3FHZA

Crystal structure of the arginine repressor from mycobacterium tuberculosis bound with its dna operator and co-repressor, l-arginine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
molecule keywords Arginine repressor
total genus 39
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fhzA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3fhzA02
4BAYA 5FO5A 1HQCA 3I54A 2DT5A 3WGGA 4MEXF 1O3TA 4I2OA 2O6GE 3VA7A 1UFMA 4M74A 2RVCA 3LQRA 3C7JA 5E1XA 2DPUA 1KQ9A 1RI7A 3ZP5A 1I1SA 4Q48A 2FXAA 1KU7A 4HX4A 4PDKA 3RIRA 2J5PA 2RDPA 5D4RA 4GYGA 4GXOA 2QQBA 1DD5A 1R1VA 2DU9A 3IRRA 1JE8A 5J8FA 4HX7A 4LLGF 1S6LA 4EM2A 1HSTA 1J9IA 5BQTA 1QO0D 1KYWA 1XCVA 3HSEA 1K78B 1KU3A 3F72A 1MZBA 4KDPA 3VFZA 3MCZA 3E5QA 1U6GA 2P7VB 2RNJA 4ZYEA 4LLNA 3CAGA 1SD7A 2VN2A 4I02A 2O03A 1BI2A 4ASNA 4LGWA 2HS5A 2QBYA 1UHWA 3T1BA 3KP4A 3F6VA 3BY6A 2M87A 2CQKA 1RUNA 5HOOA 3IWZA 5D8KB 1HKSA 3ABUA 1EH8A 2XVCA 1LNWA 1DDNA 4U88A 4DNCA 5A2QZ 1G6NA 2IJLA 4G0UA 2KJBA 3CUQB 2OZUA 3ECHA 2PG4A 2V79A 3DFGA 3MZYA 1YW8A 2QZ8A 2MA3A 1HW5A 1HSJA 3LA3A 5LRSA 2P6SA 3PQKA 3GYHX 1BGWA 4L5IA 1SMTA 4P9UA 1STZA 1ZAOA 4B09A 1MDMA 4L9TA 1MDMB 2UXNA 5E17F 1HBXG 5LRRA 2HOEA 4U0WA 1C0WA 4WF2A 3G73A 2GXGA 3I64A 4MTEA 3JSOA 3KEQA 5ILUA 3PQJA 1AB4A 4RGSA 5JVOA 1I5ZA 2K27A 2BEOA 5L3DA 1WQ2A 5DCMB 2GA2A 4GCVA 5DEQA 5DCMA 3O3KA 3TO9A 5LEJA 5E20A 2STTA 1I1GA 4PGGA 3ZMZA 2EFWA 4IHTA 2C6YA 1WWXA 3IWFA 3R61A 2HEOA 4EGYA 4JQFA 3KETA 3JSPA 1TW2A 2PQ8A 4HV6A 5CJ9A 4OIQF 1B4BA 3HSFA 4I01A 3GEZA 1Z6TA 5L3GA 4N0BA 3B02A 5HS8A 2JZYA 1QBJA 1U2WA 5K5OA 5JVTA 3MWMA 3EYYA 1YW7A 1USSA 1R1UA 1S29A 3TKYA 1AWCA 5L3CA 3F6OA 3E6BA 1BN5A 1S7OA 2HWVA 2DBBA 1E17A 2M5WA 2Z3YA 2G9WA 2FNPA 2VBWA 4LG0B 2OQGA 3WU0A 2H94A 4GYIA 4AD9A 3BWGA 3TOBA 5LHIA 2LF7A 3VODA 1YFHA 1NHAA 3GLXA 1B9MA 2IPQX 4EQQA 4YFNF 6PAXA 1EH1A 2F5DA 1T38A 1SFEA 1F4KA 1MJ9A 2E7WA 5ERIA 3SFZA 1R00A 2DW4A 2L4AA 3LFKA 4HDVA 2DK8A 3KZYA 2VE8A 5FLXK 1UHMA 3KZZA 3FXRA 1QNTA 3QPTA 3OEPA 4KUMA 1YYVA 2K4JA 2G7HA 1R1TA 2ZXJA 2FBHA 3M7GA 1RNLA 1BJAA 3F23A 1J75A 2FMLA 2NNNA 2O61A 1XXBA 1XSVA 5HVQC 4EJUA 2PBIA 2QWWA 3FOFA 4B8XA 2RC4A 4IRIA 1FYMA 4CO8A 1IN5A 1JXSA 1FP2A 4DDQA 4Z2YA 1FT9A 3FM5A 1R23A 4G0VA 1R22A 4ZH4F 2W84A 5JFRA 2LSOA 5BS6A 1BOAA 4KB2A 5D6EA 1YIOA 3HHHA 4GFQA 2XV4S 3TDZC 4UNOA 2P5VA 4XBFA 2A61A 1OMIA 1WRJA 2QYOA 4ZZLA 1IXRC 5DDGA 2MC3A 1KGSA 3FXUA 3WTTC 2IW5A 4HBLA 2A6EF 1DPUA 1J5YA 2EV5A 1H9GA 1YLFA 2Z33A 1TLHB 2TDXA 2V6CA 3C18A 1XN7A 1XXAA 5K5QA 5CVRA 3O6BB 3R6SA 3FMQA 4OIOF 2D1VA 2L4MA 4HOBA 4HDUA 2KIUA 3WTZA 2W24A 1B4AA 3WTWC 4U7DA 1OYWA 1IN8A 2CYYA 3RKWA 2XAQA 2UWMA 3GX4X 3Q9VA 2P7CB 5A2QK 4OIRF 4OU0A 5CVIA 3REOA 3E3VA 2A6HF 1IXSB 3RKXA 1W7PA 2FRHA 3OREA 4LK0F 2NS0A 1U78A 4AIHA 3F22A 2DFIA 3N4MA 1IW7F 3WODF 1S8NA 5ILSA 2XAGA 3HYIA 5IT9Z 2H6CA 2EV6A 2CW0F 1ONVA 3FZVA 5EEGA 3DPLC 3HHGA 5E1ZB 4F7ZA 4QWQA 3FXQA 1TQPA 4HQMA 2CWEA 4IF4A 5DD8A 1FX7A 1O3RA 1O3SA 2PMUA 1K7AA 3M1EA 4KN7X 3FF5A 5DD4A 2JPBA 2PHCB 2FBKA 3RTRA 3I59B 4UVBA 4ZYGA 1D5VA 1ZLJA 4RGXA 4I0BA 3BROA 2HKOA 3P9IA 5CVUA 4A0ZA 4XRFA 4WWCA 5BPDA 2H27A 2O8XA 1Y0UA 3I53A 3TDUC 3GFLA 3BPVA 3JAMZ 1FPQA 3BP8A 2ELHA 3WTVC 2W25A 3ZMDA 1VTNC 3U9GA 3DEUA 3WTYC 2KIMA 3BUEA 3DF8A 5LGUA 5BMZA 2FE3A 4LB6B 2DAOA 5CLSA 1K78A 4G7ZF 4BNCA 5IT9K 4CICA 3T8RA 2P5KA 2X4HA 4WX9A 3MZHA 4UHTA 3H3UA 1LVAA 1TNTA 4KC6A 1O7LA 2OU2A 3I71A 2WTEA 4I98B 5H6QA 2BBYA 3QP6A 3ZQ7A 4R1HA 3CDHA 2E1CA 3ELKA 1IS1A 2GIVA 1FBSA 2OA4A 4L18B 4HAMA 1IRGA 1X3UA 5K5RA 1JHFA 2ZMEB 5TRDA 3KLOA 3ZMUA 3QRFF 4IRGA 4OOIA 1BJTA 4IXAA 3WU1B 5FLXZ 1KU9A 1EV7A 4ESBA 5E8IA 3D5LA 4EVIA 2KJCA 1HW1A 2Y48A 5HLHA 4KN4X 4EJOA 1D3YA 1U5TB 2FOKA 3E6MA 1FSHA 3DP7A 2DLLA 2M45A 5HDNA 3DQVC 2NNYA 1CF7A 2COMA 1Q1HA 2XKPA 2VODA 2M8EA 2MBFA 3FX3A 5D5XB 3U2RA 4ZZDA 3ECOA 4N9HA 2ZNYA 3QX3A 4NQWA 1ZREA 1LDJA 3LAPA 3L9FA 2HZTA 2XIGA 4M72A 5FFXA 4HF1A 4M73A 2CG4A 2HTSA 3NRVA 4M9ZA 2MD5A 3F8NA 4A2UA 4FM9A 1QPMA 1FYKA 3QOPA 1TQMA 4KIGA 4A12A 2ZCWA 3RPUA 1LB2A 2XHKA 3GZ5A 1OYYA 4HYEA 2HYGD 1KQ0A 1BI3A 3F8MA 5LBQA 1P6RA 3J81Z 1DUXC 3IL2A 1MKMA 2IA1A 4P55A 4MTDA 2VC0A 1FYLA 1TTYA 2W85A 3J80Z 5J6XA 4EMSA 2EV0A 4IHSA 4KIFA 4Q47A 3BPXA 3ZN1A 4E70A 3J80K 4MQ9F 4ENJA 3MMLB 3V7CA 3RJPA 4FT8A 3BJAA 3BJ6A 1ZG5A 4YFKF 1W7PB 3I59A 1R5HA 1LEBA 3L4JA 3C3WA 4KFCA 5CVVA 5D5VB 3EUHA 3MAJA 2BV6A 4HLYA 1WI9A 1BI0A 3E5XA 4M6YA 1T0FA 2XCRB 3GFIA 2R7FA 3VB2A 1AOYA 3JW4A 3KP6A 5F64A 2QM3A 1MD0A 3BOQA 4N9IA 5HDKA 4ZYDA 4WK8F 4RB2C 3TGNA 2Q0OA 1MJAA 4G6DA 1TNSA 4I09A 1IZ1A 3CUQA 4BHCA 4R79A 1ZGAA 3DV8A 2FF4A 4JBAA 1OYIA 3VOEA 2EFPA 3KEOA 5DV5A 1YW9A 4IRHA 2Q2EA 2XAFA 2Y0MA 5L3FA 3F8BA 3GWZA 2K7LA 2OD5A 1P4XA 3MQ0A 3LAJA 2QUFA 4U7BA 1QGPA 2HGCA 1FZPB 2KIFA 2L3DA 1Z05A 2P5MA 2DI3A 2WWYA 3TO7A 1J2XA 1O7FA 2EK5A 3ZN0A 1OPCA 4L0YB 2EA2A 4KAWX 1I6XA 1GXQA 4U0VA 1LDDA 4RAYA 2XAJA 3E6DA 1ZGJA 2P6TA 4YFXF 4UV8A 3H92A 2IVMA 3Q9SA 3W6KB 1UCRA 2GAUA 4CGZA 5ICFA 5HDGA 2OBPA 2FA5A 1PDNC 5DYMA 2H6BA 1B9NA 1S7AA 4ENNA 1K6OA 3KP2A 1BI1A 1IF1A 4FHTA 5FFZA 1P4AA 2RGVA 4G94A 4ESFA 