3FHZA

Crystal structure of the arginine repressor from mycobacterium tuberculosis bound with its dna operator and co-repressor, l-arginine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
155
structure length
155
Chain Sequence
ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
total genus 39
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01316 Arg_repressor Arginine repressor, DNA binding domain
A PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fhzA01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3fhzA02
2Q2EA 1SFEA 3FM5A 1J2XA 4Y17A 5F1RA 4HF0A 3P9IA 2F5EA 1ZYRF 2A5YB 3GFLA 3GFJA 4L9VA 4HA8A 4Q5SF 2VBZA 1R5GA 1GXPA 2KIFA 3M8EA 4HLXA 4HOBA 4IF4A 2K86A 1P6RA 5FFZA 3QX3A 3I5UA 1TNTA 4U0YA 2JPCA 2W24A 1BC7C 3RKWA 1R23A 4HV6A 4XLPF 1BM9A 5HLGA 2V9VA 1J75A 5DEQA 3MAJA 5ILVA 4M6XA 5BS6A 1W5SA 1IXSB 3MZHA 3CLOA 3GO5A 1TQIA 2R7DA 2P7VB 3ELKA 4HF1A 1P4XA 1DDNA 3F6OA 3KP2A 4UNOA 1IXRC 2BV6A 1QO0D 3CUOA 1ODDA 5FGMA 2UZKA 1J7KA 2E1CA 1FLIA 4MQ9F 1KQ9A 2LKPA 3FXQA 4GO1A 1QBJA 2HKOA 1T39A 4OOIA 4QWQA 5IT9K 2EFNA 3B73A 1XSDA 3R4KA 3MFKA 1T98A 2EWNA 3TQNA 4ZZDA 4UV8A 3KP3A 1TW3A 1DP7P 2FQ3A 1ULYA 1BJTA 3SHFA 4UUVA 1MJ9A 2GA2A 4EGZA 2MH2A 1FYMA 5J8FA 1RNLA 1Z91A 1IS1A 1ZLKA 1KA8A 3WTUC 5HDKA 1LB2A 2DW4A 2GWRA 4UXNA 1LVAA 2F5CA 5JHUA 4I0AA 4WWCA 1K79A 2V1UA 4EV0A 2JRTA 4KIFA 1I5ZA 3OREA 4CO8A 2WC2A 2MLGA 1CGPA 3K1NA 3K9TA 4KDPA 3BPXA 2K4JA 2MBFA 2M87A 3L09A 2KRFA 1R1VA 4PDKA 1WRJA 2EFOA 1XDUA 2FA5A 2EK5A 2KJBA 2EV6A 5H6QA 3K69A 4ENNA 5HS8A 1MGTA 1SD5A 2O6GE 5CVIA 2L3DA 1FWZA 4YFXF 1ZGAA 2ZMEA 3CUQA 2J5PA 1O3QA 1FT9A 2O0YA 4HX4A 4ESBA 4MTEA 2VOPA 4OIRF 2ESHA 1DPUA 4KIGA 3F21A 1D5VA 4KNYA 1ON2A 2R7FA 4BH9A 1XN7A 1YIOA 2ZJ2A 1U3EM 4G0UA 4LK0F 1E17A 3ERED 1FPQA 5J6XA 2KJCA 3JTHA 1XXCA 5BPDA 1HSJA 2R3SA 3SZPA 4WF2A 3TO6A 1SD4A 4DDQA 3ABUA 2FNAA 1HSTA 3C3WA 2ELHA 1DD5A 2A61A 4HDUA 3TOAA 4A0XA 3I58A 4A0ZA 1T2KA 4R1HA 2YX7A 2RC4A 4BHCA 5L3CA 1EK8A 5K5OA 5AONA 2QWWA 3HHGA 4EJTA 2G7UA 2YSRA 4Q48A 4O6JA 1ZVUA 2HS5A 2CW0F 4LLGF 1EH7A 5D8KB 1USTA 3I54A 2YPRA 1WQGA 2OD5A 1UB9A 3RDIA 2NAZA 3LQQA 3BROA 3DV8A 4KDDA 4GXOA 5LRRA 1I6XA 5EEHA 1WI9A 1HXDA 2K27A 3IC7A 1P4WA 3TDZC 4FT8A 4I98B 4P96A 3KP6A 2XHKA 4L9NA 2IW5A 1QZYA 3QOPA 5K5QA 2GXBA 4A0YA 2VT3A 2VC1A 2VT2A 2PFBA 4OMZA 2EV5A 3FMSA 3GZ6A 2VOOA 2K02A 2CFXA 4LGWA 3ULQB 2QVOA 1H0MA 3R61A 4A5MA 1J9IA 3RKYA 1FBSA 4Z2YA 2K7LA 2Z99A 4OU0A 3CO6C 1TNSA 2W84A 4U0VA 2IPQX 3ZMZA 3IKTA 3HRMA 4IJAA 2IA1A 3RI4A 1R58A 2PBIA 1UHWA 4FHTA 2HOEA 2OU2A 3V7CA 2PMUA 1BI0A 2DK8A 5CJ9A 1R7JA 2XV4S 3LSTA 2M5WA 3IWFA 3HTSB 4NHJA 3RYRA 2VBXA 2L4AA 1LDDA 4L9JA 1IUYA 3I0TA 3MEXA 2JPBA 1L3LA 1BBYA 3E6CC 3F6VA 3WE2A 3V7RA 2V79A 4Q4ZF 1YS7A 4KMUX 3SXYA 2FNPA 5L3GA 1SMTA 1ZHFA 2DQRA 3ABTA 4KA4A 5LEKA 5JR3A 2A68F 5L3FA 1Y0UA 4L5JA 1ZN2A 3HUGA 1HBXG 4A2UA 2UXXA 1TTYA 2OZ6A 1BN5A 1KU3A 3GFMA 2RGVA 1JGSA 4I09A 1S6LA 1FOKA 3WGIA 3WTTC 3BJ6A 2QM3A 4OIQF 3KLNA 4MHGA 3OPFA 4M73A 3KP4A 1ZRFA 1YG2A 3LFKA 3J80K 3QU3A 1GHCA 2EB7A 3KETA 1B59A 5D5XB 2XCQA 5LEJA 4O5VA 3HIFA 2RGRA 1G3YA 2XASA 1U5TB 3PQKA 4U88A 1RUNA 3EYYA 2L54A 5DCMB 5HDGA 1EH8A 1IZ1A 5DCFA 4G0WA 3CUQB 4LFUA 3K1PA 3T8RA 1F9NA 3H92A 2DQLA 2Y48A 2DPDA 2VC0A 3F8CA 1HW2A 1S3JA 3Q9VA 1T6SA 2PN6A 3J81K 2CO5A 4M6YA 5ED4A 1ZRCA 2M8EA 2HWVA 2EFPA 2XIGA 2P5MA 4HX7A 2HDCA 5JFRA 4GFQA 3O2PE 4NB5A 2VONA 1I27A 1WQ2A 2OZUA 2RVCA 2QQAA 3ECOA 4RB3C 2ACJA 1YS6A 3V8JA 4BYYA 3E97A 3DXJF 2RDPA 3FX3A 4D0PA 5FLXK 4WX9A 4HDVA 4RGUA 2FMYA 5LHIA 2XAJA 4PZJA 2K4BA 1FNNA 3FF5A 4L18B 3FXUA 2HZTA 2CSOA 4CHUA 4KB2A 2ESNA 4A6EA 5AIQA 3WGGA 1UHMA 4LJZF 1VTNC 2P5VA 2V6CA 4JQFA 5FD6A 3NQOA 1XGMA 1GVJA 1OKRA 5AIPA 5HLIA 5LGUA 1NHAA 4G0VA 2XKPA 4BNCA 3FMRA 4GYIA 2D1VA 3I4PA 3J80Z 2STWA 2VBYA 2HKXA 1FC3A 1IN6A 1AB4A 4EM1A 5HS7A 4EJOA 1YO5C 4AD9A 2DI3A 2FSWA 2XAGA 4Q47A 2TDXA 1XMKA 2HYFA 3P9KA 2IVMA 1OMIA 4BHBA 3RPUA 2FEZA 1JHHA 1S7AA 2DT5A 5D4SA 2ZBKA 2EV0A 3CTAA 1LEAA 3U2RA 1MD0A 