3FHZA

Crystal structure of the arginine repressor from mycobacterium tuberculosis bound with its dna operator and co-repressor, l-arginine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
b'ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
total genus 39
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fhzA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3fhzA02
2P6TA 5K5QA 1K78A 1FNNA 5ILVA 1FYKA 2E1CA 4HW0A 1R1TA 4PCQA 3RJPA 5LEJA 2CGPA 1YW9A 1S29A 2WC2A 2QUFA 2P5VA 5AONA 4O6JA 1JHFA 2RGVA 3TQNA 1S7OA 1G3WA 3EUHA 4N0BA 1IXRC 1YFHA 1BC7C 2RVCA 1UHMA 5BOXA 2FBKA 1U5TB 2P7VB 4M72A 2IW5A 1ZN2A 2FRHA 3TGNA 4Z2YA 1J0RA 4U0WA 3TOBA 2V6CA 2XHKA 3TO7A 4A6EA 3ECOA 2AS5F 4ESFA 4U88A 3RPUA 3QP6A 1F1ZA 1P6RA 1YIOA 1T0FA 4OMYA 3WTTC 2F5EA 4EM0B 2Z33A 4RB3C 4JBAA 3BZ6A 3HRUA 3ROUA 2M1BA 2H27A 1K78B 1XXCA 3GFLA 3WTZA 4WXHA 4FHTA 3SQNA 5LRSA 2OQGA 2XAGA 3IWZA 3B73A 1EH8A 2EFNA 1ULYA 2FXAA 1ZGAA 2P4WA 5CVRA 5D6EA 3RYRA 4WXCA 3FZVA 4S04A 4HDUA 3J81Z 4KT5C 4Y13A 5JFRA 3VOEA 3M7GA 4FM9A 4HV5A 5FO5A 2EFPA 1OYYA 4YFKF 4A0XA 4HF2A 1KQ8A 5ICEA 1RI7A 4G6QA 2KRFA 1I1SA 3E6DA 4OIOF 4QWQA 4M9SA 3T1BA 3KP2A 1FWZA 4HX4A 1GE9A 3IRRA 2ZFWA 2RN7A 3DV8A 1VTNC 2FA5A 1IS1A 3GZ6A 2F2EA 3VB2A 2F5DA 2XASA 1FBQA 3F6OA 1GHCA 3FM5A 2IA2A 4EJTA 3MQ0A 4J3NA 3DXJF 3H92A 1WI9A 4M74A 2FE3A 1XGMA 2QZ8A 2Z9OA 3WE3A 4YFXF 2ZMEB 1FC3A 2QM3A 1B9MA 2PEXA 4MEYF 1BI1A 4XRFA 3GEZA 4HZFA 4A5NA 3IKVA 4L18B 1O7LA 3L7WA 3C3WA 4UV9A 4KICA 3R0AA 3KP6A 3M8EA 1WQHA 3SFZA 2DFIA 3KEOA 1L0OC 1OMIA 2HYFA 2EV6A 5ICGA 2UXNA 2DPDA 1CF7A 1LQ1A 2BBYA 3L2CA 4KIGA 4N9IA 2A61A 2X0LA 2CQKA 2XRNA 4P96A 4XLNF 1B1BA 3FOFA 2J5OA 2JSCA 3TDZC 3MAJA 2A6HF 3OOPA 3IL2A 1FP1D 3HUGA 5CVIA 5J8FA 3SHFA 2PBIA 2MBFA 4I09A 1RUNA 3E5UA 2F5FA 5LGNA 1USSA 4LD5A 1EH1A 1BM9A 4OIPF 4AVPA 1WRJA 1HKSA 5HLGA 4I02A 1USTA 4HAMA 1EV7A 3FF5A 2RV8A 2DO7A 4CICA 1FBUA 1W7PA 5F6FA 2FMLA 3V7CA 4EM2A 4LK1F 1H9GA 5CJ9A 3JAMZ 3KETA 1GXPA 3FMRA 4RB0A 3I64A 1DPRA 2RC4A 2ZNYA 1G3YA 1ZYRF 5CLSA 3DP7A 1F9NA 3KLNA 1LNWA 4BH9A 3W6JB 4RAZA 1XXAA 1HXDA 2JTVA 3KP7A 4GXOA 3T5XA 1XSXA 2LF8A 3KP5A 4PZJA 2HKOA 1KQ9A 4LG0A 2A07F 1GXQA 5EEGA 2OU2A 5DCMA 4IF4A 1XCVA 2GZWA 1MDMA 3DEUA 2VE8A 4MQVA 2M87A 5E8GA 5H20A 3MMLB 2NYXA 2G7UA 3RI4A 5LRRA 5DD8A 1W7PB 4CO8A 2CSOA 2QQ9A 3BWGA 3FXRA 3DPTA 1R5HA 5FFXA 1BN5A 1V4RA 3VFZA 1O3SA 1IZ1A 1QO0D 3JSPA 3V7SA 2FMYA 1FSHA 2EFOA 4B09A 3QU6A 1KYZA 4BHCA 4QLCU 1IN4A 1U78A 1XDUA 4G7ZF 2D45A 1U2WA 2Q2EA 4GCVA 5E1XA 1U8RA 2EK5A 3PQJA 4JQFA 3LAJA 3H3UA 4MQ9F 2L4AA 4EJOA 2FU4A 1ZRFA 3MZYA 3GUDA 1MDMB 3GX4X 2ZCWA 2CO5A 1J75A 1YLFA 2HOEA 1KU7A 3I54A 4EV0A 1ZAOA 2BE5F 1ZHFA 1R58A 2TDXA 1E17A 3C7JA 3E3VA 4A12A 3C18A 3W6KB 1RUOA 2Y75A 4ETSA 4KDPA 2P5LC 3HYIA 2YPRA 3WG9A 3J80K 3EDPA 1B4BA 4MHGA 4UNOA 4UVCA 3GFJA 3SZPA 3RYPA 1IN5A 3ULQB 1TBXA 3BJOA 2STWA 1Z91A 2EJRA 3R60A 3E97A 3MWMA 5JVOA 4G7OF 4RGRA 2DI3A 4OU0A 1I27A 3F6VA 3KP4A 1SD7A 4CGZA 4RGXA 1BIBA 1WQFA 3QAHA 1D3YA 4I01A 2ZNZA 2K27A 2QLZA 3JSOA 4G9YA 5AIPA 1IF1A 5E17F 4FX4A 4HF0A 3V7RA 2GAUA 4IPAA 2XROA 3BROA 4I7HA 4WF2A 3HOTA 1B9NA 3FWEA 2P6SA 4A5MA 3K1NA 5HS9A 5ILSA 5E1WA 2ZFZA 2MD5A 1AB4A 4KC6A 5L3BA 1ZREA 4I98B 4H0EA 1B59A 3CAGA 1O57A 5CVVA 1ISEA 3T0YA 2ELHA 5HLHA 1LB2A 4ZZDA 1H9TA 3I4PA 1L3LA 3WTVC 4LLGF 1Y0UA 4KIFA 1F4KA 5LHIA 1SD6A 4ENJA 1KYWA 1ZARA 1ZLKA 1TNSA 2HGCA 3JW4A 4Q47A 2CYYA 1DD5A 2FBHA 1JXSA 5LHHA 1QGPA 3JTHA 2DTRA 2VT2A 2HTSA 4PGHA 1QZZA 1H0MA 3HHHA 3VODA 2QQBA 2K4BA 4E70A 1W4MA 2VODA 2Y3PA 3GWZA 2V1XA 4WWCA 1V3FA 1YTYA 1BI0A 4WX9A 1XDSA 2H09A 3L4JA 1P2FA 4G0WA 3LQQA 3ZMUA 1FYLA 1P4XA 3I58A 2KJBA 1U3EM 3KZZA 2DU9A 3WE2A 1REPC 3RIRA 3HSRA 5LHGA 3F21A 5AIQA 3OREA 1P92A 3J80Z 3REOA 1FP2A 1IN6A 4WK8F 4RB2C 2ISZA 1QNTA 2C6YA 5DV5A 2R3SA 2KIFA 5ILUA 4LK0F 4MEXF 1HSJA 1FBSA 3IWFA 3AAFA 4ZYEA 4L9VA 2IA1A 2P8TA 4LB5A 2IA0A 2GXBA 2ZMEA 3BY6A 2GXGA 2IVMA 4G0UA 5L3DA 2HWVA 1BI3A 1KA8A 2DBBA 4GO1A 3ZMSA 2M5WA 4AIJA 2A69F 2FBIA 1FX7A 3N97A 4YFNF 2WTEA 2ETHA 4G8XA 5FLXZ 2ZBKA 3PQKA 1ZGJA 1SD5A 1DDNA 3BJAA 3KCCA 4MTEA 2PI0A 1IXSB 5K5RA 1Z1DA 4I0AA 5FD5A 1G3SA 3E5QA 1HW5A 3BUEA 1T98A 4L0ZB 2L4MA 1PP8F 2EB7A 1GVJA 2EWNA 2F5CA 3FOEA 5H6RA 3D0SA 1K79A 3I71A 4IVNA 2XVCA 3P9IA 1KGSA 5JR3A 5F64A 4RAYA 4EQQA 1TW3A 4O5VA 2MH9A 2GIVA 1FYMA 2VC1A 4LLLA 1OR7A 2Z3YA 1QBJA 2HR3A 2WV0A 4L9JA 2FF4A 3TOAA 4BYYA 5E1ZB 3HTUA 1T39A 3C1DA 3DQVC 1MJAA 2O03A 3LWFA 3T8TA 4NHJA 1Z9CA 2GA2A 4LGWA 1DUXC 5ED4A 4AD9A 3E6CC 4L5JA 3L09A 2LKPA 4Y17A 1P4WA 4I0BA 5E8IA 3JTGA 1MGTA 5HS7A 2O61A 3O3KA 4DDQA 3RKWA 3CLOA 2P5KA 2OQRA 2G7HA 2FQ3A 1BGWA 2NNYA 1SFUA 1SD4A 5LBQA 1XGSA 2CWEA 2UWMA 3EYYA 4BAYA 2L01A 4OIQF 1ZRCA 1XB4A 1XGNA 1Z6TA 4U7BA 2VXZA 3LA2A 4P9UA 4KB2A 3ZN1A 4L9NA 5CVUA 2VBZA 1A04A 1W5SA 1XD7A 4GYGA 2DAOA 1ZH5A 2DW4A 3R6SA 3D5LA 3KE2A 3QOPA 2O8XA 2CFXA 1IN7A 5DCFA 4ZH4F 5HDGA 5KVRA 5K1YA 4HA8A 1YW7A 2IRFG 4XLPF 3P7NA 1R5GA 3KEQA 2O0YA 3HSFA 3HIFA 2RDPA 1X3UA 5CVJA 4CYDA 5LGUA 1IRFA 3WU0A 4Y15A 2L54A 3TO6A 2JT1A 1ODDA 4ZYGA 1HW2A 2QQAA 2FSWA 4P55A 4HX8A 2Q8KA 