G G;  5FLM G;  4IPD A;  1X3E A;  1K9M C;  5IYD G;  3A74 A;  1Q1E A;  1CKN B;  3H0G G;  3OW2 A;  3S17 H;  2WFW A;  4DV6 Q;  3KJP A;  2UXB Q;  3HOX H;  1JJG A;  4JOI A;  1FVI A;  2LSS A;  3CQZ H;  3D31 A;  1OXX K;  2RCN A;  3FKI H;  1T9H A;  5FLX c;  1N34 Q;  4APV A;  2B63 G;  2R92 G;  4DV4 Q;  4L5Q A;  3PUX A;  4DV6 L;  3M3Y H;  5C4J H;  4IOC A;  1MIU A;  4KHZ A;  4P75 A;  1OXU A;  3KOJ A;  5GAH C;  1G51 A;  1N34 L;  2Q2U A;  3S2D H;  4A3L G;  4BY1 G;  1W3S A;  3OYY A;  4LUZ A;  4DV4 L;  4BXX H;  3E9H A;  3ERS X;  4JBW A;  1VQH A;  4AH6 A;  4KLK A;  5IYB G;  4R4C A;  1EUJ A;  5M3M G;  1X9N A;  4UY8 C;  4EX5 A;  2IY5 B;  3K81 C;  4DV5 Q;  1UE1 A;  4C2M H;  5C44 G;  3S1Q H;  2JA6 H;  3L7Z C;  2H5X A;  1Y1V H;  4DV2 Q;  4R1J A;  1C0A A;  3TRE A;  4LFA Q;  1CKO A;  2YTY A;  5GAG C;  3T1Y L;  5IYC H;  1SN8 A;  1BKB A;  3S14 H;  1E3P A;  2ZTE A;  1N32 Q;  2LXJ A;  3AFQ A;  4NXN L;  4DV2 L;  3I4O A;  3L2P A;  3F8T A;  1NMG A;  4LFA L;  4A76 A;  2R6G A;  1Y1W H;  3CC4 A;  1FGU A;  1SLJ A;  3STB C;  1N32 L;  3K8A A;  4DUY Q;  1GD7 A;  1N8R C;  2CWP A;  2HHH Q;  4JI2 Q;  2OTJ A;  2K52 A;  1JB7 A;  4DV0 Q;  5GRO A;  2UUA Q;  4NXM Q;  4IPG A;  3CCQ A;  4DUY L;  4DR6 Q;  3K7U C;  1PH9 A;  4HID A;  2HHH L;  2JA7 H;  1GKH A;  4A3E H;  1HZB A;  3CCU A;  4NXM L;  4DV0 L;  2UUA L;  4L5T A;  1Y1V G;  3UDF A;  3W5O A;  4PZ7 A;  3J7Z C;  1JMC A;  3RNU A;  1XNR Q;  1SMX A;  1C7Y A;  3PV0 A;  5IYC G;  3EN2 A;  5IP9 H;  2Z6K C;  2UU9 Q;  2ATW A;  4A4I A;  3U50 C;  4DV1 L;  2VW9 A;  4X64 Q;  4A3K G;  4GKK L;  3I2Z A;  1HNW Q;  1XNR L;  5E7N A;  3PUY A;  4OWT B;  2UU9 L;  4GOP C;  4LF9 Q;  2D62 A;  3CCV A;  5FJ8 G;  4DUZ Q;  1HNW L;  2BA1 A;  2VQE Q;  4A3I G;  4A3D H;  1K0R A;  2YV5 A;  1JJC B;  3CCE A;  3AYH B;  1D7Q A;  1OXT A;  4GKJ Q;  4GNX C;  1LYL A;  3K0X A;  4YWK A;  2V1C C;  2VUM G;  2VQE L;  3A5U A;  5DLQ E;  1QVG A;  2JA7 G;  1E1T A;  4A75 A;  4A3E G;  2KCT A;  4JI8 L;  3TS0 A;  1VQC A;  2AWO A;  2VQF Q;  2PQA A;  2EIF A;  3I4M H;  1N33 Q;  3BJU A;  5C0X G;  2NVQ H;  1FJG Q;  1YHB A;  3RR5 A;  4DK3 C;  4IO9 A;  1JE5 A;  4A3M H;  4X6A H;  2VQF L;  1N33 L;  4X62 Q;  3VDY A;  1AE3 A;  3CCM A;  1FJG L;  1HR0 Q;  1D8L A;  3J81 c;  4LF4 L;  3J81 j;  4QGU A;  1A8V A;  1TWF H;  1BBW A;  1PYS B;  1NTG A;  1YI2 A;  4GS3 A;  2K5N A;  4X62 L;  4LNQ A;  1VQO A;  4GLA C;  4A3D G;  3HOY H;  1HR0 L;  1CKN A;  4DR2 L;  4GLV B;  2PI2 A;  4O2D A;  1HJP A;  2ES2 A;  1VQ8 A;  2CWA A;  2EXD A;  1SE8 A;  3HOW G;  1PH5 A;  3S1N H;  1YZ6 A;  3I4M G;  1X3G A;  3PUW A;  2ZJP A;  1B8A A;  1P16 A;  5EAY A;  1Z47 A;  5LMU Q;  3FP9 A;  2A8V A;  1VQP A;  5IT9 c;  4YCW A;  1OXS C;  3UDX A;  1X54 A;  2YU9 H;  2WAQ E;  2A19 A;  3ULL A;  2AWN A;  3KFU A;  4IJH A;  4A93 G;  1AH9 A;  2VZA A;  4JI7 Q;  4JI0 Q;  1PH8 A;  2RHQ B;  2N49 A;  4BBR H;  5ELO A;  1BBU A;  4DAM A;  2VY3 A;  2XGT A;  4IFD J;  3ICE A;  4JI7 L;  1WJJ A;  4JI0 L;  2BH2 A;  3BU2 A;  1YHQ A;  2JQO A;  4MZ9 A;  5ELN A;  3CC7 A;  2NZO A;  1B7Y B;  2IHE A;  2WP8 J;  1IBL Q;  5M5X H;  2YTV A;  1VCI A;  4LF7 Q;  2FXQ A;  4DV3 Q;  4LF8 Q;  3JAM c;  5M3F H;  1HR0 W;  3CCL A;  4BY7 H;  3GTG H;  2ZM6 Q;  1U0L A;  3FHW A;  1YJW A;  4DNI A;  5BR8 Q;  5AJ3 Q;  2K14 A;  4GOP A;  1IBL L;  2YTX A;  2UUC Q;  4B3T Q;  4LF8 L;  4LF7 L;  4DV3 L;  2XTI A;  2BA0 A;  4HIM A;  1WOC A;  3UDI A;  1MJE A;  4A3C G;  1S72 A;  2NVX H;  5AJ3 L;  2PI2 E;  5BR8 L;  4DR4 Q;  3HOV G;  1KRT A;  1X56 A;  4B3T L;  1L0W A;  3KJO A;  4DR5 Q;  2UXD Q;  1PH1 A;  2AHO B;  2MFI A;  1A62 A;  4R4T A;  2E2H H;  5IE8 A;  3CXC A; 
#chains in the Genus database with same CATH topology
 2F0T A;  3CCR A;  4KTA A;  2F4V Q;  1HUN A;  2VB2 X;  1J9O A;  1E7Z A;  1RF2 D;  4Q0F A;  2VS1 A;  2E5L Q;  1EQR A;  4PMB A;  3TQY A;  2KEN A;  2EYH A;  1J6Q A;  4IUV A;  4A3J B;  2E75 C;  5C3W A;  1WD1 A;  3A5Z B;  4K2L A;  3NXW A;  3HOX G;  1Q8K A;  2E76 C;  3D3R A;  2EY1 A;  1TWA H;  1CQV A;  4X3K A;  1UUP A;  2ASB A;  1I4P A;  1EY5 A;  1TQO A;  1GO3 E;  5T1G A;  1ET9 A;  4B3M L;  3V96 A;  3PUZ A;  1QOH A;  3A55 A;  3GTP H;  4IUP A;  1IL2 A;  3KF8 B;  4JI2 L;  3VYR A;  2MO1 A;  2KHJ A;  2OWO A;  2PO4 A;  4X66 Q;  1HA6 A;  2N3S A;  3DXJ C;  4JPB W;  1EEF D;  1VQ9 A;  1KAW A;  3CPW A;  1TWC H;  4LFC Q;  2AKW B;  2CQA A;  1H95 A;  2F3I A;  1HCZ A;  1FL0 A;  3U58 A;  3UDG A;  3PO2 H;  2QEX A;  2Q8T A;  4X64 L;  3V05 A;  3DLL A;  3G4S A;  2L12 A;  3CCJ A;  2JA8 H;  3SR1 A;  3IKJ A;  4DUZ L;  1EIY B;  2A1A A;  1VQJ A;  1IBM Q;  2A6E D;  1O80 A;  4U68 A;  2P5Z X;  1BCP C;  1DCZ A;  1JOO A;  5GQO A;  1XPU A;  2CKZ B;  5IP9 G;  2MJ8 A;  5LMN Q;  4HIO A;  