3FHZA

Crystal structure of the arginine repressor from mycobacterium tuberculosis bound with its dna operator and co-repressor, l-arginine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
molecule keywords Arginine repressor
total genus 39
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fhzA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3fhzA02
3CO7C 2GAUA 5HDNA 3K9TA 5LBQA 4YG2F 1XMAA 3IKTA 4R8HA 3KP4A 2O3FA 3TQNA 4DDQA 5E20A 1XSVA 4OMZA 5F64A 1ONVA 2UWMA 3F8NA 1YYVA 4HBLA 2CW0F 2F5FA 2NNYA 2COMA 3I59A 4G9YA 4OMYA 3I64A 3JAMZ 1SD6A 4RAYA 3HRUA 2P5LC 4BYYA 3P9CA 4EM0B 1WQGA 4LMYA 2QQAA 2R7FA 3QU6A 2QENA 2DAOA 2DQRA 1RNLA 1J2XA 3LFKA 3GEZA 1KQ0A 3FMQA 3OOPA 1W5TA 4RB3C 3K69A 2CYYA 2HZTA 1ZG3A 5ICFA 2ELHA 4IJAA 4UUVA 5ED4A 4KMUX 5CJ9A 4LB6B 2RQPA 5HDGA 4KB4A 3M7GA 2NNNA 5CLSA 3SZTA 2FU4A 1XSXA 2X4HA 4I0BA 4L5JA 2HQNA 1W7PB 1HKSA 1LDDA 4U0YA 2XAQA 3MWMA 5FLXK 4HF0A 3HUGA 4MTDA 5LGUA 3QX3A 5DUIA 3GZ5A 3W6KB 2FOKA 2K7LA 4DNCA 2V9VA 2W84A 4BHCA 4J3NA 1LEAA 5HS9A 3R0AA 4HLXA 1ZRFA 4N0BA 3L2CA 5IT9K 2DPDA 2RNJA 1S8NA 3T8TA 2W57A 3MAJA 1XMKA 5CVUA 1K78B 1XXBA 4IF4A 3SQNA 4Q5SF 2XCRB 4ASNA 2HYFA 3FOFA 2X0LA 3MEXA 5L3BA 2EJRA 1HQCA 3E5UA 3TDUC 1UHWA 3GFLA 2VT3A 1ZAOA 2BV6A 2JPBA 2EFNA 3GFJA 3GLXA 1EV7A 3BJ6A 2RV8A 2L02A 3I5UA 1BOAA 2DU9A 1B9MA 1AB4A 2EFPA 5FO5A 4CXFA 3LSTA 1IXCA 3LA3A 4KMFA 4WF2A 3KLNA 2CG4A 3J80Z 5D4SA 3VOEA 3IL2A 2ESNA 4L5IA 2VBYA 4TV7A 3LA7A 5FFZA 3D5LA 3WODF 4OU0A 5J8CA 4EJWA 1KYWA 3RJPA 4CYDA 1YTYA 2BE5F 1HSJA 4HDUA 4D0PA 3ZQ7A 3H3ZA 2XUBA 1XN7A 1F5TA 3V4GA 3WE3A 3TKYA 1TQMA 2ZFWA 5A2QK 3FXRA 1XDSA 2L4AA 1BGWA 3S2WA 3F8MA 1XDUA 3ELKA 5K5RA 2UZKA 1UFMA 2STWA 3WTVC 1LJ9A 3T5XA 4PGGA 2OAZA 3KP3A 4XLNF 4KB2A 1HKQA 1OYYA 3Q9SA 3WG9A 2Z9OA 4U88A 4LD5A 4FX4A 3TOAA 4O3MA 1J0RA 4P55A 1KU3A 3F6OA 1FLIA 3QU3A 5HVQC 2JZYA 2P6SA 5HLHA 4KNYA 2OU2A 3COAC 2P4WA 1TBXA 3L9FA 2HS5A 5LGNA 3GF2A 4RGRA 4U0VA 2P8TA 3M8EA 4FM9A 4AWXB 3QAHA 5DYMA 4LLGF 3FZVA 3K1MA 5HLIA 2XCQA 4M72A 1IN6A 1J59A 4I01A 1BN5A 4LLNA 3RPQA 1GXPA 4G7HF 2M5WA 4WCGA 3CUQB 3VA7A 1I27A 1JHHA 3QP6A 1WWXA 4L0YB 1B4AA 4KA4A 3BPVA 2G9WA 1OPCA 5LEJA 1ZGJA 3FX3A 2P5KA 1I1SA 2WTEA 3ML6A 4MEXF 1DP7P 4HQEA 1Q1HA 3TDZC 1R1VA 1RUNA 3R6SA 3WGIA 1G3YA 1QO0D 3HRTA 1DD5A 3GW2A 3N4MA 2R7DA 5ERIA 1TLHB 2V1UA 1ZH5A 4I98B 1L3LA 2DO7A 4KIBA 1I6XA 2ESHA 2XAGA 1IF1A 2VC1A 2D45A 4EJVA 1J9IA 5ICGA 4BHBA 1P4WA 1JGSA 3P7NA 2DLLA 1JHFA 4KFCA 2KIUA 1R7JA 4EVIA 3MZYA 4Q4ZF 1XXCA 4YFXF 4WK8F 1QBJA 3HOTA 1YW8A 3E6BA 3WE2A 5E8IA 2O03A 4G0WA 2WC2A 1XB4A 3NRVA 1UHMA 3EDPA 3PQJA 1FZPB 1HW5A 5E1XA 2KIMA 2EB7A 3K1NA 3E5XA 1OYIA 3ZMVA 4GGGA 3V7CA 1FSHA 1QQIA 1IN4A 4ENKA 2ISZA 2DQLA 2H94A 1O7LA 4ESBA 1J5YA 2LDUA 2IA0A 2RC4A 3CDHA 4I0AA 4KICA 1U8RA 4M6XA 2BYVE 4ZZDA 2BGCA 2GA2A 2UXXA 4AVPA 3FM3A 3LPXA 4BH9A 2ZKZA 3Q9VA 1XD7A 4L9NA 4EJOA 1UB9A 1HW2A 2BBYA 1V4RA 2XIGA 2ZBKA 3JSPA 3JTHA 1RIOH 2HQRA 4UV8A 3GO5A 2DI3A 4S04A 2P5MA 5CVJA 2HFHA 2QBYA 3FM5A 1W4MA 3FMSA 2F5CA 4LG0B 2QM3A 3HHGA 3F8FA 2KKOA 4Z2YA 2Z3YA 5L3CA 2P6TA 5DCMA 1D8JA 2DK5A 2AXLA 3CUOA 1XGOA 3I59B 2GA1A 1IXRC 2HEOA 1D3YA 3OPFA 3RKXA 2CFXA 1LNWA 4GCVA 4A0YA 1XCVA 1Z05A 3CUQC 4M71A 3IHUA 4UVAA 5DD4A 3EETA 4CDGA 1R5HA 4GO1A 3QRFF 1LB2A 5JR3A 1YQAA 1G6NA 2JT1A 2YSRA 3LWFA 4CZZA 5FB2A 4FHTA 2QUFA 4IRGA 3MFKA 3HHHA 4HLYA 4KDPA 3GVAA 1FYKA 1F1ZA 3TOBA 4RB2C 5H6RA 1BIAA 4M74A 1WRJA 5CVIA 4E70A 1AWCA 4M73A 5JFRA 1FBSA 1IUYA 3CJNA 2O61A 1FBQA 2VT2A 3DF8A 3IRQA 3LAJA 2LSOA 2Q8KA 2EV0A 2VBWA 3E6DA 2HKOA 4HZFA 2ZMEA 1RZ4A 2W24A 1EH1A 2OQRA 4KN4X 5DV5A 2XV4S 2F5DA 1ZGAA 4LLLA 4HV5A 2ZFZA 2IP2A 2MLKA 2DFIA 2HTSA 3F8CA 3SXYA 2ZCWA 2L4MA 4KUMA 1O3TA 4WWCA 1H9TA 1R00A 2A6HF 2ZNYA 1ZREA 4CICA 2ACJA 5TJJA 2MA3A 3I0TA 5LLQA 4YFNF 1U5TA 4WXHA 3G73A 1IS1A 1T6SA 4BXUA 4JQFA 1IRGA 2VE8A 4Y15A 2A68F 1U5TC 4RGSA 3P9IA 5JVOA 4HX4A 3GXOA 1FYLA 3GZ6A 5LEKA 4ON0A 2QZ8A 4L0ZB 3WGGA 4QLCU 1ZLKA 4L18B 1G3SA 2FMYA 1L0OC 5DCMB 1PDNC 1T38A 1T0FA 3NQOA 3HRSA 1YFHA 1QPMA 3KFWX 1SMTA 5DD8A 4UXNA 2FRHA 4IRHA 1XGMA 4GXOA 1W5SA 2LKPA 2HR3A 4HF1A 2G7HA 3I53A 1U78A 1P4XA 5ILUA 4G7OF 3E6MA 1SFXA 3RKYA 2FA5A 4O5VA 2IW5A 4KIGA 2O6GE 2RKHA 4MTEA 2EFWA 2OZUA 4ETSA 5E1ZB 1F4KA 3J7AO 1SD4A 2RVCA 2JTVA 1K6OA 4EGYA 5A2QZ 4EM2A 4WXCA 1W7PD 4XSZF 3WU0A 5LHIA 2WV0A 2NRAC 4PDKA 3WTWC 3N97A 4NQWA 1S3JA 3I71A 3DFGA 1J75A 2VC0A 1PUEE 4KAWX 3ISPA 1HBXG 3AAFA 4U7BA 4IRIA 3ABTA 1MKMA 5AONA 1USSA 2JRTA 4EJTA 4U7DA 2PEXA 4LK0F 5BS6A 2V79A 4AD9A 4PCQA 4DQ2A 3KP5A 4I7HA 2ETHA 5ILVA 1G3WA 2GIVA 2XAJA 3L4KA 3C1DA 1BC7C 2R3SA 2RGRA 1P92A 3IKVA 2IA1A 4XLPF 2ZXJA 1MD0A 5FFXA 1SD7A 2FBKA 2JPCA 1YS7A 4S05A 4HX7A 1G4DA 4YIFA 1AOYA 5K5QA 2YX7A 3W6JB 1LVAA 2PN6A 5BPIA 1PP7U 2OQGA 3BPXA 1K78A 1O7FA 1IXSB 1Y0UA 3R0JA 2KRFA 1KU7A 5F1RA 3F21A 5IT3A 3JTGA 1FSEA 2IVMA 5IT9Z 4JBAA 2UXNA 3E97A 3DPLC 3FXQA 3ZN1A 1E17A 4HX8A 3NUHA 4HDVA 2PI0A 2H6CA 5D5VB 1YW9A 5EEHA 4ZYEA 2L54A 1FX7A 2Q0OA 1IZ1A 4LFUA 1DUXC 2IPQX 4G6DA 5D6EA 1ODDA 1Z7UA 4ENMA 2KJBA 3WTSC 3KETA 5KK1A 4B8XA 2P7CB 4HF2A 4MQVA 4CGZA 