2PLYA 1J7KA 2XCOA 2K7LA 3ZP5A 3L4KA 3F8FA 5A2QK 2A68F 3TO9A 5JHUA 3O6BB 2COMA 3M1EA 4HV6A 5L3FA 3CTAA 1EH6A 3SZTA 2JRTA 2QBYB 2VBWA 3ZMZA 2DT5A 3F72A 1IN8A 2QWWA 4L0YB 4ON0A 1W7PD 1JHHA 4S05A 1SMYF 1YG2A 4IRIA 5L3EA 2A3SA 3VEPA 3I0TA 5KK1A 4O3MA 4IJAA 1MD0A 5D4RA 4HLYA 2E1NA 2V79A 3FMQA 3EQLF 4LJZF 2LF7A 1FLIA 5D5XB 1TLHB 4P5OA 3L9FA 1FZPB 3GFMA 3BP8A 3T8RA 1S7AA 5ICFA 4HOBA 5D5VB 2XCRB 2G9WA 3V8JA 3F8CA 1B6AA 4D0PA 5BQTA 4U7DA 1XMKA 2HYGD 3TDUC 4M6XA 5DYMA 1D5VA 1IUYA 3F3XA 3FHZA 4KMUX 3QP5A 3IC7A 3I53A 2GA1A 3I59A 2YX7A 1S3JA 4F7ZA 2VN2A 3WGIA 3ISPA 3LA3A 5HLIA 1ZLJA 5DUKA 4ZYDA 4JK1X 3ECHA 3GF2A 4U0VA 4BXUA 4UHTA 4UVAA 2A5YB 1KU2A 1XCBA 1FY7A 1Z7UA 5F1RA 5D5WB 3O2PE 2HQRA 1WQGA 3RTRA 3OPFA 2KIUA 3U1DA 2PMUA 1NHAA 4RS8A 4YIIA 2L02A 4Q4ZF 1RNLA 2W57A 2VC0A 4B8XA 3GFIA 4OINF 5BPDA 3IKTA 1AOYA 1TW2A 1R36A 4RGSA 4OOIA 2HDCA 1TTYA 2ZO4A 4M73A 2FNPA 2MLKA 5LLQA 1Z05A 5J8CA 2DQLA 4CZZA 3LQRA 3I59B 5D8KB 1Z6RA 4Q5SF 2H6CA 3QX3A 3KLOA 4KB4A 3J81K 2V1DA 3BOQA 4G6DA 4YG2F 3NEUA 1IW7F 1XN7A 5A2QZ 2R7DA 2L3DA 1YW8A 2OZUA 3WU1B 4GFQA 2XAJA 4PDKA 3KFWX 3ML6A 4M71A 1RIOH 5IT9K 4TV7A 2IPQX 1J59A 3ZN0A 2XV4S 4EVIA 2KJCA 2YU3A 3NUHA 1MJ9A 3RDIA 2OAZA 3GO5A 4HLXA 1PP7U 3U9GA 3FXUA 4KNYA 4KYWA 2ZXJA 4OIRF 2MLGA 2Y0MA 3HOSA 1J2XA 3RKYA 2VONA 4R1HA 3GLXA 1J9IA 2E7WA 4KUMA 1R23A 3H3ZA 3ZQ7A 2K4JA 4BQAA 1LEBA 1QQIA 3K9TA 2GWRA 1HKQA 4DNCA 4ENNA 1EK8A 5HDKA 5BS6A 5BPIA 4P9FA 4ESJA 3MZHA 3NQOA 1LDJA 1HQCA 1MJBA 1T38A 3K69A 5ERIA 1KQ0A 1LEAA 2QENA 3WGHA 3E6MA 1O3QA 3V4GA 2H6BA 2CW0F 2RGRA 3CUQC 4BNCA 3F23A 5D8LB 2XAQA 2M8EA 4L5IA 1T2KA 2VOPA 1PUEE 4BHPA 1UHWA 2OZ6A 2HZTA 2XAHA 4LFUA 2K02A 4NQWA 2FEZA 3M9AA 3QRFF 2W85A 1OPCA 2DK5A 4IRGA 5TJJA 3GW2A 2YX4A 2KWAA 4CDGA 1QPMA 4ESBA 4DQ2A 1Q1HA 2YR2A 1AWCA 1ZG1A 3MFKA 1LDKB 3G73A 3WTWC 3R61A 3BPVA 1T6SA 5E18F 2XUBA 3DPLC 3FXQA 4KIBA 4UV8A 2RQPA 3F8MA 2KKOA 1BIAA 3RPQA 5DEQA 4OMZA 1MZBA 1ON2A 4FX0A 4ENMA 3VA7A 1IRGA 1D8JA 1KU3A 2MC3A 3DKWA 2OBPA 4HQEA 4EMSA 2Z5UA 4N9HA 3CUQA 3SXYA 1WIHA 3JAMK 4BHBA 4AWXB 3K1MA 2PFBA 3KP3A 3KZYA 1O3RA 3OEPA 1C0WA 3OV8A 4G94A 3I5UA 1IAWA 3IHUA 3NRVA 4UUVA 2YSRA 3BDDA 4KN4X 5IT9Z 1JGSA 2XCQA 1R7JA 1YYVA 5E20A 3Q9SA 5EEHA 1K6OA 3F22A 1D8KA 1HBXG 1STZA 3DFGA 3CO6C 4K2EA 1KU9A 1TQPA 4A2UA 4L9TA 3TKYA 2MH2A 2VE9A 2HTJA 4EJVA 5DDGA 1PDNC 2HFHA 3ZMVA 3LAPA 4KAWX 2ESNA 2PMHA 4CHUA 4WXDA 2O6GE 3F8NA 4A6DA 1S6LA 1I6XA 2PG4A 1OYWA 3QPHA 1SAXA 4Q48A 5D5UB 1WKMA 1FPQA 2LSOA 2FNAA 1LVAA 3CO7C 3HHGA 4G0VA 1XSVA 3P9KA 3CUQB 4HQMA 2IP2A 2XAFA 1DPUA 1I1GA 5JI6A 2NRAC 3FMSA 1BC8C 3QPTA 3M8FA 4HYEA 3V8KA 3WTYC 1CGPA 4WCGA 1F5TA 2VT3A 5TRDA 2DLLA 2PHCB 1ZVUA 2HKXA 4YIFA 3E6BA 4HX7A 2D1HA 1SMTA 1YQAA 2KIMA 1XXBA 3HRTA 3HRMA 4MGRA 1UB9A 2O3FA 3FX3A 2W84A 1LDDA 2LDUA 3R4KA 2P7CB 2Y48A 4UXNA 1G4DA 3MCZA 2D2WA 3WODF 3WTXC 4A0ZA 4CXFA 4MTDA 1ZRDA 2QBYA 2BGCA 3EYIA 3CJNA 2CG4A 1I5ZA 4KDDA 3ABUA 1OYIA 5LGTA 2VBYA 4XSXF 1FSEA 1J5YA 4U0YA 4EJWA 2QVOA 2MA3A 1BJTA 4KFCA 1R00A 1UCRA 3WTUC 2ESHA 2J5PA 4RB1A 2DPUA 2V9VA 2B0LA 3CUOA 5DD4A 3ABTA 5L3GA 3WTSC 2R7FA 2Z99A 1ONVA 1YO5C 1DP7P 2E7XA 1CF7B 2BYVE 3F8BA 2OA4A 3E5XA 3FM3A 2D1VA 1BI2A 4M6YA 2XIGA 3EETA 4EJUA 1FOKA 1K7AA 4M9ZA 3Q9VA 2XKPA 2EFQA 1IXCA 5BMZA 1P4AA 3N4MA 3ZMDA 3GXOA 4ZYHA 4LB6B 5IT3A 3RKXA 3GZ5A 2XGXA 2GQQA 4AIKA 2VBXA 1HKTA 5FB2A 5FD6A 4EGYA 1R1UA 3BJ6A 2W24A 3MEXA 3WGGA 2ISYA 1G6NA 3BPXA 1E2XA 5JVTA 5ICCA 2UZKA 3COAC 4XSZF 1R1VA 1FT9A 2EA2A 4HF1A 2ADUA 1ZG5A 1XMAA 5H6QA 2IT0A 3IRQA 3LA7A 2JPBA 4HBLA 4RGUA 5D6FA 2PJPA 2A6EF 3V8LA 3QU3A 4LMYA 4KN7X 4EM1A 2BEOA 2QYOA 2EV0A 3LSTA 3HTSB 5J6XA 3K1PA 4KMFA 3HRSA 1ZG3A 4GGGA 2RKHA 5K5OA 5D4SA 2ZKZA 4LLNA 2K86A 3K2ZA 3L00A 2X4HA 4AIHA 2H94A 4LG0B 5LEKA 4XBFA 5CYVA 1RZ4A 1TNTA 1XGOA 5HVQC 5DCMB 1G3TA 3GYHX 4I2OA 1WSUA 2EFWA 1W5TA 2AXLA 1HW1A 4ASNA 2VOOA 3LPXA 2XKOA 1QZYA 1WQ2A 3G3ZA 2JPCA 3LFKA 2PQ8A 1TQMA 3DF8A 3ERED 2HEOA 2OD5A 2Q0OA 2V1UA 2NNNA 1LJ9A 4MNUA 1O7FA 4PGGA 1U5TC 4IXAA 1O3TA 3ELKA 1YS7A 2JZYA 4HDVA 5L3CA 3R0JA 3ZPLA 1EH7A 3K0LA 4UVBA 2RNJA 4M9XA 1HSTA 4IHSA 5DUIA 2NS0A 2LNBA 2P5MA 2FOKA 4R8HA 2M30A 2HQNA 1B4AA 2M45A 1JE8A 4NB5A 1SFEA 2NAZA 3ZMTA 3S2WA 1XSDA 1MKMA 1ON1A 2UXXA 4IRHA 2PN6A 2DQRA 3GVAA 3Q5FA 5HDNA 5FLXK 3P9CA 1R22A 1SFXA 2DK8A 2IJLA 1U6GA 2HS5A 5HS8A 1WWXA 4ZZLA 3U2RA 1BBYA 4IHTA 2ZJ2A 2EA4A 6PAXA 5FGMA 1U5TA 1YS6A 4R79A 2WWYA 2W25A 2BV6A 5FFZA 3B02A 3PFIA 2ACJA 5HOOA 1OKRA 4G7HF 1BJAA 3CDHA 4GYIA 4KA4A 3HSEA 1S8NA 4ENKA 4A0YA 2EV5A 1TQIA 4FT8A 3J7AO 1UFMA 4EGZA 2STTA 1BOAA
chains in the Genus database with same CATH superfamily