1HXDA 1MGTA 2PJPA 4MHGA 1XSXA 1XMKA 1BC8C 1FBUA 5ICCA 4LLLA 3RI4A 3K69A 5CVJA 4UXNA 2QENA 2A3SA 2HKXA 4G8XA 3HUGA 1A04A 2YX4A 3KLNA 3R0JA 1JHHA 3M9AA 2NRAC 2PLYA 4NHJA 4YG2F 1XDSA 3I4PA 4EJVA 1V3FA 2ZMEA 5D4SA 4CYDA 3OOPA 5E8GA 4I0AA 4K2EA 4AWXB 2FMYA 2WV0A 4CZZA 2XASA 3RPQA 4OMZA 2L54A 4A0XA 4Y13A 1FP1D 3SQNA 1ZG1A 3L2CA 4HX8A 4ETSA 2D2WA 5DCFA 4KICA 4O6JA 1J59A 3EETA 1O3QA 3AAFA 5ED4A 4BXUA 2Z99A 5LGTA 3FM3A 3G3ZA 2XAHA 1G3YA 1ZG3A 2ZBKA 4KDDA 2PI0A 1P92A 2BGCA 1P2FA 2GA1A 4J3NA 3W6JB 4WCGA 4DQ2A 1W5SA 3HIFA 5DUIA 5BOXA 3K9TA 1D8JA 5E18F 3WTXC 3FMRA 4FX0A 4LB5A 4UV9A 1ZLKA 3F21A 4G7OF 3MFKA 4EJWA 4L9NA 2O3FA 3GW2A 4ZYHA 1RIOH 1WQFA 1WSUA 4LFUA 3HRMA 1ON1A 2DK5A 3LSTA 1FSEA 4LD5A 2VT3A 2LDUA 1E2XA 2OQRA 5AIPA 4AIKA 5JHUA 2IRFG 3N97A 3WTUC 3WE3A 1JGSA 3K1PA 4BQAA 2DPDA 4UVAA 1K79A 4BYYA 2MH2A 3GZ6A 2FU4A 1U3EM 3FOEA 3E5UA 5JI6A 3GXOA 4IVNA 4G9YA 3DPTA 1ZYRF 4EM0B 1GE9A 4HLXA 2OZ6A 2IA0A 4EJTA 1T39A 3V7SA 1WQHA 3CO6C 1F1ZA 4A6DA 2LNBA 5D5UB 4CHUA 4YIIA 5D5WB 2W57A 4CDGA 5LGNA 1ZRFA 3D0SA 3GFJA 1R7JA 3EYIA 3KE2A 1XCBA 1GVJA 1L0OC 4PGHA 2ZKZA 3LA7A 5HS7A 1FNNA 2RGRA 3ML6A 3ZPLA 4GGGA 1QQIA 1CGPA 5EEHA 2WC2A 4L9JA 5FD5A 3BZ6A 3KFWX 4JK1X 3ZMSA 1YO5C 1TBXA 1LQ1A 4OIPF 2XKOA 4GO1A 3SXYA 1IRFA 2EWNA 4EM1A 3SHFA 5KK1A 1H0MA 4HA8A 3FWEA 4RS8A 2DQLA 4PCQA 3M8EA 1KQ8A 3QU3A 3IC7A 3NUHA 2Z9OA 4RGUA 5H20A 3LA2A 1OKRA 2HQRA 2Y75A 3T5XA 3HRSA 4KMUX 3L00A 3LWFA 4L9VA 2F5EA 1H9TA 1SMYF 1ZHFA 1RZ4A 2ZNZA 1YS6A 3WTSC 5CYVA 4MGRA 3JAMK 3DKWA 3EDPA 3Q5FA 2HQNA 2L02A 3WG9A 3CUQC 2KRFA 3L7WA 2VE9A 1U5TC 1J7KA 2E7XA 3R0AA 2K4BA 3U1DA 3V8JA 3COAC 2M30A 4NB5A 1EH7A 1BIBA 2PEXA 2A69F 2VBYA 5DUKA 3WGHA 3SZPA 2FEZA 3B73A 3R60A 1IUYA 4G0WA 3OV8A 4G6QA 3I58A 1ULYA 5LLQA 2CSOA 4L0ZB 2A5YB 3FMSA 2PFBA 5KVRA 1WKMA 1R58A 2ISZA 1ZN2A 1USTA 2YR2A 5F6FA 1ZARA 2P4WA 1L3LA 3KP3A 2JTVA 2EFNA 4A5NA 2YSRA 3L09A 2ACJA 4XSXF 2XUBA 3PFIA 4FX4A 1HKTA 2ZFWA 4EV0A 4S05A 1T98A 1PUEE 1W5TA 1EK8A 1REPC 3HTUA 4P5OA 3OPFA 4M6XA 2ADUA 2Q8KA 3S2WA 1F5TA 4KNYA 5TJJA 3K0LA 2XGXA 4G7HF 4XLPF 1R36A 3CO7C 4KA4A 2AS5F 3QP5A 1QZYA 3K2ZA 1SFUA 4L5JA 4Y17A 1LJ9A 4UUVA 3CLOA 1I27A 2GWRA 1PP7U 2VC1A 2Z5UA 1PP8F 4QLCU 3P7NA 3TO6A 3HSRA 1B59A 3WE2A 3CTAA 2L01A 1XB4A 1W4MA 1DPRA 4LJZF 2FQ3A 2IA2A 2VXZA 3ZMTA 2M1BA 4MQVA 1U8RA 2J5OA 1IN6A 4HQEA 3QU6A 1BM9A 1KU2A 2K02A 2ESNA 1HW2A 4O5VA 3DXJF 4MEYF 2HTJA 3O2PE 2ISYA 4RAZA 2CGPA 4KYWA 3K1MA 2EJRA 2HYFA 1FLIA 1T6SA 5K1YA 3R4KA 5E1WA 2PMHA 3CUOA 1P4WA 1FBQA 4I7HA 3IHUA 1YS7A 3C1DA 1XGMA 2XRNA 3IRQA 4H0EA 4EGZA 2A68F 1GHCA 5BPIA 1FY7A 2XCQA 4AIJA 2RQPA 3ABTA 1SD5A 4ENKA 1R5GA 2P8TA 3NQOA 2JPCA 5AONA 3IKVA 1FWZA 1SAXA 1U5TA 5HLIA 2VBZA 5H6RA 1FOKA 2P5LC 2H09A 1B1BA 2JSCA 4P9FA 1F9NA 3BJOA 4HF0A 1XGSA 5HS9A 2V9VA 1LEAA 1BC7C 3QAHA 1BIAA 2X0LA 4XSZF 2GZWA 4OINF 2V1UA 1MJBA 1YQAA 1IN4A 1Z1DA 2JRTA 4A0YA 3MEXA 1IXCA 3SZTA 4RB1A 4MNUA 1G3SA 5ICEA 4YIFA 3E97A 2DO7A 1G3TA 3V8LA 2A07F 4ESJA 1G4DA 2LKPA 4OMYA 3J7AO 1IN7A 4M9XA 2QQAA 5IT3A 4TV7A 3T0YA 3IKTA 2DQRA 1Z7UA 1YG2A 2MH9A 3LPXA 3BDDA 2VOOA 3ULQB 2B0LA 2IT0A 4IPAA 4S04A 1RUOA 5ICGA 4KB4A 4U0YA 2Y3PA 1XXCA 2OAZA 1TQIA 2V1DA 4WXCA 2KWAA 2VONA 3J81K 1G3WA 3RKYA 2STWA 2FSWA 2QLZA 2BYVE 1ODDA 2V1XA 3HOTA 2G7UA 1DP7P 2YPRA 4Y15A 3CJNA 4IJAA 5ILVA 1WQGA 5HLGA 1ZRDA 2XCOA 4R8HA 4HZFA 1LDKB 2HFHA 2RV8A 3TQNA 4M71A 4CXFA 5F1RA 1OR7A 3E6CC 3EQLF 4BHBA 4XLNF 4D0PA 3HRTA 1B6AA 2HDCA 3F3XA 3HOSA 4KIBA 2NAZA 1XSDA 2VT2A 2EA4A 4O3MA 1SFXA 2ZO4A 3RYPA 2GQQA 1GXPA 4M9SA 1QZZA 2MLKA 2EFOA 4Q5SF 3HRUA 2E1NA 4BHPA 1KA8A 4HV5A 4A5MA 3KP7A 1Z9CA 3ERED 1XDUA 2RN7A 4ENMA 2DTRA 4HW0A 1XGOA 4PZJA 3V7RA 3I0TA 3NEUA 3V4GA 2IP2A 3VEPA 2K86A 2EB7A 3GF2A 1FC3A 2EFQA 5D6FA 4KMFA 2UXXA 3T8TA 4HF2A 2F5CA 1YTYA 2QVOA 3JTGA 3WGIA 5JR3A 1ZH5A 3V8KA 3ZMVA 1SD4A 2CFXA 3F8CA 1V4RA 2BE5F 3L4KA 2JT1A 1TW3A 5LEKA 1EH6A 1ON2A 2ESHA 2VOPA 2HR3A 5LHHA 1ISEA 3GUDA 3JTHA 2FNAA 4WXDA 4UVCA 3QPHA 1T2KA 2R3SA 1Z91A 2ZJ2A 1XD7A 4LK1F 4AVPA 3GVAA 4P96A 1J0RA 2XROA 4BH9A 1SD6A 5LHGA 1Z6RA 3F8FA 5FB2A 2PN6A 4KT5C 3P9CA 2F2EA 5FD6A 3M8FA 2GXBA 5FGMA 2QQ9A 2QBYB 2UZKA 3TOAA 1D8KA 4A6EA 1XGNA 3GFMA 3H3ZA 1ZRCA 2O0YA 2D45A 1S3JA 2RKHA 1IAWA 5J8CA 2KKOA 1UB9A 3KCCA 1WIHA 3ROUA 1ZVUA 3GO5A 3LQQA 4LMYA 3HTSB 4Q4ZF 1O57A 5AIQA 1HKQA 2D1HA 2ETHA 2NYXA 3ISPA 3KP5A 2VBXA 1BBYA 2AXLA 2ZFZA 2MLGA 4LG0A 3RYRA 1W7PD 2CO5A 1KYZA 3P9KA 3I5UA 1XMAA 4RB0A 5D8LB 4ON0A 2YX7A 2YU3A 2R7DA 2F5FA 5L3BA 4RGRA 4RB3C 3FHZA 3K1NA 2FBIA 4WXHA 1CF7B 3RDIA 5L3EA 2LF8A
chains in the Genus database with same CATH superfamily