4ON0A 3J81Z 3T5XA 5D6FA 2D2WA 3NUHA 3COAC 3FMQA 3RKXA 2JTVA 3G73A 3LAPA 2DFIA 4BHPA 4ENKA 4S05A 4PGGA 1HW5A 2FBHA 1CF7A 5LHHA 3R60A 4ZYDA 1YW9A 3D5LA 3G3ZA 4BXUA 1PP7U 4UVCA 1HKTA 4JK1X 2H09A 2D45A 3GLXA 2E7WA 2UWMA 5D5VB 5FLXZ 3V4GA 4EVIA 2AXLA 1XD7A 2Y75A 3N4MA 1H9GA 1S8NA 1B4BA 3LPXA 3SQNA 2M45A 2QBYB 1KU7A 1HKQA 4EMSA 2ISZA 2O61A 1AWCA 3TOBA 1TQPA 2COMA 1U5TA 4AIKA 2P4WA 1U2WA 1YLFA 5KK1A 2L02A 5DCMA 2Q0OA 1G3WA 5K5RA 2HTSA 2LF8A 3F8NA 4I7HA 2KIUA 4ENJA 1X3UA 5LGTA 1T38A 3IRQA 1OYYA 4N9IA 5DYMA 4AIHA 1HKSA 1XGNA 5ICEA 3KLOA 3MQ0A 1IXCA 3MWMA 1B9MA 5FD5A 4KICA 3I71A 4AVPA 3HRUA 1ZG1A 3ZMSA 2H6CA 1TQMA 3VFZA 3E5UA 3C18A 4OIPF 3Q5FA 2JT1A 4ESFA 1W7PD 5DD8A 1I1SA 4LB5A 2FU4A 1K78B 1LJ9A 1IRGA 3F23A 4MTDA 2DPUA 1WWXA 4G7HF 2BBYA 2ISYA 4LG0A 1S7OA 2YX4A 3KFWX 1LQ1A 4LB6B 3BDDA 3K2ZA 1Z6TA 5E1XA 4HX8A 2BEOA 4EJWA 2Y0MA 4I02A 4CGZA 1UCRA 4ZYHA 4IHTA 3KP7A 2IP2A 1U78A 4KC6A 1QQIA 1BI2A 4G9YA 3ZPLA 1BI3A 4WCGA 1BI1A 1R1UA 1A04A 3EDPA 3QAHA 1P2FA 3RYPA 2G9WA 4MGRA 2IRFG 2P5LC 1WQFA 4HW0A 1SAXA 3CAGA 3OEPA 3R0AA 4IHSA 5H6RA 2GIVA 2DAOA 1XB4A 1SD7A 2QUFA 4JBAA 3BY6A 4L5IA 4BQAA 2E1NA 4RAYA 5CVRA 1RIOH 2XUBA 1BC8C 1IRFA 3IL2A 3H3UA 3JW4A 1U8RA 1HW1A 3FXRA 3WGHA 4G8XA 1BIBA 1R36A 3F8MA 4G6QA 3M8FA 4RS8A 4L0YB 4P5OA 2EFQA 1ZRDA 1WSUA 1QZZA 2YR2A 3GEZA 1BJAA 2H6BA 2OA4A 1D8JA 2XAQA 3T8TA 2KWAA 4M9XA 2F5FA 3WTWC 4G7OF 4U0WA 3S2WA 4ESJA 5D6EA 2VE8A 2XRNA 2P7CB 1KU2A 3LAJA 3ZN1A 1FX7A 1OYIA 2IJLA 5CVJA 4R79A 4B8XA 3CDHA 5D4RA 1K6OA 3DKWA 5CYVA 4EGYA 2CQKA 2UXNA 1MJAA 4NQWA 3WU1B 4ZH4F 2XGXA 1LEBA 5D5WB 2GZWA 1JXSA 1O3SA 1IN7A 4LLNA 3N97A 3E6MA 3WG9A 2MLKA 3WTXC 5HS9A 2D1HA 3QP5A 1XGOA 1SFXA 3BJAA 4IRHA 2ZFZA 1Q1HA 2QBYA 3DPLC 3RIRA 3EQLF 1PUEE 3DF8A 3C1DA 1FYKA 4PCQA 1XSVA 3HTUA 4YIFA 5BMZA 4AIJA 1YYVA 4OIOF 1CF7B 2ZNYA 2PJPA 2VE9A 2QYOA 2BYVE 2KKOA 3TO7A 3PQJA 4P9UA 3SZTA 2W25A 2O8XA 4CICA 3RJPA 4ETSA 1U6GA 5L3DA 3ZQ7A 2WWYA 2P5KA 2XAHA 4E70A 1JHFA 2GA1A 2WTEA 3DFGA 5D5UB 3WTSC 3F8FA 2P6TA 3LQRA 2A07F 3TKYA 5DD4A 3M1EA 2OAZA 1MDMB 2A6HF 4RGSA 1K78A 3TDUC 4L9TA 1OR7A 3OOPA 4MEYF 2ZFWA 2V1XA 4AWXB 3HOSA 2HEOA 4A5NA 2FXAA 1G3SA 4UVBA 1IW7F 2HFHA 4LK1F 4HF2A 4S04A 4RB2C 2DK5A 4MNUA 1H9TA 2GQQA 2OQGA 3VB2A 2HQNA 3EYIA 1YW8A 1USSA 5HOOA 1TW2A 1ISEA 1XSXA 2XCRB 5CVUA 1ZREA 1ZARA 3REOA 3AAFA 4I2OA 3BWGA 4KUMA 2RKHA 2STTA 1SFUA 1S29A 1J59A 2NYXA 3IKVA 3MZYA 4XBFA 3LA7A 4YIIA 1PP8F 4WXHA 3DQVC 5FFXA 4LG0B 2DU9A 2LNBA 1BOAA 1XCBA 4FM9A 1OPCA 5F64A 3P9CA 5LBQA 2XAFA 3DEUA 4N9HA 1RUOA 1P4AA 1KQ0A 1R1TA 1BGWA 1OYWA 4RGRA 3M9AA 1XCVA 2KIMA 3BP8A 4DNCA 3NRVA 1EH6A 4HZFA 1GXQA 5BOXA 3K1MA 1KYZA 1G3TA 2EA2A 3HHHA 4YFKF 4WXDA 2FBKA 2QENA 2MD5A 3GUDA 1MKMA 3IWZA 4EJUA 3KP5A 5ILSA 3FM3A 5E8GA 3QPHA 4CYDA 3O3KA 1HQCA 4IXAA 3M7GA 3VODA 2PMHA 1XMAA 4EQQA 1SD6A 3BUEA 4YFNF 1FY7A 3WE3A 4H0EA 1TBXA 1YW7A 3ECHA 3L9FA 3WTVC 2P6SA 2M1BA 4UV9A 3E6BA 3F3XA 2JSCA 4I0BA 3F8BA 3D0SA 2A3SA 1AOYA 4U7BA 3FHZA 2HQRA 2EJRA 3SFZA 1O7FA 4M74A 3T1BA 1YTYA 1FP1D 4XSXF 5A2QZ 3FOFA 1FP2A 5DV5A 2LDUA 4HLYA 5LLQA 5HDNA 1W7PB 1G4DA 3GX4X 3CJNA 4ENMA 3RPQA 4HBLA 1YQAA 2W57A 3F72A 4WK8F 5K1YA 1O3RA 1RI7A 2H94A 2Z5UA 3J7AO 2FE3A 2RQPA 3C7JA 4LLLA 1KU9A 2H27A 1B4AA 2Q8KA 1Z7UA 3LA3A 5ILUA 1ZAOA 3KZYA 1FZPB 2VN2A 2IA0A 1PDNC 2OQRA 2VBWA 3FWEA 3LWFA 1R5HA 4ZYGA 4EM0B 2ZKZA 4UHTA 3WTZA 2PI0A 3VEPA 3ZMVA 1B6AA 3BZ6A 4MEXF 3GF2A 2RN7A 1IN4A 2ZCWA 3HSEA 1B1BA 1TLHB 1B9NA 1MDMA 2ETHA 5TRDA 4HYEA 1ZLJA 5LHGA 2AS5F 3TO9A 3U9GA 2HR3A 4RAZA 2HTJA 3QRFF 3I59B 4R8HA 2XROA 4GCVA 1W5TA 2O3FA 3KEQA 4OINF 4HV5A 2X4HA 1D8KA 2LF7A 3GFIA 2ADUA 2Z33A 1REPC 4IRGA 3RTRA 1P92A 2HYGD 3E6DA 3KCCA 2NS0A 5ICCA 4CXFA 5D8LB 5L3EA 6PAXA 3V8KA 2C6YA 2Z9OA 1LDJA 3P7NA 1EV7A 1K7AA 2QQBA 4ZYEA 4N0BA 4UVAA 1WIHA 4WXCA 4U7DA 1C0WA 1DPRA 5FO5A 5LRSA 5DDGA 3HRTA 4PGHA 4RB0A 5ICGA 4RB1A 3KZZA 3HSFA 1EH1A 1R00A 1UFMA 3I53A 1RZ4A 5E8IA 1FSHA 4G7ZF 5IT9Z 3H3ZA 3HYIA 4HAMA 5E1WA 1SMYF 4CZZA 3DP7A 1E2XA 1FSEA 2F5DA 