5F27A 1BL0A 2CV1A 3BG6A 2P6TA 5K5QA 5FRMA 1K83C 2X9DA 1K78A 1FNNA 5ILVA 1FYKA 2E1CA 3PO3C 4HW0A 1R1TA 4PCQA 3RJPA 1SVOA 1R9TJ 3LOCA 2BXYA 5JLXA 5LEJA 3DKYA 2CGPA 4KMDA 2K9SA 1YW9A 4DJAA 2VUMA 1S29A 1YX3A 2LD5A 2I5UA 2KP6A 2VJ4A 2WC2A 3CLQA 2QUFA 1ZQ3P 2KDOA 4PFOA 3CC2I 2P5VA 3IV5A 1JI8A 1O2BA 5AONA 4O6JA 4A3CK 1JHFA 2O7OA 3FXKA 3UR3C 3QODA 2RGVA 5K7HA 2H8WA 3HOWC 3TQNA 1S7OA 3SYTA 2V26A 5F04A 1G3WA 3EUHA 3ZQQA 2WA0A 4N0BA 4YFKA 1IXRC 1YFHA 2LREA 2LY1A 3ZCOA 4A93K 1MBEA 1BC7C 2RVCA 1UHMA 1FOYA 2EBIA 2ICWG 5BOXA 2FBKA 4E6KG 3GTKC 4I99C 1U5TB 2P7VB 3BTIA 2XGEA 3C2BA 4M72A 4HNUA 3PNTA 2IW5A 3GTOK 1ZN2A 1O4XA 2FRHA 4XN0A 3TGNA 2M0CA 1J0RA 4Z2YA 4U0WA 3CQZC 2DFEA 1LUJB 3TOBA 3BTLA 4O2DA 2V6CA 2XHKA 3TO7A 4A6EA 4AU7A 5J4YA 5TMCA 5B3SH 3ECOA 2AS5F 4ESFA 4BL0B 3HB9A 4U88A 4KN7A 3RPUA 3ERMA 3QP6A 4E7ZA 2ZC2A 3H1CA 1F1ZA 1P6RA 1YIOA 4XNFA 2DT6A 4MFEA 2XF5A 2O5RA 1T0FA 3C2HA 4C2UA 3IUOA 3WTTC 2F5EA 2JVHA 4EM0B 2Z33A 4OMYA 5FRNA 3S1MK 4RB3C 4JBAA 2BW3B 3G2BA 3BZ6A 3HRUA 2OV7A 3ROUA 5IP9J 2M1BA 3PJRA 3VDXA 2H27A 1PUFB 3S2DC 1K78B 2E2HK 3OYMA 1XXCA 3F0CA 3GFLA 3WTZA 1Z7LA 4PUSA 3K7AJ 4WXHA 3GEHA 1T95A 4FHTA 1BDFA 1Y1WC 1B72A 1OR7C 3SQNA 2OQGA 2XAGA 3IWZA 5GPCA 5LRSA 3CMAI 3B73A 1EH8A 2EFNA 3GTJA 2X1EA 3VWBA 1ULYA 2FXAA 1ZGAA 2P4WA 5CVRA 3SJMA 3HOZJ 1IQ0A 5D6EA 2BY2A 3RYRA 3HC7A 1D0XA 4WXCA 3DTKA 3FZVA 4S04A 3Q3SA 4HDUA 2V6UA 5C44J 3A02A 1OJLA 3LFUA 1J6WA 4NUBA 4BBRJ 3FK7A 3J81Z 4A3BK 1KONA 4KT5C 4Y13A 5JFRA 1I50J 3VOEA 2VJIA 2ID3A 3M7GA 1VQ6I 2WAEA 3RKQA 4ZTJA 4FM9A 2JA5K 1V54H 1WJ5A 4NDLA 4HV5A 2MG4A 5FO5A 4A3GC 1QA6A 2KQRA 2COBA 1MSEC 2EFPA 2OCEA 1OYYA 4YFKF 1D0ZA 4A0XA 4HF2A 1KQ8A 3LSKA 5ICEA 1RI7A 4G6QA 2KRFA 3TP0A 1I1SA 3PUFA 3E6DA 3G1LA 3VYTB 4OIOF 2VUMK 5B66C 4QWQA 4M9SA 3ZQHA 3T1BA 3KP2A 3G1OA 3KYCB 4ANJA 1FWZA 1X3WB 4HX4A 3BR5A 2NVQJ 4AH6A 1GE9A 3DBHB 3IRRA 3HOUJ 3BG9A 2ZFWA 2RN7A 3HJEA 3DV8A 1VTNC 5KAFC 3OYBA 4DYRA 2FA5A 1IS1A 1J6XA 3GZ6A 5CPRB 2F2EA 3VB2A 2CQQA 2XSJC 5C3EJ 2F5DA 2XASA 3WODA 1FBQA 1P9QC 1X31C 2DMUA 2NVTK 3F6OA 4BE1A 1GHCA 1PJ5A 4BY1K 3CDIA 3FM5A 2IA2A 4EJTA 3J7AY 3MQ0A 4J3NA 3DXJF 3RZDC 2BZTA 1Q1VA 2Y31A 3H92A 3KX2A 3KYLA 2KFDA 1WI9A 2P0WA 4J19A 1WI3A 1OCOH 4M74A 1R71A 2FE3A 2CW7A 1XGMA 1AU7A 2QZ8A 3T00A 2MFZA 2Z9OA 4XSXA 3WE3A 4DIQA 4YFXF 2ZMEB 1J09A 1FC3A 5FJ8J 2QM3A 1B9MA 3OWTA 3S2HJ 3OYAA 2PEXA 2E2JJ 4MEYF 4HG2A 3T02A 1POGA 1BI1A 1IO2A 3FIWA 5EDNA 2QGUA 3PO2C 4JX5A 2NVXJ 4XQFA 1WZ2A 4KMAA 1V5EA 1F7VA 3BQYA 4XRFA 3K70D 3GEZA 4HZFA 3H0GC 5C4XC 4A5NA 5IOTA 5M5WJ 3IKVA 4L18B 2R7VA 2W7NA 2VKHA 3ZR8X 2CFAB 3DEWA 1A6IA 3DU6A 4JX4A 1O7LA 3L7WA 3I55I 2R7TA 2VI6A 3C3WA 4UV9A 4PABA 4KICA 3HOXJ 3GTMA 1TWCJ 2DOEA 3KP6A 3M8EA 2KL4A 3R0AA 1WQHA 3PO3K 2KRCA 3SFZA 4A3DC 2GAHC 4AUXA 2DFIA 3OYJA 3GTJK 2DJNA 2R7XA 3KEOA 1ZYRA 1L0OC 2XF7A 2CQNA 5IPAA 1E0EA 3CP2A 4XONA 1OMIA 2HYFA 3BTCA 2K40A 2EV6A 1YX5A 2UXNA 5ICGA 2DPDA 2M4GA 4BBSK 1CF7A 2DA7A 1LQ1A 3HOWK 2BBYA 3CCMI 3SZGA 1QRYA 2NVYJ 3L2CA 4KIGA 4ZDLA 4IHVA 2JMWA 2WB1L 4N9IA 2A61A 2X0LA 2CQKA 2VASA 2XRNA 4P96A 1OCCH 4XLNF 1U0JA 1B1BA 3FOFA 4E7LA 3HGGA 2J5OA 2JSCA 3TDZC 3FK6A 2Y9YA 2IEKA 3MAJA 5CQEA 2CU7A 1IG7A 1R9TC 2A6HF 3S17J 2WB1N 3OOPA 1FP1D 3HUGA 5CVIA 4AC0A 3IL2A 4BLAA 5J8FA 3SHFA 2PBIA 2MBFA 4I09A 1RUNA 3E5UA 2F5FA 3E1SA 1SC7A 5LGNA 3G4CA 1USSA 2AHQA 4LD5A 1EH1A 3BQZA 1BM9A 2E2IJ 4LR2A 2DA2A 4Z6YA 4OIPF 1I6HC 1HF0A 4HNVA 2X1DA 4AVPA 1WRJA 3BTJA 1HKSA 2HQAA 3TFJA 5M5XK 5HLGA 3AD9C 2FUG2 5FKMA 4I02A 1USTA 3BT9A 1VLOA 4HAMA 1UG0A 1EV7A 1RRJA 4A3IC 3FF5A 2RV8A 2DO7A 4D5FA 4YRVA 4LOCA 2HNHA 4CICA 4XSZA 3H0GA 1FBUA 4F55A 1X4PA 1W7PA 2HVRA 1TC3C 4X0GA 4JX6A 2FMLA 5F6FA 3V7CA 3QPSA 3S2DK 4EM2A 4LK1F 5E3LA 2OTJI 1H9GA 3JRGA 5CJ9A 4G6TB 3JAMZ 1O26A 2MD0A 3KETA 2R92A 1R6RA 3S32A 1JOEA 2A6EA 1GXPA 2XC7A 3FMRA 4RB0A 3I64A 2IS4A 3BR3A 4BXXJ 2XGDA 1DPRA 2RC4A 4V19K 5TISC 4A3KJ 2ZNYA 3BP8C 1VI0A 3AFHA 1G3YA 1ZYRF 5CLSA 1I3QC 3DP7A 1P7JA 3HOVC 3OYIA 1F9NA 2QSGX 1X1AA 4ABZA 3KLNA 1LNWA 4BH9A 3W6JB 1MH3A 4HPQA 2LR8A 3BR0A 1DGRM 2LVSA 3HEFA 1W0TA 4RAZA 4C2MK 3DBLB 3H5AA 1XXAA 4A3GK 3JRDA 4ZDOA 2EIJH 4HRIA 1LPQA 1HXDA 2JTVA 4A3JC 3KP7A 3UNGC 4PAAA 4GXOA 5J1RA 3GTMK 3T5XA 1XSXA 3K7AC 1PJ6A 2LF8A 4XCHA 3KP5A 4PZJA 5IP7J 1R9TA 3SDGA 2HKOA 5KHDA 1KQ9A 2DA4A 4LG0A 3PM1A 3ESWB 3BP3A 1DGWY 2A07F 2IS2A 1GXQA 1YJ9I 2YU9A 4EATA 5EEGA 3WG7H 3HZJA 2WY8Q 2OU2A 5DCMA 1XTAA 2L7ZA 2RAEA 4IF4A 1XCVA 4BBRC 2GZWA 1MDMA 3DEUA 2VE8A 4MQVA 1USOA 4C2TA 2HU9A 2M87A 5E8GA 5H20A 4BUPA 3MMLB 4H4KC 1ZTRA 2BVLA 2NYXA 2G7UA 2KZVA 2DT7B 2G0EA 5M5YJ 4RAGA 1Z3XA 1RESA 3ZQGA 2KHMA 3RI4A 5LRRA 2KIQA 5DD8A 2R5ZB 1W7PB 4BJ5C 4CO8A 3TFHA 2PA8L 2CSOA 2MGQA 3RZDK 3MKYB 2OTLI 4B44A 4IOCF 2QQ9A 3BWGA 2ZJRF 4CZCA 3K4CA 3GTKJ 1XMXA 3GTLC 5IYBK 3FXRA 3FXOA 1I3AA 1R5HA 3DPTA 4FTHA 1W1WE 1BN5A 5FFXA 1FEXA 1V4RA 3RCOA 2YS9A 1JUMA 1V5GA 2EQRA 4QPOA 3VFZA 3SEQA 1O3SA 3CQZJ 3DBRB 1IZ1A 1FTTA 2EZLA 1J98A 1OISA 2P81A 1QO0D 4Y7NJ 3JSPA 2IGMA 2JA7J 4E7SA 3V7SA 3S14J 5C3EC 4UUTA 2A6TA 2CW8A 3TW7A 5GP9A 2FMYA 4G7OA 1BJZA 1FSHA 2E1OA 2EFOA 3BR2A 3H0GK 3WU2C 4B09A 5C4XK 3QU6A 3U1KA 5M3FK 1KYZA 4BHCA 4QLCU 1O27A 3I4MK 1IN4A 1U78A 1XDUA 4RA2A 5HL8A 1Z77A 2R7OA 4G7ZF 2D45A 1A31A 2B7EA 1U2WA 2Q2EA 4M6VA 4GCVA 5E1XA 1U8RA 2EK5A 2GXAA 2LC2A 3PQJA 2R92K 3AG1H 1WH5A 4JQFA 1B8IB 3LAJA 3H3UA 4MQ9F 2L4AA 4EJOA 3WHCA 2FJ1A 2FU4A 3DTEA 1IBAA 1ZRFA 3D5SC 2IXSA 3MZYA 2E2JC 1IUFA 1HOMA 3GUDA 1Y1WJ 1MDMB 3GX4X 2VB6A 2ZCWA 3RQIA 2CO5A 4YELA 3HKZD 1J75A 1YLFA 2HOEA 1KU7A 4XM3A 5J3LA 