4BAYA 4ZC3A 5FO5A 1HQCA 3I54A 4N4NB 4ABZA 2DT5A 1B72B 4A3CJ 3I4NK 5IYCK 3OYCA 1ZGWA 3WGGA 5IP9C 4MEXF 5FKOA 3S32A 4BS9A 2FUG2 5IYDK 1XX5A 1T08B 1EQRA 2LY9A 1O3TA 3PJRA 3OS2A 2O6GE 4I2OA 3VA7A 2E2IK 3K70C 2CUFA 1UFMA 2OTLI 4RDUA 4M74A 1QVUA 2RVCA 3CP2A 2CQXA 2M34A 4BL0B 5IYDC 1GV5A 3LQRA 3C7JA 2CMPA 2PJRB 1K61A 4Y7NC 5E1XA 2ZFUA 2DPUA 1KQ9A 1RI7A 3ZP5A 1I1SA 4Q48A 2FXAA 1KU7A 4XLFA 4IEJA 1WJBA 4HX4A 1V5EA 2BVMA 4PDKA 5B1AH 3RIRA 2J5PA 2RDPA 5D4RA 4GYGA 1LVKA 4GXOA 1Y1WA 2QQBA 4NC8A 3GDZA 3BCBA 1DD5A 3W2WA 1R1VA 2DU9A 3IRRA 1JE8A 2ID6A 1JUPA 5J8FA 4HX7A 4LLGF 3I4NJ 1S6LA 4JX6A 4EM2A 4XLAA 1HSTA 2VJJA 1J9IA 4XLPA 1JT0A 5BQTA 3CQZJ 1KONA 1QO0D 3S1RK 1KYWA 2YU9C 1WJAA 1XCVA 3HSEA 1K78B 2DYRH 4IOAF 2R7OA 2MG4A 1KU3A 4ANJA 3F72A 1MMGA 2R7ZJ 1MZBA 4KDPA 3VFZA 3MCZA 4FQGA 1FTZA 3E5QA 1U6GA 2P7VB 1MBEA 1H89C 2TCTA 2RNJA 4ZYEA 3HC7A 1CQTA 1JUMA 4XONA 4A3DJ 2PMZN 4LLNA 3NAUA 3CAGA 2NVQJ 1J6VA 1SD7A 2VN2A 4I02A 2I10A 2O03A 4A3DC 4RLFA 1BI2A 4ASNA 3HOYK 2CU7A 3S1RJ 3CQZK 3LSPA 4XOPA 2VPRA 4LGWA 2HS5A 2QBYA 2XPWA 5IOYA 1UHWA 3T1BA 3H5AA 1DU6A 3KP4A 4G12A 2GSNA 5EGEA 3AL0B 4Y52K 3BTIA 3F6VA 2XPUA 3MKYB 2YU9J 3CQZC 1MMAA 3HOZK 3BY6A 2M87A 2CQKA 5IY5H 2MW8A 1RUNA 1R49A 5HOOA 1DQUA 2OCEA 1T0FC 1AKHB 1V5GA 1BS2A 3F0CA 3IWZA 2L7MP 3KZIC 3RZDJ 1ZQ3P 2ZC2A 5D8KB 4IOCF 1HKSA 3OYNA 4QJVB 3ABUA 1EH8A 2XVCA 4IHYA 5FRNA 3BG6A 2PMZD 1LNWA 3G4SI 1DDNA 2BW3B 4Q4ZA 2XDVA 4U88A 4W97A 4DNCA 1Y1VJ 4OAZA 4PJ0C 5TGTA 5A2QZ 1JKOC 2FX0A 3K10A 2VASA 3S1NK 2Y0SN 1G6NA 2IJLA 4XN3A 5EGOA 3SZZA 4G0UA 3DBHB 2MD0A 2FOWA 1TWCC 2KJBA 2OTJI 3CUQB 2OZUA 1ORKA 4A3BK 3ECHA 2PG4A 2V79A 1UG0A 1VQMI 1X1BA 4M6VA 3DFGA 3MZYA 1YW8A 2L9VA 1VH2A 2QZ8A 5IYDJ 5J47A 2MA3A 1HW5A 1HSJA 3LA3A 4A3LJ 2JRMA 5LRSA 2P6SA 3H5NA 5JLXA 5C3EK 1VNDA 3K4BA 2WAQL 4A3BC 4A3GK 1QU3A 3TW6A 3M4OK 3PQKA 3GYHX 1EI6A 3ZR8X 1BGWA 1HA8A 3LSMA 4L5IA 4RLQA 1SMTA 3AG3H 4P9UA 1STZA 1ZAOA 2ZXWH 4B09A 3FHNA 1MDMA 2ME0A 1H8AC 3I4MJ 4L9TA 1MDMB 4HEA2 2BY1A 2UXNA 5E17F 1HBXG 5LRRA 4AYBA 4FCYA 4A3LC 3I4MC 4KT6A 2HOEA 4U0WA 5M3MJ 2VXDA 4UUSA 1F43A 1ITYA 3ZQLA 1C0WA 3GTQK 2MABA 5J40A 4WF2A 3G73A 3S2HK 4AYBN 3OYKA 2GXGA 3JREA 1I50C 3I64A 1R9TC 4XOTA 4MTEA 2WBMA 3JSOA 3CJTB 3KEQA 3PQJA 5ILUA 2XC7A 2MGQA 1AB4A 1SFKA 2M2EA 4RGSA 2W7VA 3T02A 5JVOA 3S1QK 1I5ZA 2LY2A 2WADA 2K27A 2BEOA 3GTQC 5L3DA 1WQ2A 4QIWL 2JMWA 1U9NA 3L2VA 1UAAA 2AQEA 5DCMB 2GA2A 2ZXIA 3BP3A 1RR7A 3K4JA 4GCVA 3O3KA 5DCMA 5DEQA 1G8XA 3TO9A 4AM3A 5LEJA 5E20A 2K40A 1I1GA 4PGGA 3ZMZA 2STTA 2LTPA 2EFWA 4IHTA 4P5AA 4XSXA 5JFEA 2C6YA 1WWXA 3GTJK 2H8RA 3IWFA 3R61A 1W36D 4RMFA 1IC8A 4BY7C 3ASNH 2CJJA 3HEFA 4EGYA 3OWTA 2HEOA 2EZKA 4RM2A 3GTJA 4JQFA 2O9LA 2B63K 2DOEA 3RZDC 2Y9ZA 3S16C 2JA8K 2VJ5A 3KETA 4XSZA 2I5UA 3GTJC 3JSPA 4OINA 3TL4X 2DDAA 1TW2A 2PQ8A 4HV6A 4BDYA 3S1MJ 5CJ9A 4OIQF 1B4BA 3HSFA 4I01A 1Q1VA 3E7LA 3GEZA 1Z6TA 1ZTRA 2BVLA 5L3GA 5IYBK 4A3FK 3S16K 3ABKH 5KCMA 3W6VA 4PABA 3KPHA 5M5YJ 1K83K 4N0BA 1TWHA 3B02A 2TRTA 3N05A 2NXNB 2DYSH 5HS8A 1V5VA 2BHYA 1XMXA 1VQNI 5K7FA 2JZYA 1QHHD 3D5RC 3A8IA 1QBJA 2A05A 1U2WA 1UG2A 5K5OA 5JVTA 4LG3A 3MWMA 5M5XK 3EYYA 4A3FC 3A0HC 1YW7A 2GM4A 4HG2A 3CJRB 2NS8A 1TWAJ 1LFUP 1K83J 3MMYB 2NVYK 1USSA 1R1UA 1S29A 3TKYA 3JRGA 1AWCA 1EKEA 5L3CA 4LOCA 3F6OA 3E6BA 1SFOC 5E79C 1BN5A 3BC8A 1S7OA 2HWVA 2DBBA 2IS4A 1IV8A 1E17A 3OL3A 1R5ID 3FIWA 2M5WA 2Z3YA 3EUHC 2G9WA 3U1KA 3L2QA 2JA8J 3I3LA 2FNPA 2P0WA 3JCUC 2VLAA 2VBWA 1TWGJ 4UB8C 4BJ6C 4LG0B 2VUMJ 2CFAA 2HOTA 1F7UA 1VFCA 1MNMC 2OQGA 2DA6A 3WU0A 4C30A 2H94A 2E1OA 3OYFA 1PJ7A 4GYIA 9ANTA 3AD8C 1Y39A 1I3QC 4AD9A 3BWGA 3TOBA 5LHIA 4ZDPA 2LF7A 5C4XK 4A3MJ 2WAEA 3VODA 1HOMA 4OIOA 2VUMC 1YFHA 4BLBA 2NVXA 5C4XJ 1F7VA 1NHAA 1VI0A 3GLXA 1B9MA 2IPQX 2JA7C 4EQQA 2Z2SB 2HOAA 3GSIA 1OCOH 4HPQA 4YFNF 3MZ8A 2F5VA 2LFBA 2OCCH 6PAXA 3OYDA 2VUMK 1EH1A 3LMMA 4RM3A 3MN2A 4F93B 2F5DA 1T38A 4G7OA 1SFEA 1F4KA 1MJ9A 3CF2A 2E7WA 3ZGKA 2LY1A 1A35A 5ERIA 3SFZA 4KASA 1R00A 3GEEA 2DW4A 2L4AA 2Y9YA 3HOVK 4BLAA 1SC7A 3LFKA 1WH7A 3ADAC 3RQ4A 2MC4A 2OC6A 3WU2C 3S2DJ 4HDVA 1Y1VA 3HOWC 2DK8A 3KZYA 2VE8A 5FLXK 2X1DA 5FKKA 1UHMA 4C3HJ 3S15J 2LP0A 3KZZA 3FXRA 2F6CA 3KX2A 1QNTA 1TC3C 4XCHA 2LBFA 4NQWB 1Z3XA 2JSPA 3M8JA 3QPTA 3ZXSA 3OEPA 4KUMA 1MNDA 1YYVA 2G7HA 1R1TA 2K4JA 2ZXJA 4YFXA 3HOUJ 2FBHA 3M7GA 1RNLA 1BJAA 3F23A 1J75A 4GTEA 2VQLA 2FMLA 2OPTA 3TFHA 4A3EC 2LRDA 5GTIC 2E71A 2NNNA 2O61A 3S1MK 3MKZA 2VQCA 3JRIA 1ZKGA 1XXBA 1Z7LA 1WJEA 1XSVA 2F4OB 5HVQC 1IRZA 4EJUA 2PBIA 2OUMA 2QWWA 1JTXA 2PJRA 4M3FA 2NOGA 3FOFA 4B8XA 2RC4A 4YELA 1Y1VK 3HKZN 2YU9A 3K4MA 4ZTJA 4IRIA 2HXOA 1FYMA 2QKLB 1QZEA 4CO8A 1IN5A 1JXSA 1K83A 1FP2A 3SZYA 3GTGK 1FOWA 2WAQA 4DDQA 4YRVA 4Z2YA 2F4IA 1FT9A 1BJZA 4ZDOA 1BR2A 3FM5A 5E3LA 1Z3YA 1R23A 4G0VA 1R22A 4C3JK 2QSFX 3FXLA 4Y52J 3N0BA 4ZH4F 5KNLA 2W84A 1FEXA 2WAQN 5JFRA 2JH3A 2LSOA 4XRSA 5BS6A 5FLMK 1BOAA 1MBKA 5D6EA 4KB2A 1YIOA 3HHHA 1Y1WJ 3S2HJ 1X1CA 3QYBA 3A2KA 4GFQA 2XV4S 2KRCA 3BTJA 4NUBA 3TDZC 1UV7A 4UNOA 1BW6A 2P5VA 1K4SA 4XBFA 5F0CA 2A61A 1OMIA 1WRJA 3QYEA 2Y0SL 2QYOA 4ZZLA 1YX5A 3CZ6A 2JA7J 1BOBA 3DCFA 4E7SA 1IXRC 5DDGA 2MC3A 1KGSA 3FXUA 1TWHK 3WTTC 2DCEA 2E36A 2IW5A 4HBLA 4MO7A 5H2FC 2A6EF 1DPUA 1J5YA 2EV5A 1O2BA 1H9GA 3EUAA 1YLFA 2Z33A 3PUFA 2BXZA 3FKIK 1WZ2A 1TLHB 3RKQA 1WOPA 2TDXA 4NDLA 2NVTC 3DTKA 4BQQA 4A3KC 3DU6A 2V6CA 2E2IC 1RC9A 2W00A 3C18A 4ZJZA 4KMHA 1XN7A 4RBOA 3MKLA 1X2MA 2NOJB 3IH2A 1XXAA 2Y0SD 5K5QA 5CVRA 4XLEA 4EEFG 2V7FA 3O6BB 3R6SA 3FMQA 3L2RA 4OIOF 3FKIC 3AD7C 2D1VA 2L4MA 2EZLA 3BR3A 4HOBA 4HDUA 2KIUA 3GTLA 