3EQL C;  1HFN A;  4QY7 A;  1JB3 A;  1K3B C;  2PNH A;  1JR0 D;  2B2V C;  2AQ3 B;  1VQE A;  4F7X A;  2E2I H;  3GV3 A;  2A5H A;  3NQT A;  3G6J B;  5M5W B;  2F4I A;  4F8M A;  2DGY A;  4YHH Q;  3A0J A;  1JOQ A;  5K36 H;  1DON A;  5JVG 3;  3NTI A;  3U9O A;  1H9S A;  2EYO A;  3M4O H;  3TRZ A;  3PUV A;  2ZXR A;  1EY7 A;  4A3G B;  4KY5 A;  1L1O C;  1R4Q B;  4JK1 C;  1Q82 C;  3PO3 B;  4QIW B;  1GUS A;  3NEN A;  4DK0 A;  3S15 H;  2AQ2 B;  3STB D;  2GVA A;  3X3N A;  4DAV A;  4HJ9 A;  3ND8 A;  4JV5 L;  2VL6 A;  2XVS A;  1A0I A;  3BYY B;  4J15 A;  1XMO Q;  2MUY A;  2JA5 H;  1VQ6 A;  3GTJ B;  3VA5 A;  5J3B A;  5DEH A;  2MO0 A;  3F1Z A;  2KEE A;  3EJI A;  5FLM H;  5M3M B;  3RZO H;  5E4X A;  2Q8R E;  3W1G A;  3AMU A;  1H9M A;  2NBF A;  2ZM6 L;  3MVV A;  1QZG A;  3PIO A;  3T51 B;  3VYU A;  2GN5 A;  2XNA C;  2HUG A;  2WB1 G;  5CR3 A;  4DR4 L;  4KHP Q;  3MAQ A;  4DKA C;  1QWY A;  3G6E A;  1J5E Q;  3QIA A;  3TZD A;  3V2T A;  1WTX A;  4P74 A;  1K3R A;  3C2P A;  1KC8 C;  2F4V L;  2HD3 A;  2EVB A;  3QWN A;  3BZK A;  1FYC A;  1A15 A;  3K6O A;  1UEA B;  1T5X D;  3LNN A;  1VQF A;  2KA7 A;  3PO3 G;  4DNR B;  4AIM A;  2PQE A;  2HCI A;  3S16 B;  3CAM A;  1HNZ Q;  1M8A A;  1LTA D;  1LO5 D;  2KVM A;  5IP7 H;  4P72 A;  1EOV A;  2JXM B;  3GTQ H;  2NN6 G;  1RIP A;  5H1S E;  3NP8 A;  3CME A;  1XTD A;  1L1O A;  4DR3 Q;  1Z7T A;  4H13 C;  4MTN A;  4CJ0 B;  1UE6 A;  4J6H A;  2EQS A;  2R7Z B;  1Z6H A;  1ZYR C;  4NB3 A;  1G6Z A;  3MXN A;  4RA8 A;  3HKZ E;  1SR3 A;  4NKL A;  4A3K H;  1BCP B;  2B8F A;  1WCM G;  3KF6 B;  1MI2 A;  4HJ8 A;  1FNU A;  4A3I H;  3RD4 A;  3NBH B;  1SYB A;  4G4K A;  3ITP A;  4JBK A;  2VUM H;  2KUM A;  4HSP A;  4IJL A;  4FF3 A;  4FF4 A;  5CMD A;  5ELD A;  4N8X 1;  1RDP D;  3K80 C;  1QZH A;  3I4M B;  1EQV A;  2B29 A;  5FLX E;  1LTT D;  3W1B A;  4CKC A;  4NMZ A;  4OO1 G;  3T13 A;  3T53 B;  3M4Q A;  4CDE C;  1KHI A;  2L11 A;  1OXV A;  4UP7 A;  1L1O B;  2EZV A;  4O42 A;  1G91 A;  1TWG H;  1SDF A;  1O7I A;  4JI8 Q;  4J8Q A;  3K58 A;  2IT1 A;  4UP8 A;  1NJI C;  3MXN B;  2R7Z G;  1EIG A;  4CHT B;  1PLF A;  1CHQ D;  3Q6S A;  2KED A;  1U4P A;  1IBK Q;  5C4X G;  4LF5 Q;  3SGI A;  4XT3 B;  4GN4 B;  3EBE A;  4LF4 Q;  2NVY B;  2H4O A;  2NVT B;  4XQN A;  4NDX A;  1A3V A;  4HMJ A;  1B3Q A;  1LLR D;  1X55 A;  2F0E A;  4DAP A;  3HOV B;  4OWW B;  4MHE A;  4EQ5 A;  3UE0 A;  1LAB A;  4LFB L;  1B44 D;  2R61 A;  4XQQ A;  1V1Q A;  1Z9F A;  1EYC A;  2WII B;  2UXC Q;  1KL9 A;  4OXP A;  4CKB A;  1JWU D;  1SYE A;  1WTP A;  2WKC A;  1BDO A;  1I5F A;  3KBX A;  3GTO B;  4A3B B;  2K5H A;  1U9R A;  3S2H H;  1I94 L;  4NP5 A;  2IJ0 A;  2WAQ B;  1EZ8 A;  3H0G H;  4HR7 B;  1HUM A;  5CV9 A;  1UAP A;  1LTG D;  2CH4 W;  2R92 H;  4TKO B;  3CCS A;  4IOA A;  1N36 Q;  2F1M A;  2D9U A;  5KND A;  3J81 L;  5C4J B;  1JOR A;  1ET6 A;  4K8J A;  4A3L H;  3QJY A;  4MIU A;  4JBM A;  4IFD G;  2HIX A;  1PH2 A;  3L3O C;  1QVC A;  2Q2H A;  1JJ2 A;  1TS2 A;  3I91 A;  4OON A;  4C3H G;  1D1I A;  1BR9 A;  3A74 A;  1CKN B;  3OW2 A;  1Y1V B;  3K5L A;  4RFB A;  3HOX H;  1ONL A;  1JJG A;  2KEC A;  1N34 Q;  3D31 A;  2RCN A;  5FLX c;  1NUC A;  1T9H A;  4R8N A;  4ZUJ A;  4L5Q A;  4DV4 Q;  2WAC A;  3M3Y H;  1B9M A;  3AB9 A;  1F77 A;  1Y1W B;  3WOE A;  1OXU A;  5GAH C;  3S2D H;  1KNA A;  1W3S A;  3N52 A;  3ERS X;  4JBW A;  1VQH A;  1QCB D;  5IGE A;  4J1M A;  3VR2 A;  1UE1 A;  5C44 G;  4DXF A;  4K5W A;  4DV2 Q;  3IFT A;  4R1J A;  1JC7 A;  1JWS D;  2YTY A;  4DK1 A;  5JPN C;  3KUP A;  4C1N K;  3J7Y W;  2LXJ A;  3FPU B;  3I4O A;  3F8T A;  1NMG A;  1FGU A;  2CW0 D;  4FXK C;  1N32 L;  2QKI C;  4CDC C;  3JAM E;  3K5N A;  3GP7 A;  2HHH Q;  4LK1 C;  2G9H D;  1A3U A;  2UUA Q;  4BS9 A;  4DR6 Q;  4MN3 A;  3R3O A;  1U4L A;  2JA7 H;  5CV5 A;  1TII D;  1PTO H;  1Y1V G;  4RCN A;  4PZ7 A;  3M4Y A;  1I4R A;  3RNU A;  1XNR Q;  1SMX A;  3FPP A;  5IP9 H;  5DM7 3;  3C1E A;  2VW9 A;  4G7H C;  4A3M B;  3I2Z A;  3HRZ C;  5KYL A;  4G57 A;  3HS0 C;  1RHP A;  4RKL A;  4TRD A;  2D62 A;  2E2I B;  2EYJ A;  2IWH A;  1ZXT A;  2VQE Q;  2YV5 A;  1JJC B;  1EU3 A;  4KY7 A;  5E4W C;  2LFN A;  1PZK D;  4GNX C;  1WVL A;  4YWK A;  3NHH A;  3SK8 A;  1S5E D;  4JI8 L;  2ZXP A;  3Q23 A;  1VQC A;  2EIF A;  5FK9 C;  2BE5 C;  5C0X G;  3M4O B;  1TVX A;  2VQF L;  2B2W A;  1N33 L;  4IUR A;  3VDY A;  3F2U A;  2YU9 B;  1FJG L;  2A73 B;  2NB0 A;  4LF4 L;  1IW7 C;  1TWF H;  2ICE C;  3BDO A;  1NTG A;  1YI2 A;  2K5N A;  4X62 L;  4A3D G;  2WIN B;  5I6Y A;  2Z4H A;  4GLV B;  4O2D A;  4EGV A;  4RGT A;  2ES2 A;  2A69 D;  1VQ8 A;  2A6H C;  1PH5 A;  2FFK B;  3DWQ A;  4UHV A;  1KDC A;  5C3X A;  3LWE A;  3HP3 A;  5FO9 B;  2L4N A;  3UDX A;  1STA