3I54A 4CSWA 2NVXC 2V6EA 3B6CA 3DKXA 4EV0A 1ZAOA 3A01B 2BE5F 1ZHFA 4E4HA 2NXNB 4E7JA 1I50A 1R58A 2TDXA 1E17A 1YIJI 3C7JA 3S1RK 4QIWD 3E3VA 3F9KA 4A12A 3EUAA 3C18A 1D1BA 3W6KB 1IGNA 3BCBA 1RUOA 2Y75A 3PFYA 4GRIA 3HOXC 2M7AA 1YRNB 4XN3A 4ETSA 1TWCC 1ORKA 4KDPA 5IORA 2P5LC 1MBFA 1R9TK 2E34A 4MLOA 5H2FC 2L5QA 3HYIA 2O9LA 2YU9K 2YPRA 4ZC3A 4BKXA 3ABLH 1TWAJ 1MBJA 3WG9A 3J80K 3EDPA 1B4BA 4MHGA 4UNOA 4UVCA 3GFJA 1X4OA 3SZPA 4M3GA 2DODA 3RYPA 1MMNA 1IN5A 4G7HA 3MN2A 1HA8A 3ULQB 1TBXA 2QF7A 3BJOA 2STWA 1Z91A 2EJRA 2NVYC 3K4KA 3R60A 3E0JB 3E97A 3LSGA 4C3JJ 4QJVA 3MWMA 4E7KA 1JKRC 2R93J 5JVOA 4CCJA 3ZQIA 4MO7A 4G7OF 3WHBA 1T33A 2Q2EB 1N25A 4RGRA 3GTPC 1SFOJ 4AYBL 3S17C 1R4NB 4M1XA 4NNJA 1LE8A 2DN0A 4ZDPA 2DI3A 1VQMI 4OU0A 3H35A 3OYFA 4KT6A 1I27A 2DFFA 3OYNA 3F6VA 3QOEA 3KP4A 1SD7A 4AYBN 2XAUA 4CGZA 4RGXA 2WAQD 1L0WA 3FHNA 1IRXA 3E7LA 4D1QA 2JA8J 3IH3A 1BIBA 2AQEA 5EYRA 3SZYA 1WQFA 3H36A 4G12A 3QAHA 1D3YA 4I01A 2NVXA 5GADJ 1HQMA 4M3BA 2QA4I 2LH9A 2XF6A 3S15J 3CCLI 2VJJA 2ZNZA 3C2GA 1NK3P 2K27A 2QLZA 3GCMA 5IP9K 3JSOA 3PO2J 3FXLA 4G9YA 3RZOK 4XICA 2NVUB 5C4JJ 5AIPA 3I9V2 3K7AK 4I76A 1IF1A 1TWFC 5E17F 1BA5A 4FX4A 4LG3A 2IGNA 1TWCA 1ZBSA 3ABKH 3KIOA 1D0YA 3IH4A 2IS6A 4HF0A 2DA6A 1QVUA 2V9KA 4A3KC 1WJEA 3V7RA 3HOZK 2GAUA 4IPAA 2XROA 4A3DJ 3BROA 4I7HA 4WF2A 2R7UA 5C44K 3HOTA 1B9NA 1FJLA 4BBRK 3FWEA 2P6SA 3L1PA 2CRGA 1W0UA 2Y0SD 1T56A 1ETQA 3FBNB 4A5MA 3K1NA 1I50K 3M4OC 1JGGA 2AQFA 5HS9A 5ILSA 5E1WA 3W6VA 2LP0A 3NARA 2MD5A 2ZFZA 1ETYA 4QJVB 3S3OA 1AB4A 2NVYA 4ILDA 1KZHA 3PIOF 4KC6A 3BLYA 3LSIA 4MFDA 3JR9A 1WOPA 4BQOA 3ABMH 5L3BA 1H89C 1ZREA 3G1MA 4IHYA 1WJAA 4I98B 2BW3A 1U9OA 5JLWA 1UHSA 1LE8B 5IP7C 1LVKA 4H0EA 1B59A 3CAGA 2FQ4A 1VRQC 1O57A 4QTRA 1YITI 2NVQK 3M1CA 1PUFA 5CVVA 1ISEA 3ONQA 3T0YA 1YNJA 1GVDA 2ELHA 3ZQCA 5HLHA 3HOUK 1WJFA 2DA5A 1E3PA 1LB2A 4ZZDA 1H9TA 3I4PA 1L3LA 3WTVC 4LLGF 1Y0UA 4KIFA 2E2IA 2JWTA 3VPRA 1F4KA 5LHIA 5DM7F 2ZMEC 1SD6A 4ENJA 1KYWA 1ZARA 1ZLKA 3OL3A 2L0KA 1TNSA 1WGXA 2HGCA 3JW4A 1I6HJ 2ZJPF 4Q47A 2CYYA 1DD5A 3ASOH 2FBHA 2F5VA 4XLAA 1JXSA 5LHHA 1QGPA 4NC7A 1WPKA 3JTHA 2DTRA 2VT2A 2HTSA 3DEEA 4PGHA 1QZZA 2A69A 1H0MA 3HL2A 3HHHA 4L5EA 4A3IJ 2KMUA 2L9SA 3VODA 1DCOA 2QQBA 2K4BA 4E70A 1W4MA 4AYBA 1WVRA 2VODA 4XIDA 2Y3PA 3GWZA 2V1XA 3M8JA 1O29A 2E60A 4OIOA 4UB8C 4WWCA 1V3FA 2L9NA 1YTYA 1BI0A 4WX9A 3GTQA 4PJJA 1XDSA 2H09A 5FJ8K 3L4JA 2KZGA 2L9VA 4BLBA 1IC8A 1UV7A 4Y7NC 3S2HK 1P2FA 1YE9A 4G0WA 3LQQA 3ZMUA 3K70C 1P4XA 3I58A 1FYLA 2JA7C 2B9SA 3S14C 5KCMA 2KJBA 1U3EM 1BR2A 4WILA 3KZZA 2NVXK 2DU9A 2XB0X 3WE2A 3A4CA 1VQ5I 1REPC 3RIRA 3HSRA 5IYCJ 5LHGA 3F21A 5J40A 4ZTFA 1I3QJ 5M5WK 3HOVJ 2HXIA 5AIQA 2VJ5A 2WV1A 3JRCA 4V2FA 2LG4A 2V6SA 3DXJA 3OREA 1P92A 5EF6A 3J80Z 3REOA 1FP2A 3HOXK 1IN6A 1TWCK 4RMNA 4WK8F 3CJTB 4RB2C 2ISZA 1WCMJ 2DTZA 2KT0A 1QNTA 4D7MA 4A3JJ 2C6YA 5DV5A 4LOWA 2LLKA 2E19A 2R3SA 3ZRGA 3PIPF 1K83A 4C3HJ 4UUSB 3H0DA 2QQ8A 2KIFA 3HG9A 4KMUA 3CESA 4YFXA 3BR6A 5ILUA 4LK0F 4MEXF 1HSJA 1VNDA 2Z16A 1WORA 1FBSA 3HXAA 4MEYA 3W2WA 3IWFA 3AAFA 4ZYEA 4L9VA 2IA1A 2P8TA 3RSNA 4LB5A 2IA0A 2GXBA 1A5JA 4PSXA 2ZMEA 2DYSH 3BY6A 2GXGA 2NVYK 1QZEA 2IVMA 4G0UA 5L3DA 3HOYC 2HWVA 3IP4B 1G59A 1BI3A 2VPLA 1KA8A 3Q0WA 2DBBA 5FKLA 4JK1A 4GO1A 2O5IA 3ZMSA 2XRLA 4FE4A 2M5WA 3H5NA 2MW8A 3S3NA 5J1UA 2NOGA 3X2QH 4AIJA 2CUJA 2ZXWH 3S17K 2A69F 2CFAA 2FBIA 1FX7A 4UY8I 3N97A 4YFNF 2WTEA 2ETHA 1TWAC 3GTKA 1BR1A 4G8XA 2ZUFA 5FLXZ 2E2IK 3JSTA 3IPJA 4ZYAA 2ZBKA 3PQKA 4XKVA 1ZGJA 1SD5A 2K9LA 5LFAA 1DDNA 3CQZA 3BJAA 3KCCA 3GTLJ 3BG5A 4MTEA 1LFPA 3TBIA 1JUSA 3RPUD 1IXSB 2PI0A 2JA7A 3JCUC 5K5RA 1Z1DA 4I0AA 5FD5A 4C3JC 1G3SA 3J7ZI 3E5QA 3K4LA 3OMYA 4NC6A 1HW5A 2R93C 3BUEA 1T98A 4OAZA 4L0ZB 2X6XA 2L4MA 1PP8F 4PFPA 4XLNA 2EB7A 5IOZA 1GVJA 2EWNA 1OLTA 4CCMA 1AA7A 3A8IA 2F5CA 1JT6A 3CCEI 3FOEA 1SFOC 5H6RA 3D0SA 1K79A 4A3LC 3I71A 4IVNA 5FLMC 3CMYA 2XVCA 4FE7A 2A6HA 4PJMA 1X1CA 4B1RA 4IQ4A 1NTCA 3P9IA 1QHHD 1EI6A 1KGSA 3GTQK 1WOOA 2BHZA 2JJ7A 5JR3A 2EINH 3K4MA 5F64A 4BXXK 2LMDA 3FBIB 4RAYA 2K3FA 4EQQA 4XLEA 1EQRA 1TW3A 4OIPA 1MBGA 2ZSHB 4O5VA 4NOIA 2MH9A 2JA8C 2GIVA 5FROA 2CUEA 1FYMA 2VC1A 4A3CJ 1Y1WA 4LLLA 1OR7A 2Z3YA 1JTXA 2LTPA 1QBJA 2HR3A 2R4GA 2WV0A 2MC4A 2FF4A 4L9JA 3TOAA 4BYYA 3S15C 2UV1A 1JJ6C 4A93J 3JREA 3GTGJ 5E1ZB 3HTUA 3CCVI 4P9SA 2FD5A 1T39A 3C1DA 5C4JC 3DQVC 3GLLA 4E7IA 1W36D 4LK1A 1EF4A 2GOMA 1MJAA 2O03A 5IP7K 3LWFA 3T8TA 4ZJZA 4C30A 4NHJA 1K83K 1Z9CA 2GA2A 4LGWA 4XRSG 2DYRH 5GTIC 1DUXC 1JTYA 5ED4A 1SEUA 4AD9A 1DQUA 3E6CC 2TRTA 4L5JA 2CUZA 3AG3H 2GSOA 3L09A 2LKPA 4Y17A 1P4WA 4I0BA 1IE0A 5E8IA 3JRFA 4P5AA 3JTGA 1MGTA 5J4VA 2QKLB 5HS7A 2O61A 3O3KA 2ME0A 2EBBA 4DDQA 5M5YK 3RKWA 1TWGJ 4CCLA 3CLOA 1UZCA 2WY7Q 4CCNA 3IH2A 2P5KA 4GTDA 2BOLA 2OQRA 3DLAA 3I4NJ 2G7HA 2FQ3A 4PSWA 1BGWA 2R93A 2M8GX 3BR1A 2NNYA 1SFUA 1SD4A 5LBQA 3LNQA 2X1CA 2H1LA 2RREA 3L2UA 1XGSA 3ZQLA 3FXJA 2CWEA 2UWMA 1SFOA 3OS2A 2CV2A 3K4BA 3EYYA 3GTKK 4BAYA 3LSJA 3MVPA 2L01A 1S5LC 4BGDA 4OIQF 1ZRCA 3GTPJ 1XB4A 1XGNA 1Z6TA 3S1NJ 3A0BC 3CQZK 3HKZL 4U7BA 4Y7NK 2VXZA 2E1MC 3LA2A 2JA7K 