2WB1N 1W5CC 4Y7NK 2KISA 3EPZA 4D5CA 3A01B 2IAIA 3WTZA 2DMUA 2W24A 1MH3A 1B4AA 2R93J 3WTWC 2PMZL 4G7ZA 2X1CA 1TWAC 2KFDA 3FKIA 3OYLA 4U7DA 1OYWA 1IN8A 1IW7A 2CYYA 3RKWA 2XAQA 2Z16A 2UWMA 1S9HA 3GX4X 3Q9VA 1FTTA 2P7CB 2LR8A 5A2QK 1UMQA 4OIRF 4OU0A 1I3QA 5CVIA 3REOA 3CMMA 1BDFA 3SEZA 3PNVA 3E3VA 2E1MB 4XKCA 2A6HF 1IXSB 2HQAA 3RKXA 2NS7A 2JA5J 3S1RC 2YU9K 2IBDA 5J4YA 1W7PA 2FRHA 3OREA 2L7ZA 4LK0F 2NS0A 1TT5B 1U78A 4AIHA 3F22A 2VKEA 2DFIA 4BBSJ 3VDXA 3N4MA 1IW7F 5EG0A 4XQFA 3ZQQA 1UELB 3IH4A 1S8NA 3WODF 2L7FP 3HOYJ 3GTMC 3OIPA 5ILSA 2BY2A 3CDLA 3CCVI 2XAGA 3HYIA 5IT9Z 2M3AA 1NK3P 1OQYA 2H6CA 2EV6A 2CW0F 2A6HA 3PIOF 3I9V2 4A3DK 3D1NI 4KITB 1ONVA 1WCMC 3HOXJ 2G0EA 1OCPA 4F91B 4YEJA 5C4JJ 1X1AA 3FZVA 2E19A 3BTCA 3DPLC 5EEGA 2VI6A 3HOUK 3HHGA 1ZR4A 2DOFA 5E1ZB 3B6CA 4F7ZA 3HOZC 3PM1A 3K7AJ 4QWQA 3FXQA 2JA6C 1TQPA 2ZB9A 4HQMA 3TTGA 3HOUC 2CWEA 4IF4A 2K9MA 3GTMJ 5IOTA 5DD8A 3GTKK 1FX7A 1Y8RB 3OOUA 1O3RA 3MVPA 5C44C 2K9SA 1B8IA 1J6XA 3HKZL 3FK7A 4PJNA 1AA7A 1O3SA 2PMUA 4F55A 3HUGB 1K7AA 3NWSA 5IYCC 4ZH4A 4PFOA 3M1EA 4KN7A 4KN7X 5GTHC 5FLVA 1TWFK 3OIOA 2HNHA 2PX9A 3I55I 4PJMA 2R92A 3FF5A 5DD4A 2JPBA 2PHCB 1XTAA 2FBKA 3G4CA 3RTRA 2MFZA 3I59B 4UVBA 4ZYGA 1D5VA 2VL8A 1ZLJA 4RGXA 4I0BA 3BROA 3PNTA 2HKOA 2R7WA 2CV2A 3M4OC 4CCLA 3P9IA 3TP3A 5CVUA 4A0ZA 4XRFA 1EFWA 3V42A 2KMUA 4WWCA 1JT6A 5BPDA 1X4PA 3BR5A 2A6TA 2H27A 4E7HA 2O8XA 1Y0UA 3I53A 2IS1A 3B6AA 3TDUC 3GFLA 1W1WE 3BPVA 3JAMZ 1D0ZA 2ID3A 1FPQA 1BR4A 3BP8A 2ELHA 2Y2ZA 3WTVC 1X31C 4XM3A 1OCZH 1W0UA 2DFHA 2W25A 2JA2A 2XRLA 3ZMDA 1VTNC 2AXTC 3U9GA 2N8GA 3DEUA 3WTYC 3K4LA 2KIMA 2ELKA 3C2HA 3DF8A 4JOMA 4BQNA 5LGUA 3MKWB 2R5YB 2JQ7A 1QHGA 3PIPF 2KT0A 5BMZA 2R5YA 5HODA 5DM7F 2F48A 2FE3A 3S1QC 1FIPA 4FETA 4LB6B 2DAOA 4KJZA 2EINH 3HL2A 4MIMA 2LH9A 3ZQFA 5CLSA 3BR2A 1K78A 1Z77A 4G7ZF 1D5YA 4BNCA 5IT9K 3CCUI 4XN0A 1G2HA 1VRQC 4CICA 5D4DA 4B3AA 4LIUA 3T8RA 2P5KA 3ZQIA 2X4HA 4WX9A 3J7AY 2VPLA 3MZHA 4NNJA 4UHTA 5M3FK 3GTLC 3HOYC 2JA7A 2CW8A 1FOYA 3H3UA 4BY7K 3N0CA 1TWCA 3M3YJ 1LVAA 1TNTA 1QA6A 3DKXA 4FISA 1VQ6I 4KC6A 5FKLA 1O7LA 1OJLA 5JVGF 2OU2A 3I71A 2M7BA 2NVQC 2WTEA 2KQRA 4I98B 5H6QA 3GTLK 2BBYA 3QP6A 3ZOBA 3ZQ7A 4R1HA 3CDHA 1ETOA 4LK1A 1IUFA 2O8KA 1YRNB 2E1CA 3ELKA 3OY9A 1IS1A 2GIVA 1OCRH 4BDZA 1IDYA 1FBSA 2OA4A 4D7MA 5DM6F 4L18B 4HAMA 1IRGA 5IOSA 5IP6A 1X3UA 4JP0A 1JHFA 2ZMEB 5K5RA 4KMUA 5TRDA 1X3ZB 2HVRA 1IL2A 1SVOA 3KLOA 3OYAA 3ZMUA 3QRFF 4IRGA 3GTLJ 3OSGA 4OOIA 1BJTA 4IXAA 1HI9A 5HL8A 1OR7C 3WU1B 2JWTA 5FLXZ 1KU9A 1EV7A 3BQZA 1V5FA 4BY7J 4ESBA 5E8IA 4IQJA 3D5LA 2DMTA 1W36C 3FK6A 1DCPA 4EVIA 1MBHA 2KJCA 1HW1A 3RQIA 2Y48A 1BW5A 5HLHA 4KN4X 4EJOA 1D3YA 4N4OB 1U5TB 2FOKA 3E6MA 2NVUB 5B66C 2ECBA 1FSHA 3DP7A 2DLLA 2M45A 5IORA 1IE0A 5HDNA 2K3FA 3DQVC 2ME6A 2NNYA 5CHPA 1CF7A 2COMA 1Q1HA 5M3MK 3CC4I 2XKPA 1YRNA 2WA0A 2CV1A 2M8EA 2VODA 2MBFA 1O25A 4KARA 3FX3A 2R4GA 3G6EI 1BA5A 5D5XB 1R71A 3PSIA 3U2RA 4ZZDA 3ECOA 4N9HA 2ZNYA 4LJZA 4OAYA 2O5JA 4WJ3M 3QX3A 4NQWA 2LBFB 4XRSG 1ZREA 2VKVA 1LDJA 1WH5A 2VQGA 3L9FA 1OCCH 2HZTA 2XIGA 4M72A 3LAPA 5M5WK 1MIJA 5FFXA 1JKRC 1I50K 1R9TK 3Q0WA 1ETVA 4A3GJ 2YUSA 4HF1A 3WG7H 4M73A 2CG4A 2HTSA 4PFPA 3NRVA 4M9ZA 1JGGA 3K7AK 3FXJA 2MD5A 2QQ8A 3F8NA 4A2UA 3FBNB 4V2FA 4FM9A 1HCRA 1QPMA 4A3BJ 2K9NA 1ETWA 1X1DA 3MD2A 1FYKA 3QOPA 1TQMA 4KIGA 4A12A 3L2UA 2ZCWA 3RPUA 2VJ4A 1LB2A 2XHKA 3GZ5A 2E2JC 1I3QJ 2R7XA 1OYYA 4HYEA 2HYGD 3S1NJ 4P9SA 4H4KC 1KQ0A 2D6FC 1C0AA 2I8DA 2E2HA 4DGWB 1BI3A 5TJ3A 3F8MA 4QIWN 2V9PA 1W0TA 2IGKA 5LBQA 5CQEA 3RZDK 1P6RA 4CCJA 2JA8C 3J81Z 1DUXC 2XB0X 3IL2A 1MKMA 2IA1A 2PA8L 2X6YA 4BUPA 4P55A 4MTDA 2VC0A 3OSFA 4BY1J 1VQLI 1I39A 1FYLA 1TTYA 2DOAA 2W85A 4YFKA 3ZRGA 4A3JC 3J80Z 5J6XA 3KEYA 3SEQA 4PJLA 3HKZD 4EMSA 4A3IJ 1APLC 2EV0A 3G1OA 2HVSA 3CCLI 1K83C 4A3EK 4IHSA 2X1EA 3S8PA 4KIFA 4Q47A 3BPXA 5CPRB 3ZN1A 2GAHC 4PSWA 2KP6A 4A3JK 3HM5A 4E70A 4PK4A 3OR1C 3J80K 4MQ9F 1TT0A 2CH0A 4E7IA 2HPIA 4ENJA 4C3HC 3MMLB 5EG0B 3V7CA 3RJPA 4FT8A 3ESWB 3BJAA 3IPJA 5E68A 5C4JK 3BJ6A 1ZG5A 4YFKF 4HSTA 2BXYA 3HOXK 1W7PB 3I59A 1R5HA 3FISA 1LEBA 4EATA 3BUEA 4KMDA 3L4JA 2R93K 2M9HA 3GTKA 2CQ7A 1AHDP 2CW7A 5BNGA 3C3WA 4KFCA 4HNUA 2BW3A 5CVVA 5F0FA 5D5VB 3JSTA 2BY3A 3HGGA 4XORA 3EUHA 1P7IA 2BV6A 3MAJA 4HLYA 4MQ9A 1U0JA 1WI9A 4A93C 3ABMH 3GMEA 3HPGA 1BI0A 3E5XA 1BL0A 4M6YA 1R6RA 1T0FA 3C2GA 1GDTA 4AYBD 2LMDA 2XCRB 3GFIA 4IHWA 2R7FA 1PJ6A 1RRJA 3RPUD 5C4XC 3G1MA 3H9QA 3VB2A 3IH3A 1AOYA 3BG7A 3JW4A 3KP6A 5F64A 2QM3A 1MD0A 3BOQA 4N9IA 5HDKA 4ZYDA 2JA7K 4WK8F 1TWHC 3KIOA 3TGNA 4RB2C 2Q0OA 3VWBA 4C3IC 3S17K 1MJAA 1D0YA 1WORA 3OYHA 2W7NA 4G6DA 1TNSA 2E2IJ 1VQ7I 2O7OA 4I09A 1IZ1A 1Y1WK 3CUQA 5FLMJ 1WSRA 4BHCA 4AIDA 4R79A 1ZGAA 3DV8A 1R4NB 2FF4A 4JBAA 1OYIA 3DLAA 3J7ZI 1WI3A 4XRMA 1MH4A 3VOEA 2EFPA 3KEOA 3JRHA 3Q3SA 5DV5A 1YW9A 1Y1WC 1IQ0A 4G6TB 4YFNA 2K9QA 4IRHA 4BBRJ 3TBIA 2Q2EA 1FOXA 2XAFA 1YNNA 5TISC 5F08A 2Y0MA 4CSWA 5L3FA 3F8BA 3GWZA 4GTFA 3H35A 5J1YA 2K7LA 2OD5A 1D1BA 3GTPK 1P4XA 1HC8A 4IX7A 3MQ0A 2CUZA 3LAJA 2QUFA 4U7BA 1QGPA 1VQPI 2HGCA 4J00A 1FZPB 2KIFA 2E2HC 3DU5A 