2Y75A 1EH7A 2IRFG 1EH6A 4UHTA 5H6QA 4AIJA 1O57A 2GWRA 2YPRA 5D8KB 1O3QA 4A2UA 3WGHA 3V8JA 2E1NA 1EH8A 1Z6RA 2H27A 4R79A 3BP8A 5EEGA 4MNUA 2IT0A 4CO8A 4HV6A 4B09A 5E8GA 2RDPA 1MDMA 1R58A 2FBHA 4I2OA 2Z99A 2OD5A 4GYIA 2A69F 3T0YA 5KVRA 3ECHA 1ZRCA 3JAMK 2GQQA 1IN7A 2V1DA 4XRFA 3FF5A 3J81Z 2DT5A 4KC6A 2XCOA 4OIRF 3VEPA 1J7KA 1GE9A 3RIRA 2EA2A 1U2WA 1YS6A 2ISYA 1SMYF 5D5UB 3WTXC 2VBXA 3KP2A 3BJAA 2YR2A 4G8XA 2G7UA 1Z9CA 1A04A 1STZA 3E6CC 4A5MA 3WTTC 1YG2A 5JI6A 2M30A 1MGTA 4NB5A 4P9UA 3E3VA 4UVBA 3I54A 3H3UA 3EUHA 5HDKA 1XCBA 3VB2A 3CLOA 4BAYA 5DEQA 3MQ0A 5HOOA 4Y17A 2FMLA 2MLGA 3CAGA 1FOKA 1FP1D 3TGNA 4H0EA 3KLOA 2PJPA 1GVJA 1GHCA 1FT9A 2Y0MA 4ZYHA 4AIKA 1K79A 1OMIA 4WXDA 5D8LB 2Z33A 1B4BA 2DW4A 3RYRA 4M9XA 1BI3A 3BWGA 4ZZLA 2CQKA 2XHKA 3ABUA 1FC3A 3ERED 2FSWA 4RGUA 2MH9A 4BHPA 1ZYRF 3ZP5A 4IHTA 2GXBA 3F23A 2XVCA 1B9NA 1K7AA 1OYWA 5LRSA 1WI9A 2FNPA 2J5OA 3EYIA 2ZO4A 3HTSB 4RS8A 1IRFA 2MC3A 3HIFA 2FNAA 1BI2A 1LQ1A 1Z1DA 1BC8C 1B6AA 4L9JA 3OREA 1XGSA 1ON2A 1OR7A 5ILSA 4PGHA 2VOOA 5D5XB 5D5WB 2E7WA 3K1PA 1KA8A 1S7AA 4RB1A 5L3EA 1QZYA 1P4AA 1FPQA 3P9KA 5L3GA 3REOA 5FGMA 3E5QA 1U3EM 1YIOA 5L3FA 2F2EA 3F6VA 1T98A 4PZJA 3IRRA 3C18A 3TO7A 4N9IA 5AIQA 3EQLF 4UVCA 3KZZA 4A12A 4JK1X 2DPUA 2XRNA 1ZN2A 2PMHA 2NAZA 1PP8F 1U6GA 2EFOA 3HSEA 3LAPA 1R22A 2XAHA 4HYEA 3J80K 3QPHA 5HS8A 3VODA 3PFIA 4A6DA 5BMZA 6PAXA 1FWZA 1QZZA 1B1BA 1TTYA 1ZRDA 4MGRA 4EMSA 4BQAA 2ZNZA 4ESJA 1U5TB 5DUKA 2A3SA 2PHCB 1ZVUA 3H92A 2NYXA 2C6YA 2P7VB 2OZ6A 1OKRA 3GWZA 1S29A 4G0UA 1R1UA 2EWNA 1DPUA 5JHUA 2KJCA 3IWFA 5E18F 3QP5A 4I09A 4Q48A 3L00A 3BDDA 3LA2A 4OINF 2QBYB 4K2EA 2F5EA 3DQVC 1MJAA 3ULQB 4F7ZA 2NS0A 1XSDA 3BROA 2PMUA 2FBIA 3IWZA 3TO6A 4YIIA 2BEOA 2OA4A 2E7XA 2K02A 1KU2A 1Z6TA 1YW7A 4AIHA 2A61A 3F72A 1USTA 1CGPA 5ICCA 1YO5C 3RI4A 3T1BA 4MHGA 5J8FA 1KGSA 2QQ9A 5AIPA 3ZMDA 3RPUA 3B02A 3GUDA 1R23A 1C0WA 5LHGA 5LHHA 2K4JA 1SFEA 3BY6A 5E17F 3DP7A 1X3UA 2CWEA 1D5VA 2M87A 2W85A 1ZARA 2QYOA 1BM9A 2M45A 4O6JA 2K86A 2XROA 2FQ3A 2D2WA 3BOQA 3V8LA 4YFKF 4CHUA 4MQ9F 2D1VA 4ZH4F 1LEBA 1ISEA 2HYGD 1NHAA 4A0XA 4UNOA 3ZPLA 1V3FA 2L3DA 3RDIA 4MEYF 2JSCA 3K2ZA 3RTRA 4XBFA 1IN8A 5D6FA 3C7JA 4G0VA 2VONA 3F8BA 5F6FA 1TW2A 2ZMEB 1DDNA 2CO5A 4RGXA 4L9TA 3L09A 1QNTA 2EV6A 3VFZA 2Y48A 1Z91A 2J5PA 2QVOA 3KP7A 3OEPA 1KQ9A 4ESFA 4IXAA 2ADUA 3QPTA 4R1HA 1REPC 2YX4A 2EFQA 1JE8A 5D4RA 3HRMA 4XSXF 1LDKB 3PQKA 4KIFA 4KDDA 3V7SA 1LDJA 2B0LA 3J81K 3Q5FA 4EGZA 2L01A 3JW4A 2STTA 4A0ZA 1VTNC 3ZN0A 2QLZA 4ENJA 1BJAA 1H9GA 2PG4A 4P96A 2PFBA 1WIHA 1FNNA 4UV9A 4HQMA 2GXGA 2CSOA 1WQHA 3F3XA 3HYIA 1DPRA 5E1WA 4G94A 1P2FA 4RAZA 5H20A 2E1CA 3JSOA 4L9VA 2A6EF 4IPAA 3CTAA 5J6XA 2HDCA 2W25A 3U2RA 4IVNA 4Q47A 2H09A 2P5VA 2KWAA 2XKPA 4OIPF 1T2KA 2PBIA 1FY7A 3R60A 2VBZA 1SAXA 1XGNA 3RYPA 3IC7A 1EK8A 1G3TA 3O3KA 5BOXA 3MMLB 4NHJA 2KIFA 2VE9A 4LJZF 4GYGA 4G7ZF 1ZG1A 3V8KA 2AS5F 3MZHA 4GFQA 3CO6C 2XGXA 3DV8A 3KP6A 1TNTA 2IA2A 2LNBA 3GFMA 4I02A 3L7WA 1CF7A 2ZJ2A 5DDGA 1F9NA 3BJOA 4KT5C 4OOIA 4LG0A 3GYHX 2XKOA 2DBBA 3R4KA 2O0YA 3LQRA 3QOPA 3GFIA 2FXAA 1GXQA 2Z5UA 5DCFA 4WX9A 3FWEA 1S6LA 5K5OA 2PQ8A 5HLGA 3SZPA 2WWYA 1R1TA 2LF8A 2MH2A 2EA4A 3R61A 2HWVA 4LK1F 3SHFA 4A5NA 4P5OA 3HSRA 1BI1A 3ZMUA 1HXDA 2FEZA 1UCRA 2O8XA 3KEQA 2DK8A 4KN7X 1E2XA 5CYVA 1BI0A 4ZYGA 2QWWA 5LRRA 3DXJF 1RI7A 1IAWA 1HKTA 1TNSA 3ZMSA 3DKWA 1WKMA 3ZMTA 3L4JA 3FMRA 2K27A 1R5GA 1IN5A 1O3SA 1BJTA 3HTUA 3C3WA 4HW0A 3O2PE 2IJLA 1ZG5A 1MJ9A 3G3ZA 1QGPA 3FXUA 2LF7A 4EJUA 2MD5A 4EV0A 3HOSA 1MZBA 1B59A 1CF7B 3U1DA 4RB0A 4P9FA 3U9GA 3F22A 4Y13A 2HOEA 4QWQA 4G6QA 2D1HA 1MJBA 3LQQA 3MCZA 5ICEA 1FP2A 2PLYA 5TRDA 1TQPA 3B73A 3KCCA 2V1XA 4EQQA 3HSFA 1H0MA 2YU3A 1R36A 2HKXA 1KYZA 2HTJA 2FF4A 1YLFA 2CGPA 3NEUA 1D8KA 3ZMZA 3GX4X 1KQ8A 2QQBA 3WTUC 2VODA 1ZLJA 4KYWA 5FD5A 1FYMA 4U0WA 3M8FA 1ON1A 5JVTA 1WQFA 1S7OA 1RUOA 3ROUA 2MBFA 1T39A 1BBYA 1KU9A 4BNCA 5FLXZ 3TO9A 3EYYA 1TW3A 3D0SA 2VXZA 2RGVA 3I4PA 4LB5A 1P6RA 2VOPA 5CVRA 3BZ6A 2M8EA 1IW7F 3CUQA 4LGWA 3OV8A 3V7RA 3M1EA 2Q2EA 1WQ2A 1ULYA 1WSUA 1XXAA 4ZYDA 4HAMA 2A5YB 5BPDA 5HS7A 3DPTA 2EV5A 3KZYA 2OBPA 2XAFA 3O6BB 5FD6A 1SFUA 4FX0A 3M9AA 4A6EA 2XASA 3SFZA 1O3RA 3DEUA 2Y3PA 2RN7A 4EM1A 3T8RA 4HA8A 2VN2A 3BUEA 4OIOF 1I5ZA 1TQIA 4M6YA 3KE2A 3I58A 5LGTA 4OIQF 4FT8A 3FOEA 3K0LA 4ENNA 4IHSA 2V6CA 5L3DA 2TDXA 3WTYC 1MDMB 1FBUA 2K4BA 2M1BA 3ECOA 2A07F 5K1YA 4HOBA 4N9HA 3WTZA 1SD5A 1HW1A 2FE3A 5BQTA 3FHZA 1I1GA 3RKWA 3KEOA 3WU1B 2DTRA 1BIBA 1JXSA 4M9SA 2H6BA 2HGCA 1HSTA 1W7PA 4M9ZA 2GZWA 1ZHFA 5CVVA 2EK5A
chains in the Genus database with same CATH superfamily