4L0ZB 5F6FA 2IA2A 2X0LA 3ROUA 2E7XA 1XXAA 3MMLB 5DUKA 4P55A 4HQMA 3R6SA 4A12A 1ZH5A 4LD5A 3BPVA 1V3FA 1Z6RA 4KYWA 2VXZA 2JZYA 2HGCA 4XLNF 3GYHX 4I01A 5CVVA 1V4RA 2MA3A 3JTGA 4M71A 4B09A 2FMLA 2O03A 5ICFA 3NEUA 2QLZA 3WODF 2LSOA 3ZN0A 3QPTA 1F1ZA 3T0YA 1QNTA 1YFHA 3JAMK 4RGXA 3EETA 3K0LA 4FX0A 3WTYC 3GVAA 3EUHA 4KN4X 1FYLA 1STZA 5IT3A 3KEOA 2ZNZA 3VA7A 2V1DA 4M9SA 5BPIA 1WKMA 2FBIA 4G6DA 3L7WA 2A69F 3U1DA 4ASNA 4P9FA 5E17F 2VODA 1KGSA 1ONVA 4XRFA 5E18F 2CYYA 3GZ5A 4KFCA 2Y3PA 5E20A 4M9ZA 2GXGA 4YG2F 2PLYA 2XKOA 4KIBA 1D3YA 4ZZLA 5JI6A 1XDSA 1IN8A 1W7PA 5JVTA 4CDGA 2QQ9A 4Y13A 4LMYA 5HLHA 2A6EF 2RV8A 5BQTA 2WV0A 2XCOA 2DBBA 5CLSA 5ERIA 3HRSA 3QU6A 1WQHA 1Z05A 1Z1DA 3GW2A 1G6NA 3B02A 1I1GA 4M72A 5FB2A 2BGCA 2ZXJA 5E1ZB 1J5YA 1MJBA 2ZO4A 1DUXC 3V7SA 2CWEA 3ZP5A 2FRHA 3BJOA 1QGPA 3ML6A 5L3BA 2B0LA 2L01A 4KAWX 1XXBA 4GGGA 3E3VA 1IF1A 2QZ8A 4FX4A 2P8TA 2PQ8A 1IN5A 2DTRA 1ZG5A 1QPMA 3L2CA 4HQEA 2PG4A 2RNJA 4J3NA 4EJVA 4MQVA 1JE8A 2J5OA 1IAWA 1FBUA 4DQ2A 1L0OC 3L4KA 2MH9A 3I59A 3FZVA 5H20A 3BOQA 3WU0A 3VOEA 2FF4A 3HOTA 2EA4A 4F7ZA 4K2EA 2YU3A 3E5QA 3O6BB 3IHUA 4KT5C 1R22A 3JAMZ 1F4KA 1W4MA 3PFIA 1KYWA 3W6JB 2NRAC 3FOEA 3QP6A 3CO7C 3GWZA 1U5TC 2PEXA 2L4MA 1GE9A 4EM2A 4GYGA 4O3MA 1O7LA 2F2EA 4KB4A 3I64A 4KMFA 3ZMTA 3JSOA 2DLLA 3CUQC 1T0FA 2MC3A 4IPAA 2G7HA 2IT0A 5JVOA 3E5XA 1ON1A 3ISPA 3ZMDA 1O3TA 4QLCU 3JSPA 1F5TA 1MZBA 2PHCB 5LGNA 1ZGJA 2FOKA 1Z9CA 4OMYA 1FBQA 2CGPA 3HSRA 2CG4A 4KN7X 4A6DA 4IRIA 2DO7A 1LDKB 3Q9SA 3MCZA 3V8LA 2W85A 3DPTA 2NNNA 1LNWA 4TV7A 1J0RA 5A2QK 2EFWA 4Y15A 2ZMEB 5KVRA 3OV8A 3GXOA 4IVNA 4G94A 1O57A 3KE2A 5TJJA 1XGSA 2Z3YA 2OBPA 1BIAA 3LA2A 3ZMUA 1ZG3A 3R0JA 4XSZF 5DUIA 3L4JA 3IRRA 5J8CA 2NNYA 1KQ8A 3L00A 2BE5F 2XVCA 5EEGA 2GAUA 3W6KB 3F22A 4BAYA 5HVQC 2M30A 3TGNA
chains in the Genus database with same CATH superfamily
2Q2EA 1SFEA 2GIZA 1VQ7I 3FM5A 1WJCA 3TBIA 1J2XA 3IAS2 4IQ4A 4D5FA 3K4BA 4Y17A 4XSXA 1V5FA 2COBA 3BR2A 5F1RA 4HF0A 2AHQA 3Q0WA 4MQ9A 2I10A 2VXDA 3P9IA 1NK3P 2F5EA 1ZYRF 2A5YB 1I50K 2QEXI 3GFLA 5GADJ 4KATA 2E60A 4PFOA 3GFJA 4L9VA 4E7LA 4HA8A 2K9LA 4Q5SF 2KL4A 2VBZA 2YU9J 1R5GA 1J98A 3MKWB 1GXPA 4B4CA 2WAQD 4GTDA 2KIFA 3M8EA 4HLXA 4HOBA 4IF4A 2RH6A 2K86A 1I50C 4A3CC 1P6RA 3NWSA 5FFZA 2LMDA 1TP4A 1MBFA 4NOIA 2HYJA 3QX3A 3I5UA 5M5WJ 1AKHA 2DA1A 3S14J 1FEXA 1TNTA 2K5CA 1QU3A 1TWAA 3H35A 4XORA 4U0YA 3PIOF 3L2UA 2JPCA 1JVIA 1WCMK 3H5AA 3BZCA 2W24A 5K7HA 5DM6F 1BC7C 1WJ5A 4JYKA 3LSHA 2FUG2 3FBIB 3RKWA 3HOZK 3PFYA 1R23A 3PNTA 4HV6A 4H4KC 4XLPF 1BM9A 3JREA 4C45A 2DYSH 3S8PA 5HLGA 3FKJA 1VLOA 2CMPA 1WCMC 3S1MJ 2V9VA 4BQOA 2KQRA 4XNFA 1OQYA 1J75A 3G1LA 5DEQA 3MAJA 3HOZC 4KMUA 1T33A 5CQGA 5ILVA 2BHYA 4HNVA 3OYLA 4XICA 3CCYA 4M6XA 5BS6A 3QPLA 3OMYA 3S14C 4C2MJ 3JSTA 4LR2A 1W5SA 2BZTA 2ZJPF 1IXSB 3EUAA 3MZHA 3GEEA 3CLOA 1U0JA 3GO5A 1FMVA 1TQIA 2R7DA 2P7VB 1VZ0A 1Z77A 3ELKA 4CYCB 1P4XA 4HF1A 3FXOA 3VWBA 1W0TA 3A0BC 1DDNA 3HOUJ 2JA5A 3F6OA 2JA6A 3LSKA 4M3EA 3KP2A 4M1XA 4UNOA 3CQZJ 1IXRC 4G6TB 2BV6A 1QO0D 3CUOA 1WI3A 2R7RA 1ODDA 5FGMA 3K4NA 2GAHC 4OINA 2UZKA 1J6XA 1J7KA 2E1CA 5D4DA 1FLIA 4MQ9F 1KQ9A 3OL4A 2LKPA 3FXQA 2HQAA 4GO1A 4A3KJ 1QBJA 1IC8A 1Y1WK 3HOUK 2HU9A 4C2MC 4BJ6C 1O4XA 4PAAA 2EQRA 1EFWA 1O2BA 4XLEA 2HKOA 1T39A 4OOIA 4QWQA 1D1AA 5IT9K 2EFNA 3ASNH 1IO2A 3CCJI 3B73A 3HOUC 1XSDA 3R4KA 1Y1WC 3MFKA 2KDOA 2XGEA 1T98A 2EWNA 3TQNA 2DMUA 4ZZDA 4UV8A 3M07A 4OIRA 3KP3A 1TW3A 3RZDJ 1DP7P 1ZK8A 3CJRB 2FQ3A 2I8DA 2L7KA 1ULYA 1BJTA 3SHFA 5TMCA 3BCAA 1I3QK 4UUVA 4O2DA 5CKTA 4PJJA 2R7ZA 1MJ9A 2GA2A 3D5RC 2CQNA 4EGZA 2MH2A 1N25A 3K4MA 4BY7J 1FYMA 3CCMI 5J8FA 4QIWL 1RNLA 4XKBA 1Z91A 1IS1A 1ZLKA 1KA8A 3WTUC 4NDLA 5HDKA 2F4IA 1I3QC 1LB2A 1RKWA 2DW4A 2GWRA 2HOAA 3HXLA 1LVAA 2XGDA 4UXNA 1UG2A 4QSHA 2F5CA 5B3SH 2E2JJ 2L0KA 2E2HA 2B63A 1RR7A 3S0XA 5JHUA 2XGCA 4I0AA 1D1CA 4WWCA 4C2UA 4GTLA 1K79A 2V1UA 4EV0A 5CHPA 5IYBJ 2JRTA 2YUSA 4KIFA 3RSNA 1RESA 2D6FC 1I5ZA 1F36A 5IYDK 3OREA 4CO8A 3RZDC 2ID3A 2WC2A 1RKTA 