A;  4PV1 C;  5LHY 1;  1JOK A;  2RDF A;  3KLS X;  3ULL A;  1Q8I A;  2KCC A;  1Y69 U;  1QE6 A;  3KFU A;  4A93 G;  1EIH A;  2F0O A;  1E2Z A;  3VR6 A;  4JI0 Q;  5JOB A;  2RHQ B;  2DY8 A;  1SYG A;  4IFD J;  2O5J C;  2XGT A;  1BCP F;  4JI7 L;  3OIP A;  1EY6 A;  4BWG B;  1SFO B;  1B7Y B;  5C5M A;  5E3F A;  2YTV A;  3W3A A;  4LF7 Q;  4DV3 Q;  3JAM c;  1HR0 W;  1B9N A;  4QMG A;  1IBL L;  2K14 A;  4HTH A;  2MHV A;  2B2U A;  3NWS A;  1WOC A;  3UDI A;  1MJE A;  4A3C G;  4B3T L;  4ME5 A;  4ODG A;  2AHO B;  2MFI A;  2E2H H;  3I73 A;  2NN6 H;  1EU4 A;  1KAB A;  4OEL B;  4HJ7 A;  4DR5 L;  1S5B D;  5CV7 A;  4A3F H;  4JCV E;  2K50 A;  3SXH A;  2C5C A;  5DNF A;  2OCE A;  1QVF A;  3QO2 A;  4AQY Q;  2OTL A;  3DWA A;  3PQI A;  1D5Z C;  2Y0S B;  3T1H Q;  1FD7 D;  1NY4 A;  2OT2 A;  5JJI A;  2QCP X;  3KDF B;  4UDU C;  1WCM H;  4EQP A;  4B9X A;  4U67 3;  5CV6 A;  1ASZ A;  4ZAI A;  3GV6 A;  2GVB A;  4B3M Q;  2L15 A;  1U4M A;  1HTL D;  4HCE A;  5T1I A;  1D2B A;  1CSP A;  1LUZ A;  5JJK A;  1HFG A;  2CQO A;  2IX1 A;  1AP0 A;  3SK4 A;  4C3I B;  3HOZ H;  3E9I A;  4GNX B;  2JA6 G;  2MNA A;  3TN2 A;  2R93 B;  4PZ6 A;  4DR6 L;  1LTL A;  4OO1 H;  2EY5 A;  3PSI A;  3G71 A;  1P8L A;  3RZD B;  3PIP A;  3TS2 A;  4K0K L;  1JWM D;  1CA5 A;  1CI3 M;  2IX0 A;  4KK7 A;  5FLX L;  1SMY D;  3OSO A;  3GQB A;  1UWV A;  3E0J A;  5C0X J;  4YWM A;  1EFW A;  2VNU D;  4Y52 H;  1LM0 A;  5M5Y H;  2EYF A;  4AYB B;  1EYG A;  4FDB A;  4F88 A;  4O0A A;  4LF6 Q;  2IX3 A;  4LAA A;  5I4D A;  1RTO A;  1LTS D;  3K7A H;  2L0C A;  4C3I G;  2WB1 E;  4DNT B;  5KNB A;  5COY A;  2F0D A;  2A74 C;  2G5D A;  4RAU C;  4G7O C;  3TDQ A;  5C3E B;  3H15 A;  1DGS A;  1EYA A;  1IKM A;  1Q46 A;  5K5P A;  1XXG A;  2OQ0 A;  4B3S L;  4OGQ C;  5JJZ A;  4JV5 Q;  3I7F A;  1ENA A;  2RF4 A;  2B63 B;  3HOY G;  3P75 A;  2N8N A;  3K59 A;  4JI1 L;  2RHS B;  1X3Q A;  5ISR A;  2F0H A;  5LMN W;  4LJZ C;  4IPC A;  1X3F A;  2Z6K A;  1HA5 A;  4IFD H;  1PXU A;  3E0E A;  1GUO A;  2EJF C;  1EWC A;  5IGG A;  4PG3 A;  5F2D A;  4C3H H;  2R7D A;  4IPH A;  4LW1 A;  3RLO A;  4TVA B;  1QUQ A;  2JEB I;  4Y7N B;  2B2T A;  2RKS A;  1VQA A;  5KIX A;  2E74 C;  4OHJ A;  1IL8 A;  3EFX D;  3KF8 A;  1GM5 A;  1STH A;  5CC4 A;  1X32 A;  3K0Y A;  1WYD A;  3R8B A;  3CD6 A;  1XPO A;  3BZC A;  2PMZ B;  5ELB A;  2Q2T A;  3T16 A;  5C3E G;  4GN3 B;  1WTO A;  3P20 A;  1O7L A;  1QNU A;  5J22 A;  4TQU S;  1F9Q A;  4EQO A;  4BY7 G;  5C44 H;  1GUW A;  4C3J G;  1KAA A;  4ME3 A;  1W2B A;  3GTL H;  3HOU H;  1VQ5 A;  1MSH A;  1SXT A;  4P73 A;  1HQM C;  4AQY L;  5IGD A;  2F0W A;  3S1M H;  2D2C C;  4X3S A;  3PF4 A;  3T1H L;  1HNX L;  4DK6 C;  2BOS A;  4IZ8 A;  4DPG A;  3I55 A;  1YIT A;  1BVS A;  1YVC A;  3LX0 A;  1Y8P B;  1QUQ B;  3IRB A;  1VQM A;  4OIJ A;  3HKS A;  4JC0 A;  5JEA G;  1E24 A;  4V19 0;  3I4N G;  1A63 A;  3S1R B;  4QL5 A;  3OTO L;  2PYK A;  3H09 A;  3H3V H;  4RKB A;  3JAM L;  2JA7 B;  3TEH B;  1F9S A;  5COR A;  4C56 C;  2L5T A;  1S5F D;  1X6O A;  1STB A;  3S24 A;  3AQQ A;  1II3 A;  2BDN A;  2N55 A;  3GO5 A;  1CKM A;  1HQR D;  4I7A A;  2QGQ A;  4H02 A;  1MD2 D;  1FNW A;  2K4K A;  1BNZ A;  1TXY A;  4WFN 3;  1KLU D;  1EWI A;  4A3J G;  4HN7 A;  3QOJ A;  1YNJ C;  4DV1 Q;  4CJ2 C;  3HOW B;  1NBW A;  3I4L A;  5C0X H;  2I5L X;  1K8M A;  4L8J A;  1BOS A;  5HUR A;  4KV6 A;  1ICW A;  3EIV A;  1CSQ A;  2R7F A;  3C46 A;  4LF6 L;  1L0X B;  5JVH 3;  4JYA L;  3DMU A;  4HJ5 A;  4S3S A;  2XWJ B;  3DM3 A;  2F0Q A;  3FMC A;  3OW7 A;  3M7G A;  1VQ7 A;  4FYD A;  4BA2 I;  4QUC A;  1BQQ T;  1ROD A;  1VQL A;  1SNC A;  1C9O A;  4DU9 A;  3JAM i;  1VQ4 A;  3LWU A;  1OTC A;  3E3X A;  2Z9H A;  3AFP A;  3HZX A;  1RJT A;  1STE A;  1RL2 A;  2K5D A;  4OEM B;  4A93 H;  5NUC A;  1KIX A;  1C48 A;  5G3L F;  4LFB Q;  2OXP A;  4OWX B;  3BS1 A;  3C1F A;  2QA4 A;  1XYI A;  3MFY A;  1YEZ A;  4WOR A;  2JK8 A;  1I94 Q;  2A68 C;  4QCL A;  2ZJR A;  2C35 B;  1ZYR D;  3L0O A;  4BBS B;  4OX9 L;  2OEO A;  4IUU A;  2SNM A;  1E2V A;  1MJC A;  4A3C H;  5IY0 A;  3VA7 A;  1EYD A;  1KDA A;  1PVO A;  3CQZ B;  3FKI B;  3NPP A;  4QQB X;  1ICF B;  2PQA B;  5KYI A;  3NK9 A;  1SE3 A;  3MXG A;  1LV9 A;  5M9O A;  4BY1 H;  1PH6 A;  3K5M A;  1K28 A;  3OPO A;  3KF6 A;  4A3F B;  4I7Z C;  2X6G A;  2L1B A;  1UE5 A;  4JI3 L;  3D4W A;  2N88 A;  2WV6 D;  4LMQ D;  2B2V A;  2A6E C;  4X3U A;  4A3G G;  3TP6 A;  4IPD A;  3U9S A;  1K9M C;  5IYD G;  3S1Q B;  3MEH A;  4FXD A;  3NBH A;  4HSV A;  2F0J A;  3S17 H;  2WFW A;  3BG3 A;  4CBV A;  2UXB Q;  3DUZ A;  5IT9 L;  2Z8L A;  1OXX K;  1EL0 A;  2FJ2 A;  2F0F A;  3MXU A;  3KBG A;  4UAI A;  4ZKC B;  1BXT A;  1LT3 D;  4IOC A;  1MIU A;  3IFD A;  4LUZ A;  