4XLFA 3CO7C 2GAUA 5HDNA 4UB8C 1JQWA 5IOQA 3K9TA 5LBQA 5C4XK 4YG2F 2R7VA 1XMAA 1U0JA 3IKTA 2JA6A 4R8HA 1IUFA 2P0WA 5M3FJ 1H88C 2NVTK 2M4GA 3KP4A 2O3FA 2A5WA 1GT0C 3GTMJ 3TQNA 4DDQA 1IRZA 3SZZA 2V1NA 2LRDA 2VB6A 5E20A 1XSVA 4OMZA 2QCOA 1ONVA 5F64A 2UWMA 2DA6A 5J4YA 2LY2A 2R7RA 4A3LK 3F8NA 1YYVA 3U1KA 3QOEA 3GZNB 4HBLA 2CW0F 3HKZN 2F5FA 2M7BA 2E2HC 3VPRA 2NNYA 2COMA 5IYCJ 4MEXA 3I59A 4G9YA 4RMNA 4OMYA 5J1UA 3I64A 3JAMZ 5IYDC 3DWLE 3EUAA 1SD6A 4RAYA 2DOEA 2M0MA 3HRUA 2JA2A 2HPIA 4UUSB 2P5LC 4BYYA 3P9CA 1TWFJ 2JVHA 4EM0B 1WQGA 3O8HA 4LMYA 2KP6A 1A5JA 5IP9C 3M3YJ 1PUFA 5M5WK 2QQAA 5F1JA 3E1SA 2R7FA 3S32A 3J7AY 2EIMH 2X1CA 3QU6A 2QENA 3GTMC 2K9NA 2DAOA 3I4MJ 2DQRA 4G7HA 1RNLA 1J2XA 3TP0A 5GADJ 2RH6A 3LFKA 2Z16A 2A05A 3GEZA 3Q0WA 1KQ0A 3FMQA 5JLWA 2AHQA 3OOPA 5C44K 3A03A 2K40A 4PJNA 4RBOA 2HPMA 2B9SA 4O2DA 2NVXJ 3Q0VA 1W5TA 4RB3C 3K69A 2CYYA 2HZTA 1ZG3A 4Y52J 5ICFA 2ELHA 4KJZA 4C3JC 4IJAA 3G4AA 4UUVA 4BLAA 5ED4A 2W7NA 2GOMA 4AM3A 4KMUX 5CJ9A 4LB6B 1RETA 2RQPA 3GMEA 5HDGA 4KB4A 5GAHJ 1T33A 2F4OB 1RC9A 4QIWD 3M7GA 2NNNA 1ETXA 1Y1WC 5CLSA 3SZTA 1XSXA 2FU4A 2X4HA 4HNVA 4I0BA 3P5JA 4L5JA 3NWSA 2HQNA 1A31A 2WV1A 1W7PB 1HKSA 1LDDA 1OQYA 2IEKA 4U0YA 4ZC3A 2XAQA 1Y1VA 1B72B 3MWMA 5FLXK 4HF0A 3HUGA 5E3OA 5IY5H 4MTDA 5LFAA 5LGUA 1YITI 3S1MK 1D0ZA 2XGCA 3QX3A 5DUIA 2DCEA 3GZ5A 3W6KB 5FLMK 2FOWA 3CMAI 1UG0A 1WVRA 2FOKA 1WOSA 4BJTA 2K7LA 4DNCA 2V9VA 2R7ZK 4Q4ZA 1NTCA 4XLEA 2BY2A 2W84A 1WCMA 4BHCA 3GTLK 3JRDA 3PL8A 1ZR4A 4J01A 4BACA 4BBSK 5IOZA 4J3NA 5M3FK 4RDUA 2XB5A 2I5UA 1LEAA 5HS9A 1V54H 2EIKH 3R0AA 1VQOI 4HPQA 3K4MA 1ETKA 4CCNA 4HLXA 2R5ZA 4N0BA 2DA7A 3L2CA 1ZRFA 4L5EA 5M5YJ 5IT9K 2DPDA 3GTPA 1ENHA 1Z67A 2RNJA 1S8NA 3D5SC 3AQOA 3T8TA 1OFCX 2GBYA 2W57A 4KARA 4H4KC 3KX2A 1ZXOA 3A02A 2VUMC 1WOOA 4XLCA 1RRJA 3MAJA 1XMKA 5LD2C 5CVUA 1K78B 1SANA 1XXBA 2XF7A 4IF4A 2VJ4A 3SQNA 1FTZA 2H8WA 4Q5SF 1SFOA 4IHVA 3S1RJ 1TWFK 2JK3A 2XCRB 1VI0A 4ASNA 3S1QK 1C0AA 2EBBA 5TMCA 2HYFA 3FOFA 2X0LA 1F43A 2R7XA 3MEXA 5L3BA 2EJRA 3M3YK 1MW7A 1HQCA 3E5UA 3TDUC 1UAAA 1UHWA 3GFLA 2R92A 5IYDK 3ABMH 3ESWB 4GTCA 2VT3A 1ZAOA 2EZKA 4BY1K 3PJRA 4A3MK 4C2UA 2GLOA 2BV6A 1YJ9I 3J7YJ 2JPBA 3Q3SA 2K5CA 2OV7A 4Y52C 4DYQA 4D7MA 2K3PA 1W0TA 2DMTA 2EFNA 3S17K 2NVXK 3GFJA 1JKOC 3GLXA 3LNQA 3BCAA 1EV7A 5F0FA 1IGNA 4C2MC 3BJ6A 2RV8A 4IKFA 2L02A 3I5UA 1BOAA 5GTHC 2DU9A 1G51A 1B9MA 1AB4A 2EFPA 5FO5A 4CXFA 1IE0A 3LSTA 1ZR2A 2GSUA 1V5VA 1IXCA 1SFKA 3LA3A 4KMFA 4WF2A 2E2IJ 1OR7C 2ZJRF 3KIOA 1QZEA 3KLNA 2CG4A 3J80Z 2WAQA 2H1KA 2M34A 3HXAA 5D4SA 5FJ8J 2GSOA 2XGDA 3VOEA 3S14K 3IL2A 2JVGA 2ESNA 5B66C 2NVXC 3WG7H 4L5IA 2E2HA 2BXZA 2VBYA 1X4PA 4TV7A 3K70D 4MO7A 2XSDC 3LA7A 5FFZA 5GPAA 1OCTC 2GXAA 1FMVA 3D5LA 4KMAA 3WODF 2JUGA 2WY7Q 4OU0A 5J8CA 4AC0A 3G2BA 4EJWA 2H8RA 1KYWA 3M8JA 4BQOA 3RJPA 4CYDA 1YTYA 4A3JC 1WJ5A 3BG5A 4A3FJ 2BE5F 1ITYA 1ZBSA 1XC5A 1HSJA 4HDUA 4D0PA 3S1RC 1FIAA 5CQEA 3ZQ7A 4XQFA 1LE8B 2CW7A 3M4OJ 3DPUA 3H3ZA 2CUEA 1D0XA 2XUBA 1XN7A 4QJVB 1F5TA 1A6QA 5IP7J 2JA5K 3V4GA 3WE3A 2ZUFA 3TKYA 4E7HA 1TQMA 4A3GK 2ZFWA 3GIRA 5A2QK 3OSFA 3FXRA 3BTIA 4B1RA 1XDSA 2L4AA 1BGWA 3S2WA 3F8MA 1WJFA 5KAFC 1XDUA 2JQ7A 3HGYA 1GLNA 5DTDA 2ZXWH 4MIMA 4C3IK 3BR3A 1ETWA 3ELKA 2DOFA 1Y0NA 5K5RA 1I3AA 3OYHA 4FE4A 2LVSA 2CUFA 2UZKA 1ZKGA 5C4XC 4OIOA 1UFMA 1TWAA 4G7OA 2EINH 2KZGA 2STWA 3WTVC 1XZQB 1Y8QB 1Q1VA 3S15J 1KQ4A 1LJ9A 3AG3H 3T5XA 4PGGA 3HM5A 1MBHA 3UR3C 4A3CC 2O5RA 2OAZA 3KP3A 4XLNF 4F93B 4A3MJ 1R49A 2MABA 1HKQA 1OYYA 1JT0A 4KB2A 3H3VD 3GEEA 3Q9SA 2VKVA 4JX6A 2K3FA 3WG9A 2VKDA 1ZTRA 4LITA 1X1CA 4LD5A 4U88A 2RQQA 2Z9OA 2V6UA 2Y0SD 4FX4A 5CQGA 3EPZA 3TOAA 1M1EB 2FQ4A 4M6VA 5F0HA 4O3MA 1J0RA 5F04A 4BY7J 3JRAA 1YOVB 4P55A 3PSIA 4P1WA 1KU3A 1EA3A 3F6OA 1OJLA 3H0DA 1YJWI 2JWTA 3QYEA 4HNTA 1VQ6I 4IQ4A 1HCRA 1FLIA 2O7OA 3QU3A 5HVQC 2JZYA 1POGA 2P6SA 5HLHA 4KNYA 1X31C 2OU2A 3JRHA 2O5IA 1QRYA 2NOGA 4C3JJ 3S14J 3COAC 2P4WA 1TBXA 4A3BC 4A3MC 3H5RA 4AIDA 1F36A 3OR1C 3L9FA 4NOIA 2HS5A 3VDXA 4A3IK 5LGNA 3CP2A 1VF9A 3GF2A 3I4NK 4RGRA 4U0VA 1SFOJ 2CUJA 2P8TA 4BKXA 3M8EA 4FM9A 4AWXB 3QAHA 5B5EC 1BR1A 5DYMA 4LLGF 4A3FK 3FZVA 1IRXA 3K1MA 5HLIA 2D5VA 3HKZA 2DA2A 2E60A 2XCQA 2OTJI 3TFJA 1I6HK 1NG6A 4NQWB 2E2JJ 2GSNA 4M72A 1PJ7A 1IN6A 2PPBA 2AQFA 3ZCOA 1J59A 4I01A 2R93C 5EGEA 1AHDP 1HOMA 3CJQB 3AFHA 3CCEI 2DDBA 1Y1WA 4JP0A 2WAQL 1LFBA 1BN5A 4LLNA 2EILH 2B7EA 1BDFA 2R93A 3RPQA 4IOAF 3K2AA 2XPVA 1GXPA 5M5YK 3NWTA 3VYSB 4G7HF 3HB9A 2M5WA 1P7IA 3S3NA 1O2FB 1J6XA 4WCGA 3CUQB 2DA5A 3LMMA 2DT6A 3VA7A 1I27A 4KISA 1JHHA 3QP6A 1WWXA 2DA3A 5KNLA 2A6HA 4L0YB 1B4AA 4KA4A 3B6AA 1RKWA 3BPVA 2G9WA 4M3FA 5IYCC 1OPCA 5LEJA 2NVXA 2CFOA 1ZGJA 3EUKL 3GTKA 3FX3A 2P5KA 1I1SA 2WTEA 3ML6A 4MEXF 1Z0XA 1DP7P 3HOVK 4HQEA 1Q1HA 3TDZC 1R1VA 1RUNA 4BY1J 4KATA 2L7MP 4QIWL 3R6SA 3WGIA 1MMNA 1G3YA 1YNNA 4DJAA 9ANTA 1QO0D 3HRTA 4BY7K 2A6EA 1O25A 1DD5A 5JVGF 3GW2A 3BQZA 4N4NB 3OYMA 4XOPA 2R7DA 3N4MA 5ERIA 3CMYA 1TLHB 2V1UA 3S17J 3W3CA 2CV1A 1F93A 3HGGA 4PJLA 5C3EJ 1ZH5A 2BHYA 3QPLA 4I98B 3H9QA 1Z7LA 1L3LA 2DO7A 2JA8C 4KIBA 2E35A 1I6XA 2ESHA 2XAGA 3SYTA 1IF1A 2VC1A 1JUPA 3CDLA 2D45A 4EJVA 3OYCA 1J9IA 3TW6A 3GTOK 5ICGA 5FLVA 1E3PA 3MKLA 5KHDA 4BHBA 1PJ5A 5C4JJ 2VQLA 1P4WA 1JGSA 3P7NA 3S1QC 4S0HB 2DLLA 1JHFA 2HI3A 5FJ8K 3DU6A 4KFCA 2E2IC 3S2DK 5E79C 2K85A 2KIUA 1R7JA 4EVIA 1TWHJ 3MZYA 1PJ6A 4Q4ZF 1ORKA 1XXCA 4YFXF 4WK8F 1QBJA 4ZDLA 1I3QC 5KCMA 4I99C 3BG6A 3HOTA 4IEJA 1WJBA 2L7ZA 4IHWA 2E2IA 1YW8A 3E6BA 1KZHA 3ZQHA 3WE2A 1Z77A 3FKIJ 5E8IA 1X1PA 2O03A 4G0WA 2WC2A 3GTQK 1XB4A 3NRVA 2W82A 2DXIA 