2X51A 4RMFA 2MLGA 1CGPA 3K1NA 4F91B 4BBSK 3K9TA 2W48A 1ZR2A 4G7ZA 4U87A 4KDPA 3BPXA 3OS0A 9ANTA 2K4JA 2MBFA 3LSRA 4NC6A 1SMYA 2M87A 5KNLA 5J1RA 2DA3A 4BBSC 3DWLE 3L09A 2KRFA 1R1VA 4PDKA 1WRJA 1ZELA 2EFOA 1MMAA 1XDUA 1I39A 2FA5A 3ASOH 3A2KA 4X6AK 2DTZA 2EK5A 3I9V2 2KJBA 2EV6A 5H6QA 3K69A 1TWGA 1KZHA 5HS8A 5HNFA 4ENNA 1ZQ1C 1MGTA 1SD5A 3G1MA 2MW8A 2O6GE 5CVIA 4M6VA 3S17J 2L3DA 3DEWA 4F92B 3OYDA 1FWZA 3C2BA 2PX9A 4YFXF 1GLNA 2PMZA 3OYCA 3F9KA 1ZGAA 1V5VA 1VQMI 4LIUA 2ZMEA 3CUQA 2J5PA 1O3QA 5C4XK 1FT9A 2O0YA 4HX4A 4MLOA 4MTEA 4ESBA 2VOPA 4OIRF 3WODA 2X6OA 2ESHA 3GTJJ 2V9KA 4AH6A 5L46A 5C4XC 1DPUA 4KIGA 4LLGA 4DYRA 1VJEA 3F21A 1D5VA 1OFCX 4KNYA 1ON2A 4WILA 4XR6A 4ANJA 2R7FA 4BH9A 1XN7A 1Q1VA 2EIMH 1E3PA 1D0ZA 1X1PA 3Q0VA 2CV1A 1YIOA 3S17C 4BDZA 3HOXK 2ZJ2A 1U3EM 2RREA 1RU0A 4G0UA 4XOPA 2A69A 3HKZL 1SFOK 3A8JA 4A3LK 5FROA 4LK0F 1E17A 1EJ9A 3HOXC 3ERED 3IAM2 3UR3C 1FPQA 2KFDA 5J6XA 2KJCA 4PFPA 3GTJC 4P9SA 3JTHA 1A6IA 1A35A 1XXCA 5B5EC 1HSJA 5BPDA 1SFOC 2R3SA 1WOOA 3SZPA 1GT0C 2BXYA 2LLKA 2NVYK 4QJVA 2BOLA 4WF2A 3TO6A 4IHWA 1SD4A 3AG3H 3KIOA 1K83K 3S16K 3G6EI 4YG2A 2R7SA 4BE1A 2V6UA 4DDQA 4I6ZA 2QSGX 2R92K 3ABUA 1TT5B 1JOEA 2FNAA 4DZJA 5J1YA 1K83C 3GTOA 1HSTA 3S16C 3C3WA 4YRVA 2ELHA 2R92C 1DD5A 3Q0UA 5LFAA 1ETQA 3FDYA 2A61A 2JMWA 4HDUA 5IP7J 5HODA 3TOAA 1JQWA 1WJDA 3PUBA 3A8IA 4A0XA 3I58A 2ZXIA 4A0ZA 1T2KA 3H36A 4R1HA 4UB6C 2DODA 2KZGA 2YX7A 3ZQCA 1R9TK 2MD0A 2RC4A 4BHCA 5L3CA 2NVQJ 3GZNB 1EK8A 1EF4A 5E3MA 5K5OA 2CS3A 2XSJC 2QKMB 5AONA 2QWWA 1O29A 3HHGA 4EJTA 4D5CA 2G7UA 2YSRA 2BVLA 1R9TC 3GTLK 3JCUC 4Q48A 1WOSA 2R7WA 2XRLA 4O6JA 5FKOA 2E2IA 1DCOA 1ZVUA 3DBRB 1GUUA 2HS5A 2HXIA 1BR2A 3H0DA 2Y69H 2CW0F 1U9OA 2R7OA 3ONQA 4LLGF 1A5JA 3BP8C 1S9HA 1EH7A 2Y9ZA 5D8KB 1QZEA 1USTA 2KRCA 3I54A 3GTLC 5IP7C 2M7BA 2YPRA 2BHZA 2JSPA 4C3JJ 1WQGA 1MSFC 1MBEA 3DTKA 3D1NI 3GTMK 2OD5A 1UB9A 3RDIA 4E7KA 2GBYA 2NAZA 5IP9J 3LQQA 4XKVA 2LH9A 3BROA 3DV8A 4XN3A 2O5RA 4XL9A 1HA8A 4KDDA 1X4PA 2VB6A 1XZPB 4GXOA 1W0UA 3T01A 5LRRA 3RZOK 4CYCA 3CDLA 2R7VA 1VQPI 4A3EK 1W1WE 3GTMC 2R5YB 1I6XA 1WI9A 5EEHA 2HVRA 2ME0A 4BE0A 1HXDA 1F7UA 2X6WA 2K27A 3BR6A 3IC7A 1P4WA 4QPOA 4FT8A 3TDZC 4I98B 4P96A 2CU7A 3KP6A 2XHKA 2AXTC 2CRGA 2WB1L 3JRAA 2MABA 5IOZA 3RZOC 4L9NA 1OCRH 4A3EC 2DMNA 2LBFB 2IW5A 2V6TA 2HZDA 4C3JC 1QZYA 3QOPA 2YU9A 5EG0A 1T8IA 5K5QA 2GXBA 1ZQ3P 4A0YA 2VT3A 4LQYA 4HPQA 4ZDLA 2VC1A 2VT2A 3CCEI 2PFBA 4OMZA 4BEHB 3BZKA 2EV5A 3FMSA 3GZ6A 3CCLI 2K02A 2VOOA 3H0GJ 2CFXA 4GZYA 3SFIA 3ZQIA 2LD5A 1FMWA 4LGWA 3LSIA 1YITI 3ULQB 1O28A 2QVOA 4XN0A 3R61A 1H0MA 2H1KA 4A5MA 1J9IA 2R7ZJ 3CP8A 3RKYA 1FBSA 3PSIA 2FJ1A 4Z2YA 2K7LA 2Z99A 3A4CA 4OU0A 3VDXA 3CO6C 1TNSA 3BR1A 2W84A 4U0VA 4DBQA 2IPQX 3ZMZA 3IKTA 3PO2K 3HRMA 2VKHA 4IJAA 2IA1A 3RI4A 4E4HA 1LFBA 2E2HJ 3GTPJ 1R58A 2PBIA 4N4OB 3G2BA 1DCPA 1UHWA 4ITVA 4FHTA 3E1SA 4QTRA 2HOEA 3PO2C 2OU2A 4M3BA 1QA6A 3H0GC 3V7CA 2PMUA 1RRJA 1X1BA 1BI0A 1T08B 1JTXA 2DK8A 4KJZA 3S1NJ 5CJ9A 1R7JA 2XV4S 3LSTA 2WA0A 2M5WA 4V2GA 2JUCA 1K6YA 3GTGJ 1U8BA 2K9NA 3IWFA 3HTSB 3PNVA 4YEJA 3BTIA 3OS2A 4NHJA 2LRDA 3RYRA 2VBXA 1E0EA 3GTPC 1JJ6C 1OLTA 2L4AA 4IOAF 3CQZA 1LDDA 3JR9A 4L9JA 2E71A 3I4NJ 1IUYA 3I0TA 3MEXA 2DOAA 2JPBA 4PK4A 1L3LA 2K85A 4P5BA 3GTQK 1BBYA 4II3A 4CCMA 3E6CC 1VI0A 4CUGA 1VNDA 3F6VA 3WE2A 3V7RA 4DIQA 2HDWA 2BXZA 5CQEA 2V79A 3S1RK 4Q4ZF 1YS7A 4KMUX 3SXYA 4C3IK 3H9GA 2FNPA 3BG6A 5L3GA 3GTQC 1SMTA 1FIAA 1ZHFA 2DQRA 3ABTA 4KA4A 5LEKA 5JR3A 2CQ7A 1VRQC 4C3HJ 2A68F 3K7AJ 4ZYAA 4BBRJ 4A3DK 5L3FA 3CC2I 1Y0UA 4L5JA 1IRXA 1D0YA 3LSMA 4XSZA 2VJ4A 3KZIC 1ZN2A 1Z67A 3KYCB 2LG4A 3HUGA 4ABZA 5K7ZA 2R93K 3KEYA 4CCKA 1HBXG 1JKRC 4A2UA 3K10A 2UXXA 1TTYA 4A3DC 1TWCJ 2OZ6A 1BN5A 1KU3A 1Y1VK 2BE5A 3GFMA 3HKZA 4Y52J 1OISA 5FLMK 2RGVA 2R93C 1GVDA 1MNDA 2HNHA 1JGSA 5E79C 4I09A 4BY1J 2DMTA 4RM2A 1J6VA 1S6LA 1FOKA 2LC2A 3S1QJ 3AH5A 4M3FA 1Y1VC 3WGIA 4XLCA 3WTTC 3I4MK 4S0HB 1UV7A 5FLMC 3BJ6A 4C3HC 2QM3A 2NVTK 5TGTA 4RLFA 1WGXA 4OIQF 3KLNA 3TFHA 