1C4Q A;  4OIK A;  4AH6 A;  4KLK A;  1CZW A;  1HRJ A;  5M3M G;  4EX5 A;  1BF4 A;  1IKL A;  5AFW A;  1WTV A;  2JA6 H;  3BVG A;  1EY4 A;  2FIN B;  4HCS A;  3FEW X;  1CKO A;  5GAG C;  2F0V A;  1SN8 A;  4KY6 A;  3S14 H;  1N32 Q;  4KJO A;  1ESF A;  4LFA L;  3A7A B;  3OMG A;  3STB C;  3I90 A;  3K8A A;  4KKS A;  1TR5 A;  1JB7 A;  1PMR A;  3D6C A;  2F0N A;  3K7U C;  1GKH A;  4A3E H;  4NXM L;  2L9H A;  1C7Y A;  3PV0 A;  5IYC G;  2ATW A;  4A4I A;  4DV1 L;  3T4A C;  3BYT B;  1SYC A;  2UU9 L;  4GOP C;  1ENF A;  1PYW D;  1DXM A;  5FJ8 G;  3CCV A;  1WTR A;  3CCE A;  1D7Q A;  3K0X A;  3A5U A;  4NW2 A;  4JW0 A;  5C6A A;  4A75 A;  2VQF Q;  2K03 A;  3S1N B;  1N33 Q;  2FMM A;  4KMU C;  2NVQ H;  1FJG Q;  3RR5 A;  3KLS A;  2HDL A;  5ELF A;  4X6A H;  2QEJ C;  4E6I A;  5CV8 A;  4X62 Q;  2LY7 A;  3I8Z A;  3CCM A;  3BDC A;  4L6T B;  2SNS A;  3J81 j;  4QGU A;  1PYS B;  4GS3 A;  4GLA C;  4BBR B;  3HOY H;  3FVQ A;  1SSO A;  1CKN A;  1O7Z A;  2PI2 A;  1HJP A;  1HXY D;  2K6A A;  3A7L A;  1YZ6 A;  3I4M G;  3PUW A;  1RKN A;  3ERO A;  1B8A A;  1P16 A;  5M3F B;  2A8V A;  1FGB D;  2H1E A;  1VMP A;  1JE4 A;  1X54 A;  4EQN A;  2A19 A;  1AH9 A;  4JI7 Q;  2NVX B;  4X3T A;  2KCN A;  4CDD C;  1BBU A;  1KTK A;  3NTH A;  4DAM A;  1O78 A;  5EBC A;  2JQO A;  1JQY D;  3CC7 A;  3W2D A;  2IHE A;  5D3D A;  1H9K A;  1IBL Q;  2M2L A;  4K8I A;  5M5X H;  1NR2 A;  3WDN A;  2FXQ A;  2KJX A;  4BY7 H;  3GTG H;  1U0L A;  4GOP A;  2YTX A;  3SK6 A;  2SOB A;  4B3T Q;  4LF8 L;  4Z9C B;  3BVM A;  3HGB A;  1NCV A;  3CKI B;  5EPJ A;  3GTL B;  5AJ3 L;  5BR8 L;  3HOV G;  1KRT A;  1DJR D;  4DR5 Q;  1A62 A;  4R4T A;  5IE8 A;  3S1M B;  5IGC A;  4RGO S;  3CXC A;  1YIJ A;  2UXD L;  2Q8I B;  3TP5 A;  1VQN A;  3RN2 A;  4DR7 Q;  2UXB L;  1CUK A;  4KHV A;  1TWA B;  3WWV A;  1K8O A;  1NMF A;  1Q7Y C;  2I5M X;  1D1K A;  2HCC A;  3I4N H;  1PFS A;  3PF5 A;  4A3B G;  2F0S A;  3AEV A;  1M4V A;  2BE5 D;  2WAQ G;  3GTP B;  1CZG A;  1I6V C;  3NQI A;  1VQK A;  4HIK A;  2JP1 A;  2KHS A;  4MNO A;  1E1O A;  2M00 A;  5D65 A;  1TWC B;  1IW7 D;  4ZCK A;  2YYZ A;  1IXR A;  4EVO A;  3C3L A;  1STG A;  1XX8 A;  1TWH H;  3PO2 B;  1XNQ L;  4GOP B;  4NPS A;  3I3C A;  4A3J H;  2A6H D;  2JA8 B;  5EPK A;  3TP7 A;  1PFN A;  2F03 A;  4DV7 L;  4UP9 A;  3J7A F;  3M7N A;  1AEX A;  2D5D A;  4K0K Q;  3HKZ B;  4GN5 A;  1X65 A;  1NE3 A;  2NZ1 D;  1U5K A;  2ICI A;  2EYM A;  1Y1W G;  2C9O A;  1IYJ B;  3EA6 A;  2UUB L;  1DOM A;  3MC0 B;  3BDL A;  1CT1 D;  1K8G A;  1GUN A;  1HZC A;  1PYB A;  2NUC A;  3HEJ A;  3MWY W;  1PV4 A;  3SVM A;  2IW3 A;  1E22 A;  1V43 A;  3CP0 A;  1K0S A;  2RVL A;  2K28 A;  2VB3 X;  1WTQ A;  3ND9 A;  2IHF A;  1PRT C;  4DAY B;  1GXD C;  3H6M A;  1D6E C;  1Y8N B;  2K75 A;  4KN7 C;  4XTC S;  1I4X A;  5C5L A;  4DR1 L;  3PIP 3;  3S15 B;  4JOI C;  1L2F A;  1MHW C;  3DM1 A;  3KYH C;  1Q1B A;  3QB3 A;  4K5X A;  4B3S Q;  3GTM H;  2JA5 B;  3U4Z A;  1S4Z A;  3FRP B;  1PA6 A;  2B2Y C;  5KGU A;  1I3Q H;  4N8F A;  4A3M G;  3J80 E;  1SYF A;  3RZO B;  1GHJ A;  4JI1 Q;  1MBY A;  5M5W H;  4HJA A;  1N9W A;  4K14 A;  3CMA A;  4L5R C;  4CJ1 B;  1I4G A;  3KDF A;  5EKI A;  4P2C B;  3NE5 B;  1XPR A;  1ZKO A;  1Q12 A;  4BY1 B;  2XWB B;  2QDL A;  4BA1 I;  1QJO A;  3GTK H;  4HMI A;  1TKW B;  2K01 A;  5GAD C;  1GHK A;  1QG7 A;  3PO3 H;  1X3P A;  3M4P A;  3S17 B;  3PGZ A;  4GNX A;  3D8G A;  2EY6 A;  1F9R A;  3CRK C;  3LGJ A;  4JI6 Q;  2AUJ D;  3GTQ B;  4LUO A;  2I0Q A;  3PCO B;  2DNC A;  1PH3 A;  1ZEQ X;  4DR7 L;  5M3M H;  1T5E A;  2FHT A;  4RHS A;  3SHL A;  1LTB D;  1V9P A;  3RN5 A;  1HNX Q;  1NR4 A;  1UEB A;  2SEB D;  3DEP A;  4KD4 A;  1RTN A;  3S14 B;  4A3K B;  1K83 H;  2EDG A;  2GA4 B;  1GOZ A;  5LL6 X;  5BN5 A;  1QNK A;  2B2Y A;  3P7J A;  1LT4 D;  3OTO Q;  1ILQ A;  4PZ8 A;  4A3I B;  1M90 C;  2NYZ D;  1A3T A;  4ABN A;  1AZQ A;  2DUD A;  2VUM B;  3ONA B;  4POG A;  1IYV A;  2DNE A;  5BN3 A;  1WD0 A;  3S16 H;  2KCM A;  2JEA I;  4IFD I;  1M1K C;  4TSS A;  1W6J A;  1YNN C;  2F0U A;  3QOL A;  5IP7 G;  2E2D C;  1HZA A;  3J80 c;  1PRT B;  3OMC A;  5FJ8 H;  2ZTC A;  3OWF A;  4DA2 A;  3A54 A;  1FR3 A;  3ULJ A;  1TWG B;  3QR8 A;  4POF A;  3NWT A;  1UE7 A;  2R7Z H;  2Y0S G;  1PTO C;  2RDG A;  5C4X H;  5A35 A;  1V1O A;  2B3G A;  4JYA Q;  4RHR A;  1TY2 A;  2O5I C;  3RLN A;  3JC6 6;  2KBN A;  5J1Z A;  4B3R L;  3NTK A;  5KRU A;  5ELE A;  1GJX A;  2M9V A;  4DFA A;  3M9B A;  1QIL A;  5DM6 3;  4DXG A;  3F2D A;  2R93 G;  4YY3 L;  4KKU A;  4O1N A;  2JA9 A;  5FO8 B;  2LMC B;  1F2Z A;  2AQ1 B;  1OO9 B;  4LUV A;  1I6H H;  1SE2 A;  1SYD A;  2RSO A;  3G48 A;  3H3V I;  2F0M A;  5JPM C;  3S2H B;  1EY9 A;  1SNO A;  2R3Z A;  4QIW E;  3H0G B;  