3PO2K 4F55A 1MSFC 4BUPA 4ANJA 1UHMA 3QQAA 3Q3QA 4D5CA 3EDPA 1FOYA 4PJ0C 4ITVA 2V9PA 3PQJA 1FZPB 1HW5A 2K9QA 5E1XA 2KIMA 2EB7A 3K1NA 3E5XA 3VWBA 4XNFA 2FQTA 1MBFA 1OYIA 3TL4X 1X19A 3A8KA 3ZMVA 4A3GJ 3DBHB 4GGGA 3V7CA 1VQ7I 3JRBA 1FSHA 1XPPA 1QQIA 3ZQFA 1IN4A 1VZ0A 4ENKA 2A68A 4FCYA 2FQOA 1I50J 2XF5A 4A3KC 2ISZA 2DQLA 4Y33A 1A6IA 2H94A 1O7LA 5EJCA 4ESBA 2E19A 1J5YA 2LDUA 2IA0A 4BE0A 2RC4A 3DLAA 3ABLH 3CDHA 2Z2SB 4CUGA 3W2WA 4I0AA 4KICA 1U8RA 1LKXA 3S93A 4M6XA 2BYVE 4NDLA 3MKZA 4ZZDA 2BGCA 3HOYJ 4A3KJ 2NVQK 2GA2A 4XRMA 2UXXA 4AVPA 1QVTA 2IS6A 1EFWA 1MMGA 4CSWA 3FM3A 3LPXA 4BH9A 2ZKZA 3Q9VA 5K7HA 1XD7A 4L9NA 4X0GA 3OL3A 4EJOA 1YRNB 4GRIA 5EF6A 1P7JA 1UB9A 5GAGJ 3S16C 1HW2A 2A6TA 3HOWK 2EH3A 2BBYA 2KRCA 1V4RA 2XIGA 1DU6A 2XRLA 2ZBKA 1X58A 3JSPA 3JTHA 4HSTA 2L7KA 1RIOH 4KASA 2EZHA 4X1EA 1Y39A 2XF6A 2BVLA 2F5VA 3NAUA 1RESA 4PK4A 2HQRA 4UV8A 3GO5A 2DI3A 5B1BH 3VYUB 4S04A 1WJEA 2P5MA 3RQ4A 5CVJA 1SMYA 2IS4A 2HFHA 2QBYA 1NG7A 1JUMA 1V55H 5C4JK 3FM5A 1W4MA 2VQCA 3FMSA 2M9HA 2F5CA 2Y0SA 2VXDA 3IH2A 4LG0B 2QM3A 3HHGA 4JK1A 4BBSC 3F8FA 4F91B 2KKOA 2ECBA 3BG7A 1MIJA 2Z3YA 4Z2YA 5L3CA 2P6TA 5F0CA 5DCMA 1IDYA 4A3IJ 4IQJA 3I4NJ 5JLXA 3K7AC 3TFIA 1MNDA 1D8JA 2DK5A 2JRMA 2QGUA 3OOUA 4NBQA 2CMPA 3FKIK 2AXLA 3CUOA 1XGOA 3I59B 2GA1A 4AYBN 3PO2J 1B72A 3PO3C 3ZR8X 1IXRC 5IYBJ 2HEOA 1D3YA 3DBRB 2HZDA 4OINA 1TL8A 1JKPC 3OPFA 4Y4RA 4UUSA 1A36A 2M4KA 3RKXA 2CFXA 4BY1C 1LNWA 4GCVA 4A0YA 1XCVA 1Z05A 3CUQC 4M71A 3IHUA 4UVAA 5DD4A 3I56I 3EETA 3QYFA 1AA7A 4CDGA 2Y9YA 4ABZA 1R5HA 3S3OA 4GO1A 5IYBC 4RLFA 4DW6A 3QRFF 3PO3K 1LB2A 5JR3A 1YQAA 1G6NA 2CW8A 5HNHA 3RZOK 1R9TC 2CFAA 4ILDA 2JT1A 2YSRA 3LWFA 4CZZA 3CF5F 5FB2A 1HLVA 5CHPA 3ZQIA 2MW8A 4FHTA 2QUFA 4IRGA 3MFKA 3HHHA 4HLYA 2TCTA 2QKMB 3FDYA 3GVAA 4KDPA 2YU9A 2CQNA 1OCPA 4DIQA 2Y30A 3BG3A 2NVQJ 2CS3A 1FYKA 1F1ZA 5IOSA 1I50C 4KMHA 4IX7A 1JTXA 1FEXA 3TOBA 4RB2C 5H6RA 3AG1H 1BIAA 4M74A 4XONA 1WRJA 5CVIA 4EATA 3WHBA 4M73A 4E70A 5JFRA 1AWCA 1FBSA 2X51A 5CKTA 2LK2A 3HUGB 3JREA 1IUYA 4A3JK 3CJNA 2O61A 3HOXJ 3FKJA 3UNGC 1FBQA 2KZVA 2L9SA 2VT2A 3DF8A 3CCMI 4YFXA 3IRQA 2VPLA 3LAJA 2LSOA 2Q8KA 2EV0A 5J1YA 2VBWA 2ZUEA 3E6DA 2HKOA 3L2RA 1O2BA 2NVQC 2DDAA 4HZFA 2ZMEA 2HDDA 1VQ4I 1LUJB 1VQ9I 3H3VK 2CQXA 1RZ4A 4LK1A 1XX5A 4CZCA 3G71I 2V6SA 2W24A 4NC7A 1VQKI 1O24A 1TWHK 4XCHA 2B63A 1EH1A 2OQRA 2X1DA 4KN4X 5DV5A 2LTPA 2FD5A 2XV4S 2F5DA 1ZGAA 4LLLA 1K61A 1JUSA 4HV5A 3AH5A 4C45A 1VGXA 2ZFZA 2IP2A 2MLKA 2DFIA 2HTSA 2V7FA 3GTKJ 2CV2A 3F8CA 3SXYA 2MG4A 2ZCWA 2L4MA 4KUMA 2NVYJ 3RKQA 2CV0A 1O3TA 5DM7F 1UG2A 2KDZA 1ETQA 1EJ9A 4XSXA 3SEQA 3GTJK 4CCOA 4WWCA 3U21A 1H9TA 2EQRA 1R00A 2A6HF 2NXNB 5HLTA 2ZNYA 2LD5A 3PO3J 1YRNA 1ZREA 1ZQ1C 3GTQC 3PNVA 4CICA 2ACJA 5TJJA 1GUUA 2MA3A 3CESA 3SJMA 1HQMA 3I0TA 5LLQA 1UV7A 4YFNF 2R7ZJ 2PMZL 2O9LA 1U5TA 3QWLA 4WXHA 3G73A 1IS1A 1YJNI 1T6SA 4BXUA 4YIRX 1EF4A 1IJWC 4JQFA 4BBSJ 2YUSA 4IL6C 2VE8A 1DGRM 1IRGA 4Y15A 1Y1WJ 2A68F 5M5XK 5IOTA 1U5TC 2LP0A 4RGSA 3P9IA 5JVOA 3H0GA 1A35A 1ETVA 4HX4A 2EPFA 3OYJA 3GXOA 3FXLA 3I55I 3PO2C 4AYBL 1FYLA 3GZ6A 1GDTA 3S3MA 5LEKA 4ON0A 3OS2A 3HOYK 2QZ8A 3WGGA 4QLCU 4L0ZB 1ZLKA 4A3KK 4L18B 4HRIA 1G3SA 1S5LC 2XB0X 2V4JC 2K9LA 2XSJC 2FMYA 1L0OC 1OCZH 2XDVA 5DCMB 1PDNC 1UHSA 1T38A 4X6AC 1T0FA 3NQOA 1B8IA 2HOTA 1UELB 3HRSA 1YFHA 1QPMA 2DMPA 1TWFA 3RCOA 3K10A 3AL0B 3H9JA 3M4OC 5TJ3A 1YX3A 1SMTA 2DFFA 3KFWX 5DD8A 1WSRA 3CF2A 4QSHA 4UXNA 3K4BA 2FRHA 2VJJA 1MH4A 1E3HA 4IRHA 2OTLI 2CW0A 1IO2A 5HL8A 1XGMA 3LSKA 4GXOA 1LE8A 1W5SA 2LKPA 3FBNB 1BR2A 1GVDA 2E1OA 2HR3A 4HF1A 1R4NB 2G7HA 3BCBA 3I53A 1DCHA 2BHZA 2E34A 1P4XA 5ILUA 1U78A 1JKQC 4G7OF 3KZIC 3E6MA 4UUTA 3HL2A 3A2KA 4KM8A 1SFXA 2DMQA 2FA5A 3RKYA 4O5VA 2G0EA 4C2MK 1VQLI 2IW5A 4KIGA 2O6GE 4BDZA 2RKHA 4MTEA 2JA6K 3HPHA 2EBIA 2GM4A 4XICA 4GFBA 4P5BA 4C3HK 3GTGC 2R93K 5EEAA 2EFWA 2OZUA 1R6RA 2CQ7A 3F9KA 2DT7B 4KN7A 4ETSA 5B3SH 4N4OB 5E1ZB 2Y0SN 2QKLB 5FKNA 5TGTA 3T01A 3LL7A 1F4KA 3J7AO 1SD4A 4PABA 2RVCA 2JTVA 1K6OA 4EGYA 5A2QZ 3GLLA 2R92J 2QSGX 4EM2A 4WXCA 3S1NK 1W7PD 3HOUC 2AO9A 4XSZF 1TWAJ 3WU0A 5LHIA 2JA7J 3OIQA 4DYRA 2WV0A 1GV2A 4BXXC 2WB1N 3HOVC 3GTQA 3TMOA 4GTFA 2NRAC 3G4CA 4PDKA 3WTWC 3N97A 1JT6A 2MGQA 2QSFX 2Y31A 4NQWA 3UKGA 1K83C 4A3CK 4A93C 1PVEA 2QSHX 1PYVA 1S3JA 3I71A 4JOMA 1VQ8I 3W2VA 1RR8C 4XKWA 4PSWA 3DFGA 1J75A 2VC0A 1DP3A 3KPHA 3JRGA 3ISPA 1PUEE 4KAWX 1HBXG 3AAFA 2ICWG 4U7BA 2DMNA 2JA7C 1KONA 4AYBD 1I3QJ 4W1UA 4IRIA 3ABTA 3PIPF 2BXYA 1DQUA 2HOSA 1MKMA 3IP4B 1USSA 2ZC2A 5AONA 2JRTA 4D7NA 5F08A 4KMDA 5IP9J 4EJTA 4U7DA 3AG4H 4LJZA 4M3BA 1ZQ3P 2PEXA 1QHGA 4LK0F 1HDPA 5BS6A 2V79A 3ASNH 2E71A 4AD9A 4PCQA 4DQ2A 3KP5A 4I7HA 2ETHA 5ILVA 1G3WA 2GIVA 2XAJA 3A0BC 3L4KA 3CC7I 5E68A 3J7ZI 3C1DA 4YFNA 4RM2A 1BC7C 3S15C 2R3SA 2GAHC 1BR4A 3CD6I 3OYNA 2VIXA 2RGRA 1P92A 3JRFA 2JMWA 3IKVA 2IA1A 4OWRB 4XLPF 2ZXJA 1PUFB 2I10A 1MD0A 3FXOA 4A3EK 2M0CA 5FFXA 3WODA 4DBRA 4LQYA 1SD7A 1JGGA 2FBKA 2JPCA 1YS7A 2KHMA 2L5QA 2LH9A 4HX7A 4S05A 4CCJA 1H89C 1J98A 1HI9A 3A8IA 1O4XA 4PJJA 2R7TA 3BP8C 3IH4A 1G4DA 4EEFG 4YIFA 5H2FC 3A01B 