3VYUB 2L3DA 3RCOA 1Z05A 4S0HB 2P5MA 2LOOA 2ZXHA 4WILA 2NVXK 5J1RA 3GIRA 3Q0UA 1IRXA 2DI3A 3TO7A 2WWYA 1J2XA 1O7FA 1O26A 5IP7K 2EK5A 1YX3A 2DA2A 3HPHA 1R9TA 3ZN0A 4B44A 4C2UA 1OPCA 3M3YC 1P7JA 3PO3K 1H88C 4L0YB 2EA2A 3ERMA 1WSVA 4DYRA 3AH5A 4KAWX 2Y69H 1F36A 1I6XA 3IAS2 4QPQA 4NBQA 1GXQA 4U0VA 1LDDA 2R7ZA 4RAYA 2XAJA 4U87A 3E6DA 1INNA 4C45A 3QODA 5EJCA 5FRMA 1ZGJA 1A36A 2KPMA 2P6TA 4YFXF 4I99C 4UV8A 1WHUA 4A3EJ 4AC0A 2DA7A 1YOVB 1WGXA 2IVMA 3H92A 3Q9SA 3GTGC 3W6KB 1UCRA 4DJAA 1X1PA 1TP4A 2EPFA 1I3AA 2GAUA 2B7EA 1YIJI 2E1MC 4CGZA 5ICFA 5HDGA 2GAGC 2OBPA 3DXJA 2FA5A 1PDNC 3SYTA 3DTIA 4XK4A 1WCMK 3HOVJ 5DYMA 2H6BA 3G4AA 1B9NA 1S7AA 5HNHA 4ENNA 4BXXK 1RPWA 3VSKA 4V2GA 3C2BA 1K6OA 3KP2A 1BI1A 4BQOA 3TFIA 1IF1A 4FHTA 2L7KA 4LQYA 3OYJA 5FFZA 1P4AA 2RGVA 4G94A 4ESFA 5GPCA 1PUFA 1HXDA 1MGTA 2PJPA 2B9SA 1I6HJ 4MHGA 2QSGX 4GTCA 1XSXA 3H0GA 5IP9K 3FBIB 1XMKA 1BC8C 1FBUA 2XF6A 5ICCA 3KYCB 2LREA 4LLLA 3RI4A 2VB6A 1VZ0A 3K69A 4M3GA 3H9GA 5CVJA 4UXNA 2E5ZA 2A3SA 2EIJH 2QENA 3EUKL 3W3CA 2HKXA 4G8XA 4OWRB 2A68A 3HUGA 3OS1A 1TWGA 2R5ZB 1A04A 2YX4A 1O27A 3K6GA 2KL4A 3KLNA 1QVTA 2MYSA 3RZOC 5J4VA 3R0JA 3S2DK 5CKTA 4IHVA 2KRHA 2R7VA 4GTAA 2NVTK 1JHHA 1Z21A 4A3KK 1A5JA 3I4NC 3A1YA 3PFYA 3M9AA 2NRAC 2Y0SA 1IDZA 4DW6A 2PLYA 2XF7A 3GTOJ 4NHJA 4GRIA 1X2NA 1XDSA 2ZSIB 3I4PA 4EJVA 4YG2F 2BY0A 2L2OA 3VYSB 1X3WB 5GADJ 1V3FA 2H1KA 2ZMEA 1E3PA 5D4SA 1M1EB 4CYDA 3H3VD 1TWGC 3OOPA 5E8GA 4DBQA 2WAFA 4I0AA 4K2EA 2HXIA 4NOIA 4AWXB 2FMYA 3LNQA 2WV0A 3GEIA 1RKWA 2IEKA 4CZZA 2V6EA 4RAGA 1K4TA 4B3XA 2RNGA 2XASA 4F3QA 4X1EA 3RPQA 2W1OA 4OMZA 3CP8A 2L54A 4A0XA 4LITA 4Y13A 1N77A 5EDNA 2HYJA 3QYFA 4XR6A 2O5IA 2ELJA 1FP1D 3SQNA 1ZG1A 3L2CA 4HX8A 4ETSA 3AFHA 2VIXA 1TWFA 5IP9J 2D2WA 1XZQA 2JVHA 5DCFA 4KICA 4O6JA 5IYBJ 4BEHB 1I6HK 1J59A 3EETA 1O3QA 3AAFA 3DBLB 5ED4A 1O2FB 4BXUA 4CYCB 2Z99A 4B1RA 5LGTA 3FM3A 3A03A 3G3ZA 3JR9A 2XAHA 1G3YA 1SFOJ 1JKPC 1NTCA 1IO2A 1ZG3A 2ZBKA 5EZHA 4KDDA 1HQMA 5FJ8K 2LVSA 1P92A 2BGCA 3K4NA 4FTHA 1P2FA 2GA1A 1G59A 2PI0A 4J3NA 1ZBSA 1B8IB 1I6HC 4BXXJ 3W6JB 4WCGA 4DQ2A 1W5SA 3HIFA 5DUIA 3GTGA 5BOXA 3K9TA 1D8JA 4Y52C 5E18F 4XMYA 3WTXC 4LK0A 3FMRA 4HNTA 4FX0A 4LB5A 4UV9A 3H5RA 3UKGA 1ZLKA 3F21A 4G7OF 5F1JA 3MFKA 4EJWA 3CC2I 2R93A 2V6SA 3CCQI 5M3FJ 4L9NA 2O3FA 2LKXA 3GW2A 2CW0A 3BG5A 1PJRA 4ZYHA 2LLKA 2CQQA 2V6TA 3S16J 1RIOH 1WQFA 3S3OA 5K7HA 2Q2EB 2CUJA 1WSUA 4LFUA 5F04A 3HRMA 1ON1A 1TWCK 5C44K 3GTQJ 5EF6A 4D9JA 2DK5A 2XPVA 3A0BC 2GXAA 2JUGA 4B43A 1Y0NA 3LSTA 2ZUEA 1FSEA 3CCMI 1OISA 1U8BA 1NK2P 2NVTJ 1MW7A 2DXIA 4LD5A 1R4MB 2VT3A 2LDUA 2IS2A 3AKZA 3GTOC 2XB5A 4NC7A 1E0EA 1HDPA 1E2XA 2OQRA 1GV2A 1FMWA 3CESA 1Y6IA 5AIPA 5JHUA 1MBFA 4AIKA 3N97A 2IRFG 3WTUC 3WE3A 1JGSA 2FJ1A 3K1PA 4BQAA 4X0GA 5EYRA 2DPDA 4UVAA 1KQ4A 1K79A 4BYYA 2MH2A 2X6OA 3GZ6A 2FU4A 3FKJA 1U3EM 5F27A 2R7SA 4X6AJ 1YJ9I 3TW7A 2QKMB 3FOEA 2K9LA 3E5UA 5JI6A 2VUMA 3GXOA 4IVNA 4G9YA 3PSFA 3DPTA 1ZYRF 4EM0B 4UUTA 1WOSA 3A01A 1WCMA 4A3GC 1GE9A 2LC2A 4HLXA 1PVEA 2OZ6A 2IA0A 1ETKA 4CH7A 3A02A 4EJTA 2XSDC 3HG9A 2X48A 1T39A 1UHSA 2GSOA 1UJ8A 1N78A 3V7SA 1WQHA 1D1AA 3CO6C 3GTMA 1F1ZA 2VJIA 3DWLE 4M3DA 2V4JC 2RREA 3CMAI 4A6DA 2LNBA 3QOEA 2Y31A 5D5UB 4CHUA 3H0GK 4YG2A 4C2MK 3I4MK 4DIQA 4YIIA 5D5WB 2W57A 4CDGA 4KATA 5LGNA 3K7AC 2DJIA 2A5WA 1X58A 3U21A 1P9QC 1ZRFA 3D0SA 3GFJA 1R7JA 1OFCX 5HNFA 3GTKJ 3EYIA 3KE2A 5C3EJ 1XCBA 1JVIA 4MFEA 1MMDA 2MSYA 1GVJA 1Y8QB 3GLLA 1L0OC 2CFOA 2DODA 4QJVA 4PGHA 4XKBA 2ZKZA 3LA7A 5HS7A 3CF5F 3WHCA 2A6EA 1FNNA 2LK2A 2RGRA 3ML6A 3ZPLA 4M3EA 4GGGA 1QQIA 1CGPA 5EEHA 2NVQK 3DTEA 1WPKA 3ZQGA 2WC2A 4L9JA 5FD5A 3BZ6A 3F9KA 4ITVA 4HNVA 2WY7Q 3KFWX 2CS3A 1D0XA 2KHMA 4JK1X 2DT6A 3ZMSA 5GAEJ 4E7ZA 1I6VA 2DDBA 2KDZA 1YO5C 2DA1A 2JA5C 1TBXA 1LQ1A 4OIPF 2ICWG 4Z6YA 2XKOA 4A3IK 4GO1A 4WJ4A 5IYBC 3SXYA 4W1UA 1IRFA 2E2IA 2EWNA 4EM1A 2JA5K 4BY1K 3SHFA 2FQOA 2IS6A 5KK1A 1V54H 2Z1DA 3KYLA 1XG1A 1H0MA 2R93C 4A3IC 3A8KA 2KDOA 4HA8A 4XL9A 4OIRA 1DCOA 5KAFC 3FWEA 4PSXA 1GLNA 4RS8A 2DQLA 2HI3A 3M8EA 2X6XA 4PCQA 1KQ8A 2WB1D 4BY1C 4BKXA 1SMYA 1USOA 1N25A 3QU3A 3IC7A 1VGXA 3OR2C 3NUHA 1JI8A 2Z9OA 4RGUA 5H20A 3LA2A 2ZJQF 2R7ZK 5GP9A 4Y7NJ 2D5VA 2Y75A 1OKRA 2HQRA 2IGOA 4IQ4A 2HZDA 3T5XA 3HRSA 2OV7A 3LSKA 4KMUX 4GZYA 2LYCA 4IHXA 1VJEA 3L00A 4QSHA 1TL8A 3TMOA 3LWFA 3E0JB 4L9VA 2F5EA 1H9TA 1SMYF 4KN4A 4A3CK 1MBGA 4AYBL 3GTOA 1ZHFA 1RZ4A 1R9TJ 2ZNZA 1YS6A 2K3PA 3WTSC 5F0HA 5CYVA 4MGRA 3JAMK 4BGDA 2HQ5A 3DKWA 3LOCA 3EDPA 4A3CC 1VQOI 2AQFA 3Q5FA 3AQOA 2JJ7A 2HQNA 2L02A 3WG9A 4DYQA 3JRCA 3CUQC 2KRFA 3L7WA 3HOWK 2VE9A 2GIZA 1B72A 1U5TC 1J7KA 2E7XA 2V6UA 4DBRA 3R0AA 4HRIA 4LR2A 3CLQA 2ZSHB 4M1XA 3GTQA 3HXLA 3K4CA 2K4BA 4DYCA 4BJTA 1YHQI 2M4GA 3AQPA 3U1DA 2R7TA 1O24A 3HOVC 3PO2C 1J6WA 3V8JA 3COAC 2M30A 2EBIA 2DFEA 2PA8D 3UR3C 3G1LA 3AL0C 3TP0A 3S1MC 2E2HK 2UUZA 2DMPA 3JRAA 1AU7A 4XLHA 4AU7A 4QIWD 3GTGJ 2XGCA 3PO2K 1USMA 4BXFA 4NB5A 1EH7A 1YJWI 2EILH 1BIBA 4II3A 2PEXA 1WOOA 2A69F 1WFXA 2VBYA 3S14K 2EZHA 5DUKA 5C4JC 3WGHA 1FMVA 2EIMH 5B1BH 3JRFA 1IV6A 1DP3A 4PJJA 1JQWA 3SZPA 2FEZA 3ZQHA 2OJED 5EEAA 