1Q3L A;  4LWC A;  4H0L C;  4ZUI A;  2PW7 A;  2J0T D;  3R93 A;  2R92 B;  1LTI D;  2WKD A;  2K33 A;  4AYB G;  1VS0 A;  4GLX A;  3J7A V;  5C4H A;  4OX9 Q;  1RD9 D;  5I2Y A;  1BO0 A;  1CTM A;  5M5X B;  1L0Y B;  1DD2 A;  2LKV A;  3EVQ A;  4YWL A;  4P71 A;  2NVY H;  1CFM A;  2NVT H;  2EXZ A;  4RWS C;  1MKH A;  5IWA L;  3HOV H;  1EIF A;  1PDQ A;  1B3A A;  5C0X I;  4IAL A;  3HOX B;  4X65 L;  1SRO A;  1SMY C;  2LS0 1;  4M1U B;  4JI4 L;  1UNS A;  5EQ0 A;  4JI3 Q;  3M3Y B;  1XMQ L;  4FP5 D;  4FF2 A;  3DEO A;  5CGK A;  4B08 A;  3S2D B;  4QF4 A;  4JI6 L;  2X6L A;  4JI5 L;  2Z0S A;  1YNJ D;  1ESR A;  4UPA A;  4A3B H;  1X3E A;  1BCP D;  1Q1E A;  3J81 E;  2DY7 A;  3H0G G;  5KNC A;  2O2L D;  2EY2 A;  2EJG C;  3KJP A;  1FVI A;  3VR4 A;  2B63 G;  2R92 G;  5EKL A;  4ID6 A;  4DV6 L;  5C4J H;  1BUV T;  3PIO 3;  4KHZ A;  1MGS A;  3KOJ A;  4P75 A;  2PZU A;  1G51 A;  3O13 A;  1DOL A;  2VXW A;  3DWP A;  3K57 A;  4MTK A;  1TWH B;  1XTC D;  4A3L G;  3E9H A;  5IYB G;  4R4C A;  4ZRZ A;  1X9N A;  4UY8 C;  2IY5 B;  3K81 C;  3Q22 A;  4C2M H;  1B1Z A;  4DV5 Q;  3L7Z C;  3OHX C;  2H5X A;  1Y1V H;  3TRE A;  4LFA Q;  1IYU A;  3Q0A A;  1GUG A;  1PTO B;  1BKB A;  4CDF C;  1NSN S;  1STN A;  2PCF B;  3L2P A;  4A76 A;  2R6G A;  1FNV A;  2K7V A;  2RBM A;  1Y1W H;  1SLJ A;  1SEB D;  3MTS A;  4R9W A;  1XWE A;  1SNM A;  4HED A;  4K6L A;  2CWP A;  2OTJ A;  4NXM Q;  5GRO A;  4IPG A;  4DUY L;  1PH9 A;  2A68 D;  2KQ3 A;  1J8I A;  3CCU A;  4DV0 L;  3W5O A;  3UDF A;  1PFB A;  2O4X A;  3EN2 A;  2ZXO A;  2KOL A;  2UU9 Q;  1TS5 A;  1LAC A;  1LT5 D;  1VF5 C;  1TT2 A;  3MZ5 A;  1A6X A;  3PUY A;  2I07 B;  3URY A;  2Z4I A;  4LF9 Q;  1F2M A;  1HNW L;  5C4Z A;  2BA1 A;  4A3D H;  1K0R A;  1TWF B;  1LTR D;  2TMP A;  3AYH B;  1OXT A;  4GKJ Q;  1W6K A;  1ML0 D;  3TZU A;  4M8A A;  1E1T A;  3K5O A;  2JA7 G;  2KCT A;  3A8J E;  3TS0 A;  1QB5 D;  2PQA A;  3GTM B;  3BJU A;  2BDO A;  2EJM A;  4A3M H;  2AUK A;  1I3Q B;  3OWE B;  1JCK B;  3VR3 A;  1D8L A;  3J81 c;  1A8V A;  1BBW A;  2PNR C;  3IL8 A;  4LNQ A;  1VQO A;  2FMC A;  1HR0 L;  3J80 L;  5EJW A;  1KNE A;  1STY A;  3MXP A;  2WB1 B;  3HG9 A;  5FOB B;  2DJG C;  2NTS A;  2F0L A;  2QIL A;  2CWA A;  2EXD A;  5IOC A;  3HOW G;  2HQE A;  1X3G A;  3GTK B;  1Z47 A;  5LMU Q;  4FO2 A;  1VQP A;  1G2T A;  2YU9 H;  2WAQ E;  2AWN A;  4IJH A;  2VZA A;  3VYT A;  1PH8 A;  4RGN A;  1CHP D;  5ELO A;  2B8G A;  2VY3 A;  5EBD A;  5A2Q E;  3ICE A;  2E2H B;  1DM0 B;  1SNP A;  3BU2 A;  4OL7 A;  4MZ9 A;  5ELN A;  2NZO A;  3R2T A;  4PQX A;  1PRT F;  2RCF A;  1VCI A;  4LF8 Q;  2IPK D;  1F9P A;  3CCL A;  2TSS A;  1WTH A;  2I46 A;  2XN9 C;  5AJ3 Q;  5BR8 Q;  2UUC Q;  2XTI A;  4ZLT F;  1S72 A;  2PI2 E;  2UXD Q;  3KJO A;  3D4D A;  4PMC A;  1PH1 A;  2QDB A;  3ER0 A;  1WCM B;  5JEA J;  1K83 B;  3J80 i;  3M85 A;  1SFO H;  1H9S B;  2ZT9 C;  1K8A C;  2PZT A;  3SK5 A;  4R4O A;  4BBS G;  1SNQ A;  4V0B A;  1Y14 B;  5EKK A;  3X3M A;  2E5L L;  4WJ3 M;  2MQH A;  3HOZ B;  3D6W A;  5EPL A;  1CM9 A;  2PPB C;  4L5S A;  1B2T A;  4DV5 L;  3ULP A;  2F0G A;  3FKI G;  4KD3 A;  1XNQ Q;  4K6D A;  2PW5 A;  1DOK A;  2EPB A;  4XYQ A;  3B6Y A;  4A3F G;  3ZJY C;  1YHA A;  1KQS A;  4BXX G;  4DV7 Q;  1NNX A;  4PNY A;  5J39 A;  3H3V C;  5M5Y B;  1VQG A;  2RSN A;  3Q8D A;  2HDM A;  3MHB A;  2LXK A;  1V8Q A;  1PH7 A;  2JN4 A;  4R8I A;  5C4X B;  5IOD A;  2Z1C A;  2J7Z A;  2UUB Q;  4IN3 A;  3AU7 A;  5FKA C;  4X66 L;  2XIW A;  1GVP A;  3K7A B;  4LFC L;  3MA2 B;  3CW2 C;  1B50 A;  3TP8 A;  4C3I H;  5IGF A;  4LF9 L;  2AMC B;  4WJW A;  3HOZ G;  2R93 H;  1BBX C;  1V1P A;  1A2T A;  3G7L A;  2Q2I A;  4GKJ L;  2HIV A;  3UE1 A;  1YJ9 A;  3KLW A;  5CBA E;  2ALY B;  2I5H A;  2N78 A;  1IBM L;  3RZD H;  4ZYS A;  2X69 A;  5HY6 A;  3FDT A;  4DR1 Q;  1KRS A;  1I6H B;  1B53 A;  3DHQ A;  5LMN L;  4XQJ A;  3NSW A;  1SBB B;  1EZ6 A;  1YNX A;  1WI5 A;  1D5M C;  2HQL A;  1Q81 C;  2K5V A;  2JYO A;  1AE2 A;  4QUF A;  4WRD A;  4JG2 A;  2ENB A;  3CPF A;  4YHH L;  1S40 A;  4C3H B;  1WFQ A;  1TY0 A;  1G6P A;  3GD7 A;  1PZJ D;  1PFM A;  2F0I A;  5LMU L;  3E6Z X;  2EYP A;  1PTO F;  1EQQ A;  1V1P B;  5JJL A;  1Q86 C;  1VQB A;  1I4H A;  1AZP A;  2DJF C;  2L55 A;  3NBI A;  3N6R A;  4C1N I;  5C3E H;  1E2W A;  4RMF A;  1G8Z D;  4ILW A;  4RCO A;  1U4R A;  5G3L D;  1XMO L;  1AN8 A;  3D4R A;  2JE6 I;  4N9T A;  1EWH A;  5I9O A;  4C3J H;  5C44 B;  4KI0 A;  1R9T H;  1YJN A;  5EGT A;  2NZH A;  2D0P A;  3RLF A;  2UUC L;  1AFP A;  3HOU B;  2B63 H;  1KXL A;  1SRU A;  3CHB D;  4BBR G;  5TSS A;  2ID0 A;  2RQX A;  1VQI A;  2E8G A;  2RA4 A;  4I65 A;  4G7Z C;  1A2U A;  3MEF A;  3CF5 A;  1E0B A;  3UI2 A;  1PHJ A;  2E2J H;  2CVR