3GTGA 1AOYA 5K5QA 3GSIA 4YFKA 2DJIA 2VLAA 1VQMI 1YCLA 4CA0A 2YX7A 1Y1VC 5L46A 3W6JB 4ZYAA 1LVAA 1G8XA 3HJEA 2PN6A 3BPXA 2OQGA 3PSFA 3OYIA 5BPIA 1PP7U 1K78A 2KDOA 1O7FA 4LK0A 1MMSA 2KRHA 3GTLA 2E5NA 1IXSB 3L2QA 1DCOA 1Y0UA 4A3LC 3S17C 4UY8I 1V5GA 3R0JA 2KRFA 4C30A 1KU7A 5F1RA 3HOVJ 1LVKA 3F21A 3ZOBA 3LSPA 5IT3A 1YI2I 3JTGA 1FSEA 1W36D 2IVMA 4XM3A 5IT9Z 3GTJA 2R7OA 4JBAA 2R92K 2UXNA 3E97A 1Y1VK 4GTAA 3MD2A 1W36C 3DPLC 3FXQA 3ZN1A 1E17A 4HX8A 4C3JK 3NUHA 4GZYA 4HDVA 4OIPA 2PI0A 4NNJA 4RAGA 2DOAA 2H6CA 2RAEA 2V6TA 5D5VB 3GTPC 2NVYK 4XLNA 1DGWY 4D9JA 1WPKA 1YW9A 2KISA 5EEHA 4C2TA 4B47A 1UMQA 3BC8A 3DCFA 4ZYEA 2L54A 1FX7A 2B63J 2Q0OA 4Q5SA 2E2JC 1IZ1A 2BY1A 2N8GA 2XPWA 3BQYA 4LFUA 1I39A 1DUXC 1JKRC 1WGXA 5FROA 1MBEA 2IPQX 4KT6A 4G6DA 5D6EA 3OS1A 3RZDJ 2X6WA 2LYCA 1ODDA 1I6HJ 1Z7UA 4ENMA 2KJBA 1IDZA 5J4VA 3WTSC 1TWCA 3KETA 5KK1A 5EGOA 4B8XA 2P7CB 5EYRA 4HF2A 4MQVA 1N78A 4CGZA 1I3QA 1V5FA 2Y75A 2JA5C 1EH7A 3G4SI 5C44J 3BZKA 2IRFG 1JI8A 1SVOA 1EH6A 3D5RC 4UHTA 5H6QA 4AIJA 5FRNA 1O57A 3RSNA 2GWRA 2O8KA 4E7JA 2YPRA 5D8KB 1TWHA 4WILA 5E3MA 1O3QA 4A2UA 3T02A 1K4SA 3WGHA 3V8JA 2E1NA 3A01A 1WCMJ 1EH8A 1Z6RA 3ABKH 2R0QC 2H27A 4R79A 1VQPI 3BP8A 3TTGA 5EEGA 2GAGC 4MNUA 2IT0A 1R71A 3AD8C 4CO8A 4HV6A 4B09A 4RA2A 2CJJA 3AG2H 3OR2C 1VJEA 5E8GA 2RDPA 1MDMA 1R58A 3FXMA 3IV5A 2FBHA 3MZ8A 4I2OA 3HOXC 2FUG2 2Z99A 2OD5A 4GYIA 5EG0A 2HDWA 2A69F 3CQZJ 1TT5B 2HNHA 2MFZA 2IGMA 3T0YA 4M1XA 1R5ID 5KVRA 3ECHA 1ZRCA 3JAMK 3S0XA 2GQQA 3PM1A 1IN7A 1D1BA 2V1DA 4XRFA 2NVTC 3FF5A 4HEA2 3J81Z 3HOYC 2DT5A 4KC6A 3DEEA 1IV6A 3N0BA 3WU2C 4Y52K 3TEDA 2R93J 3G1LA 4XKCA 2H1LA 2VKEA 4OIRF 4KITB 3OYBA 1MMAA 2XCOA 3VEPA 1RU0A 1Y1VJ 1J7KA 3ADAC 1GE9A 3RIRA 1Y8RB 2EA2A 1U2WA 1QA6A 1ZYRA 1YS6A 2ISYA 3NARA 2WB1A 2L9VA 2IGNA 3DBLB 1SMYF 5D5UB 3WTXC 2BW3B 4AU7A 4Z6YA 2PJRB 2VBXA 3KP2A 3BJAA 2YR2A 2OCCH 4G8XA 4RAFA 2G7UA 1Z9CA 1A04A 4HG2A 2R92C 1STZA 2R4GA 2UUZA 4GTDA 2DA1A 3E6CC 4FE7A 4A5MA 3WTTC 1YG2A 5JI6A 2M30A 1MGTA 3DTIA 3S1RK 2WBMA 4A3BJ 1XG1A 2W00A 4NB5A 2JA5A 4XR6A 4P9UA 5FLMJ 4DYCA 5EZGA 3A4CA 3KYDB 5HNFA 4BXFA 4CYCA 3BTLA 3E3VA 5C44C 4PAAA 4UVBA 3I54A 3H3UA 3EUHA 1X4OA 5TMFA 5HDKA 1XCBA 4ZH4A 3K6GA 3OYKA 4QPQA 4I6ZA 5IP7C 2R7UA 3GCMA 3OYGA 1TWCJ 3VB2A 4CCMA 2BZTA 3CLOA 3IAS2 3KEYA 4B4CA 4BAYA 1QPIA 3SFIA 2LY9A 5DEQA 1JOEA 3GTKC 5FKMA 3MQ0A 5HOOA 4Y17A 2FMLA 4D1QA 2QA4I 2MLGA 1WCMC 3CAGA 1I6HC 1WJDA 4LG3A 1FOKA 3HOUK 3HPGA 4XOTA 3CCRI 1FP1D 1HC8A 3TGNA 1R4MB 2ZJPF 4XMYA 4H0EA 1YIJI 3KLOA 5JFEA 2PJPA 1K83A 2F4IA 3CCQI 1GVJA 1GHCA 1FT9A 2Y0MA 4ZYHA 2EZLA 4B43A 4AIKA 1K79A 1OMIA 1W1WE 1ETYA 4WXDA 5D8LB 2Z33A 1B4BA 4KM9A 2JJ7A 1TT0A 2DW4A 1BA5A 2JA7A 3ZQQA 4U87A 1MMDA 2HXIA 4ZJZA 2WAFA 3RYRA 4YRVA 4M9XA 3AD9C 1BI3A 3BWGA 1R9TA 2CQKA 2XHKA 3RQIA 4ZZLA 3CQZK 2ID6A 1FC3A 3ABUA 1D1CA 3ERED 4A3GC 2FJ1A 2FSWA 2QF7A 2MH9A 4RGUA 4BHPA 4D5FA 4XSZA 1ZYRF 4NUBA 1X1DA 3ZP5A 1VRQC 1BJZA 1HF0A 4IHTA 1WHUA 2GXBA 3S2HC 3HOWJ 3F23A 1K83K 2XVCA 4E4HA 1B9NA 2ID3A 1K7AA 1OYWA 4GT9A 4XKVA 1IC8A 5LRSA 1WI9A 2COBA 2FNPA 2J5OA 4XLHA 3EYIA 4ZDPA 4BU2A 3LSJA 1PJRA 2ZO4A 2Q1ZB 3HTSB 1ERDA 2W1OA 4M3DA 4RS8A 4BBRJ 1IRFA 1IW7A 2MC3A 3S8PA 3HIFA 2FNAA 1BI2A 3OY9A 1LQ1A 1MBKA 1Z1DA 3CCJI 4C3IJ 1BC8C 3H9GA 2PX9A 3FXKA 4NC6A 2WY8Q 1B6AA 4L9JA 1TWGK 2L7FP 2R5ZB 1APLC 3OREA 1XGSA 1ON2A 1OR7A 1N75A 5ILSA 1H8AC 1J6WA 1YE9A 1WJAA 4A3BK 3GBGA 4PGHA 2VOOA 1O2AA 3CJTB 5J40A 1XMXA 4BQQA 3GTPJ 5D5XB 2IS2A 5D5WB 1G59A 3S15K 1Z3XA 2E2HJ 2E7WA 1VH2A 3K1PA 1KA8A 1S7AA 1BS2A 4RB1A 2EZIA 2OUMA 1ZGWA 5L3EA 1QZYA 1P4AA 1FPQA 3P9KA 2PMZN 3LSGA 3ZXSA 4F52A 5L3GA 3H35A 4P9SA 3REOA 5FGMA 1LFUP 3E5QA 2WAQD 1U3EM 1YIOA 1BL0A 2JN6A 1K6YA 2ZXIA 5L3FA 2F2EA 3AL0C 2R7SA 1SVMA 4IOCF 3F6VA 1T98A 4PZJA 3IRRA 2XPUA 3C18A 1D1AA 3KYLA 3TO7A 4N9IA 2V26A 5AIQA 3GEHA 3EQLF 4UVCA 3GTOA 1XZPA 3KZZA 4A12A 4JK1X 2DPUA 3HDDA 3DKYA 1RR7A 1WCMK 2XRNA 1ZN2A 2R7WA 3AQPA 2PMHA 2NAZA 1FJLA 1EKEA 4JX4A 4RLQA 3ERMA 1PP8F 2KIQA 3M1CA 2W4SA 2AQEA 3LSMA 1U6GA 2EFOA 1B8IB 3HSEA 2HXOA 3LAPA 1TC3C 1R22A 2LREA 3CMMA 2M2EA 2JUCA 1WI3A 2XAHA 4KN4A 3GTGJ 4HYEA 3J80K 3QPHA 4B3XA 3TP3A 4XKBA 5HS8A 1K83J 3VODA 3I9V2 4XLPA 2Y2ZA 3PFIA 1O28A 1T95A 2ECCA 3ZRGA 4A6DA 3FK6A 5BMZA 2E2JK 6PAXA 1FWZA 1QZZA 4ZDOA 1B1BA 1TTYA 4M3EA 1ZRDA 1VLOA 4DZPA 4MGRA 4EMSA 3QYBA 4BQAA 3I4MC 1F7VA 5C4XJ 2ZNZA 4MQ9A 4ESJA 1U5TB 5DUKA 2R5YA 4BGDA 2NVTJ 2GIZA 2A3SA 4RM3A 5EZHA 1JJ8C 2Y9ZA 1AKHB 2PHCB 1ZVUA 3H92A 2LKSA 4DZJA 4FISA 3ZQCA 2WB1L 4P5AA 4QJVA 2LY1A 2OPTA 2NYXA 3SDBA 3JCUC 2C6YA 4KMUA 1TWGJ 3CC2I 3M3YC 4E7IA 2P7VB 2OZ6A 1OKRA 2ME0A 3GWZA 5FKOA 1S29A 2A69A 2WAQN 4BJ5C 1D5YA 4G0UA 4XL9A 1R1UA 4HSRA 1USMA 1W0UA 2PMZD 3C2HA 2EWNA 1W5CC 1F7UA 2JA8J 1IG7A 1DPUA 5JHUA 2E2HK 2KJCA 4E6KG 3IWFA 1JVIA 1NK2P 5E18F 3QP5A 1X1AA 3MKWB 4I09A 4Q48A 3L00A 3BDDA 3LA2A 1ACIA 1Z3YA 2AXTC 4OINF 4BLBA 2QBYB 3A1YA 2DFHA 2BY0A 2NS7A 4K2EA 2F5EA 3DQVC 1Z21A 3AKZA 1TWCK 3H1CA 1MJAA 3IAM2 4A3EC 2HOAA 3ULQB 3JRCA 2VUMA 3H36A 1FOXA 4F7ZA 3H5NA 4LR2A 1OCCH 2NS0A 3H0GJ 3SEZA 4QIWN 1XSDA 3BROA 1QVUA 3X2QH 