1XG1A 3BC8A 4XIDA 4Y52K 2L7ZA 1TWFJ 3LL7A 3G1OA 4MHGA 2HDDA 3DXJA 5F0HA 3OPFA 2NVTC 4M73A 1ZR4A 3FBNB 2V9PA 3KP4A 1ZRFA 1ETVA 1YG2A 3LFKA 3J80K 1MSEC 2R7UA 4Y52C 3DU5A 3QU3A 1GHCA 2EB7A 2H8RA 4E7HA 4BY1C 3KETA 5M5XK 4F52A 1B59A 5D5XB 2XCQA 3AD9C 2CUZA 5LEJA 2FOWA 3AQOA 4O5VA 3HIFA 2RGRA 1G3YA 2WY8Q 2XASA 1U5TB 3PQKA 4U88A 1RUNA 1WVRA 1HDDC 4A93J 2GSUA 3EYYA 2LREA 2L54A 2F4OB 5DCMB 5HDGA 4CCJA 5GP9A 5GAGJ 1EH8A 1IZ1A 2E19A 5H2FC 5DCFA 1JUPA 4G0WA 2DA6A 3CUQB 2VASA 4LFUA 5M3FJ 1YX5A 3K1PA 3K4JA 3T8RA 1F9NA 3H92A 4XLPA 2DQLA 2FD5A 2Y48A 4KN4A 2DPDA 3RPUD 3K4KA 2VC0A 1WZ2A 3F8CA 1JUSA 1HW2A 1A6QA 1S3JA 4ILDA 3Q9VA 2H1LA 2ZUEA 1YNNA 1NTCA 2IS1A 1T6SA 2PN6A 3J81K 3BP3A 4A93C 2CO5A 4M6YA 5ED4A 4Y33A 3GTJA 2E35A 3HC7A 1ZRCA 4BQQA 3S2DK 1YX2A 2M8EA 2HWVA 2EFPA 4FISA 2XIGA 2P5MA 2WAQN 3MKLA 3OYMA 4HX7A 2HDCA 5JFRA 2JA7K 1JKQC 4RA2A 4GFQA 3O2PE 2CJJA 4NB5A 2GOMA 3ABMH 2VONA 3S2DC 1I50J 4A3CJ 1I27A 1WQ2A 2OZUA 2RVCA 2QQAA 4LOCA 2WB1A 4QJVB 1FOXA 3ECOA 2JA7C 1K83A 5GPAA 4RB3C 3CMEI 2JJ7A 2ACJA 1YHQI 4BLBA 2LY9A 2R92A 1YS6A 2LYCA 3V8JA 4BYYA 3E97A 3DXJF 2RDPA 3A0HC 3FX3A 4D0PA 3JRIA 5FLXK 4WX9A 1L0WA 4F3QA 4M3DA 1MMNA 3AFHA 4HDVA 3QOEA 1XZPA 4RGUA 2FMYA 2DFHA 5LHIA 2XAJA 1QHHD 4HNTA 2R5YA 4EATA 4PZJA 1WCMJ 2ZC2A 2K4BA 1PYVA 1C0AA 1FNNA 3FF5A 4DW6A 4Y3OA 3HOZJ 3TFIA 4L18B 3B6CA 3FXUA 2HZTA 3MKZA 1LE8A 1PJ5A 2ZUFA 2CSOA 3SEQA 1VQLI 2L2OA 4CHUA 3NAUA 2DMQA 2ESNA 4KB2A 1U9NA 2LBFA 4A6EA 5AIQA 3A8KA 1P9QC 5EF6A 3GBGA 3WGGA 1UHMA 4LJZF 1VTNC 1YOVB 3AG4H 2P5VA 1I3AA 4C2TA 5EDNA 2V6CA 1BOBA 4JQFA 4BEHA 5FD6A 1Y8RB 2DOFA 2FQ4A 3NQOA 5GAHJ 1VQOI 1XGMA 2CV0A 1GVJA 4OAYA 2PA8D 1OKRA 3GTKK 1H89C 5AIPA 3ABLH 3RCOA 5HLIA 5J47A 5LGUA 3FKIK 2B7EA 1NHAA 2X6YA 3SYTA 4J00A 5TISC 4G0VA 3GTKC 3OSGA 1HC8A 2HPIA 2XKPA 4BNCA 3FMRA 4GYIA 3S3MA 2DFFA 2M9HA 5E3OA 3OS1A 2D1VA 3I4PA 3PNYA 3J80Z 5FJ8K 1MBHA 3BT9A 3SEZA 2DA4A 3L2VA 2STWA 2VBYA 2HKXA 1YJNI 1FC3A 4HNUA 4KM8A 1IN6A 1Y1WJ 2KRHA 1AB4A 4EM1A 1ETOA 5HS7A 4EJOA 5EGHA 4AYBD 4XMYA 4L5EA 1YO5C 3AG1H 3HOWK 4AD9A 2DI3A 2FSWA 2IXSA 2XAGA 1R71A 4A3BK 3LSPA 4Q47A 2TDXA 4LG3A 1XMKA 4XM3A 1BR4A 3DEEA 4D9JA 2HYFA 5EG0B 3P9KA 4QPQA 2IVMA 1OMIA 3HJEA 3HOWC 5EJCA 4UB8C 4BHBA 3J7YJ 3CLQA 4A3JK 2VUMK 3RPUA 1Y8QB 1JGGA 2FEZA 1QVUA 1JHHA 1S7AA 2DT5A 1I3QJ 2JN6A 4FASD 2W4SA 5D4SA 3BG5A 2TCTA 2ZBKA 4YFXA 4XONA 2EV0A 2IGMA 3CTAA 3A01A 1LEAA 3U2RA 1NG7A 2Y0SN 1SEUA 1MD0A 1NK2P 4ON0A 2WADA 1R6RA 3J81Z 3HOVK 3T5XA 5D6FA 2D2WA 3NUHA 1VFCA 3H0GA 3COAC 3IH4A 3VSKA 2M4KA 3FMQA 3RKXA 5EEAA 4KASA 1ZXOA 2JTVA 3G73A 2LR8A 2DFIA 3LAPA 4BHPA 1BS2A 3BLYA 3SDGA 1VQKI 3HOVC 2OPTA 5IYDJ 4HSTA 4EEFG 3AL0C 3H9JA 4ENKA 4S05A 2VPLA 4BJ5C 4BBSJ 2R7QA 4RAGA 4PGGA 2B9SA 1SVLA 3HG9A 1HW5A 2FBHA 3C2GA 2HVSA 1CF7A 1DGRM 5LHHA 2A05A 1SC7A 3R60A 4ZYDA 5B1AH 1YW9A 1UAAA 1OCTC 3GTPA 3D5LA 4NQWB 3G3ZA 4BXUA 2V26A 1PP7U 2WBMA 3ZRGA 4UVCA 2OTJI 1HKTA 4JK1X 3CCRI 4LK0A 2L9NA 2H09A 2D45A 1G59A 5E68A 4A3GK 3GLXA 2E7WA 2IS4A 2Y0SD 2UWMA 1MNEA 5F0CA 5D5VB 5FLXZ 2WAQA 4I76A 3V4GA 4EVIA 5EGOA 3OYKA 2Z16A 3A02A 3QODA 2AXLA 4A3GC 1XD7A 2K40A 2Y75A 2CW7A 3GTGA 3N4MA 1H9GA 5IYDC 1S8NA 1EA3A 1PJRA 1MNMC 2BY2A 2IGOA 1B4BA 1DQUA 1LKXA 2R5ZB 3LPXA 3CJQB 3SQNA 3CP2A 5IYCK 2VQGA 2M45A 2QBYB 2HPMA 1KU7A 1HKQA 4EMSA 5C4JJ 5C4XJ 2VKVA 2ISZA 3L2RA 2O61A 1AWCA 3DPUA 5IYCC 2JA8K 3TOBA 2V6EA 1TQPA 3DBHB 1WSVA 2COMA 2R93A 1U5TA 1SVOA 2CQXA 4AIKA 3HUGB 4FE4A 2VQLA 2P4WA 1U2WA 1YLFA 5KK1A 3WHBA 3I55I 2L02A 1GV2A 2IS6A 1R5ID 5DCMA 3OYEA 2JA8C 4RLQA 2Q0OA 5C4JK 1G3WA 5K5RA 2HTSA 2LF8A 4V2FA 3TW6A 3AD8C 1TWHK 3F8NA 1OR7C 3HOXJ 4I7HA 1FTZA 3IV5A 2KIUA 4XKWA 2QCOA 1X3UA 4ENJA 5LGTA 1T38A 2QF7A 3IRQA 3ZXSA 1SFOJ 1OYYA 2LFBA 1BL0A 4A3LJ 5C4JC 4N9IA 2CW0A 1Y39A 2LK2A 5DYMA 1HKSA 4AIHA 1TWCA 1XGNA 3KLOA 5ICEA 3MQ0A 1IXCA 1TWHC 3MWMA 1B9MA 5FD5A 1D5YA 1VQNI 4ZDOA 3FISA 2ID6A 5E3NA 1N77A 3OYFA 4KICA 3I71A 4AVPA 3HRUA 4IHYA 1ZG1A 3DLAA 2JVHA 3ZMSA 2H6CA 1TQMA 3VFZA 1X3ZB 2NVYJ 5C3EK 3E5UA 