A;  5IYB H;  4KHP L;  4PMW A;  4H44 C;  1GUT A;  5JEA H;  5M3F G;  1H9J A;  4XT1 B;  1J5E L;  2JJQ A;  1LT6 D;  3SEB A;  3I56 A;  4IUQ A;  4Y7N H;  4C2M B;  4RH6 A;  2Y0S E;  1K73 C;  2F3W A;  1VF7 A;  1PRT D;  1VQD A;  3NEL A;  1I50 H;  2V4D A;  3WOF A;  5KEE A;  3CC2 A;  2F0K A;  2MP1 A;  4DF7 A;  2KHI A;  3U4V A;  1HNZ L;  5CBE E;  2PZW A;  4ZQ3 A;  3BVZ A;  2B2W C;  4DAY A;  5CV4 A;  2CHB D;  1IHZ A;  4XDX A;  5HGT A;  3T1Y Q;  2DN8 A;  5JAV A;  2QW7 A;  4YCV A;  4NXN Q;  3Q24 A;  5IIF A;  4DR3 L;  4ALP A;  3HOU G;  4R4I A;  4XXE A;  4CKE A;  5DAU A;  3HFZ B;  1HZ9 A;  3J81 i;  4JBJ A;  2NTT A;  1B70 B;  1EFI D;  4A3D B;  3S1R H;  5I2X A;  4QB4 A;  1JT8 A;  3TSS A;  1YBY A;  2NN6 I;  4AYB E;  3E5S A;  3S9W A;  1F2L A;  4F87 A;  4GKK Q;  4WJ4 A;  2CH4 A;  1SE4 A;  1S5C D;  1SJE D;  2EE1 A;  4B3R Q;  2CFM A;  1VMC A;  2OQK A;  4RG1 A;  2D0O A;  3KLR A;  4A93 B;  3PO2 G;  2B2U C;  3RUZ A;  1XJV A;  1CA6 A;  2BH8 A;  4YY3 Q;  1O7Y A;  1JIC A;  1S3O A;  2JA8 G;  3D0F A;  3ERQ A;  4IUT A;  5I6W A;  1KD1 C;  5GAE C;  3HOW H;  4FVM A;  3HKZ G;  2B39 A;  4DN4 M;  4YCU A;  1G2S A;  5E1F A;  1IBK L;  3VR5 A;  4LF5 L;  4DR2 Q;  4ZKB B;  3MFG A;  2MPM A;  2CCZ A;  1DZ1 A;  2J4X A;  2CW0 C;  3TBI B;  4OO1 I;  3F2B A;  2ZJQ A;  3L9A X;  4QJF A;  3VYS A;  5I9P A;  1ILP A;  4XIG S;  5D3I B;  5K36 G;  5A2Q L;  3GDE A;  4YIJ A;  2F52 A;  5IWA Q;  4A3G H;  4ULL A;  2ZTD A;  4B9W A;  2UXC L;  5IYD H;  4X65 Q;  1YNN D;  1SND A;  1NAP A;  5LL6 S;  3NEM A;  4JI4 Q;  1I4Q A;  5ELC A;  3F2C A;  1ASY A;  1XMQ Q;  2HT1 A;  1PH4 A;  3A56 A;  2PMZ E;  4JI5 Q;  4ZK9 B;  1IZ6 A;  3OOC A;  1HH2 P;  4CGY B;  5HGQ A;  3GTJ H;  2JA5 G;  4HAE A;  4R4Q A;  4H7B A;  4BBS H;  1N36 L;  3CRL C;  3J7A 5;  1G29 1;  1PTO D;  1TS4 A;  5FLM G;  4RGM A;  2MGS A;  3NUC A;  2JA6 B;  1Y8O B;  4DV6 Q;  1SJH D;  4JOI A;  2EOT A;  2IL8 A;  3FKI H;  2LSS A;  3CQZ H;  3QG1 A;  4KJN A;  4APV A;  3PUX A;  1D5X C;  4KN4 C;  3RMH A;  2K5W A;  1N34 L;  2Q2U A;  3SDZ A;  1H9R A;  4FXG C;  1HTP A;  3OYY A;  4BY1 G;  4DV4 L;  4BXX H;  2A69 C;  2RDH A;  5IT9 E;  1TU2 B;  1EUJ A;  2K32 A;  1HHV A;  3S1Q H;  3R2I A;  4L63 B;  4A3E B;  1C0A A;  3OIQ A;  2EYL A;  2QF7 A;  3TME A;  3T1Y L;  5IYC H;  1R4P B;  2F3V A;  1E3P A;  2ZTE A;  3AFQ A;  3BZD B;  4NXN L;  4DV2 L;  3CC4 A;  5BN4 A;  3KK7 A;  4DUY Q;  1GD7 A;  1N8R C;  4JI2 Q;  2K52 A;  4DV0 Q;  3CCQ A;  2K5Q A;  1HPC A;  1VDZ A;  4HID A;  2HHH L;  1MSG A;  1HZB A;  2UUA L;  4L5T A;  3J7Z C;  1JMC A;  5D14 A;  2Z6K C;  1CQF A;  2XSC A;  3U50 C;  4K5V A;  2NVQ B;  4A3K G;  4X64 Q;  4FF1 A;  4GKK L;  1HNW Q;  1Q90 A;  1XNR L;  1EY8 A;  4XYO A;  5E7N A;  4OWT B;  1SAP A;  1RCV D;  1EQT A;  4DUZ Q;  2B2T C;  1S5D D;  4A3I G;  4FNF A;  5L37 A;  3I70 A;  3HOY B;  1LYL A;  3H94 A;  1PZI D;  2V1C C;  2VUM G;  2VQE L;  5DLQ E;  1QVG A;  1WTW A;  4A3E G;  2Z6B A;  1C8C A;  2AWO A;  3I4M H;  1YHB A;  3SE0 A;  2F0P A;  4DK3 C;  1JE5 A;  3I72 A;  5IGB A;  4IO9 A;  4Q5V A;  3IAY A;  1AE3 A;  4GZY C;  4N9P A;  1DYQ A;  1HR0 Q;  4JVZ A;  2K1B A;  4IUN A;  1F2Y A;  3PMF A;  2JSO A;  4DR2 L;  5FO7 B;  3CU7 A;  1AW7 A;  1SE8 A;  3H91 A;  3S1N H;  1KDB A;  2ZJP A;  5EAY A;  2K04 A;  3FP9 A;  5IT9 c;  4BY7 B;  4YCW A;  3GTG B;  1OXS C;  1TS3 A;  4C3J B;  4K2K A;  1EOT A;  3A8I E;  3T56 B;  1R9T B;  4IQZ A;  1ENC A;  2N49 A;  4BBR H;  1B4O A;  1EEI D;  2NWG A;  1WJJ A;  2XRS D;  4JI0 L;  2BH2 A;  1EY0 A;  2OF1 A;  1CK1 A;  1YHQ A;  3P1H A;  2WP8 J;  2SDF A;  4DGZ A;  5M3F H;  2E2J B;  4KKT A;  3ZYY X;  2ZM6 Q;  3FHW A;  1YJW A;  4DNI A;  3GTO H;  3I4N B;  2XRQ D;  4LF7 L;  2K05 A;  4DV3 L;  2BA0 A;  4HIM A;  2BCO A;  2G9D A;  3A8K E;  2NVX H;  4DR4 Q;  1X56 A;  5CYU A;  1L0W A;  1I50 B;  1KLG D; 
#chains in the Genus database with same CATH homology
 3ER0 A;  1YIJ A;  5JEA J;  3CCR A;  2UXD L;  3J80 i;  3M85 A;  4DR5 L;  4HJ7 A;  3RN2 A;  1SFO H;  1VQN A;  2F4V Q;  1CUK A;  4DR7 Q;  2UXB L;  1K8A C;  1E7Z A;  3WWV A;  1NMF A;  4A3F H;  4JCV E;  2VS1 A;  1Q7Y C;  2I5M X;  2E5L Q;  2K50 A;  1EQR A;  4R4O A;  3TQY A;  2OCE A;  3I4N H;  4BBS G;  2KEN A;  1QVF A;  1J6Q A;  1Y14 B;  1PFS A;  3PF5 A;  2E5L L;  4A3B G;  4WJ3 M;  2MQH A;  4AQY Q;  2OTL A;  2WAQ G;  3AEV A;  3A5Z B;  3T1H Q;  1NY4 A;  5JJI A;  4L5S A;  4DV5 L;  3ULP A;  4HIK A;  1VQK A;  3KDF B;  3HOX G;  4MNO A;  1E1O A;  1WCM H;  3FKI G;  1Q8K A;  1XNQ Q;  1ASZ A;  1TWA H;  2YYZ A;  1IXR A;  2GVB A;  4B3M Q;  1TWH H;  2L15 A;  3B6Y A;  3ZJY C;  1YHA A;  4GOP B;  4A3F G;  1KQS A;  1XNQ L;  4NPS A;  2ASB A;  4BXX G;  4DV7 Q;  1GO3 E;  1CSP A;  4A3J H;  1LUZ A;  5JJK A;  