3B73A 3R60A 1IUYA 4G0WA 3OV8A 2KZVA 1YCLA 4G6QA 3OYBA 3S14C 3I58A 4XLCA 3LSJA 1ULYA 1ETXA 5LLQA 5HLTA 2CSOA 3L1PA 1JJ8C 5GAGJ 4L0ZB 1I50J 3H3VL 5M5WJ 1XPXA 1VQ5I 2A5YB 3FMSA 1YNJA 2DA3A 4Y3OA 4ILDA 3S15K 5TMCA 2PFBA 5KVRA 1RESA 1LFPA 1WKMA 1V55H 2KZGA 3E1SA 1R58A 3KYDB 3RSNA 1VQ9I 4CCMA 2ISZA 4C2MJ 1ZN2A 4KISA 3Q0VA 1USTA 2YR2A 5F6FA 5GPAA 4CZCA 4ZTFA 2YS9A 1ZARA 4J19A 4BACA 4JX5A 2P4WA 3IUOA 1L3LA 3KP3A 3VSLA 2JTVA 1XZPA 3VYRB 1LPQA 2EFNA 2QEXI 4A5NA 3H9JA 2YSRA 3L09A 1LUJB 2ACJA 4XSXF 2XUBA 3PFIA 4FX4A 1HKTA 1O4XA 2ZFWA 3P5JA 4EV0A 2X85A 1T98A 4S05A 1PUEE 1W5TA 1EK8A 4GTLA 1REPC 3HTUA 1IBAA 3RZOK 4P5OA 3OPFA 2DA5A 1DGWY 5DTDA 1JOEA 4M6XA 4CCOA 2ADUA 2DJNA 2Q8KA 4OIQA 2RQQA 3BZCA 3S2WA 2L0KA 4C3IJ 3AG1H 1F5TA 4KNYA 5TJJA 4LLGA 3K0LA 2EBBA 2XGXA 4G7HF 4XLPF 1R36A 2DFFA 1TWGK 3CO7C 4KA4A 2AS5F 4A93J 3QP5A 1QZYA 3JRBA 3K2ZA 4BE0A 1SFUA 2QCOA 2WB1A 2HDDA 3K2AA 4L5JA 4XICA 4Y17A 2XGEA 1VQKI 4FZBA 1LJ9A 4UUVA 3CLOA 3ZQCA 1I27A 2GWRA 1PP7U 5IP7C 2VC1A 3CCEI 1IGNA 2JA6A 4IKFA 2Z5UA 1PP8F 3M3YK 3PO3C 1TWAK 3OMYA 2WV1A 4CCNA 3P7NA 4QLCU 4BU2A 3TO6A 3Q3QA 3HSRA 1B59A 3WE2A 1QPIA 3BR6A 4O2DA 3CTAA 3BLYA 2L01A 3BG3A 1WVRA 5M5XJ 1XB4A 2HVQA 2DA4A 2GLOA 3HJEA 1W4MA 4GTBA 1DPRA 4LJZF 2FQ3A 2IA2A 4FE7A 2VXZA 3GBGA 2IGMA 1VQ4I 3SDBA 4LOWA 3CCSI 4E4HA 1QRYA 3A4CA 3ZMTA 1ETYA 4A69C 3S14J 1S5LC 2M1BA 4DZPA 1JJ6C 4MQVA 3K70D 3QPLA 1U8RA 3H3VK 5FJ8J 2LD5A 2JA6K 2J5OA 3DPUA 2B63J 1IN6A 2R7QA 4I76A 5B3SH 4HQEA 3FXKA 1WCMJ 4GTDA 3QU6A 3GTKC 1BM9A 2KIQA 1E3HA 2W48A 3DBRB 4ZYAA 1KU2A 1SFOK 2K02A 1MBJA 1PYVA 2DMNA 2ESNA 4PUSA 2AO9A 1RR8C 3GCMA 4DZJA 1HW2A 4O5VA 3L2WA 3DXJF 4MEYF 2QA4I 2HTJA 1YITI 1J98A 3O2PE 2ISYA 4RAZA 2P81A 2CGPA 1GUUA 1TWFC 1POGA 4C2TA 4M3BA 3K1MA 4KYWA 1T95A 2EJRA 2HYFA 1FLIA 5B5EC 2R5ZA 2VKDA 1T6SA 5K1YA 3S1NC 4KM8A 3R4KA 3GTPA 2CQNA 5E1WA 2M0MA 1A6IA 2PMHA 4DOZA 3CUOA 3AD9C 5LFAA 3HOWJ 3S2DC 1P4WA 1FBQA 4I7HA 3IHUA 1YS7A 2V26A 2EH3A 2QSHX 3C1DA 5IP7J 3GTOK 2JK3A 1XGMA 2XRNA 4FASD 3IRQA 2X51A 2NVXJ 2WAQD 1NH3A 2DTZA 4H0EA 4BBRC 4EGZA 2A68F 2IGNA 3CCJI 5BPIA 1FY7A 1GHCA 1VQ8I 2XCQA 4AIJA 3SZGA 3ASOH 2RQPA 3ABTA 3HBLA 1SD5A 4ENKA 1MSFC 1R5GA 2P8TA 4GDFA 2GBYA 2FD5A 3NQOA 4BBRK 5E3OA 2JPCA 4UUSB 5AONA 3IKVA 1S7EA 1X19A 3BT9A 1FWZA 4MLOA 4A3LK 1SAXA 1U5TA 1X4OA 2X9DA 2VBZA 3LSIA 2RAEA 5H6RA 5HLIA 4XIDA 1FOKA 2P5LC 3BCAA 1EJ9A 1TWHJ 1XPPA 2H09A 3WHBA 1B1BA 2XGDA 2H8WA 2COBA 2E35A 2JSCA 1F9NA 4P9FA 3BJOA 4C9YA 1OLTA 1MSEC 3H0GC 4HF0A 3S17J 1XGSA 5HS9A 1XS9A 4G7HA 1N75A 2K85A 2V9VA 3CCYA 4D5FA 1LEAA 1E3OC 3CCRI 1BC7C 2LKSA 3QAHA 1BIAA 2X0LA 3OYGA 4XSZF 3G71I 4E7JA 4P5BA 2GZWA 2L5QA 1A6QA 4OINF 2V1UA 3SDGA 1MJBA 1YQAA 3ZCOA 4BBSK 1JTYA 2BOLA 2AHQA 1IN4A 2Q1ZB 4IO9F 1Z1DA 2JRTA 1BR1A 4A0YA 3MEXA 4C3JJ 1IJWC 1IXCA 3SZTA 3FDYA 3H1CA 3TFJA 4RB1A 4MNUA 1S72I 1G3SA 5CQGA 5ICEA 3SJMA 4BBSC 4YIFA 1FJLA 4BJ5C 3LL7A 3E97A 4B47A 1XZPB 3LSGA 1SVLA 2ECCA 3GZNB 2DO7A 3NWTA 4IL6C 4PAAA 1YJNI 1G3TA 3V8LA 2A07F 4ESJA 1G4DA 4XNFA 3BG9A 3PO3J 2H1LA 2LKPA 3HGYA 1O2AA 3VYTB 1UZCA 4OMYA 3J7AO 4AH6A 1HF0A 1IN7A 4M9XA 2QQAA 5IT3A 3BP8C 4TV7A 3T0YA 3CMEI 1NG7A 2BHZA 3HKZA 3IKTA 2DQRA 3A8JA 1XC5A 2R7RA 1Z7UA 1I50A 1YG2A 2MH9A 1PJ5A 3BDDA 3LPXA 3TEDA 2GOMA 1U9OA 2HDWA 2VOOA 3ULQB 2B0LA 2IT0A 3GTPJ 3I56I 4IPAA 4S04A 2M4KA 3LFUA 4A3JJ 1Y56A 1RUOA 5ICGA 4KB4A 4U0YA 3FKIJ 2NVYC 1XXCA 2Y3PA 1A31A 2OAZA 1TQIA 2V1DA 4WXCA 2L9RA 3PNYA 2KWAA 4JYKA 3J81K 2VONA 1J09A 5C3EC 3S93A 1G3WA 3H0GJ 3RKYA 2STWA 1ETQA 2ZJPF 4MEYA 3LSRA 4E7LA 1F93A 1EA3A 2FSWA 2QLZA 2F4MB 1O28A 1K6YA 4B48A 2BYVE 2JA5A 1ODDA 2V1XA 3HOTA 1VF9A 2UV1A 2G7UA 2QF7A 1WJCA 3K4KA 1DP7P 2YPRA 2K5CA 3S3NA 1SANA 1PUFB 4Y15A 3CJNA 3H36A 5IOZA 3N3YA 4IJAA 1I3QK 5ILVA 3JRDA 1WQGA 5HLGA 2EZIA 1ZRDA 5DS9A 5JLWA 1RKTA 2XCOA 4R8HA 2DMQA 3HXAA 4HZFA 4X6AK 1LDKB 2HFHA 2RV8A 2V9KA 1Z0XA 3TQNA 5GAHJ 4M71A 4BE2A 3S2HC 4CXFA 5E3NA 3DKYA 5F1RA 1OR7A 3E6CC 4C2MC 1ZYRA 4BE1A 2XF5A 5IYCJ 3EQLF 3ABLH 5LD2C 4BHBA 2B63A 1ZQ1C 2EIKH 1VLOA 4XLNF 4MFDA 4X6AC 4E7KA 2NVYA 1KZHA 4D0PA 4GT9A 2M7AA 3HRTA 1B6AA 2HDCA 4D1QA 3F3XA 2HU9A 3HOSA 2R0QC 3AG4H 2JA6J 4KIBA 2GOXB 1SAUA 1ENHA 2VKHA 2X6WA 1ZR2A 2FQTA 1DGRM 2NAZA 1XSDA 2VT2A 2EA4A 2E60A 3EQLA 5C44J 1LKXA 2L9NA 1L0WA 3S0XA 1TWCJ 1SFXA 2ZO4A 4RA2A 3RYPA 2PMZA 3OYEA 4O3MA 4BKWA 4XLNA 2GQQA 1SEUA 2B63C 1GXPA 4M9SA 1QZZA 2E2JK 2MLKA 2EFOA 3BQYA 1MMSA 4Q5SF 3HDDA 2R92C 3HRUA 4NC6A 4XKVA 2HPMA 2V1NA 2E1NA 4BHPA 1KA8A 4HV5A 3CJQB 2M0CA 4A5MA 1ERDA 3KP7A 2CV0A 3LSHA 3HZJA 3ERED 1Z9CA 2CFAB 2LG4A 3X2QH 4C3HK 1XDUA 2RN7A 4ENMA 2R92K 4II2A 4P1WA 3HOXC 2DTRA 4HW0A 1XGOA 3FXMA 2WY8Q 4RAFA 3CMYA 5M5YK 1GVDA 2XAUA 3FXOA 3OIQA 4PZJA 3V7RA 3I0TA 3BR1A 3NEUA 3BZKA 3V4GA 1T56A 2IP2A 2QGUA 3DEEA 3HB9A 3QPSA 1ZELA 3VEPA 2WB1L 2K86A 2EB7A 4UY8I 3GF2A 4Y4RA 1FC3A 1GT0C 3OS0A 2EFQA 2BE5A 4A93K 5D6FA 2DN0A 4KMFA 1TZLA 1WJFA 1MNEA 2UXXA 2W4SA 3T8TA 2F5CA 4AUXA 5E3MA 4HF2A 4OIPA 3VPRA 1YTYA 2CRGA 2QVOA 2JVGA 3JTGA 3WGIA 5JR3A 1ZH5A 2BZTA 1DU0A 3ONQA 3V8KA 4C3JC 1ACIA 3ZMVA 1SD4A 3IP4B 3SFIA 2R7ZC 