3C18A 3CCSI 4OIPF 2VJIA 1K83J 1P7JA 3Q5FA 2O7OA 3S16J 3WG7H 3ERMA 2DT7B 1ETYA 5GTIC 2JT1A 1INNA 2R92J 4ESFA 1W7PD 4JX6A 5DD8A 5C3EC 1S72I 4BS9A 1I1SA 4FQGA 1TWFA 2Z1DA 4LB5A 3KPHA 1UELB 2FU4A 1K78B 4A3LC 1LJ9A 2Y30A 1IRGA 3MMYB 3F23A 2DDBA 4YELA 3BG7A 5DS9A 4MTDA 2DPUA 3L2QA 1WWXA 1X3WB 4G7HF 2MGQA 4FTHA 2BBYA 2ISYA 1V5GA 4B43A 2NVYC 1MH4A 4LG0A 2GOXB 1S7OA 2YX4A 3ZQLA 2BW3B 1R9TJ 3MZ8A 1IQ0A 1ETKA 1LPQA 3KFWX 5FKNA 1LQ1A 1N78A 4FETA 4LB6B 4BDYA 5M5YK 5FRMA 1VH2A 2CFOA 1IV6A 2HXOA 3BDDA 3K2ZA 1Z6TA 5E1XA 4HX8A 2BEOA 4EJWA 3MVPA 2Y0MA 3GTLJ 4I02A 4CGZA 2W82A 1ZGWA 4G7OA 1UCRA 2RNGA 4ZYHA 1E3OC 4IHVA 2V1NA 3KP7A 4IHTA 2IP2A 3J7AY 1DGWY 4W97A 1AA7A 1N75A 2W1OA 5J3LA 1BA5A 1U78A 2CUFA 5FLVA 4KC6A 3T02A 1QQIA 3ZQHA 1VQ4I 4RMNA 1BI2A 4G9YA 3ZPLA 3GTMJ 2K9SA 1IDYA 2YS9A 1BI3A 4WCGA 3OYNA 1K4SA 1BI1A 1MMGA 3BCBA 3H9QA 3A1YA 3JRGA 2GSNA 4A3IK 3OYJA 1R1UA 1A04A 3EDPA 3BR5A 3QAHA 1P2FA 3RZOJ 3RYPA 2G9WA 4A3EJ 4MGRA 2IRFG 4Y4RA 1K61A 2P5LC 1WQFA 4HW0A 1SAXA 3CAGA 3TFJA 3HOYK 3H3VD 3CCQI 3OEPA 5JLWA 1TWAK 4BXXK 3R0AA 1V54H 1YE9A 4XLAA 5H6RA 2GIVA 3S32A 3EUKL 1CQTA 4IHSA 2DAOA 4A3IC 1XB4A 1SD7A 2DJIA 1I50A 2QUFA 3QYEA 2V4JC 4JBAA 1TC3C 3BY6A 3HOYC 4L5IA 1NH3A 2EIKH 4BQAA 5J4VA 2E1NA 1TWAC 4BXXC 5EYRA 4RAYA 5CVRA 1RIOH 3M3YK 4WJ4A 2XUBA 3ABKH 3CDIA 1BC8C 1IRFA 4XLHA 3G4CA 3OYAA 3IL2A 3H3UA 3JW4A 1LE8B 1U8RA 1VQ6I 1HW1A 3FXRA 3LOCA 4Q4ZA 3WGHA 4XOTA 3M3YC 4G8XA 2LOOA 3HL2A 1BIBA 3FIWA 2KMUA 3EQLA 1WCMA 1YCLA 2IEKA 4J19A 4GT9A 1R36A 2A68A 3F8MA 4G6QA 3M8FA 4RS8A 4L0YB 2R7XA 4P5OA 2EFQA 1NG6A 3RQIA 2WV1A 4BUPA 1WSUA 1ZRDA 5C44K 1QZZA 3PO2J 2YR2A 2M0CA 2XC7A 1X1CA 3GEZA 1BJAA 3DCFA 2H6BA 2OA4A 2JA5K 3DTIA 2JA6K 3CMMA 1D8JA 2XAQA 3T8TA 2KWAA 4M9XA 1DP3A 2F5FA 4W1UA 5C44C 5KCMA 3VPRA 3WTWC 2MFZA 1IJWC 4G7OF 3Q3QA 2JA5C 3K6GA 1TL8A 2XF7A 3ZQFA 5IP6A 3HZJA 4BGDA 4U0WA 3S2WA 4ESJA 3UNGC 2P0WA 1BR1A 5D6EA 4AM3A 3M1CA 2VE8A 2XRNA 3BTCA 2QSHX 1ORKA 2P7CB 4IL6C 1KU2A 3LAJA 2X9DA 3ZN1A 1FX7A 1W36C 1JUMA 4D7MA 4Y7NK 2GLOA 4F93B 4OIQA 1OYIA 2IJLA 2BY3A 3NWTA 3HBLA 5CVJA 3WHCA 4R79A 2KLOA 4B8XA 3CDHA 5D4RA 5M3MK 3IH2A 1K6OA 3DKWA 4BACA 5CYVA 4EGYA 2O9LA 2CQKA 1YNJA 2UXNA 1MJAA 2OV7A 4NQWA 4Y7NC 1T56A 3GTQJ 2Q1ZB 3WU1B 3PUFA 2XGXA 4ZH4F 1LEBA 1HDPA 1HF0A 5B1BH 3HGYA 2DT6A 1Y1WA 5D5WB 3CF5F 2GZWA 3S1RJ 1JXSA 4PJ0C 4C3IJ 1J6WA 1O3SA 1IN7A 2TRTA 1KQ4A 2E5NA 3JRDA 1VQ9I 3N97A 4LLNA 3E6MA 1LUJB 3WG9A 3VSLA 2KZVA 2MLKA 2LVSA 4ZJZA 3WTXC 3PJRA 4A3DJ 3BG9A 4NBQA 5HS9A 2B63K 3CCUI 5DM7F 3LNQA 3A01B 3CESA 2R5ZA 2D1HA 3E7LA 3QP5A 2R93J 4E7IA 1XGOA 1SFXA 3BJAA 4IRHA 2ZFZA 1Q1HA 4GTBA 2LKSA 5JHFA 1S7EA 2QBYA 2A6TA 3HM5A 3ZOBA 2B63C 3DPLC 1XS9A 1I3QA 1IUFA 1SVMA 1Y1VJ 3RIRA 3EQLF 4NC7A 2G0EA 2EBIA 5FLMJ 1PUEE 3T00A 2AO9A 3P5JA 3B6AA 3DF8A 3S1RC 3C1DA 4C3IC 1FYKA 4PCQA 1JI8A 3BG3A 1XSVA 3HTUA 2UV1A 2K9MA 4X1EA 4YIFA 5BMZA 2OCCH 2OF7A 4AIJA 1WJEA 1YYVA 3I4MJ 4OIOF 2NVTJ 3S3NA 1CF7B 4AIDA 2ZNYA 2PJPA 1XPXA 1T95A 2VE9A 2QYOA 1TZLA 2BYVE 3TEDA 2KKOA 2L9RA 2KIQA 3C2HA 3PQJA 3TO7A 2LKXA 4A3MK 4FCYA 1ZKGA 4DYQA 3FXKA 1TWGK 4P9UA 3SZTA 2W25A 2O8XA 4CICA 1IBAA 1X4OA 3RJPA 4ETSA 5EGOB 2DN0A 1U6GA 5L3DA 3ZQ7A 3UKGA 1SAUA 2WWYA 4A3MC 2P5KA 3S3OA 2OC6A 2XAHA 5EZHA 1TWGC 5M5XJ 4E70A 1JHFA 2GA1A 2WTEA 3OYBA 1X58A 3DFGA 3JRCA 1O2FB 4AVZA 1I6VA 5D5UB 3I4MC 3WTSC 1IL2A 3F8FA 2P6TA 1WHUA 3LQRA 4ZTFA 2A07F 3TKYA 4XCHA 2ZMEC 2LTPA 5DD4A 5F08A 2VKDA 2WAQL 3M1EA 2OAZA 1MDMB 2DMPA 3CJTB 2A6HF 4RGSA 2EZLA 1K78A 3TDUC 2AQFA 2VJ5A 3LMMA 4L9TA 2EIJH 4PJLA 3ZQGA 3X2QH 1OR7A 2MG4A 3OOPA 4MEYF 1JKOC 2ZFWA 1PUFB 1A31A 2V1XA 4AWXB 3HOSA 4X0GA 5KAFC 2HEOA 4A5NA 2CFAA 2FXAA 1G3SA 4UVBA 1IW7F 2E1MC 2HFHA 4LK1F 3AD7C 2JUGA 4HF2A 2ZXHA 2HOSA 4S04A 4LJZA 4IEJA 4RB2C 2DK5A 4MNUA 3H1CA 1H9TA 1J09A 2BW3A 1IG7A 3RKQA 2M0MA 3S2HK 2BY1A 2GQQA 3FHNA 4OWRB 1YIJI 2OQGA 3S2DJ 2PA8L 3VB2A 4D1QA 3PO3K 3BR0A 2HQNA 2JA7J 1ITYA 3OIOA 4IKFA 4LIVA 2XPWA 3S2HC 2H8WA 3DU6A 3EYIA 1X2NA 3DTEA 1YW8A 5B66C 3HXAA 