1J6VA 3IPJA 3RZOC 2PMUA 3BR5A 2IAIA 4V2FA 3HOUJ 4BL0B 2FBIA 3IWZA 1X3WB 4YIIA 3TO6A 1SAUA 2BEOA 4IHXA 4G12A 3K7AJ 2X1EA 2OA4A 5M5XJ 3Q0UA 3GTOJ 2FX0A 2E7XA 2MC4A 1KU2A 1Z6TA 1YW7A 2K02A 4AIHA 3FIWA 3BT9A 2A61A 2ZB9A 4G7ZA 2HYJA 3EUHC 3MKYB 3CP8A 3FBIB 3F72A 1VFCA 1USTA 4AYBA 3OYLA 2IXSA 5ICCA 1YO5C 2XGEA 1JJ6C 1CGPA 1WORA 3SDGA 4J00A 1WOPA 3ONQA 2JA6C 2CFAB 3GTGK 3S1MJ 1TP4A 4CCKA 3RI4A 3T1BA 4MHGA 2CUZA 2F48A 3QPSA 5J8FA 1MSEC 1AKHA 3FK7A 1KGSA 2QQ9A 3CCLI 5AIPA 2NVYA 3ZMDA 3RPUA 3B02A 1NK3P 3GUDA 1R23A 1C0WA 5LHGA 3FXJA 2K4JA 3BY6A 1SFEA 5LHHA 1TZLA 5E17F 1UJ8A 3GTLJ 5FLMC 1GV5A 1AU7A 2BY3A 2NVYC 4BDYA 1IBAA 3IUOA 3T00A 3DP7A 1X3UA 2CWEA 1D5VA 2HVQA 2M87A 4MFDA 2W85A 3G1OA 2VASA 4XRSA 1ZARA 2QYOA 1BM9A 2JH3A 3OYFA 4BBRK 2M45A 5EGHA 4O6JA 2K86A 2XROA 2FQ3A 5K7ZA 2D2WA 1ZK8A 3DEWA 3FKIA 1X1BA 2DTZA 3N0CA 3BOQA 2DA4A 3S2DJ 3V8LA 4YFKF 4CHUA 2D1VA 4MQ9F 2JA6J 4ZH4F 2IS1A 5GPCA 3LSRA 3GTMA 1LEBA 1ISEA 2HYGD 3S16J 1IL2A 1NHAA 4A0XA 3D1NI 4UNOA 3ZPLA 4CH7A 2JA8K 1BW6A 3CCVI 4A3DK 1V3FA 3DLLF 2L3DA 4BQNA 3RDIA 4MEYF 2ZSIB 2PA8D 3CJRB 2Z1DA 2JSCA 4CCLA 4BE2A 3WHCA 1NH3A 4JYKA 2PMZA 3K2ZA 3S1NJ 1MBGA 1WJCA 3RTRA 2LR8A 4BY7C 1OCRH 1MNMC 4XBFA 1IN8A 5D6FA 3C7JA 4G0VA 2VONA 3OYDA 3F8BA 5F6FA 1TW2A 2ZMEB 5EDNA 4A3CJ 3GTJC 3PUBA 3HEFA 1DDNA 2CO5A 3L2UA 3FISA 3HKZL 3OIOA 1S72I 4RGXA 4GTLA 4B48A 3OSGA 3GEIA 4L9TA 2KFDA 3L09A 4GDFA 1QNTA 3DKXA 4YELA 3HOZK 1MBJA 2EV6A 3VFZA 3I3LA 2E2IK 2VPRA 4E7SA 1HDDC 2Y48A 1Z91A 3K4NA 2J5PA 1TWGA 4FQGA 2QVOA 3KP7A 1ZELA 4XLAA 3VSKA 2R5YB 4A93J 3OEPA 1JTYA 3OL4A 3K4CA 1KQ9A 4ESFA 2R7QA 1Y56A 1CQTA 4IXAA 2HQAA 2ADUA 4XN0A 4M3GA 3HXLA 3QPTA 2LKXA 1T8IA 4R1HA 3W6VA 2ELKA 3CLQA 1REPC 2I8DA 2IGOA 3BR2A 2O5JA 1O29A 3AD7C 5IYBK 2YX4A 2XC7A 2EFQA 3BZCA 4WJ3M 3OWTA 4BEHA 4Y7NJ 2DFEA 5D4RA 1JE8A 3PNTA 3HRMA 1U8BA 4XSXF 2DODA 1WZ2A 1LDKB 2LOOA 5JHFA 3M4OK 3PQKA 4KIFA 4KDDA 2CH0A 3V7SA 1LDJA 2JA5J 3TBIA 5IP7K 4OIQA 2B0LA 3E7LA 3J81K 2DYSH 2M8GX 3Q5FA 4EGZA 5EGOB 2L01A 4X6AJ 3JW4A 2STTA 2BOLA 4A0ZA 1VTNC 1L0WA 2VJ5A 3K4KA 3ZN0A 2QLZA 4ENJA 4DBQA 3DXJA 1BJAA 3VSLA 1H9GA 2XAUA 4BE1A 2M3AA 3HOWC 2PG4A 2Q2EB 4II2A 4P96A 4HNUA 4OIRA 5FRMA 2PFBA 1WIHA 1FNNA 4UV9A 4HQMA 5DM6F 2GXGA 2CSOA 1WQHA 1X2NA 2VL8A 3F3XA 3HYIA 4C9YA 2PA8L 3VYRB 1DPRA 5E1WA 4G94A 1DU0A 1RKTA 1P2FA 1HA8A 4RAZA 2W7VA 5M3MK 1OISA 1I6VA 5H20A 1X3ZB 2BE5A 2E1CA 4E7ZA 4L9VA 3JSOA 3CCYA 2A6EF 3L2VA 4IPAA 3CTAA 5J6XA 1MNEA 2Y69H 2MSYA 4I76A 2W25A 2HDCA 3H0GC 3U2RA 2CQQA 2L9NA 4IVNA 4BXXK 1BOBA 1U9OA 4Q47A 2H09A 2ZXHA 2P5VA 2GOXB 2F4MB 5J1RA 2KWAA 2XKPA 3IH3A 2B63K 4JX5A 4OIPF 1T2KA 2PBIA 1FY7A 2CU7A 3R60A 4CYCB 4XN3A 5GAEJ 4LLGA 3ZQLA 2VBZA 1SAXA 1XGNA 2NS8A 3RYPA 2OCEA 3IC7A 4C3IC 3HOXK 2HVRA 4OAZA 1EK8A 1G3TA 2F6CA 3O3KA 2QQ8A 5BOXA 3OYAA 3PFYA 3V42A 4YEJA 3MMLB 1T0FC 3LOCA 4AH6A 3RZDK 2M7AA 4NHJA 4FZBA 3S1NC 2KIFA 2VE9A 1YHQI 4V19K 2Y0SL 3H0GK 3BTJA 4LJZF 5K7FA 4GYGA 4G7ZF 1ZG1A 3V8KA 5E3LA 2DJNA 4MLOA 2AS5F 3MZHA 4GFQA 3CO6C 2KT0A 2XGXA 3DV8A 3BTCA 5GP9A 3KP6A 4IZZA 4A93K 1TNTA 2IA2A 2LNBA 2DMUA 3GFMA 3K7AK 1FTTA 4QTRA 4I02A 4BEHB 3S2DC 1VQNI 3FKIC 3E0JB 1T56A 3L7WA 1CF7A 1XS9A 4PFPA 3RZDC 1X2MA 3CCUI 2TRTA 2ZJ2A 4GTBA 1R9TK 1SFOK 3HZJA 3CC4I 5DDGA 1F9NA 1IV8A 3BJOA 4PJMA 4LOCA 3B6CA 4KT5C 4OOIA 4LG0A 2YU9C 5TISC 3GYHX 2XKOA 2DBBA 3C2GA 2O0YA 3R4KA 2V6EA 3LQRA 3QOPA 2X85A 4Y7NK 4AUXA 2YS9A 3CDIA 4A3JJ 1I50A 3GFIA 2FXAA 1GXQA 2Z5UA 5DCFA 4WX9A 3FWEA 1S6LA 1N77A 3C2BA 5K5OA 2PQ8A 5HLGA 4UB6C 3SZGA 3SZPA 2NOJB 2WWYA 1R1TA 2LF8A 2MH2A 2EA4A 4X6AK 2HQ5A 2WADA 1UZCA 3GTJJ 1VNDA 3R61A 1O26A 2HWVA 1TWAC 2R7ZA 1OCOH 3MVPA 4LK1F 4XK4A 2LBFB 4E7KA 3SHFA 4A5NA 4P5OA 3HSRA 1BI1A 2MD0A 3S2HJ 3ZMUA 4YG2A 4QPOA 4II3A 2ZJQF 1HXDA 2FEZA 1UCRA 4FASD 1INNA 4LIVA 2O8XA 3KEQA 1SEUA 1D0YA 3DU5A 3TFHA 2DK8A 3DTKA 2VUMJ 2EIJH 4A3FC 3LSIA 4KN7X 5M3MJ 1E2XA 5CYVA 2LLKA 1BI0A 3QODA 4ZYGA 4F92B 2QWWA 5LRRA 2L0KA 3DXJF 3K4LA 2ZMEC 3CMEI 1RI7A 1IAWA 3S16K 1MH3A 1HKTA 5J47A 4A3DJ 2X9DA 1TNSA 3ZMSA 3L1PA 3DKWA 4W97A 1WH7A 5CPRB 3O8GA 1WKMA 3ZMTA 3L4JA 3FMRA 3H5AA 4GTEA 2K27A 1R5GA 2KL4A 1VQ5I 5C3EC 3GTKK 4DOZA 1LPQA 1IN5A 2E1MB 2NVUB 3PUFA 4BXXJ 1O3SA 3JR9A 1BJTA 4PUSA 3HTUA 3C3WA 1BW5A 1G2HA 5IYCK 1XZQA 3CQZA 2X6XA 4HW0A 3O2PE 4BJ6C 1TWHC 2IJLA 2RREA 1ZG5A 3M07A 3F0CA 2JSPA 4V2GA 1MJ9A 3G3ZA 1QGPA 2WB1D 3FXUA 2IBDA 1IQ0A 3CQZC 2LF7A 4EJUA 3G6EI 2MD5A 4EV0A 4NC8A 1YX5A 1K4TA 3JRIA 1MZBA 1B59A 3HOSA 1CF7B 5IPAA 5C3EK 3U1DA 5KAIC 4RB0A 2IGKA 4P9FA 5J3LA 3U9GA 1J09A 2X48A 3HG9A 2HOEA 4Y13A 3F22A 4QWQA 4G6QA 1WH5A 1MJBA 2D1HA 5IP6A 3HOZJ 3BR6A 1XTAA 2VJIA 4XRSG 3S1MC 2X6OA 2LG4A 1FIPA 1Y1WK 3CCSI 3LQQA 3MCZA 5ICEA 1QU3A 1FP2A 2PLYA 5TRDA 4OAYA 1TQPA 3B73A 3KCCA 3DTEA 5IOYA 3EQLA 1E3OC 2HVSA 2V1XA 3GTLC 3G1MA 1FMWA 3HSFA 4EQQA 2MYSA 4LIUA 2YU3A 1R36A 2HKXA 1KYZA 2HTJA 1H0MA 1USOA 2VQHA 2RNGA 4BS9A 2FF4A 3HOZC 1YLFA 2CGPA 2KLOA 2VI6A 3NEUA 1D8KA 3ZMZA 1DCPA 3GX4X 3GTQJ 1KQ8A 3JSTA 2QQBA 2V9KA 3WTUC 2VODA 2L2OA 4LOWA 1ZLJA 4KYWA 2ELJA 2R7ZC 3H3VL 4A3DC 1SVLA 5FD5A 2JA7K 3KYCB 