2ZXIA 4P9UA 3S14K 4KB2A 3ZN1A 4L9NA 2R7ZJ 2GIZA 2QEXI 4GTAA 1Z21A 5CVUA 1USMA 4A3BJ 2VBZA 4BE2A 4GTCA 1A04A 4HEA2 4JOMA 1JQWA 1RR7A 4FCYA 1SAUA 3HKZN 4QIWL 5IYDJ 1W5SA 1VQLI 1XD7A 4GYGA 2LYCA 4F52A 2DAOA 2LRDA 1ZH5A 3N0BA 5HLTA 3CCSI 2DW4A 3R6SA 1DU0A 3D5LA 3KE2A 2KDZA 3QOPA 1BR4A 2O8XA 2R5ZA 4QIWN 3H3VL 1APLC 2CFXA 4OAYA 2X51A 2DMTA 3OR2C 1IN7A 3W2VA 5IOQA 5DCFA 4X6AJ 4XR6A 4DZJA 4ZH4F 2IS1A 5HDGA 5KVRA 1TWFJ 3VSLA 4HA8A 1YW7A 5K1YA 2IRFG 1RKTA 4XKBA 3D5RC 3P7NA 3I3LA 3LMMA 4XLPF 1R5GA 1Y1WK 3KEQA 2O0YA 1VQ9I 3HSFA 1TZLA 3HIFA 2RDPA 5IYCC 2E35A 2LOOA 2FQOA 1X3UA 1FMVA 5CVJA 2R0QC 4GTEA 1SFKA 4CYDA 5LGUA 1IRFA 1HI9A 3WU0A 4Y15A 5HNHA 2ME6A 1IJWC 4G7ZA 3M4OJ 1EKEA 4DYQA 2L54A 1IV8A 4PK4A 2E5ZA 3TO6A 3AL0C 3OSGA 1WCMC 3KZIC 2M4KA 2JT1A 1ODDA 1Y39A 3OYHA 4MQ9A 4ZYGA 2RH6A 3LSRA 4C3HC 4DW6A 3OYLA 1HW2A 4FETA 1CQTA 2QQAA 2FSWA 4P55A 2V4JC 2WAQL 4HX8A 4M3DA 5F08A 2Q8KA 2PLYA 3AQOA 1J7KA 1I39A 2XPUA 1B8IA 2XCOA 1SVMA 2K7LA 3ZP5A 3L4KA 3F8FA 5A2QK 2A68F 4B3AA 3TO9A 2LKXA 4KJZA 1N75A 1ETXA 5JHUA 2BY3A 3L2QA 3O6BB 2BE5A 2COMA 2JK3A 2WAQN 3M1EA 5KAIC 2CFOA 2MSYA 4HV6A 5L3FA 2K3PA 3NWTA 2IBDA 3GEIA 3CTAA 5TGTA 2R93K 1EH6A 3SZTA 2BVMA 2ECCA 2JRTA 2VBWA 2QBYB 3ZMZA 4N4NB 2DT5A 3F72A 3LSMA 3A01A 9ANTA 1IN8A 2QWWA 2WB1A 1MSFC 4L0YB 4ON0A 1SFOK 5GTHC 1W7PD 1MNMC 2EZKA 1JHHA 4S05A 1SMYF 1WSRA 4RLFA 3A03A 1YG2A 2ELJA 4IRIA 1HDPA 1F7UA 4F91B 5L3EA 1X1DA 2A3SA 3VEPA 1PJRA 2GOXB 3I0TA 1YRNA 1GLNA 5GPAA 5KK1A 4XRMA 4IJAA 1MD0A 4O3MA 5D4RA 4HLYA 2E1NA 3A8JA 5FKOA 2V79A 3FMQA 2JA8K 1RR8C 2HPIA 3EQLF 1K61A 4LJZF 2LF7A 3DWLE 1FLIA 5D5XB 4IZZA 3K4JA 3GSIA 1R4MB 1TLHB 4P5OA 1O28A 3L9FA 3SFIA 1FZPB 1TWHC 4A3MC 3LL7A 5GAHJ 3GFMA 3BP8A 3FKJA 2R7RA 2W7VA 3QQAA 3S16C 4KN4A 1I3QA 2PMZD 3PO2K 3OOUA 3T8RA 1S7AA 5ICFA 2Y0SN 5J47A 2EIMH 4HOBA 5D5VB 5C4JK 1LFBA 2XSDC 2XCRB 2G9WA 3V8JA 3F8CA 2Z1DA 1B6AA 4D0PA 5BQTA 1WCMA 3OYDA 4KISA 2XB5A 1VZ0A 4U7DA 1XMKA 2HYGD 3TDUC 4M6XA 1XG1A 4BQQA 5DYMA 2DXIA 2BHYA 4A3DK 1D5VA 1ZKGA 4A3CC 2DOAA 4V2GA 4RLQA 1IUYA 4HNTA 3F3XA 1S9HA 2E1MB 3FHZA 4KMUX 3QP5A 1JKQC 3IC7A 3BZKA 2Z2SB 3G6EI 4QSHA 4A93C 3I53A 3GTGC 4CYCB 2GA1A 3I59A 1AKHA 2YX7A 3AKZA 3BC8A 1S3JA 1UELB 3H9GA 4F7ZA 1XPPA 3GTOC 2IGKA 3HOYJ 1QVTA 1DCPA 2VN2A 3WGIA 3ISPA 3LA3A 5HLIA 4PJNA 1ZLJA 3CCYA 3PNVA 5DUKA 2ZUEA 3A0HC 4ZYDA 1EA3A 3ECHA 3GF2A 4JK1X 4U0VA 2YUSA 4DZPA 4BXUA 1H88C 4UHTA 4UVAA 2A5YB 3CCUI 1KU2A 5K7ZA 5E3OA 4A3FJ 1JJ8C 1XCBA 3OS0A 1FY7A 3GTLA 5DTDA 1Z7UA 5F1RA 2HZDA 3DTIA 5D5WB 1TWGC 1I6HK 3O2PE 2HQRA 1WQGA 3CCQI 3RTRA 3AQPA 2Y9ZA 3S1MC 3OPFA 2K9NA 2KIUA 3U1DA 3I4NC 1WJCA 1GV5A 2PMUA 2H8RA 2XPVA 2HDWA 4EEFG 1NHAA 4RS8A 4A3IK 3K2AA 2FQTA 3N05A 1X1PA 1X58A 4YIIA 2M34A 2L02A 3GTMJ 4Q4ZF 2LFBA 3FKIJ 3AL0B 1RNLA 3N0CA 2W57A 2VC0A 4B8XA 3CZ6A 4II3A 3GFIA 4OINF 3Q0UA 3S1NC 5BPDA 3IKTA 4A3LJ 5FLMJ 3PSFA 1AOYA 2EZIA 4LLGA 1TW2A 1HLVA 1R36A 4RGSA 1O24A 2Y2ZA 4OOIA 5CKTA 1WOSA 1O25A 2HDCA 4GTLA 4B47A 2R7ZC 3VSKA 1TTYA 2ZO4A 4M73A 2FNPA 2MLKA 5LLQA 4A3BC 1Z05A 1IL2A 4IOAF 3DCFA 5J8CA 3ZXSA 5IYCK 1ZGWA 5IYDC 1I3QK 2DQLA 1OCTC 4CZZA 3HOVK 3LQRA 3I59B 1AKHB 5D8KB 1FOXA 1Z6RA 4Q5SF 3GTGA 2H6CA 2DDBA 5FKNA 3DLLF 3QX3A 3KLOA 4KB4A 4PJ0C 3H3VK 3J81K 2V1DA 3BOQA 4G6DA 4YG2F 3OYCA 3NEUA 1IW7F 1XN7A 3O8GA 5B5EC 5A2QZ 2R7DA 2L3DA 1WCMK 2VUMC 3AD7C 2ZXHA 1F93A 4X6AC 1YW8A 4A3JK 2OZUA 3WU1B 4BACA 1MIJA 4C3HK 2KPMA 1LFUP 4GFQA 2XDVA 2XAJA 3BG3A 2DOFA 4PDKA 1YJNI 3KFWX 3ML6A 4M71A 1RIOH 1HDDC 5IT9K 4TV7A 2IPQX 3N3YA 3GMEA 3EUHC 5D4DA 4M3EA 4KM8A 1J59A 1DCHA 4XKCA 3ZN0A 3CC7I 2XV4S 1ITYA 2HPMA 4EVIA 1TWGA 1UMQA 2KJCA 2V7FA 2YU3A 2GSNA 3NUHA 1MJ9A 2DCEA 2X6YA 3RDIA 2OAZA 3QWLA 4WJ3M 3GO5A 2VQGA 4HLXA 1PP7U 3U9GA 4GT9A 3FXUA 4KNYA 4KYWA 2ZXJA 3G4AA 2PA8D 4OIRF 2MLGA 4B48A 2OC6A 2LY9A 2VKEA 2Y0MA 2R92J 1RU0A 3HOSA 4XLCA 1J2XA 3RKYA 3CCRI 1V5VA 1WH7A 1RC9A 1Y1VJ 2VONA 3CD6I 1ETWA 4R1HA 3GTPA 3NWSA 2W4SA 3GLXA 2E7WA 1J9IA 4KUMA 5IYBJ 1R23A 3A1YA 4C9YA 4C3IJ 3ZGKA 4LK0A 4MEXA 4GZYA 3H3ZA 3GTLK 3ZQ7A 4Y52J 1T0FC 2K4JA 4LIUA 4BQAA 4UUSA 4CCKA 4IHWA 1LEBA 3OYKA 1QQIA 2R7ZA 3K9TA 1XZQB 2GWRA 1HKQA 4DNCA 3CMEI 2I8DA 3Q0VA 4ENNA 1R5ID 1EK8A 4BE0A 5HDKA 5BS6A 4D5CA 5C3EK 5BPIA 4P9FA 2CJJA 4ESJA 3S1RJ 3MZHA 3NQOA 1LDJA 1HQCA 4BQNA 1MJBA 3OYGA 2DMNA 1T38A 3K69A 2PJRA 1VFCA 1HCRA 1VQ8I 5ERIA 3QYEA 4W97A 3JRHA 1KQ0A 1WSVA 1LEAA 1ZK8A 2QSHX 5EZHA 2QENA 3GTJC 3WGHA 4BEHB 3E6MA 1ZR2A 4YFNA 5IOSA 1O3QA 1ZR4A 3V4GA 2YU9J 2H6BA 2M9HA 2CW0F 2RNGA 2RGRA 1MW7A 1TWFA 3M3YJ 4XLFA 2Y30A 5BNGA 3D1NI 3CUQC 4BBSC 4BNCA 3F23A 5D8LB 2HOSA 1O2FB 2DMQA 1YNNA 1ETKA 1MMGA 2XAQA 2ECBA 3MKZA 3HPHA 4A3EJ 2M8EA 3TFIA 4L5IA 2ZSIB 2E2JK 5IOYA 2K5CA 5JVGF 1T2KA 2OJED 2VOPA 2UUZA 1PUEE 2X48A 1W36C 4BHPA 1UHWA 2ELKA 3GTGK 1LKXA 2OZ6A 2HZTA 2WBMA 4XL9A 3QYFA 4W1UA 2XAHA 1XC5A 4LFUA 1H8AC 2K02A 4NQWA 3KYDB 3CF2A 2FEZA 4B43A 4AVZA 4BXFA 4KARA 3M9AA 3QRFF 1X2MA 2VIXA 2W85A 3T01A 1OPCA 1INNA 2DK5A 4IRGA 3TW6A 2F6CA 4KASA 4AIDA 5TJJA 3BCAA 3GW2A 2YX4A 2VKVA 2LKSA 2KWAA 4IKFA 4CDGA 4XORA 2IGOA 1QPMA 2VKDA 4ESBA 1BW5A 4DQ2A 