1D1CA 2CFXA 3F8CA 3IV5A 3UNGC 2ZJRF 4A3MK 1V4RA 3AG2H 4UB6C 5FLMC 3OYIA 2BE5F 3L4KA 3W2AA 2JT1A 3GEHA 5EGHA 1LE8A 1YX2A 1TW3A 1LE8B 5J3LA 2XSJC 3M1CA 1EH6A 1YE9A 5LEKA 1T8IA 1ON2A 2ESHA 2HOSA 4AVZA 3S1QJ 1MMNA 2VOPA 1G51A 5EZGA 3S17C 3CC7I 4A3MC 2HR3A 2W82A 4RMNA 3T00A 5LHHA 1ISEA 3GUDA 5KAIC 1LFBA 1RETA 3JTHA 3M07A 2KLOA 4L5EA 4FE4A 4CA0A 2FNAA 4WXDA 4UVCA 4IZZA 5JHFA 2ZUFA 3QPHA 1T2KA 1O29A 2FQ4A 3J7YJ 4ZDLA 4V19K 4KM9A 5FKNA 2O5RA 3D5SC 2R3SA 4A3KJ 2PPBA 1Z91A 2EQRA 2NVYJ 1ZXOA 2ZJ2A 1XD7A 1Z67A 1TWAA 5J1UA 3OL4A 4BEHA 3T01A 4LIVA 1XZQB 5EGOB 4C3IK 4LK1F 4AVPA 3GVAA 4HSRA 4P96A 1J0RA 2XROA 3NARA 3GTPC 5IPAA 4QPOA 3PUBA 4BH9A 1ZK8A 2RH6A 2CUEA 3M4OJ 1SD6A 2JUCA 5LHGA 1Z6RA 3RZOJ 2GSUA 3F8FA 5FB2A 3QWLA 2NVXC 4CUGA 2L9SA 2E34A 1YI2I 2PN6A 4A3FJ 1JUSA 3DEWA 3CDIA 4KT5C 3P9CA 2Y30A 5FKMA 2IXSA 2F2EA 5FD6A 5TMFA 3M8FA 5KHDA 4GFBA 2GXBA 5FGMA 1JKQC 3WODA 2QQ9A 2QBYB 3O8HA 1D8KA 3TOAA 2UZKA 4A6EA 2R7UA 4F52A 1NG6A 2ZMEC 1XGNA 3CD6I 1FIAA 2OF7A 4D7NA 4E6KG 3GFMA 3H3ZA 4JX4A 3CQZA 1ZRCA 1TWFJ 2O0YA 2D45A 1S3JA 2RKHA 2JN6A 3GTJJ 5L46A 1IAWA 4QTRA 5J8CA 1HLVA 1SFOA 1WJ5A 2KKOA 1UB9A 1Y1VC 2DT7B 4XKWA 3HOZJ 3KCCA 1WIHA 3ROUA 2R92J 1ZVUA 3W2VA 3DLLF 3GO5A 4CYCA 3LQQA 3GTMK 4Q5SA 4CCKA 4J01A 4LMYA 5FROA 5K7ZA 3O8GA 3HTSB 2M8GX 4Q4ZF 2A69A 1O57A 5AIQA 3BR0A 1T33A 1WJDA 1HKQA 2D1HA 1HDDC 2ETHA 2NYXA 4YIRX 3ISPA 2E5NA 3KP5A 3PL8A 2E2JJ 4I6ZA 3S15C 2VBXA 1BBYA 3BTLA 1RU0A 2AXLA 3QQAA 3OYMA 2MLGA 2ZFZA 4LG0A 3RYRA 1AKHA 1W7PD 2CO5A 1KYZA 3P9KA 4KMAA 3I5UA 4MEXA 5IOQA 1XMAA 3H0DA 4RB0A 5D8LB 1OCTC 4ON0A 4JK1A 2YX7A 2YU3A 2R7DA 2F5FA 3PO2J 5L3BA 1SVMA 4BXXC 4B4CA 3IAM2 4RGRA 4RB3C 3FHZA 3K1NA 2FBIA 2VQHA 4WXHA 3S3MA 1CF7B 3G2BA 4Y33A 4F92B 1DCHA 1EF4A 1IG7A 2E2HJ 3RDIA 5L3EA 2LF8A
chains in the Genus database with same CATH topology
4BAYA 5FO5A 1HQCA 3I54A 2DT5A 3WGGA 4MEXF 1O3TA 4I2OA 2O6GE 3VA7A 1UFMA 4M74A 2RVCA 3LQRA 3C7JA 5E1XA 2DPUA 1KQ9A 1RI7A 3ZP5A 1I1SA 4Q48A 2FXAA 1KU7A 4HX4A 4PDKA 3RIRA 2J5PA 2RDPA 5D4RA 4GYGA 4GXOA 1Y1WA 2QQBA 1DD5A 1R1VA 2DU9A 3IRRA 1JE8A 5J8FA 4HX7A 4LLGF 1S6LA 4EM2A 1HSTA 1J9IA 5BQTA 1QO0D 1KYWA 1XCVA 3HSEA 1K78B 1KU3A 3F72A 1MZBA 4KDPA 3VFZA 3MCZA 3E5QA 1U6GA 2P7VB 2RNJA 4ZYEA 4LLNA 3CAGA 1SD7A 2VN2A 4I02A 2O03A 1BI2A 4ASNA 4LGWA 2HS5A 2QBYA 1UHWA 3T1BA 3KP4A 2GSNA 5EGEA 3F6VA 3BY6A 2M87A 2CQKA 1RUNA 5HOOA 3IWZA 5D8KB 1HKSA 3ABUA 1EH8A 2XVCA 1LNWA 1DDNA 4U88A 4DNCA 5A2QZ 1G6NA 2IJLA 4G0UA 2KJBA 3CUQB 2OZUA 3ECHA 2PG4A 2V79A 3DFGA 3MZYA 1YW8A 2QZ8A 2MA3A 1HW5A 1HSJA 3LA3A 5LRSA 2P6SA 3PQKA 3GYHX 1BGWA 4L5IA 1SMTA 4P9UA 1STZA 1ZAOA 4B09A 1MDMA 4L9TA 1MDMB 2UXNA 5E17F 1HBXG 5LRRA 2HOEA 4U0WA 1C0WA 4WF2A 3G73A 2GXGA 3I64A 4MTEA 3JSOA 3KEQA 5ILUA 3PQJA 1AB4A 4RGSA 5JVOA 1I5ZA 2K27A 2BEOA 5L3DA 1WQ2A 5DCMB 2GA2A 4GCVA 5DEQA 5DCMA 3O3KA 3TO9A 5LEJA 5E20A 2STTA 1I1GA 4PGGA 3ZMZA 4P5AA 2EFWA 4IHTA 5JFEA 2C6YA 1WWXA 3IWFA 3R61A 2HEOA 4EGYA 3GTJA 4JQFA 3KETA 3JSPA 1TW2A 2PQ8A 4HV6A 5CJ9A 4OIQF 1B4BA 3HSFA 4I01A 3GEZA 1Z6TA 5L3GA 4N0BA 1TWHA 3B02A 5HS8A 2JZYA 1QBJA 1U2WA 5K5OA 5JVTA 3MWMA 3EYYA 1YW7A 1USSA 1R1UA 1S29A 3TKYA 1AWCA 5L3CA 3F6OA 3E6BA 1BN5A 1S7OA 2HWVA 2DBBA 1E17A 2M5WA 2Z3YA 2G9WA 2FNPA 2VBWA 4LG0B 2CFAA 2OQGA 3WU0A 2H94A 4GYIA 4AD9A 3BWGA 3TOBA 5LHIA 2LF7A 3VODA 1YFHA 4BLBA 2NVXA 1NHAA 3GLXA 1B9MA 2IPQX 4EQQA 4YFNF 6PAXA 1EH1A 2F5DA 1T38A 1SFEA 1F4KA 1MJ9A 2E7WA 5ERIA 3SFZA 4KASA 1R00A 2DW4A 2L4AA 4BLAA 3LFKA 1Y1VA 4HDVA 2DK8A 3KZYA 2VE8A 5FLXK 1UHMA 3KZZA 3FXRA 1QNTA 3QPTA 3OEPA 4KUMA 1YYVA 2K4JA 2G7HA 1R1TA 2ZXJA 2FBHA 3M7GA 1RNLA 1BJAA 3F23A 1J75A 4GTEA 2FMLA 2NNNA 2O61A 1XXBA 1XSVA 5HVQC 4EJUA 2PBIA 2QWWA 3FOFA 4B8XA 2RC4A 2YU9A 4IRIA 1FYMA 4CO8A 1IN5A 1JXSA 1K83A 1FP2A 4DDQA 4Z2YA 1FT9A 3FM5A 1R23A 4G0VA 1R22A 3N0BA 4ZH4F 2W84A 5JFRA 2JH3A 2LSOA 5BS6A 1BOAA 4KB2A 5D6EA 1YIOA 3HHHA 4GFQA 2XV4S 3TDZC 4UNOA 2P5VA 4XBFA 2A61A 1OMIA 1WRJA 2QYOA 4ZZLA 1IXRC 5DDGA 2MC3A 1KGSA 3FXUA 3WTTC 2IW5A 4HBLA 2A6EF 1DPUA 1J5YA 2EV5A 1O2BA 1H9GA 1YLFA 2Z33A 1TLHB 2TDXA 2V6CA 3C18A 4KMHA 1XN7A 1XXAA 5K5QA 5CVRA 3O6BB 3R6SA 3FMQA 4OIOF 2D1VA 2L4MA 4HOBA 4HDUA 2KIUA 3GTLA 3WTZA 2W24A 1B4AA 3WTWC 3FKIA 4U7DA 1OYWA 1IN8A 2CYYA 3RKWA 2XAQA 2UWMA 3GX4X 3Q9VA 2P7CB 5A2QK 4OIRF 4OU0A 1I3QA 5CVIA 3REOA 3E3VA 2A6HF 1IXSB 3RKXA 1W7PA 2FRHA 3OREA 4LK0F 2NS0A 1U78A 4AIHA 3F22A 2DFIA 3N4MA 1IW7F 3WODF 1S8NA 5ILSA 2XAGA 3HYIA 5IT9Z 2H6CA 2EV6A 2CW0F 1ONVA 3FZVA 5EEGA 3DPLC 3HHGA 5E1ZB 4F7ZA 4QWQA 3FXQA 1TQPA 4HQMA 2CWEA 4IF4A 5IOTA 5DD8A 1FX7A 1O3RA 1O3SA 2PMUA 1K7AA 3M1EA 4KN7X 2R92A 3FF5A 5DD4A 2JPBA 2PHCB 2FBKA 3G4CA 3RTRA 3I59B 4UVBA 4ZYGA 1D5VA 1ZLJA 4RGXA 4I0BA 3BROA 2HKOA 3P9IA 5CVUA 4A0ZA 4XRFA 4WWCA 5BPDA 2H27A 2O8XA 1Y0UA 3I53A 3TDUC 3GFLA 3BPVA 3JAMZ 1FPQA 3BP8A 2ELHA 3WTVC 2W25A 3ZMDA 1VTNC 3U9GA 3DEUA 3WTYC 2KIMA 3BUEA 3DF8A 5LGUA 5BMZA 2FE3A 4LB6B 2DAOA 5CLSA 1K78A 4G7ZF 4BNCA 5IT9K 4CICA 3T8RA 2P5KA 2X4HA 4WX9A 3MZHA 4UHTA 2JA7A 3H3UA 3N0CA 1TWCA 1LVAA 1TNTA 4KC6A 1O7LA 2OU2A 3I71A 2WTEA 4I98B 5H6QA 2BBYA 