4B3M L;  2CQO A;  3PUZ A;  2IX1 A;  3GTP H;  3HOZ H;  3E9I A;  4GNX B;  1IL2 A;  3KF8 B;  1VQG A;  4DV7 L;  4UP9 A;  2MNA A;  4JI2 L;  2JA6 G;  3Q8D A;  2MO1 A;  2KHJ A;  2LXK A;  2OWO A;  3M7N A;  4PZ6 A;  4DR6 L;  1LTL A;  4X66 Q;  4K0K Q;  2N3S A;  1PH7 A;  1VQ9 A;  4GN5 A;  1KAW A;  3PSI A;  1TWC H;  1P8L A;  3G71 A;  3CPW A;  2UUB Q;  4LFC Q;  1X65 A;  2AKW B;  1H95 A;  3PIP A;  1NE3 A;  1U5K A;  4X66 L;  2F3I A;  3TS2 A;  4K0K L;  1Y1W G;  1FL0 A;  1IYJ B;  1GVP A;  3U58 A;  3UDG A;  3PO2 H;  2IX0 A;  4LFC L;  2QEX A;  2UUB L;  4X64 L;  1K8G A;  3DLL A;  1HZC A;  1PYB A;  3G4S A;  1UWV A;  3CW2 C;  3CCJ A;  2JA8 H;  5C0X J;  4C3I H;  1PV4 A;  4LF9 L;  4YWM A;  1EFW A;  2VNU D;  4Y52 H;  1LM0 A;  2AMC B;  5M5Y H;  4DUZ L;  1EYG A;  2A1A A;  1EIY B;  3HOZ G;  1VQJ A;  2R93 H;  1IBM Q;  4FDB A;  1E22 A;  1V43 A;  2Q2I A;  4GKJ L;  2HIV A;  4O0A A;  3UE1 A;  3CP0 A;  1YJ9 A;  4LF6 Q;  5GQO A;  1XPU A;  3KLW A;  2ALY B;  2CKZ B;  5IP9 G;  2I5H A;  2N78 A;  1IBM L;  3RZD H;  5LMN Q;  5HY6 A;  4HIO A;  2IHF A;  4DAY B;  1KRS A;  4DR1 Q;  4QY7 A;  2K75 A;  2PNH A;  4XTC S;  3K7A H;  1VQE A;  2E2I H;  5LMN L;  4DR1 L;  1YNX A;  1WI5 A;  2HQL A;  2WB1 E;  4JOI C;  1L2F A;  1Q81 C;  2DGY A;  3KYH C;  1Q1B A;  4YHH Q;  2K5V A;  3A0J A;  1AE2 A;  4B3S Q;  3GTM H;  3H15 A;  3U4Z A;  1DGS A;  3M4O H;  4JG2 A;  3TRZ A;  3PUV A;  1PA6 A;  1Q46 A;  3CPF A;  4YHH L;  1I3Q H;  2OQ0 A;  1S40 A;  1WFQ A;  1G6P A;  4A3M G;  4B3S L;  3GTO H;  3GD7 A;  1L1O C;  4JV5 Q;  1Q82 C;  3I7F A;  5LMU L;  3NEN A;  4JI1 Q;  3S15 H;  3STB D;  2GVA A;  4HJ9 A;  2RF4 A;  5M5W H;  4HJA A;  1N9W A;  1EQQ A;  4JV5 L;  5JJL A;  3CMA A;  1Q86 C;  2VL6 A;  1VQB A;  2N8N A;  4L5R C;  1A0I A;  4JI1 L;  4J15 A;  3HOY G;  2RHS B;  1XMO Q;  3KDF A;  5LMN W;  5C3E H;  4IPC A;  2JA5 H;  1XPR A;  1X3F A;  1VQ6 A;  2Z6K A;  1Q12 A;  4RMF A;  5J3B A;  4BA1 I;  3E0E A;  1XMO L;  3GTK H;  4PG3 A;  2MO0 A;  4C3H H;  3F1Z A;  2R7D A;  4IPH A;  2JE6 I;  5FLM H;  4LW1 A;  3RLO A;  4TVA B;  1QUQ A;  5GAD C;  4C3J H;  3RZO H;  2JEB I;  3W1G A;  4KI0 A;  3PO3 H;  1R9T H;  1YJN A;  2NZH A;  2D0P A;  3M4P A;  2ZM6 L;  3RLF A;  1VQA A;  2UUC L;  3PGZ A;  1QZG A;  3PIO A;  1GM5 A;  4GNX A;  2B63 H;  1KXL A;  1SRU A;  4BBR G;  2GN5 A;  2ID0 A;  1WYD A;  1VQI A;  2E8G A;  2WB1 G;  3LGJ A;  4JI6 Q;  3CD6 A;  1XPO A;  4DR4 L;  4KHP Q;  3BZC A;  4LUO A;  4DKA C;  3G6E A;  3PCO B;  3MEF A;  2I0Q A;  3CF5 A;  5C3E G;  4GN3 B;  1J5E Q;  2Q2T A;  4P74 A;  1K3R A;  1PH3 A;  1PHJ A;  2E2J H;  5IYB H;  1KC8 C;  4PMW A;  4KHP L;  2F4V L;  4TQU S;  5M3F G;  5M3M H;  4DR7 L;  1J5E L;  3BZK A;  4BY7 G;  2JJQ A;  5C44 H;  1VQF A;  3I56 A;  4Y7N H;  4ME3 A;  1V9P A;  2Y0S E;  1W2B A;  1K73 C;  3GTL H;  3PO3 G;  3RN5 A;  4AIM A;  1VQ5 A;  1HNX Q;  3HOU H;  1VQD A;  1UEB A;  3CAM A;  3NEL A;  4P73 A;  1HNZ Q;  1I50 H;  4AQY L;  3S1M H;  5IP7 H;  3CC2 A;  3PF4 A;  4P72 A;  1K83 H;  1EOV A;  3T1H L;  1HNX L;  3GTQ H;  2KHI A;  3U4V A;  4DK6 C;  2NN6 G;  4DPG A;  1HNZ L;  3I55 A;  1RIP A;  5H1S E;  1YIT A;  1BVS A;  1YVC A;  3CME A;  3OTO Q;  1XTD A;  1QUQ B;  4PZ8 A;  3IRB A;  1VQM A;  1L1O A;  4DR3 Q;  3HKS A;  4JC0 A;  5JEA G;  1M90 C;  1E24 A;  3T1Y Q;  3I4N G;  1A63 A;  4MTN A;  4QL5 A;  3OTO L;  1UE6 A;  2EQS A;  2DUD A;  4YCV A;  3H3V H;  4NXN Q;  4POG A;  4DR3 L;  4NB3 A;  4ALP A;  3TEH B;  3S16 H;  4IFD I;  3HOU G;  2KCM A;  2JEA I;  1M1K C;  4R4I A;  3HKZ E;  1SR3 A;  4A3K H;  1X6O A;  3S24 A;  1WCM G;  3AQQ A;  3KF6 B;  5IP7 G;  1HZA A;  4HJ8 A;  3HFZ B;  3J80 c;  3GO5 A;  1CKM A;  1HZ9 A;  3J81 i;  2QGQ A;  4JBJ A;  4H02 A;  5FJ8 H;  2ZTC A;  2K4K A;  4A3I H;  1B70 B;  3ULJ A;  1TXY A;  3S1R H;  3NBH B;  4POF A;  1EWI A;  4A3J G;  4JBK A;  1JT8 A;  1UE7 A;  2R7Z H;  2VUM H;  1YBY A;  2NN6 I;  4IJL A;  4AYB E;  4DV1 Q;  2Y0S G;  4GKK Q;  4WJ4 A;  1NBW A;  3K80 C;  1QZH A;  5C4X H;  2B29 A;  2I5L X;  3W1B A;  4OO1 G;  2B3G A;  4JYA Q;  3M4Q A;  1KHI A;  4B3R Q;  3EIV A;  2CFM A;  1CSQ A;  2OQK A;  2R7F A;  4RG1 A;  4LF6 L;  2D0O A;  1OXV A;  4UP7 A;  1L1O B;  3RLN A;  4JYA L;  3JC6 6;  4HJ5 A;  2KBN A;  3PO2 G;  4B3R L;  3DM3 A;  1TWG H;  1XJV A;  1O7I A;  2BH8 A;  4JI8 Q;  4YY3 Q;  1VQ7 A;  2IT1 A;  1S3O A;  3M9B A;  3D0F A;  4UP8 A;  2JA8 G;  1NJI C;  3MXN B;  2R7Z G;  3F2D A;  1KD1 C;  5GAE C;  4YY3 L;  3HOW H;  4BA2 I;  2R93 G;  1VQL A;  1C9O A;  2JA9 A;  3JAM i;  1VQ4 A;  1IBK Q;  3HKZ G;  1OTC A;  4LF5 Q;  5C4X G;  3SGI A;  3AFP A;  4GN4 B;  3EBE A;  4LF4 Q;  4LUV A;  4YCU A;  1I6H H;  1RL2 A;  1IBK L;  3G48 A;  4LF5 L;  4A93 H;  3H3V I;  4DR2 Q;  1KIX A;  4QIW E;  