1Q1HA 5EGOB 2YR2A 4MIMA 1AWCA 1ZG1A 2JSPA 1K6YA 2L2OA 1A36A 3MFKA 1LDKB 1TWGK 4UB6C 3G73A 5M3MJ 3WTWC 3PSIA 3R61A 1MBHA 2MABA 1Y6IA 3BPVA 3I4NK 1T6SA 2ZB9A 5E18F 3A8KA 2XUBA 3DPLC 3FXQA 4KIBA 3QYBA 1X3ZB 1Y0NA 4UV8A 4DGWB 5B1AH 2RQPA 2PJRB 3RZOJ 4P5BA 3F8MA 2KKOA 3MD2A 1BIAA 2HVQA 3RPQA 3GIRA 5DEQA 3MKWB 5TMFA 4AYBD 4OMZA 1MZBA 1ON2A 4FX0A 4ENMA 2JA6J 3VA7A 1IRGA 1D8JA 4S0HB 5HODA 3GTPK 2CMPA 1KU3A 2MC3A 3DKWA 2OBPA 3S1NK 2B63J 4A3FC 4HQEA 4EMSA 2Z5UA 4N9HA 3CUQA 3SXYA 1WIHA 2R7ZK 3JAMK 4BHBA 1VH2A 2WAFA 4AWXB 3K1MA 5KNLA 1VQ4I 3S3MA 3OSFA 4C45A 2PFBA 3KP3A 3KZYA 1MBKA 1O3RA 4C2MC 5IYDK 2HQ5A 3OEPA 5E68A 1C0WA 3OV8A 4G94A 3L2VA 2W82A 3I5UA 1K4SA 1IAWA 2JUGA 2EZHA 3IHUA 3OR1C 2V1NA 2F4OB 3JRIA 1TWHJ 3NRVA 4A3MJ 4UUVA 5FLVA 3K4NA 4NQWB 4ITVA 3I56I 3GTMC 1YJWI 1NG7A 1UG2A 2YSRA 3BDDA 2LBFA 3FKIC 1N77A 2Y69H 4KN4X 3S16J 1ETVA 5IT9Z 3S1QK 1JGSA 4BY7J 3S1QJ 2K9MA 3IAS2 4X6AK 1M1EB 2XCQA 1R7JA 1YYVA 2I10A 3Q9SA 5E20A 5EEHA 2VQHA 4OIQA 4XLHA 4F93B 3CJQB 1K6OA 1TWFK 1TT5B 1UJ8A 1D8KA 3F22A 1HBXG 1STZA 2E71A 2CV0A 2GLOA 4WJ4A 3H9JA 2M2EA 3OYEA 3DFGA 3LSPA 1RPWA 3CO6C 3KEYA 4K2EA 1KU9A 1TQPA 1X1BA 4A2UA 1XZPA 4L9TA 4A3KK 2CS3A 3TKYA 4IQJA 2MH2A 1QPIA 3H5RA 2VE9A 2HTJA 4EJVA 5DDGA 1GT0C 1PDNC 2HFHA 3ZMVA 4Y4RA 5EJCA 2X85A 4F92B 3LAPA 4KAWX 1MNDA 2ESNA 2PMHA 3M4OK 4IX7A 4Y3OA 5EG0A 2H1KA 4CHUA 4WXDA 5DS9A 2O6GE 2R7QA 3F8NA 5F1JA 4A6DA 1S6LA 1I6XA 5EGEA 4YIRX 2CUFA 2PG4A 1OYWA 1B72B 3QPHA 2DFHA 1SAXA 1T8IA 1JT0A 2HDDA 3GTOJ 4Q48A 5D5UB 2VXDA 4ZH4A 1OCRH 2VL8A 1WKMA 2GBYA 1FPQA 2LSOA 2FNAA 3GBGA 1LVAA 3CO7C 4XLPA 3HHGA 4G0VA 2EH3A 1XSVA 3P9KA 3CUQB 4FASD 5JFEA 4HQMA 1ENHA 1YI2I 2IP2A 1TWAA 2XAFA 2FX0A 4YEJA 1DPUA 2V6TA 1I1GA 5JI6A 2NRAC 3FMSA 1BC8C 5E79C 1U8BA 3QPTA 1X2NA 3M8FA 2GAGC 1RKWA 4HYEA 2KRHA 4B3XA 3V8KA 3WTYC 2PMZL 1CGPA 1KQ4A 2L7MP 3EUKL 3I4MC 5EZGA 1O2AA 4WCGA 1TL8A 1F5TA 3S1MJ 2LBFB 3PL8A 1MMDA 4D7NA 3H9QA 2VT3A 5L46A 5TRDA 1W5CC 2R92C 2PMZN 2L9RA 2DLLA 2PHCB 3FKIA 1ZVUA 1Y8RB 2N8GA 3BZCA 3SEZA 3HGYA 2HKXA 3RQ4A 4YIFA 4M3FA 1Y1VC 3E6BA 1Y56A 2W1OA 2E2HJ 4HX7A 3CMMA 3P5JA 3MZ8A 5IYBC 1X19A 2D1HA 4C3IC 1SMTA 4Y52C 1YQAA 2KIMA 2DDAA 1XZPB 3JRBA 2A68A 1OQYA 1XXBA 3HRTA 3HRMA 4MGRA 1UB9A 2O3FA 3FX3A 1V55H 4FQGA 1SANA 1IV6A 2W84A 1ACIA 1LDDA 2LDUA 1MNEA 3R4KA 2P7CB 2Y48A 4UXNA 1G4DA 3S1RC 3MCZA 2D2WA 3WODF 3WTXC 2A05A 4A0ZA 4HSTA 3S0XA 5EG0B 4CXFA 2R7WA 4MTDA 1ZRDA 2JA5J 1GUUA 4BS9A 5FKKA 1RETA 2QBYA 1SMYA 2BGCA 3EYIA 3GEEA 4XOPA 3CJNA 4CUGA 2HOTA 3KPHA 2YU9C 2R5YA 2ID6A 2CG4A 3M3YC 1I5ZA 2DA1A 3L2RA 4KDDA 1FOWA 3ABUA 2K85A 1OYIA 5LGTA 2VUMJ 1TP4A 2VBYA 3EQLA 4LJZA 4XSXF 3BG7A 1FSEA 1J5YA 4A3EC 4IHXA 3O8HA 4U0YA 2PX9A 4EJWA 2QVOA 1WJDA 2MA3A 1BJTA 4OWRB 2QKMB 4U87A 3AG4H 2ZJQF 4KFCA 2PPBA 1R00A 1UCRA 4KM9A 1FTZA 3WTUC 3HOYK 3HBLA 2F4IA 2NVTJ 3K10A 2ESHA 2J5PA 4RB1A 2DPUA 4CH7A 2V9VA 2B0LA 3CUOA 5DD4A 4BY1J 2D6FC 4AM3A 1ZXOA 1S7EA 3ABTA 5L3GA 3G4SI 3G71I 3WTSC 3GTQJ 1R49A 2R7FA 2Z99A 1NK2P 1BOBA 1ONVA 4IO9F 1YO5C 1DP7P 3TP3A 1U9NA 2OUMA 2D5VA 1DU6A 2E7XA 1Y1VA 3ADAC 4A3FK 1MMAA 3S93A 1CF7B 1TWAK 4XK4A 2BYVE 3F8BA 2K9QA 4BDZA 3VYUB 2OA4A 3HDDA 3E5XA 5E3NA 4KATA 4NBQA 4F3QA 3V42A 3FM3A 2D1VA 2PMZA 1BI2A 4M6YA 4BJ6C 5DM6F 4XKWA 2XIGA 3EETA 4EJUA 1FOKA 5IP9C 1K7AA 4P1WA 1AHDP 4C3JK 1ZQ1C 4M9ZA 5IP6A 3RZOC 2JRMA 3Q9VA 2XKPA 5LD2C 2EFQA 2L7FP 1IXCA 5BMZA 1P4AA 5EGHA 1G2HA 1OFCX 4CYCA 3FKIK 3N4MA 3HUGB 3ZMDA 3GXOA 4DBRA 1D5YA 4PJLA 5J1YA 1YCLA 2JA6C 4ZYHA 3U21A 1VQ7I 1K83J 2R5YB 4LB6B 5EEAA 5IT3A 4A3LK 3RKXA 2JQ7A 5FLMK 2B63C 3HOZC 3GZ5A 3PO3J 2XGXA 1VQNI 3GTJJ 5C44C 2GQQA 4AIKA 1IDYA 2VBXA 5FB2A 1HKTA 2IAIA 4GTFA 1WJBA 1BW6A 3HKZA 3IAM2 5FD6A 4EGYA 1R1UA 1OCZH 3BJ6A 1I50C 1G8XA 5JHFA 2W24A 3MEXA 2VLAA 4BBSJ 3WGGA 4RMFA 2X6WA 2XGCA 3ZOBA 2Y0SL 3JRAA 2ISYA 3MMYB 4LIVA 2R7SA 1G6NA 3BPXA 1VQOI 3TEDA 3CC4I 3HOWJ 1A6QA 1E2XA 3S15K 5JVTA 2HVSA 5F0HA 5ICCA 1PVEA 2UZKA 3COAC 4XSZF 1R1VA 3TMOA 1FT9A 2X6OA 4Q4ZA 2EA2A 3S1QC 4BY7C 1SVLA 2E5NA 4HF1A 2VQCA 4XRSA 2NVQC 2ADUA 1ZG5A 3CF5F 3J7YJ 1XMAA 5H6QA 4OINA 2OCCH 2JH3A 3HOUC 3ZQFA 4I6ZA 2IT0A 3IRQA 3LA7A 2JPBA 4BDYA 4HBLA 4RGUA 2CH0A 2E36A 5D6FA 2PJPA 1C0AA 2JVGA 5CHPA 2A6EF 3K6GA 3CP8A 2GM4A 2O5JA 3V8LA 3DU5A 3QU3A 3LSHA 1Z67A 4LMYA 1VF9A 4KN7X 2JA2A 4EM1A 2BEOA 1YX2A 1VQKI 2QYOA 4RAFA 5IY5H 2EV0A 5M5XJ 1JKOC 3LSTA 3HTSB 1IRZA 5J6XA 3K1PA 4KMFA 1D1CA 1WHUA 4RM3A 4Q5SA 3HRSA 1ZG3A 1E3OC 2GSUA 2V9PA 4GGGA 2RKHA 2LY2A 4FISA 5K5OA 1QU3A 1EFWA 4BKWA 2EIKH 5D4SA 4YG2A 4A69C 2WB1D 1IW7A 1BS2A 1QHGA 3PUBA 2ZKZA 4LLNA 2K86A 3K2ZA 3L00A 1FMWA 2TCTA 2DMPA 1FIAA 1F36A 2X4HA 4AIHA 2H94A 4LG0B 3S2DJ 2JA6A 1Y1VK 5LEKA 4XBFA 1YOVB 4N4OB 1RZ4A 1T08B 1TNTA 1XGOA 5CYVA 5HVQC 2AO9A 1XS9A 2CQ7A 4JP0A 5DCMB 4C3IK 3S2HC 4E7HA 1G3TA 3GYHX 2B63A 3OS1A 4GTBA 4Y52K 2HI3A 3GZNB 4I2OA 1DP3A 1WSUA 2WAQA 4BU2A 2EFWA 1W5TA 2AXLA 1HW1A 4II2A 1JVIA 4ASNA 2DJIA 3HXLA 2OF7A 2VOOA 3LPXA 2XKOA 3VYSB 1QZYA 1MMSA 2NS8A 4DOZA 3ASNH 1I6VA 1WQ2A 2L7KA 4KITB 1E3HA 2NS7A 3G3ZA 2JPCA 1FIPA 3LFKA 2PQ8A 2M0MA 1TQMA 3DF8A 3ERED 