3ASOH 5FKLA 1O27A 1EI6A 4J19A 1FYMA 4U0WA 3M8FA 2YU9K 3HBLA 1ON1A 3SZYA 5JVTA 1XPXA 3N3YA 3BLYA 1WQFA 5F27A 3LSHA 1S7OA 1RUOA 4Y7NC 3ROUA 1TWGC 3GTOC 4MEYA 2MBFA 1N25A 4B3AA 3K4JA 1T39A 2ZSHB 1TWFC 1BBYA 1KU9A 1S9HA 4BNCA 2KPMA 2W48A 1SFOC 5FLXZ 4C2MJ 1I50K 3TO9A 1YNJA 2E1MC 3EYYA 5GTIC 1TW3A 1I3QK 1WSVA 3BR0A 2VUMK 2UV1A 4C3HJ 3D0SA 2VXZA 2RGVA 3I4PA 4A3IC 3I4NC 4WJ4A 3A8JA 4LB5A 1TWCC 5IP9K 3VYTB 3BG9A 2OF7A 3OMYA 5BNGA 4B44A 3OS0A 1P6RA 3S14C 5EG0B 3ZQGA 2VOPA 1XZPB 5CVRA 3BZ6A 2M8EA 1IW7F 3CUQA 4LGWA 3GTMK 4IHYA 3OV8A 3V7RA 3M1EA 2Q2EA 1WQ2A 3LFUA 1ULYA 1WSUA 5B1AH 1XXAA 3K70C 1T08B 4HAMA 4ZYDA 1WFXA 1TWAK 1Y6IA 2A5YB 5BPDA 5HS7A 4A3LJ 1EQRA 3DPTA 2EV5A 3L2WA 3BR1A 3KZYA 2OBPA 2XAFA 3O6BB 4MFEA 5FD6A 4G6TB 1SFUA 5IORA 3S1QJ 2DYRH 4FX0A 4DGWB 4FETA 4ZTFA 2ZFUA 2WAEA 2WA0A 3M9AA 4A6EA 2XASA 4F3QA 5DS9A 3GTPK 3PNYA 3SFZA 1S7EA 1O3RA 1QHHD 3MN2A 5IYDJ 3DEUA 2BW3A 2Y3PA 3FHNA 3TW7A 3OIPA 2RN7A 2BVMA 4EM1A 5M5WJ 5E3NA 3T8RA 4HA8A 4E7LA 2VN2A 3BUEA 2K9MA 1I5ZA 1TQIA 2KQRA 4M6YA 3W2AA 4OIOF 4BKWA 5D4DA 3I4MK 3HC7A 3KE2A 2PJRA 2KMUA 2LC2A 2E36A 2QEXI 1RPWA 3CZ6A 1LFPA 2LBFA 3I58A 4Y3OA 5LGTA 2P81A 3N05A 4OIQF 2D6FC 4FT8A 3FOEA 1V5EA 1ETOA 2CRGA 2HU9A 1SC7A 3K0LA 2ME6A 3PIOF 4ENNA 4IHSA 1FOWA 1R9TJ 2V6CA 4C3HC 5L3DA 2TDXA 3WTYC 1MDMB 4BBRC 4XIDA 2VQGA 4IO9F 1FBUA 2LMDA 2K4BA 2M1BA 2VKHA 3ECOA 1YX2A 2A07F 3BP3A 4HOBA 4N9HA 3WTZA 1SD5A 5K1YA 4A3EJ 1HW1A 2FE3A 2YU9J 5BQTA 2OC6A 4RMFA 3FHZA 4PSXA 1I1GA 4PFOA 4ZTJA 1U9NA 3RPUD 3GDZA 3RKWA 3KEOA 5C4JC 3ZGKA 3HKZD 3WU1B 2DTRA 2E5ZA 1OLTA 5HODA 1BIBA 2DN0A 2X6YA 5FKKA 1JXSA 2K9SA 4A69C 4M9SA 2H6BA 1E0EA 2L9RA 2B63C 2HGCA 4XORA 2OJED 3RZOJ 2LFBA 3S2HK 1HSTA 3OYEA 1W7PA 3MMYB 1P9QC 2GZWA 3A0HC 4M9ZA 4AVZA 1ZHFA 5CVVA 2EK5A 4FTHA
chains in the Genus database with same CATH topology
3CO7C 2GAUA 5HDNA 5IOQA 3K9TA 5LBQA 4YG2F 1XMAA 3IKTA 2JA6A 4R8HA 3KP4A 2O3FA 3TQNA 4DDQA 5E20A 1XSVA 4OMZA 5F64A 1ONVA 2UWMA 3F8NA 1YYVA 4HBLA 2CW0F 2F5FA 2NNYA 2COMA 3I59A 4G9YA 4OMYA 3I64A 3JAMZ 1SD6A 4RAYA 3HRUA 2P5LC 4BYYA 3P9CA 4EM0B 1WQGA 4LMYA 2QQAA 2R7FA 3QU6A 2QENA 2DAOA 2DQRA 1RNLA 1J2XA 2RH6A 3LFKA 3GEZA 1KQ0A 3FMQA 3OOPA 1W5TA 4RB3C 3K69A 2CYYA 2HZTA 1ZG3A 5ICFA 2ELHA 4C3JC 4IJAA 3G4AA 4UUVA 4BLAA 5ED4A 4KMUX 5CJ9A 4LB6B 2RQPA 5HDGA 4KB4A 3M7GA 2NNNA 5CLSA 3SZTA 2FU4A 1XSXA 2X4HA 4I0BA 4L5JA 2HQNA 1W7PB 1HKSA 1LDDA 4U0YA 2XAQA 1Y1VA 3MWMA 5FLXK 4HF0A 3HUGA 4MTDA 5LGUA 3QX3A 5DUIA 3GZ5A 3W6KB 2FOKA 2K7LA 4DNCA 2V9VA 2W84A 1WCMA 4BHCA 4J3NA 1LEAA 5HS9A 3R0AA 4HLXA 1ZRFA 4N0BA 3L2CA 5IT9K 2DPDA 3GTPA 2RNJA 1S8NA 3AQOA 3T8TA 2W57A 4KARA 1ZXOA 3MAJA 1XMKA 5CVUA 1K78B 1XXBA 4IF4A 3SQNA 4Q5SF 1SFOA 2XCRB 4ASNA 2HYFA 3FOFA 2X0LA 3MEXA 5L3BA 2EJRA 1HQCA 3E5UA 3TDUC 1UHWA 3GFLA 2R92A 4GTCA 2VT3A 1ZAOA 2BV6A 2JPBA 2EFNA 3GFJA 3GLXA 1EV7A 4C2MC 3BJ6A 2RV8A 2L02A 3I5UA 1BOAA 2DU9A 1B9MA 1AB4A 2EFPA 5FO5A 4CXFA 3LSTA 2GSUA 1IXCA 3LA3A 4KMFA 4WF2A 3KLNA 2CG4A 3J80Z 5D4SA 2GSOA 3VOEA 3IL2A 2ESNA 4L5IA 2E2HA 2VBYA 4TV7A 3LA7A 5FFZA 4KMAA 3D5LA 3WODF 4OU0A 5J8CA 4EJWA 1KYWA 3RJPA 4CYDA 1YTYA 2BE5F 1ZBSA 1HSJA 4HDUA 4D0PA 3ZQ7A 3H3ZA 2XUBA 1XN7A 1F5TA 3V4GA 3WE3A 3TKYA 1TQMA 2ZFWA 5A2QK 3FXRA 1XDSA 2L4AA 1BGWA 3S2WA 3F8MA 1XDUA 3ELKA 5K5RA 2UZKA 1UFMA 1TWAA 2STWA 3WTVC 1KQ4A 1LJ9A 3T5XA 4PGGA 2OAZA 3KP3A 4XLNF 4KB2A 1HKQA 1OYYA 3Q9SA 3WG9A 2Z9OA 4U88A 4LD5A 4FX4A 3TOAA 4O3MA 1J0RA 4P55A 1KU3A 3F6OA 1FLIA 3QU3A 5HVQC 2JZYA 2P6SA 5HLHA 4KNYA 2OU2A 3COAC 2P4WA 1TBXA 3L9FA 2HS5A 5LGNA 3GF2A 4RGRA 4U0VA 2P8TA 3M8EA 4FM9A 4AWXB 3QAHA 5DYMA 4LLGF 3FZVA 3K1MA 5HLIA 2XCQA 2GSNA 4M72A 1IN6A 1J59A 4I01A 5EGEA 1Y1WA 1BN5A 4LLNA 2R93A 3RPQA 1GXPA 4G7HF 2M5WA 4WCGA 3CUQB 3VA7A 1I27A 1JHHA 3QP6A 1WWXA 4L0YB 1B4AA 4KA4A 3BPVA 2G9WA 1OPCA 5LEJA 2NVXA 1ZGJA 3GTKA 3FX3A 2P5KA 1I1SA 2WTEA 3ML6A 4MEXF 1DP7P 4HQEA 1Q1HA 3TDZC 1R1VA 1RUNA 4KATA 3R6SA 3WGIA 1G3YA 1QO0D 3HRTA 1O25A 1DD5A 3GW2A 3N4MA 2R7DA 5ERIA 1TLHB 2V1UA 1ZH5A 4I98B 1L3LA 2DO7A 4KIBA 1I6XA 2ESHA 2XAGA 1IF1A 2VC1A 2D45A 4EJVA 1J9IA 5ICGA 4BHBA 1P4WA 1JGSA 3P7NA 2DLLA 1JHFA 4KFCA 2KIUA 1R7JA 4EVIA 3MZYA 4Q4ZF 1XXCA 4YFXF 4WK8F 1QBJA 3HOTA 2E2IA 1YW8A 3E6BA 3WE2A 5E8IA 2O03A 4G0WA 2WC2A 1XB4A 3NRVA 1UHMA 3Q3QA 3EDPA 3PQJA 1FZPB 1HW5A 5E1XA 2KIMA 2EB7A 3K1NA 3E5XA 1OYIA 3ZMVA 4GGGA 3V7CA 1FSHA 1QQIA 1IN4A 4ENKA 2ISZA 2DQLA 2H94A 1O7LA 4ESBA 1J5YA 2LDUA 2IA0A 2RC4A 3CDHA 4I0AA 4KICA 1U8RA 4M6XA 2BYVE 4ZZDA 2BGCA 2GA2A 2UXXA 4AVPA 3FM3A 3LPXA 4BH9A 2ZKZA 3Q9VA 1XD7A 4L9NA 4EJOA 1UB9A 1HW2A 2BBYA 1V4RA 2XIGA 2ZBKA 3JSPA 3JTHA 4KASA 1RIOH 2HQRA 4UV8A 3GO5A 2DI3A 4S04A 2P5MA 5CVJA 2HFHA 2QBYA 3FM5A 1W4MA 3FMSA 2F5CA 4LG0B 2QM3A 3HHGA 3F8FA 2KKOA 4Z2YA 2Z3YA 5L3CA 2P6TA 5DCMA 1D8JA 2DK5A 2AXLA 3CUOA 1XGOA 3I59B 2GA1A 1IXRC 2HEOA 1D3YA 3OPFA 3RKXA 2CFXA 1LNWA 4GCVA 4A0YA 1XCVA 1Z05A 3CUQC 4M71A 3IHUA 4UVAA 5DD4A 3EETA 4CDGA 1R5HA 4GO1A 3QRFF 1LB2A 5JR3A 1YQAA 1G6NA 2CFAA 4ILDA 2JT1A 2YSRA 3LWFA 4CZZA 5CHPA 5FB2A 4FHTA 2QUFA 4IRGA 3MFKA 3HHHA 4HLYA 4KDPA 2YU9A 3GVAA 1FYKA 