1X55 A;  2CCZ A;  4LFB Q;  4LWC A;  4OWW B;  4OO1 I;  3F2B A;  4EQ5 A;  2ZJQ A;  3UE0 A;  4OWX B;  4LFB L;  4AYB G;  4QJF A;  1VS0 A;  4GLX A;  2QA4 A;  4OX9 Q;  1V1Q A;  1YEZ A;  1Z9F A;  4XIG S;  2UXC Q;  5K36 G;  2JK8 A;  1I94 Q;  1KL9 A;  2ZJR A;  2C35 B;  4OXP A;  3GDE A;  3L0O A;  4YWL A;  2F52 A;  4P71 A;  5IWA Q;  2NVY H;  4OX9 L;  4A3G H;  2NVT H;  1I5F A;  2ZTD A;  2K5H A;  2UXC L;  3S2H H;  1I94 L;  5IYD H;  1MKH A;  1MJC A;  4A3C H;  4X65 Q;  3H0G H;  5IWA L;  5IY0 A;  3HOV H;  1EIF A;  3NEM A;  4JI4 Q;  5C0X I;  1PVO A;  3F2C A;  1ASY A;  2HT1 A;  4X65 L;  1XMQ Q;  2R92 H;  1PH4 A;  1SRO A;  4QQB X;  3CCS A;  2PQA B;  4JI4 L;  4IOA A;  2PMZ E;  1N36 Q;  4JI5 Q;  4JI3 Q;  1IZ6 A;  3GTJ H;  1HH2 P;  5HGQ A;  1XMQ L;  1PH6 A;  2JA5 G;  4BY1 H;  3KF6 A;  4JBM A;  4A3L H;  4IFD G;  2HIX A;  4R4Q A;  4JI6 L;  1PH2 A;  4BBS H;  1N36 L;  1UE5 A;  4JI5 L;  2Z0S A;  1QVC A;  2Q2H A;  1G29 1;  4UPA A;  4JI3 L;  1JJ2 A;  3J7A 5;  4OON A;  4A3B H;  4A3G G;  5FLM G;  4IPD A;  1X3E A;  1K9M C;  5IYD G;  3A74 A;  1Q1E A;  1CKN B;  3H0G G;  3OW2 A;  3S17 H;  2WFW A;  4DV6 Q;  3KJP A;  2UXB Q;  3HOX H;  1JJG A;  4JOI A;  1FVI A;  2LSS A;  3CQZ H;  3D31 A;  1OXX K;  2RCN A;  3FKI H;  1T9H A;  5FLX c;  1N34 Q;  4APV A;  2B63 G;  2R92 G;  4DV4 Q;  4L5Q A;  3PUX A;  4DV6 L;  3M3Y H;  5C4J H;  4IOC A;  1MIU A;  4KHZ A;  4P75 A;  1OXU A;  3KOJ A;  5GAH C;  1G51 A;  1N34 L;  2Q2U A;  3S2D H;  4A3L G;  4BY1 G;  1W3S A;  3OYY A;  4LUZ A;  4DV4 L;  4BXX H;  3E9H A;  3ERS X;  4JBW A;  1VQH A;  4AH6 A;  4KLK A;  5IYB G;  4R4C A;  1EUJ A;  5M3M G;  1X9N A;  4UY8 C;  4EX5 A;  2IY5 B;  3K81 C;  4DV5 Q;  1UE1 A;  4C2M H;  5C44 G;  3S1Q H;  2JA6 H;  3L7Z C;  2H5X A;  1Y1V H;  4DV2 Q;  4R1J A;  1C0A A;  3TRE A;  4LFA Q;  1CKO A;  2YTY A;  5GAG C;  3T1Y L;  5IYC H;  1SN8 A;  1BKB A;  3S14 H;  1E3P A;  2ZTE A;  1N32 Q;  2LXJ A;  3AFQ A;  4NXN L;  4DV2 L;  3I4O A;  3L2P A;  3F8T A;  1NMG A;  4LFA L;  4A76 A;  2R6G A;  1Y1W H;  3CC4 A;  1FGU A;  1SLJ A;  3STB C;  1N32 L;  3K8A A;  4DUY Q;  1GD7 A;  1N8R C;  2CWP A;  2HHH Q;  4JI2 Q;  2OTJ A;  2K52 A;  1JB7 A;  4DV0 Q;  5GRO A;  2UUA Q;  4NXM Q;  4IPG A;  3CCQ A;  4DUY L;  4DR6 Q;  3K7U C;  1PH9 A;  4HID A;  2HHH L;  2JA7 H;  1GKH A;  4A3E H;  1HZB A;  3CCU A;  4NXM L;  4DV0 L;  2UUA L;  4L5T A;  1Y1V G;  3UDF A;  3W5O A;  4PZ7 A;  3J7Z C;  1JMC A;  3RNU A;  1XNR Q;  1SMX A;  1C7Y A;  3PV0 A;  5IYC G;  3EN2 A;  5IP9 H;  2Z6K C;  2UU9 Q;  2ATW A;  4A4I A;  3U50 C;  4DV1 L;  2VW9 A;  4X64 Q;  4A3K G;  4GKK L;  3I2Z A;  1HNW Q;  1XNR L;  5E7N A;  3PUY A;  4OWT B;  2UU9 L;  4GOP C;  4LF9 Q;  2D62 A;  3CCV A;  5FJ8 G;  4DUZ Q;  1HNW L;  2BA1 A;  2VQE Q;  4A3I G;  4A3D H;  1K0R A;  2YV5 A;  1JJC B;  3CCE A;  3AYH B;  1D7Q A;  1OXT A;  4GKJ Q;  4GNX C;  1LYL A;  3K0X A;  4YWK A;  2V1C C;  2VUM G;  2VQE L;  3A5U A;  5DLQ E;  1QVG A;  2JA7 G;  1E1T A;  4A75 A;  4A3E G;  2KCT A;  4JI8 L;  3TS0 A;  1VQC A;  2AWO A;  2VQF Q;  2PQA A;  2EIF A;  3I4M H;  1N33 Q;  3BJU A;  5C0X G;  2NVQ H;  1FJG Q;  1YHB A;  3RR5 A;  4DK3 C;  4IO9 A;  1JE5 A;  4A3M H;  4X6A H;  2VQF L;  1N33 L;  4X62 Q;  3VDY A;  1AE3 A;  3CCM A;  1FJG L;  1HR0 Q;  1D8L A;  3J81 c;  4LF4 L;  3J81 j;  4QGU A;  1A8V A;  1TWF H;  1BBW A;  1PYS B;  1NTG A;  1YI2 A;  4GS3 A;  2K5N A;  4X62 L;  4LNQ A;  1VQO A;  4GLA C;  4A3D G;  3HOY H;  1HR0 L;  1CKN A;  4DR2 L;  4GLV B;  2PI2 A;  4O2D A;  1HJP A;  2ES2 A;  1VQ8 A;  2CWA A;  2EXD A;  1SE8 A;  3HOW G;  1PH5 A;  3S1N H;  1YZ6 A;  3I4M G;  1X3G A;  3PUW A;  2ZJP A;  1B8A A;  1P16 A;  5EAY A;  1Z47 A;  5LMU Q;  3FP9 A;  2A8V A;  1VQP A;  5IT9 c;  4YCW A;  1OXS C;  3UDX A;  1X54 A;  2YU9 H;  2WAQ E;  2A19 A;  3ULL A;  2AWN A;  3KFU A;  4IJH A;  4A93 G;  1AH9 A;  2VZA A;  4JI7 Q;  4JI0 Q;  1PH8 A;  2RHQ B;  2N49 A;  4BBR H;  5ELO A;  1BBU A;  4DAM A;  2VY3 A;  2XGT A;  4IFD J;  3ICE A;  4JI7 L;  1WJJ A;  4JI0 L;  2BH2 A;  3BU2 A;  1YHQ A;  2JQO A;  4MZ9 A;  5ELN A;  3CC7 A;  2NZO A;  1B7Y B;  2IHE A;  2WP8 J;  1IBL Q;  5M5X H;  2YTV A;  1VCI A;  4LF7 Q;  2FXQ A;  4DV3 Q;  4LF8 Q;  3JAM c;  5M3F H;  1HR0 W;  3CCL A;  4BY7 H;  3GTG H;  2ZM6 Q;  1U0L A;  3FHW A;  1YJW A;  4DNI A;  5BR8 Q;  5AJ3 Q;  2K14 A;  4GOP A;  1IBL L;  2YTX A;  2UUC Q;  4B3T Q;  4LF8 L;  4LF7 L;  4DV3 L;  2XTI A;  2BA0 A;  4HIM A;  1WOC A;  3UDI A;  1MJE A;  4A3C G;  1S72 A;  2NVX H;  5AJ3 L;  2PI2 E;  5BR8 L;  4DR4 Q;  3HOV G;  1KRT A;  1X56 A;  4B3T L;  1L0W A;  3KJO A;  4DR5 Q;  2UXD Q;  1PH1 A;  2AHO B;  2MFI A;  1A62 A;  4R4T A;  2E2H H;  5IE8 A;  3CXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...