3QP6A 3ZQ7A 4R1HA 3CDHA 2E1CA 3ELKA 1IS1A 2GIVA 1FBSA 2OA4A 4L18B 4HAMA 1IRGA 5IOSA 1X3UA 5K5RA 1JHFA 2ZMEB 5TRDA 3KLOA 3ZMUA 3QRFF 4IRGA 4OOIA 1BJTA 4IXAA 3WU1B 5FLXZ 1KU9A 1EV7A 4ESBA 5E8IA 3D5LA 4EVIA 2KJCA 1HW1A 2Y48A 5HLHA 4KN4X 4EJOA 1D3YA 1U5TB 2FOKA 3E6MA 1FSHA 3DP7A 2DLLA 2M45A 5IORA 5HDNA 3DQVC 2NNYA 5CHPA 1CF7A 2COMA 1Q1HA 2XKPA 2VODA 2M8EA 2MBFA 1O25A 4KARA 3FX3A 5D5XB 3U2RA 4ZZDA 3ECOA 4N9HA 2ZNYA 3QX3A 4NQWA 1ZREA 1LDJA 3LAPA 3L9FA 2HZTA 2XIGA 4M72A 5FFXA 4HF1A 4M73A 2CG4A 2HTSA 3NRVA 4M9ZA 2MD5A 3F8NA 4A2UA 4FM9A 1QPMA 1FYKA 3QOPA 1TQMA 4KIGA 4A12A 2ZCWA 3RPUA 1LB2A 2XHKA 3GZ5A 1OYYA 4HYEA 2HYGD 1KQ0A 2E2HA 1BI3A 5TJ3A 3F8MA 5LBQA 1P6RA 3J81Z 1DUXC 3IL2A 1MKMA 2IA1A 4P55A 4MTDA 2VC0A 1FYLA 1TTYA 2W85A 3J80Z 5J6XA 4EMSA 2EV0A 4IHSA 4KIFA 4Q47A 3BPXA 3ZN1A 4E70A 3J80K 4MQ9F 4ENJA 4C3HC 3MMLB 3V7CA 3RJPA 4FT8A 3BJAA 3BJ6A 1ZG5A 4YFKF 1W7PB 3I59A 1R5HA 1LEBA 4KMDA 3L4JA 3GTKA 3C3WA 4KFCA 5CVVA 5D5VB 3EUHA 3MAJA 2BV6A 4HLYA 1WI9A 1BI0A 3E5XA 4M6YA 1T0FA 2XCRB 3GFIA 2R7FA 3VB2A 1AOYA 3JW4A 3KP6A 5F64A 2QM3A 1MD0A 3BOQA 4N9IA 5HDKA 4ZYDA 4WK8F 4RB2C 3TGNA 2Q0OA 4C3IC 1MJAA 4G6DA 1TNSA 4I09A 1IZ1A 3CUQA 4BHCA 4R79A 1ZGAA 3DV8A 2FF4A 4JBAA 1OYIA 3VOEA 2EFPA 3KEOA 5DV5A 1YW9A 4IRHA 2Q2EA 2XAFA 2Y0MA 5L3FA 3F8BA 3GWZA 4GTFA 2K7LA 2OD5A 1P4XA 3MQ0A 3LAJA 2QUFA 4U7BA 1QGPA 2HGCA 1FZPB 2KIFA 2L3DA 1Z05A 2P5MA 2DI3A 2WWYA 3TO7A 1J2XA 1O7FA 1O26A 2EK5A 1R9TA 3ZN0A 1OPCA 4L0YB 2EA2A 3AH5A 4KAWX 1I6XA 1GXQA 4U0VA 1LDDA 2R7ZA 4RAYA 2XAJA 3E6DA 1ZGJA 2P6TA 4YFXF 4UV8A 3H92A 2IVMA 3Q9SA 3W6KB 1UCRA 2GAUA 4CGZA 5ICFA 5HDGA 2OBPA 2FA5A 1PDNC 5DYMA 2H6BA 3G4AA 1B9NA 1S7AA 4ENNA 1K6OA 3KP2A 1BI1A 1IF1A 4FHTA 4LQYA 5FFZA 1P4AA 2RGVA 4G94A 4ESFA 1HXDA 1MGTA 2PJPA 4MHGA 4GTCA 1XSXA 3H0GA 1XMKA 1BC8C 1FBUA 5ICCA 4LLLA 3RI4A 3K69A 5CVJA 4UXNA 2QENA 2A3SA 2HKXA 4G8XA 3HUGA 1TWGA 1A04A 2YX4A 1O27A 3KLNA 3R0JA 4GTAA 1JHHA 3M9AA 2NRAC 2PLYA 4NHJA 4YG2F 1XDSA 3I4PA 4EJVA 1V3FA 2ZMEA 5D4SA 4CYDA 3OOPA 5E8GA 4I0AA 4K2EA 4AWXB 2FMYA 2WV0A 4CZZA 2XASA 3RPQA 4OMZA 2L54A 4A0XA 4Y13A 1FP1D 3SQNA 1ZG1A 3L2CA 4HX8A 4ETSA 1TWFA 2D2WA 5DCFA 4KICA 4O6JA 1J59A 3EETA 1O3QA 3AAFA 5ED4A 4BXUA 2Z99A 5LGTA 3FM3A 3G3ZA 2XAHA 1G3YA 1ZG3A 2ZBKA 4KDDA 2PI0A 1P92A 2BGCA 1P2FA 2GA1A 4J3NA 1ZBSA 3W6JB 4WCGA 4DQ2A 1W5SA 3HIFA 5DUIA 3GTGA 5BOXA 3K9TA 1D8JA 5E18F 3WTXC 3FMRA 4FX0A 4LB5A 4UV9A 1ZLKA 3F21A 4G7OF 3MFKA 4EJWA 2R93A 4L9NA 2O3FA 3GW2A 4ZYHA 1RIOH 1WQFA 1WSUA 4LFUA 3HRMA 1ON1A 2DK5A 3LSTA 1FSEA 4LD5A 2VT3A 2LDUA 1E2XA 2OQRA 5AIPA 4AIKA 5JHUA 2IRFG 3N97A 3WTUC 3WE3A 1JGSA 3K1PA 4BQAA 2DPDA 4UVAA 1KQ4A 1K79A 4BYYA 2MH2A 3GZ6A 2FU4A 1U3EM 3FOEA 3E5UA 5JI6A 2VUMA 3GXOA 4IVNA 4G9YA 3DPTA 1ZYRF 4EM0B 1WCMA 1GE9A 4HLXA 2OZ6A 2IA0A 4EJTA 1T39A 2GSOA 3V7SA 1WQHA 3CO6C 3GTMA 1F1ZA 4A6DA 2LNBA 5D5UB 4CHUA 4YIIA 5D5WB 2W57A 4CDGA 4KATA 5LGNA 1ZRFA 3D0SA 3GFJA 1R7JA 3EYIA 3KE2A 1XCBA 1GVJA 1L0OC 4PGHA 2ZKZA 3LA7A 5HS7A 1FNNA 2RGRA 3ML6A 3ZPLA 4GGGA 1QQIA 1CGPA 5EEHA 2WC2A 4L9JA 5FD5A 3BZ6A 3KFWX 4JK1X 3ZMSA 1YO5C 1TBXA 1LQ1A 4OIPF 2XKOA 4GO1A 3SXYA 1IRFA 2E2IA 2EWNA 4EM1A 3SHFA 5KK1A 1H0MA 4HA8A 3FWEA 4RS8A 2DQLA 4PCQA 3M8EA 1KQ8A 3QU3A 3IC7A 3NUHA 2Z9OA 4RGUA 5H20A 3LA2A 1OKRA 2HQRA 2Y75A 3T5XA 3HRSA 4KMUX 3L00A 3LWFA 4L9VA 2F5EA 1H9TA 1SMYF 3GTOA 1ZHFA 1RZ4A 2ZNZA 1YS6A 3WTSC 5CYVA 4MGRA 3JAMK 3DKWA 3EDPA 3Q5FA 3AQOA 2HQNA 2L02A 3WG9A 3CUQC 2KRFA 3L7WA 2VE9A 1U5TC 1J7KA 2E7XA 3R0AA 4LR2A 4M1XA 3GTQA 2K4BA 3AQPA 3U1DA 1O24A 3V8JA 3COAC 2M30A 4NB5A 1EH7A 1BIBA 2PEXA 2A69F 2VBYA 5DUKA 3WGHA 3SZPA 2FEZA 3B73A 3R60A 1IUYA 4G0WA 3OV8A 4G6QA 3I58A 1ULYA 5LLQA 2CSOA 4L0ZB 2A5YB 3FMSA 4ILDA 2PFBA 5KVRA 1WKMA 1R58A 2ISZA 1ZN2A 1USTA 2YR2A 5F6FA 1ZARA 2P4WA 1L3LA 3KP3A 2JTVA 2EFNA 4A5NA 2YSRA 3L09A 2ACJA 4XSXF 2XUBA 3PFIA 4FX4A 1HKTA 2ZFWA 4EV0A 4S05A 1T98A 1PUEE 1W5TA 1EK8A 4GTLA 1REPC 3HTUA 4P5OA 3OPFA 4M6XA 2ADUA 2Q8KA 3S2WA 1F5TA 4KNYA 5TJJA 3K0LA 2XGXA 4G7HF 4XLPF 1R36A 3CO7C 4KA4A 2AS5F 3QP5A 1QZYA 3K2ZA 1SFUA 4L5JA 4Y17A 4FZBA 1LJ9A 4UUVA 3CLOA 1I27A 2GWRA 1PP7U 2VC1A 2JA6A 2Z5UA 1PP8F 4QLCU 3P7NA 3TO6A 3Q3QA 3HSRA 1B59A 3WE2A 3CTAA 2L01A 1XB4A 1W4MA 4GTBA 1DPRA 4LJZF 2FQ3A 2IA2A 2VXZA 3ZMTA 2M1BA 4MQVA 1U8RA 2J5OA 1IN6A 4HQEA 4GTDA 3QU6A 1BM9A 1KU2A 2K02A 2ESNA 1HW2A 4O5VA 3DXJF 4MEYF 2HTJA 3O2PE 2ISYA 4RAZA 2CGPA 4KYWA 3K1MA 2EJRA 2HYFA 1FLIA 1T6SA 5K1YA 4KM8A 3R4KA 3GTPA 5E1WA 2PMHA 3CUOA 1P4WA 1FBQA 4I7HA 3IHUA 1YS7A 3C1DA 1XGMA 2XRNA 3IRQA 4H0EA 4EGZA 2A68F 1GHCA 5BPIA 1FY7A 2XCQA 4AIJA 2RQPA 3ABTA 1SD5A 4ENKA 1R5GA 2P8TA 3NQOA 2JPCA 5AONA 3IKVA 1FWZA 1SAXA 1U5TA 5HLIA 2VBZA 5H6RA 1FOKA 2P5LC 2H09A 1B1BA 2JSCA 4P9FA 1F9NA 3BJOA 4HF0A 1XGSA 5HS9A 2V9VA 1LEAA 1BC7C 3QAHA 1BIAA 2X0LA 4P5BA 4XSZF 2GZWA 4OINF 2V1UA 1MJBA 1YQAA 1IN4A 1Z1DA 2JRTA 4A0YA 3MEXA 1IXCA 3SZTA 4RB1A 4MNUA 1G3SA 5ICEA 4YIFA 3E97A 2DO7A 1G3TA 3V8LA 2A07F 4ESJA 1G4DA 2LKPA 1O2AA 4OMYA 3J7AO 1IN7A 4M9XA 2QQAA 5IT3A 4TV7A 3T0YA 3IKTA 2DQRA 1I50A 1Z7UA 1YG2A 2MH9A 3LPXA 3BDDA 2VOOA 3ULQB