2HEOA 2OD5A 2CQXA 2Q0OA 1G51A 2V1UA 4IL6C 2BXZA 1TT0A 1LJ9A 2NNNA 4MNUA 1TWHA 4C2MJ 1O7FA 4OIRA 4PGGA 1HC8A 3NAUA 4A3GJ 1U5TC 2F48A 2M3AA 1MH4A 3H3VD 2E2HC 4GDFA 4IXAA 2BY1A 2DA3A 1O3TA 3SDBA 3ELKA 1YS7A 2NOJB 2JZYA 4HDVA 3UKGA 3M3YK 2FOWA 1VJEA 4BJTA 1WFXA 3OY9A 3AH5A 2QCOA 2HYJA 5B1BH 5GAGJ 5L3CA 3R0JA 1S72I 3ZPLA 1EH7A 3K0LA 4A3EK 4UVBA 1UAAA 1P7IA 2RNJA 2Y0SA 3MKLA 5F0FA 4M9XA 2F4MB 3OIOA 1HSTA 4IHSA 3EPZA 1N78A 5DUIA 1XZQA 2NS0A 3A2KA 1ERDA 2JA5C 1ZELA 1Z3YA 2WADA 4JYKA 1YHQI 1Z0XA 2LNBA 2P5MA 2FOKA 4KMHA 3SZZA 2OPTA 2EPFA 5GAEJ 4X1EA 3W2AA 4R8HA 1XPXA 1VGXA 2M30A 2QSFX 4B4CA 2HQNA 4CCOA 1B4AA 1Y8QB 2VQLA 3RZDJ 2E2IC 3GTOA 2KLOA 2BY0A 2M45A 1ETOA 2A5WA 2CW0A 3AG2H 1JE8A 4NB5A 3GDZA 1SFEA 2NAZA 3ZMTA 3TTGA 3S2WA 1XSDA 1MKMA 1K4TA 4BEHA 1ON1A 4FZBA 4DBQA 3QPLA 2UXXA 2XPWA 4NC8A 2ZFUA 2O8KA 4IRHA 2PN6A 2MYSA 2DQRA 3GVAA 4RBOA 2KISA 1F43A 5M3MK 3Q5FA 4XOTA 4J01A 5HDNA 3TL4X 5FLXK 3P9CA 1JKPC 1D1AA 3AD8C 1R22A 1SFXA 2DK8A 2LK2A 2IJLA 1U6GA 4LITA 3OL4A 1J6VA 4LQYA 1NG6A 2HS5A 4RDUA 4GFBA 5HS8A 3W3CA 2VPRA 2NVTC 1WWXA 2EILH 4ZZLA 1VQPI 3U2RA 1JUPA 1BBYA 2AXTC 4IHTA 4BY1C 1V5FA 3H0GJ 2JN6A 4Y33A 5C4XJ 2JUCA 3FISA 5M3FJ 5E3MA 2ZJ2A 2EA4A 3B6AA 5FGMA 6PAXA 3I4MJ 3GTQC 2JA6K 1NH3A 1U5TA 5HNFA 4RM2A 2HOAA 1YS6A 4R79A 4BXXC 4IEJA 5K7FA 3DPUA 2E2HA 5TJ3A 3PNYA 3M07A 3OIPA 2HXOA 2WWYA 2B63K 2W25A 4DYCA 3CJRB 1OCPA 3HPGA 3Q3QA 2BV6A 5FFZA 2RQQA 3HM5A 3B02A 2W48A 3PFIA 3FXMA 2ACJA 4HSRA 5CQGA 3VYRB 3OIQA 1IDZA 4CA0A 2W00A 5EGOA 5HOOA 2Q1ZB 1OKRA 3S8PA 2M7BA 4G7HF 1XX5A 1BJAA 3CDHA 1A35A 4J00A 4GYIA 4KA4A 3HSEA 1S8NA 4XMYA 1EJ9A 4ENKA 1PJ7A 3FDYA 1GDTA 1TWHK 4A3MK 4A0YA 2EV5A 4D9JA 4QPQA 3CCJI 3S16K 5F0CA 1TQIA 1PYVA 4FT8A 3J7AO 2JA5A 4BY7K 1UFMA 3CDLA 4EGZA 3L2WA 2STTA 1BOAA 1GV2A
chains in the Genus database with same CATH topology
2P6TA 5K5QA 1K78A 1FNNA 5ILVA 1FYKA 2E1CA 4HW0A 1R1TA 4PCQA 3RJPA 5LEJA 4KMDA 2CGPA 1YW9A 2VUMA 1S29A 2WC2A 2QUFA 1O2BA 2P5VA 5AONA 4O6JA 1JHFA 2RGVA 3TQNA 1S7OA 1G3WA 3EUHA 4N0BA 1IXRC 1YFHA 1BC7C 2RVCA 1UHMA 5BOXA 2FBKA 1U5TB 2P7VB 4M72A 2IW5A 1ZN2A 2FRHA 3TGNA 4Z2YA 1J0RA 4U0WA 3TOBA 2V6CA 2XHKA 3TO7A 4A6EA 3ECOA 2AS5F 4ESFA 4U88A 3RPUA 3QP6A 1F1ZA 1P6RA 1YIOA 1T0FA 4OMYA 3WTTC 2F5EA 4EM0B 2Z33A 4RB3C 4JBAA 3BZ6A 3HRUA 3ROUA 2M1BA 2H27A 1K78B 1XXCA 3GFLA 3WTZA 4WXHA 4FHTA 3SQNA 5LRSA 2OQGA 2XAGA 3IWZA 3B73A 1EH8A 2EFNA 3GTJA 1ULYA 2FXAA 1ZGAA 2P4WA 5CVRA 5D6EA 3RYRA 4WXCA 3FZVA 4S04A 4HDUA 3J81Z 4KT5C 4Y13A 5JFRA 3VOEA 3M7GA 4FM9A 4HV5A 5FO5A 2EFPA 1OYYA 4YFKF 4A0XA 4HF2A 1KQ8A 5ICEA 1RI7A 4G6QA 2KRFA 1I1SA 3E6DA 4OIOF 4QWQA 4M9SA 3T1BA 3KP2A 1FWZA 4HX4A 1GE9A 3IRRA 2ZFWA 2RN7A 3DV8A 1VTNC 2FA5A 1IS1A 3GZ6A 2F2EA 3VB2A 2F5DA 2XASA 1FBQA 3F6OA 1GHCA 3FM5A 2IA2A 4EJTA 3MQ0A 4J3NA 3DXJF 3H92A 1WI9A 4M74A 2FE3A 1XGMA 2QZ8A 2Z9OA 3WE3A 4YFXF 2ZMEB 1FC3A 2QM3A 1B9MA 2PEXA 4MEYF 1BI1A 4KMAA 4XRFA 3GEZA 4HZFA 4A5NA 5IOTA 3IKVA 4L18B 2CFAB 1O7LA 3L7WA 3C3WA 4UV9A 4KICA 3GTMA 3R0AA 3KP6A 3M8EA 1WQHA 3SFZA 2DFIA 3KEOA 1L0OC 1OMIA 2HYFA 2EV6A 5ICGA 2UXNA 2DPDA 1CF7A 1LQ1A 2BBYA 3L2CA 4KIGA 4N9IA 2A61A 2X0LA 2CQKA 2XRNA 4P96A 4XLNF 1B1BA 3FOFA 2J5OA 2JSCA 3TDZC 3MAJA 2A6HF 3OOPA 3IL2A 1FP1D 3HUGA 5CVIA 4BLAA 5J8FA 3SHFA 2PBIA 2MBFA 4I09A 1RUNA 3E5UA 2F5FA 5LGNA 3G4CA 1USSA 4LD5A 1EH1A 1BM9A 4LR2A 4OIPF 4AVPA 1WRJA 1HKSA 5HLGA 4I02A 1USTA 4HAMA 1EV7A 3FF5A 2RV8A 2DO7A 4CICA 3H0GA 1FBUA 1W7PA 5F6FA 2FMLA 3V7CA 4EM2A 4LK1F 1H9GA 5CJ9A 3JAMZ 1O26A 3KETA 2R92A 1GXPA 3FMRA 4RB0A 3I64A 1DPRA 2RC4A 2ZNYA 1G3YA 1ZYRF 5CLSA 3DP7A 1F9NA 3KLNA 1LNWA 4BH9A 3W6JB 4RAZA 1XXAA 1HXDA 2JTVA 3KP7A 4GXOA 3T5XA 1XSXA 2LF8A 3KP5A 4PZJA 1R9TA 2HKOA 1KQ9A 4LG0A 2YU9A 2A07F 1GXQA 5EEGA 2OU2A 5DCMA 4IF4A 1XCVA 2GZWA 1MDMA 3DEUA 2VE8A 4MQVA 2M87A 5E8GA 5H20A 3MMLB 2NYXA 2G7UA 3RI4A 5LRRA 5DD8A 1W7PB 4CO8A 2CSOA 2QQ9A 3BWGA 3FXRA 3DPTA 1R5HA 5FFXA 1BN5A 1V4RA 3VFZA 1O3SA 1IZ1A 1QO0D 3JSPA 3V7SA 2FMYA 1FSHA 2EFOA 4B09A 3QU6A 1KYZA 4BHCA 4QLCU 1O27A 1IN4A 1U78A 1XDUA 4G7ZF 2D45A 1U2WA 2Q2EA 4GCVA 5E1XA 1U8RA 2EK5A 3PQJA 4JQFA 3LAJA 3H3UA 4MQ9F 2L4AA 4EJOA 2FU4A 1ZRFA 3MZYA 3GUDA 1MDMB 3GX4X 2ZCWA 2CO5A 1J75A 1YLFA 2HOEA 1KU7A 3I54A 4EV0A 1ZAOA 2BE5F 1ZHFA 1I50A 1R58A 2TDXA 1E17A 3C7JA 3E3VA 4A12A 3C18A 3W6KB 1RUOA 2Y75A 4ETSA 4KDPA 5IORA 2P5LC 3HYIA 2YPRA 3WG9A 3J80K 3EDPA 1B4BA 4MHGA 4UNOA 4UVCA 3GFJA 3SZPA 3RYPA 1IN5A 3ULQB 1TBXA 3BJOA 2STWA 1Z91A 2EJRA 3R60A 3E97A 3MWMA 5JVOA 4G7OF 4RGRA 4M1XA 2DI3A 4OU0A 1I27A 3F6VA 3KP4A 1SD7A 4CGZA 4RGXA 1BIBA 1WQFA 3QAHA 1D3YA 4I01A 2NVXA 2ZNZA 2K27A 2QLZA 3JSOA 4G9YA 5AIPA 1IF1A 5E17F 4FX4A 1TWCA 1ZBSA 4HF0A 3V7RA 2GAUA 4IPAA 2XROA 3BROA 4I7HA 4WF2A 3HOTA 1B9NA 3FWEA 2P6SA 4A5MA 3K1NA 5HS9A 5ILSA 5E1WA 2ZFZA 2MD5A 1AB4A 2NVYA 4ILDA 4KC6A 5L3BA 1ZREA 4I98B 4H0EA 1B59A 3CAGA 1O57A 5CVVA 1ISEA 3T0YA 2ELHA 5HLHA 1LB2A 4ZZDA 1H9TA 3I4PA 1L3LA 3WTVC 4LLGF 1Y0UA 4KIFA 2E2IA 1F4KA 5LHIA 1SD6A 4ENJA 1KYWA 1ZARA 1ZLKA 1TNSA 2HGCA 3JW4A 4Q47A 2CYYA 1DD5A 2FBHA 1JXSA 5LHHA 1QGPA 3JTHA 2DTRA 2VT2A 2HTSA 