1F1ZA 5IOSA 4KMHA 3TOBA 4RB2C 5H6RA 1BIAA 4M74A 1WRJA 5CVIA 4E70A 1AWCA 4M73A 5JFRA 1FBSA 1IUYA 3CJNA 2O61A 1FBQA 2VT2A 3DF8A 3IRQA 3LAJA 2LSOA 2Q8KA 2EV0A 2VBWA 3E6DA 2HKOA 1O2BA 4HZFA 2ZMEA 1RZ4A 2W24A 1O24A 2B63A 1EH1A 2OQRA 4KN4X 5DV5A 2XV4S 2F5DA 1ZGAA 4LLLA 3AH5A 4HV5A 2ZFZA 2IP2A 2MLKA 2DFIA 2HTSA 3F8CA 3SXYA 2ZCWA 2L4MA 4KUMA 1O3TA 4WWCA 1H9TA 1R00A 2A6HF 2ZNYA 1ZREA 4CICA 2ACJA 5TJJA 2MA3A 3I0TA 5LLQA 4YFNF 1U5TA 4WXHA 3G73A 1IS1A 1T6SA 4BXUA 4JQFA 1IRGA 2VE8A 4Y15A 2A68F 5IOTA 1U5TC 4RGSA 3P9IA 5JVOA 3H0GA 4HX4A 3GXOA 1FYLA 3GZ6A 5LEKA 4ON0A 2QZ8A 4L0ZB 3WGGA 4QLCU 1ZLKA 4L18B 1G3SA 2FMYA 1L0OC 5DCMB 1PDNC 1T38A 1T0FA 3NQOA 3HRSA 1YFHA 1QPMA 1TWFA 5TJ3A 3KFWX 1SMTA 5DD8A 4UXNA 2FRHA 4IRHA 1XGMA 4GXOA 1W5SA 2LKPA 2HR3A 4HF1A 2G7HA 3I53A 1U78A 1P4XA 5ILUA 4G7OF 3E6MA 4KM8A 1SFXA 3RKYA 2FA5A 4O5VA 2IW5A 4KIGA 2O6GE 2RKHA 4MTEA 4P5BA 2EFWA 2OZUA 4ETSA 5E1ZB 1F4KA 3J7AO 1SD4A 2RVCA 2JTVA 1K6OA 4EGYA 5A2QZ 4EM2A 4WXCA 1W7PD 4XSZF 3WU0A 5LHIA 2WV0A 3GTQA 4GTFA 2NRAC 3G4CA 4PDKA 3WTWC 3N97A 4NQWA 1S3JA 3I71A 3DFGA 1J75A 2VC0A 1PUEE 4KAWX 3ISPA 1HBXG 3AAFA 4U7BA 4IRIA 3ABTA 1MKMA 5AONA 1USSA 2JRTA 4KMDA 4EJTA 4U7DA 2PEXA 4LK0F 5BS6A 2V79A 4AD9A 4PCQA 4DQ2A 3KP5A 4I7HA 2ETHA 5ILVA 1G3WA 2GIVA 2XAJA 3L4KA 3C1DA 1BC7C 2R3SA 2RGRA 1P92A 3IKVA 2IA1A 4XLPF 2ZXJA 1MD0A 5FFXA 4LQYA 1SD7A 2FBKA 2JPCA 1YS7A 4S05A 4HX7A 1G4DA 4YIFA 3GTGA 1AOYA 5K5QA 2YX7A 3W6JB 1LVAA 2PN6A 5BPIA 1PP7U 2OQGA 3BPXA 1K78A 1O7FA 3GTLA 1IXSB 1Y0UA 3R0JA 2KRFA 1KU7A 5F1RA 3F21A 5IT3A 3JTGA 1FSEA 2IVMA 5IT9Z 3GTJA 4JBAA 2UXNA 3E97A 4GTAA 3DPLC 3FXQA 3ZN1A 1E17A 4HX8A 3NUHA 4HDVA 2PI0A 2H6CA 5D5VB 1YW9A 5EEHA 4ZYEA 2L54A 1FX7A 2Q0OA 1IZ1A 4LFUA 1DUXC 2IPQX 4G6DA 5D6EA 1ODDA 1Z7UA 4ENMA 2KJBA 3WTSC 1TWCA 3KETA 5KK1A 4B8XA 2P7CB 4HF2A 4MQVA 4CGZA 1I3QA 2Y75A 1EH7A 2IRFG 1EH6A 4UHTA 5H6QA 4AIJA 1O57A 2GWRA 1TWHA 2YPRA 5D8KB 1O3QA 4A2UA 3WGHA 3V8JA 2E1NA 1EH8A 1Z6RA 2H27A 4R79A 3BP8A 5EEGA 4MNUA 2IT0A 4CO8A 4HV6A 4B09A 5E8GA 2RDPA 1MDMA 1R58A 2FBHA 4I2OA 2Z99A 2OD5A 4GYIA 2A69F 3T0YA 4M1XA 5KVRA 3ECHA 1ZRCA 3JAMK 3S0XA 2GQQA 1IN7A 2V1DA 4XRFA 3FF5A 3J81Z 2DT5A 4KC6A 3N0BA 2XCOA 4OIRF 3VEPA 1J7KA 1GE9A 3RIRA 2EA2A 1U2WA 1YS6A 2ISYA 1SMYF 5D5UB 3WTXC 2VBXA 3KP2A 3BJAA 2YR2A 4G8XA 2G7UA 1Z9CA 1A04A 1STZA 4GTDA 3E6CC 4A5MA 3WTTC 1YG2A 5JI6A 2M30A 1MGTA 4NB5A 2JA5A 4P9UA 3E3VA 4UVBA 3I54A 3H3UA 3EUHA 5HDKA 1XCBA 3VB2A 3CLOA 4BAYA 5DEQA 3MQ0A 5HOOA 4Y17A 2FMLA 2MLGA 3CAGA 1FOKA 1FP1D 3TGNA 4H0EA 3KLOA 5JFEA 2PJPA 1K83A 1GVJA 1GHCA 1FT9A 2Y0MA 4ZYHA 4AIKA 1K79A 1OMIA 4WXDA 5D8LB 2Z33A 1B4BA 4KM9A 2DW4A 2JA7A 3RYRA 4M9XA 1BI3A 3BWGA 1R9TA 4ZZLA 2CQKA 2XHKA 3ABUA 1FC3A 3ERED 2FSWA 4RGUA 2MH9A 4BHPA 1ZYRF 3ZP5A 4IHTA 2GXBA 3F23A 2XVCA 1B9NA 1K7AA 1OYWA 4GT9A 5LRSA 1WI9A 2FNPA 2J5OA 3EYIA 2ZO4A 3HTSB 4RS8A 1IRFA 2MC3A 3HIFA 2FNAA 1BI2A 1LQ1A 1Z1DA 1BC8C 1B6AA 4L9JA 3OREA 1XGSA 1ON2A 1OR7A 5ILSA 4PGHA 2VOOA 1O2AA 5D5XB 5D5WB 2E7WA 3K1PA 1KA8A 1S7AA 4RB1A 5L3EA 1QZYA 1P4AA 1FPQA 3P9KA 5L3GA 3REOA 5FGMA 3E5QA 1U3EM 1YIOA 5L3FA 2F2EA 3F6VA 1T98A 4PZJA 3IRRA 3C18A 3TO7A 4N9IA 5AIQA 3EQLF 4UVCA 3GTOA 3KZZA 4A12A 4JK1X 2DPUA 2XRNA 1ZN2A 3AQPA 2PMHA 2NAZA 1PP8F 1U6GA 2EFOA 3HSEA 3LAPA 1R22A 2XAHA 4HYEA 3J80K 3QPHA 5HS8A 3VODA 3PFIA 1O28A 4A6DA 5BMZA 6PAXA 1FWZA 1QZZA 1B1BA 1TTYA 1ZRDA 4MGRA 4EMSA 4BQAA 2ZNZA 4ESJA 1U5TB 5DUKA 2A3SA 2PHCB 1ZVUA 3H92A 4P5AA 2NYXA 2C6YA 2P7VB 2OZ6A 1OKRA 3GWZA 1S29A 4G0UA 1R1UA 2EWNA 1DPUA 5JHUA 2KJCA 3IWFA 5E18F 3QP5A 4I09A 4Q48A 3L00A 3BDDA 3LA2A 4OINF 4BLBA 2QBYB 4K2EA 2F5EA 3DQVC 1MJAA 3ULQB 2VUMA 4F7ZA 4LR2A 2NS0A 1XSDA 3BROA 2PMUA 2FBIA 3IWZA 3TO6A 4YIIA 2BEOA 2OA4A 2E7XA 2K02A 1KU2A 1Z6TA 1YW7A 4AIHA 2A61A 3F72A 1USTA 1CGPA 5ICCA 1YO5C 2CFAB 3RI4A 3T1BA 4MHGA 5J8FA 1KGSA 2QQ9A 2NVYA 5AIPA 3ZMDA 3RPUA 3B02A 3GUDA 1R23A 1C0WA 5LHGA 5LHHA 2K4JA 1SFEA 3BY6A 5E17F 3DP7A 1X3UA 2CWEA 1D5VA 2M87A 2W85A 2JH3A 1ZARA 2QYOA 1BM9A 2M45A 5EGHA 4O6JA 2K86A 2XROA 2FQ3A 2D2WA 3FKIA 3N0CA 3BOQA 3V8LA 4YFKF 4CHUA 4MQ9F 2D1VA 4ZH4F 3GTMA 1LEBA 1ISEA 2HYGD 1NHAA 4A0XA 4UNOA 3ZPLA 1V3FA 2L3DA 3RDIA 4MEYF 2JSCA 3K2ZA 3RTRA 4XBFA 1IN8A 5D6FA 3C7JA 4G0VA 2VONA 3F8BA 5F6FA 1TW2A 2ZMEB 1DDNA 2CO5A 4RGXA 4GTLA 4L9TA 3L09A 1QNTA 2EV6A 3VFZA 2Y48A 1Z91A 2J5PA 1TWGA 2QVOA 3KP7A 3OEPA 1KQ9A 4ESFA 4IXAA 2ADUA 3QPTA 4R1HA 1REPC 1O29A 2YX4A 2EFQA 1JE8A 5D4RA 3HRMA 4XSXF 1LDKB 3PQKA 4KIFA 4KDDA 3V7SA 1LDJA 2B0LA 3J81K 3Q5FA 4EGZA 2L01A 3JW4A 2STTA 4A0ZA 1VTNC 3ZN0A 2QLZA 4ENJA 1BJAA 1H9GA 2PG4A 4P96A 2PFBA 1WIHA 1FNNA 4UV9A 4HQMA 2GXGA 2CSOA 1WQHA 3F3XA 3HYIA 1DPRA 5E1WA 4G94A 1P2FA 4RAZA 5H20A 2E1CA 3JSOA 4L9VA 2A6EF 4IPAA 3CTAA 5J6XA 2HDCA 2W25A 3U2RA 4IVNA 4Q47A 2H09A 2P5VA 2KWAA 2XKPA 4OIPF 1T2KA 2PBIA 1FY7A 3R60A 2VBZA 1SAXA 1XGNA 3RYPA 4C3IC 3IC7A 1EK8A 1G3TA 3O3KA 5BOXA 3MMLB 4NHJA 4FZBA 2KIFA 2VE9A 4LJZF 4GYGA 4G7ZF 1ZG1A 3V8KA 2AS5F 3MZHA 4GFQA 3CO6C 2XGXA 3DV8A 3KP6A 1TNTA 2IA2A 2LNBA 3GFMA 4I02A 3L7WA 1CF7A 2ZJ2A 4GTBA 5DDGA 1F9NA 3BJOA 4KT5C 4OOIA