3TTGA 1B72B 1I6HK 1USSA 4NUBA 3PO3C 4C30A 5HOOA 5CPRB 1TW2A 1ISEA 2R7TA 1BW5A 1XSXA 2XCRB 1SFOA 2PJRA 1FOYA 1F43A 5CVUA 1ZREA 3W2AA 3GTOK 1W36D 1ZARA 3SDBA 2K9QA 3REOA 3AAFA 3M4OK 1I6HC 5F1JA 4I2OA 3BWGA 2I5UA 4KMDA 2E1MB 4KUMA 2RKHA 4XLFA 2STTA 4AYBL 2W7VA 1SFUA 1S29A 2ZFUA 2NVYA 2ZSIB 1J59A 2NYXA 2DJNA 4V19K 2KP6A 3IKVA 5FKKA 3DKXA 4DOZA 3MZYA 1HOMA 4XBFA 3LA7A 2EPFA 2NVXK 4YIIA 1PP8F 5FKMA 3OYHA 4WXHA 3DQVC 5FFXA 2CUJA 4LG0B 4ZC3A 4KARA 3S15K 2XB5A 2DU9A 2RAEA 1ENHA 4CCNA 2IAIA 2LNBA 2VLAA 1B8IB 2E2IK 2NVXC 1BOAA 1XCBA 4FM9A 5GTHC 1OPCA 2K3FA 5F64A 4BKXA 5TJ3A 3P9CA 5LBQA 2XAFA 4PJMA 3S15C 4A3FK 1RC9A 2DYRH 3DEUA 4N9HA 1RUOA 2WY7Q 2E2IC 1P4AA 3GTKJ 4XQFA 1R9TA 1KQ0A 4JX4A 1R1TA 1BGWA 1QHGA 2V6SA 1OYWA 3LSGA 4RGRA 5GPCA 2BY0A 3M9AA 1PJ6A 1XCVA 3OYGA 3ZR8X 3FKIJ 3EUHC 4PABA 4A3FC 1PJ7A 3K4LA 2KIMA 3GEIA 1YX3A 3BP8A 4B3XA 2F4MB 4DNCA 1FIPA 1WPKA 3NRVA 3GTLA 4AC0A 1H8AC 1EH6A 4AYBN 4HZFA 1JKPC 2EILH 1GXQA 5BOXA 1R49A 2ZXWH 4KISA 2PMZN 5FJ8J 3K1MA 2EZIA 5J40A 1LFUP 1KYZA 2ZB9A 1G3TA 2EA2A 5IORA 3HHHA 4YFKF 2WAEA 4GTAA 5FRNA 2DXIA 5GAEJ 4WXDA 1V55H 2FBKA 2CV2A 2QENA 3GTMA 2X48A 2NOJB 2MD5A 2YU9K 2P81A 4PSXA 1M1EB 3HOWJ 3GUDA 1H88C 1YI2I 2Y0SL 1R4MB 4E7JA 1MKMA 2NVUB 3CCVI 4A3BJ 2KHMA 3IWZA 4EJUA 3FKIC 3KP5A 5ILSA 3FM3A 1K4TA 5E8GA 3QPHA 1MIJA 3O3KA 4CYDA 2YU9C 1HQCA 4IXAA 5M5WK 2ICWG 3S14K 5J1UA 3M7GA 3VODA 4A3JJ 2PMHA 1XMAA 4MFDA 4EQQA 2VUMJ 1SD6A 3BUEA 4MEXA 3SZGA 1FY7A 4YFNF 4E7ZA 2MSYA 3E0JB 3WE3A 4H0EA 1TBXA 2PMZD 2NXNB 1JT6A 1YW7A 1IDZA 3ECHA 2QSFX 3L9FA 3WTVC 3PIPF 2GM4A 1ETXA 4BQNA 1O2AA 3S1MK 3HOVJ 2P6SA 3N3YA 2M1BA 2GSOA 4UV9A 4A3BC 1UMQA 3E6BA 3F3XA 2JSCA 4I0BA 3F8BA 3D0SA 2A3SA 1AOYA 4U7BA 3FHZA 2HQRA 2EJRA 1MH3A 3S1MC 3SFZA 4BXFA 1O7FA 4M74A 3U1KA 3T1BA 1YTYA 4GDFA 4C2MK 2X85A 1FP1D 4A3JC 2VUMC 4XSXF 1AU7A 5A2QZ 4KMAA 3FOFA 1FP2A 5DV5A 4Z6YA 3CMYA 4UUTA 2L7MP 3CD6I 1Z7LA 2LDUA 2O5IA 3TP0A 4X6AJ 1E3HA 4HLYA 5LLQA 2JWTA 5HDNA 3CC7I 1W7PB 1Z3XA 2W7NA 1QPIA 1G4DA 3GX4X 2O8KA 1O26A 3CJNA 4ENMA 3RPQA 3IUOA 2V7FA 1YQAA 2MC4A 2XB0X 2W57A 4HBLA 4XRSG 3F72A 4WK8F 1BDFA 3N0BA 3KYLA 4A3GJ 3CQZK 2NS7A 5K1YA 3MN2A 2ZJRF 1O3RA 1RI7A 2H94A 2Z5UA 5DTDA 4B44A 3J7AO 1YJWI 1FJLA 2FE3A 2RQPA 3C7JA 4LLLA 3N0CA 4A3KK 3QYBA 1WJBA 2E34A 2QKLB 3CQZC 1KU9A 4OIPA 2H27A 2DA2A 4FE7A 3AQPA 5IOSA 4KN7A 1B4AA 1XTAA 2Q8KA 1Z7UA 3LA3A 5ILUA 2JQ7A 4X6AC 1ZAOA 4A3KC 4A69C 5IYCJ 3KZYA 1MMDA 3G4AA 1FZPB 1ACIA 4IOCF 4GTFA 5KAIC 1PVEA 2VN2A 4IO9F 3HPGA 2IA0A 1PDNC 4KT6A 2OQRA 2IGKA 2VBWA 3GTQA 1G51A 3FWEA 3RZDK 2N8GA 2FQOA 3LWFA 1R5HA 2JA8J 4ZYGA 4G7HA 4EM0B 2ZKZA 4UHTA 3WTZA 1A36A 3VEPA 3ZMVA 1B6AA 3BZ6A 4MEXF 1IGNA 2PI0A 2O5JA 2JH3A 3OOUA 3GF2A 2RN7A 1IN4A 2LP0A 2ZCWA 3HSEA 4P1WA 3JRBA 1IRZA 1B1BA 5HL8A 4BY7K 3AL0B 1TLHB 1B9NA 4LOWA 2A5WA 2D5VA 4KMHA 5HLTA 2DFEA 2GXAA 4XRMA 4BJTA 2E2JK 2EZKA 1MDMA 1TWHJ 2ETHA 2VI6A 2AQEA 4XKCA 2VL8A 4BY7C 5TRDA 3KX2A 4JOMA 3K70C 4HYEA 4HEA2 1ZLJA 2IS2A 4GFBA 5LHGA 2AS5F 2LY2A 2OCEA 3PM1A 1WJAA 3TO9A 3U9GA 2HR3A 2XSDC 4BL0B 1PUFA 5IYBK 4RAZA 2E36A 2HOTA 2HTJA 2E2JC 3SZYA 1WJFA 3QRFF 1T0FC 3I59B 4R8HA 2XROA 3ZCOA 2VJJA 1DU6A 4GCVA 1W5TA 1Y1VA 2O3FA 3W2VA 1UG0A 3KEQA 4OINF 4HV5A 2X4HA 5JVGF 5IYBC 4QIWN 1D8KA 2LF7A 5C3EJ 3GFIA 2ADUA 2Z33A 1REPC 4IRGA 4OAZA 1YJ9I 4XLNA 4AYBA 3RTRA 1P92A 2HYGD 3E6DA 4B3AA 3KCCA 2QQ8A 2NS0A 1UZCA 3H3VL 3GMEA 2M4GA 2NS8A 5ICCA 4CXFA 1B72A 5D8LB 5L3EA 2X1EA 3GDZA 2DCEA 6PAXA 3LFUA 1GV5A 3V8KA 1HCRA 2C6YA 2Z9OA 1DU0A 2CH0A 4XRSA 3S17K 1LDJA 4GRIA 1XZQB 3P7NA 1EV7A 1K7AA 1ERDA 3ZQQA 2QQBA 3W3CA 1OCCH 4ZYEA 4N0BA 3GCMA 1KONA 1P7IA 4UVAA 4WXCA 1WIHA 4QIWD 4U7DA 1C0WA 1DPRA 2M7AA 5FO5A 4II2A 5LRSA 5M5YJ 3V42A 5TMFA 3GTJK 5DDGA 3HRTA 1X19A 4PGHA 4RB0A 5ICGA 4RB1A 3JRFA 3AG2H 3KZZA 3QYFA 2ZJQF 2CFAB 2L9VA 3HSFA 3L2WA 4UUSB 1EH1A 1BW6A 3OR2C 1R00A 1UFMA 2L7FP 2Z2SB 3I53A 2JA2A 1RZ4A 2M8GX 1RPWA 3O8HA 4AU7A 3H5NA 5E8IA 2XF6A 1B8IA 1FSHA 5J4YA 4IX7A 2QA4I 4G7ZF 4FZBA 5IT9Z 3H3ZA 3HYIA 