4PGHA 1QZZA 1H0MA 3HHHA 3VODA 2QQBA 2K4BA 4E70A 1W4MA 2VODA 2Y3PA 3GWZA 2V1XA 1O29A 4WWCA 1V3FA 1YTYA 1BI0A 4WX9A 3GTQA 1XDSA 2H09A 3L4JA 4BLBA 1P2FA 4G0WA 3LQQA 3ZMUA 1FYLA 1P4XA 3I58A 2KJBA 1U3EM 3KZZA 2DU9A 3WE2A 1REPC 3RIRA 3HSRA 5LHGA 3F21A 5AIQA 3OREA 1P92A 3J80Z 3REOA 1FP2A 1IN6A 4WK8F 4RB2C 2ISZA 1QNTA 2C6YA 5DV5A 1K83A 2R3SA 2KIFA 5ILUA 4LK0F 4MEXF 1HSJA 1FBSA 3IWFA 3AAFA 4ZYEA 4L9VA 2IA1A 2P8TA 4LB5A 2IA0A 2GXBA 2ZMEA 3BY6A 2GXGA 2IVMA 4G0UA 5L3DA 2HWVA 1BI3A 1KA8A 2DBBA 4GO1A 3ZMSA 2M5WA 4AIJA 2A69F 2CFAA 2FBIA 1FX7A 3N97A 4YFNF 2WTEA 2ETHA 3GTKA 4G8XA 5FLXZ 2ZBKA 3PQKA 1ZGJA 1SD5A 1DDNA 3CQZA 3BJAA 3KCCA 4MTEA 2PI0A 1IXSB 2JA7A 5K5RA 1Z1DA 4I0AA 5FD5A 4C3JC 1G3SA 3E5QA 1HW5A 3BUEA 1T98A 4L0ZB 2L4MA 1PP8F 2EB7A 1GVJA 2EWNA 2F5CA 3FOEA 5H6RA 3D0SA 1K79A 3I71A 4IVNA 2XVCA 3P9IA 1KGSA 5JR3A 5F64A 4RAYA 4EQQA 1TW3A 4O5VA 2MH9A 2GIVA 1FYMA 2VC1A 1Y1WA 4LLLA 1OR7A 2Z3YA 1QBJA 2HR3A 2WV0A 4L9JA 2FF4A 3TOAA 4BYYA 5E1ZB 3HTUA 1T39A 3C1DA 3DQVC 1MJAA 2O03A 3LWFA 3T8TA 4NHJA 1Z9CA 2GA2A 4LGWA 1DUXC 5ED4A 4AD9A 3E6CC 4L5JA 2GSOA 3L09A 2LKPA 4Y17A 1P4WA 4I0BA 5E8IA 4P5AA 3JTGA 1MGTA 5HS7A 2O61A 3O3KA 4DDQA 3RKWA 3CLOA 2P5KA 4GTDA 2OQRA 2G7HA 2FQ3A 1BGWA 2R93A 2NNYA 1SFUA 1SD4A 5LBQA 1XGSA 2CWEA 2UWMA 1SFOA 3EYYA 4BAYA 2L01A 4OIQF 1ZRCA 1XB4A 1XGNA 1Z6TA 4U7BA 2VXZA 3LA2A 4P9UA 4KB2A 3ZN1A 4L9NA 4GTAA 5CVUA 2VBZA 4GTCA 1A04A 1W5SA 1XD7A 4GYGA 2DAOA 1ZH5A 3N0BA 2DW4A 3R6SA 3D5LA 3KE2A 3QOPA 2O8XA 2CFXA 1IN7A 5IOQA 5DCFA 4ZH4F 5HDGA 5KVRA 5K1YA 4HA8A 1YW7A 2IRFG 4XLPF 3P7NA 1R5GA 3KEQA 2O0YA 3HSFA 3HIFA 2RDPA 1X3UA 4GTEA 5CVJA 4CYDA 5LGUA 1IRFA 3WU0A 4Y15A 2L54A 3TO6A 2JT1A 1ODDA 4ZYGA 2RH6A 4C3HC 1HW2A 2QQAA 2FSWA 4P55A 4HX8A 2Q8KA 2PLYA 3AQOA 1J7KA 2XCOA 2K7LA 3ZP5A 3L4KA 3F8FA 5A2QK 2A68F 3TO9A 5JHUA 3O6BB 2COMA 3M1EA 4HV6A 5L3FA 3CTAA 1EH6A 3SZTA 2JRTA 2QBYB 2VBWA 3ZMZA 2DT5A 3F72A 1IN8A 2QWWA 4L0YB 4ON0A 1W7PD 1JHHA 4S05A 1SMYF 1YG2A 4IRIA 5L3EA 2A3SA 3VEPA 3I0TA 5KK1A 4O3MA 4IJAA 1MD0A 5D4RA 4HLYA 2E1NA 2V79A 3FMQA 3EQLF 4LJZF 2LF7A 1FLIA 5D5XB 1TLHB 4P5OA 1O28A 3L9FA 1FZPB 3GFMA 3BP8A 1I3QA 3T8RA 1S7AA 5ICFA 4HOBA 5D5VB 2XCRB 2G9WA 3V8JA 3F8CA 1B6AA 4D0PA 5BQTA 1WCMA 4U7DA 1XMKA 2HYGD 3TDUC 4M6XA 5DYMA 1D5VA 1IUYA 3F3XA 3FHZA 4KMUX 3QP5A 3IC7A 3I53A 2GA1A 3I59A 2YX7A 1S3JA 4F7ZA 2VN2A 3WGIA 3ISPA 3LA3A 5HLIA 1ZLJA 5DUKA 4ZYDA 4JK1X 3ECHA 3GF2A 4U0VA 4BXUA 4UHTA 4UVAA 2A5YB 1KU2A 1XCBA 1FY7A 3GTLA 1Z7UA 5F1RA 5D5WB 3O2PE 2HQRA 1WQGA 3AQPA 3RTRA 3OPFA 2KIUA 3U1DA 2PMUA 1NHAA 4RS8A 4YIIA 2L02A 4Q4ZF 1RNLA 3N0CA 2W57A 2VC0A 4B8XA 3GFIA 4OINF 5BPDA 3IKTA 1AOYA 1TW2A 1R36A 4RGSA 1O24A 4OOIA 1O25A 2HDCA 4GTLA 1TTYA 2ZO4A 4M73A 2FNPA 2MLKA 5LLQA 1Z05A 5J8CA 2DQLA 4CZZA 3LQRA 3I59B 5D8KB 1Z6RA 4Q5SF 3GTGA 2H6CA 3QX3A 3KLOA 4KB4A 3J81K 2V1DA 3BOQA 4G6DA 4YG2F 3NEUA 1IW7F 1XN7A 5A2QZ 2R7DA 2L3DA 1YW8A 2OZUA 3WU1B 4GFQA 2XAJA 4PDKA 3KFWX 3ML6A 4M71A 1RIOH 5IT9K 4TV7A 2IPQX 3N3YA 4KM8A 1J59A 3ZN0A 2XV4S 1TWGA 4EVIA 2KJCA 2YU3A 2GSNA 3NUHA 1MJ9A 3RDIA 2OAZA 3GO5A 4HLXA 1PP7U 3U9GA 4GT9A 3FXUA 4KNYA 4KYWA 2ZXJA 3G4AA 4OIRF 2MLGA 2Y0MA 3HOSA 1J2XA 3RKYA 2VONA 3GTPA 4R1HA 3GLXA 1J9IA 2E7WA 4KUMA 1R23A 3H3ZA 3ZQ7A 2K4JA 4BQAA 1LEBA 1QQIA 2R7ZA 3K9TA 2GWRA 1HKQA 4DNCA 4ENNA 1EK8A 5HDKA 5BS6A 5BPIA 4P9FA 4ESJA 3MZHA 3NQOA 1LDJA 1HQCA 1MJBA 1T38A 3K69A 5ERIA 1KQ0A 1LEAA 2QENA 3WGHA 3E6MA 5IOSA 1O3QA 3V4GA 2H6BA 2CW0F 2RGRA 1TWFA 3CUQC 4BNCA 3F23A 5D8LB 2XAQA 2M8EA 4L5IA 1T2KA 2VOPA 1PUEE 4BHPA 1UHWA 2OZ6A 2HZTA 2XAHA 4LFUA 2K02A 4NQWA 2FEZA 4KARA 3M9AA 3QRFF 2W85A 1OPCA 2DK5A 4IRGA 4KASA 5TJJA 3GW2A 2YX4A 2KWAA 4CDGA 1QPMA 4ESBA 4DQ2A 1Q1HA 2YR2A 1AWCA 1ZG1A 3MFKA 1LDKB 3G73A 3WTWC 3R61A 3BPVA 1T6SA 5E18F 2XUBA 3DPLC 3FXQA 4KIBA 4UV8A 2RQPA 4P5BA 3F8MA 2KKOA 1BIAA 3RPQA 5DEQA 4OMZA 1MZBA 1ON2A 4FX0A 4ENMA 3VA7A 1IRGA 1D8JA 1KU3A 2MC3A 3DKWA 2OBPA 4HQEA 4EMSA 2Z5UA 4N9HA 3CUQA 3SXYA 1WIHA 3JAMK 4BHBA 4AWXB 3K1MA 2PFBA 3KP3A 3KZYA 1O3RA 4C2MC 3OEPA 1C0WA 3OV8A 4G94A 3I5UA 1IAWA 3IHUA 3NRVA 4UUVA 2YSRA 3BDDA 4KN4X 5IT9Z 1JGSA 2XCQA 1R7JA 1YYVA 5E20A 3Q9SA 5EEHA 1K6OA 3F22A 1D8KA 1HBXG 1STZA 3DFGA 3CO6C 4K2EA 1KU9A 1TQPA 4A2UA 4L9TA 3TKYA 2MH2A 2VE9A 2HTJA 4EJVA 5DDGA 1PDNC 2HFHA 3ZMVA 3LAPA 4KAWX 2ESNA 2PMHA 4CHUA 4WXDA 2O6GE 3F8NA 4A6DA 1S6LA 1I6XA 5EGEA 2PG4A 1OYWA 3QPHA 1SAXA 4Q48A 5D5UB 1WKMA 1FPQA 2LSOA 2FNAA 1LVAA 3CO7C 3HHGA 4G0VA 1XSVA 3P9KA 3CUQB 5JFEA 4HQMA 2IP2A 1TWAA 2XAFA 1DPUA 1I1GA 5JI6A 2NRAC 3FMSA 1BC8C 3QPTA 3M8FA 4HYEA 3V8KA 3WTYC 1CGPA 1KQ4A 1O2AA 4WCGA 1F5TA 2VT3A 5TRDA 2DLLA 2PHCB 3FKIA 1ZVUA 2HKXA 4YIFA 3E6BA 4HX7A 2D1HA 4C3IC 1SMTA 1YQAA 2KIMA 1XXBA 3HRTA 3HRMA 4MGRA 1UB9A 2O3FA 3FX3A 2W84A 1LDDA 2LDUA 3R4KA 2P7CB 2Y48A 4UXNA 1G4DA 3MCZA 2D2WA 3WODF 3WTXC 4A0ZA 3S0XA 4CXFA 4MTDA 1ZRDA 2QBYA 2BGCA 3EYIA 3CJNA 2CG4A 1I5ZA 4KDDA 3ABUA 1OYIA 5LGTA 2VBYA 4XSXF 1FSEA 1J5YA 4U0YA 4EJWA 2QVOA 2MA3A 1BJTA 4KFCA 1R00A 1UCRA 4KM9A 3WTUC 2ESHA 2J5PA 4RB1A 2DPUA 2V9VA 2B0LA 3CUOA 5DD4A 1ZXOA 3ABTA 5L3GA 3WTSC 2R7FA 2Z99A