2E1OA 1Y0NA 4HAMA 1LFPA 4LITA 5E1WA 1SMYF 4CZZA 3DP7A 1E2XA 3G71I 5F04A 3FXLA 2NOGA 2VPRA 3TL4X 1FSEA 1YRNB 1EI6A 3SZZA 2EZHA 2F5DA 5LD2C 4MIMA 4L0ZB 4A3IJ 5F6FA 2IA2A 2X0LA 4NNJA 3ROUA 2E7XA 3S93A 1XXAA 2Y0SA 3MMLB 5DUKA 3K2AA 4P55A 4HQMA 3R6SA 4A12A 3H3VK 2PJRB 2A6EA 4DZPA 1ZH5A 3HOYJ 4LD5A 2JA7A 3BPVA 1TWAJ 1V3FA 4CCLA 1Z6RA 2OTLI 4BXXJ 3BQYA 2ME6A 4HRIA 4KYWA 2VQHA 2OUMA 2Y31A 1JTYA 1W5CC 2VXZA 2JZYA 2HGCA 4XLNF 3GYHX 1QRYA 4I01A 4B47A 2R4GA 5CVVA 3OL3A 1V4RA 4RM3A 3HKZN 1VQ5I 3M3YJ 4CZCA 4ZH4A 2HVQA 5BNGA 2NVXA 1ZTRA 2MA3A 1SANA 5EZGA 3JTGA 4M71A 4B09A 2IGNA 4J01A 2FMLA 2O03A 5ICFA 1XMXA 5KHDA 3W6VA 3BTLA 3NEUA 4IQJA 2QLZA 3WODF 2LSOA 4E7SA 5IP7K 3ZN0A 4IHXA 3QPTA 1F1ZA 3T0YA 1MBGA 1QNTA 1YFHA 3IP4B 4RGXA 3JAMK 1EQRA 3EETA 3K0LA 4JP0A 1IV8A 3QWLA 2Q2EB 4CA0A 4FX0A 1POGA 2L5QA 3F0CA 3GVAA 2ECCA 4RAFA 4YIRX 3WTYC 4KM9A 3EUHA 4KN4X 1FYLA 1STZA 5IT3A 2NVQK 2ELJA 5C44J 2ELKA 3KEOA 1Z3YA 2ZNZA 2JA5J 3VA7A 3OIQA 2KDZA 2JA6J 2V1DA 4M9SA 5BPIA 4DJAA 3GIRA 4M3GA 1WKMA 2FBIA 2NVQC 1X1AA 3L7WA 4G6DA 2A69F 3HKZD 2XAUA 3U1DA 2PPBA 1FOWA 2F6CA 3K70D 4UY8I 4ASNA 2X6XA 4P9FA 1S5LC 2M34A 4C3JK 3LSJA 5E17F 3GTKA 2VODA 1KGSA 1HLVA 1ONVA 2R0QC 4XRFA 5E18F 4OIOA 3FK6A 2CYYA 1WORA 5IP9K 4BLAA 3FKIA 1WH7A 3A03A 3DKYA 4Y7NJ 5K7FA 3GZ5A 1AKHB 3HDDA 4KFCA 4JK1A 5F0FA 2Y3PA 5E20A 4M9ZA 2GXGA 4B1RA 4YG2F 2XKOA 2PLYA 1XX5A 2F5VA 4KIBA 4NC8A 1D3YA 5M3MJ 2JA6C 4ZZLA 5JI6A 1VGXA 1XDSA 3EPZA 1XPPA 1IN8A 1W7PA 5JVTA 5IP9C 3BTJA 4CDGA 2QQ9A 4Y13A 4LMYA 5HLHA 3IPJA 2A6EF 2RV8A 3U21A 5BQTA 1WH5A 3D5SC 2WV0A 2XCOA 2DBBA 1OJLA 2VIXA 3GLLA 4P5AA 4BKWA 2DA7A 3BR3A 2BVMA 5CLSA 1O24A 4D7NA 1UHSA 1SFKA 5ERIA 3HRSA 3HPHA 3QU6A 1WQHA 1Z05A 4ZDPA 1USMA 1Z1DA 3GW2A 1G6NA 1BJZA 3MKYB 3CMAI 3B02A 3H0GK 1I1GA 2B63J 4M72A 5FB2A 2BGCA 2ZXJA 5E1ZB 4C9YA 2RQQA 1RR8C 1APLC 1O27A 1J5YA 3J7ZI 3ADAC 1MJBA 2ZO4A 1DUXC 2R7ZK 3V7SA 2VUMA 2CWEA 2A6HA 3ZP5A 2FRHA 2WB1N 1O25A 3BJOA 1X1DA 1QGPA 3ML6A 4MEYA 5L3BA 2F48A 2B0LA 3HGGA 2M3AA 2X1DA 1ZBSA 4BBRC 5FKLA 2R7ZC 3PL8A 3HB9A 2L01A 4GTEA 4KAWX 4E6KG 1XXBA 3IH3A 1IW7A 2E2HK 4LK1A 3GTPK 4N4NB 2FX0A 4GGGA 3VYRB 1RETA 3E3VA 1D0XA 1OCZH 3KYDB 1OCOH 1IF1A 2QZ8A 2KISA 2Y2ZA 3L1PA 4MO7A 4CH7A 3CF2A 4FX4A 2EH3A 2E2HC 2P8TA 2PQ8A 1IN5A 2DTRA 1ZG5A 1QPMA 3L2CA 4HQEA 2PG4A 1FTTA 3S1NK 2RNJA 4XK4A 2DOEA 4J3NA 3GTGK 4CSWA 4EJVA 1G8XA 3RQ4A 4MQVA 4A3MJ 2J5OA 3JRHA 1JE8A 1FBUA 1IAWA 2EBBA 1TWGJ 4KITB 4AUXA 2OJED 4DQ2A 5EGEA 1VF9A 1L0OC 1XC5A 3L4KA 1VQ8I 1F93A 3S1NC 1TT0A 1HI9A 2WB1D 2GAGC 2MH9A 3I59A 3FZVA 3GTGC 5H20A 2JK3A 3BOQA 4DBRA 2IBDA 3VYTB 3CZ6A 3WU0A 1R4NB 3VOEA 2FF4A 3HOTA 2EA4A 1IE0A 5E3LA 2MYSA 1D1BA 4B48A 4F7ZA 1UJ8A 4K2EA 3I4NK 3DBLB 3WU2C 4A3CK 2YU3A 5JFEA 1GDTA 3E5QA 3O6BB 5JLXA 3IHUA 1WFXA 4KT5C 1R22A 3JAMZ 1F4KA 1G2HA 1W4MA 3I4NC 3PFIA 1KYWA 1MW7A 3W6JB 3OYIA 5F27A 3SJMA 2NRAC 1JJ8C 3FK7A 1Y6IA 3FOEA 3QP6A 3VYSB 3CO7C 2FQTA 1QVTA 4PJNA 3GWZA 4C3HK 1AHDP 3K7AK 4BBRK 1U5TC 2PEXA 2L4MA 3ZGKA 2LY1A 1GE9A 4PUSA 4CCOA 4EM2A 3K4CA 1WOPA 4GYGA 4O3MA 3G4SI 2K3PA 1O7LA 2F2EA 4KB4A 4GTCA 3I64A 4KMFA 1Y56A 3ZMTA 3JSOA 1HQMA 2DLLA 1XZQA 3CUQC 3K7AC 1T0FA 2DA5A 2MC3A 2W00A 2XPVA 4G12A 4BU2A 1TWCK 4IPAA 2DDAA 2G7HA 3NARA 2IT0A 5JVOA 4MFEA 2KT0A 3E5XA 1MBKA 1ON1A 3S2HJ 3ISPA 1Z21A 3ZMDA 4ZTJA 1O3TA 4QLCU 3JSPA 1F5TA 1MZBA 2PHCB 5IY5H 3PO3J 5LGNA 4RBOA 1ZYRA 4BY1K 1TWCC 1OCPA 3QPSA 1ZGJA 3DLLF 2FOKA 2VKEA 2QGUA 4BE2A 3S1QK 1Z9CA 4OMYA 4UUSA 1FBQA 2CGPA 1TWHA 5IOQA 4Q5SA 3HSRA 2CG4A 3I3LA 1I6HJ 4KN7X 2E5ZA 1MBJA 3FXJA 2DO7A 3H5RA 1LDKB 2HQ5A 1EKEA 4A6DA 4IRIA 1USOA 2WAFA 3Q9SA 3MCZA 3V8LA 3S1QC 2W85A 3DPTA 4IZZA 1TWFK 3N05A 1V5EA 3OWTA 3O8GA 3TMOA 2NNNA 2XF5A 3GTOJ 3GSIA 1LNWA 5IOTA 3VYUB 3M4OJ 4TV7A 5HNHA 1X31C 3OR1C 2L9SA 4YFKA 1J0RA 5A2QK 4RDUA 2EFWA 3PSFA 3TW7A 4Y15A 2ZSHB 1TWFC 4I99C 1YRNA 2ZMEB 1JT0A 5KVRA 3OV8A 2JVGA 3GXOA 2EINH 5IPAA 3OSFA 2CUEA 3AKZA 4IVNA 2JRMA 4G94A 4DYCA 2KPMA 3TP3A 1O57A 2NVXJ 4A93K 2CW8A 3KE2A 2X1CA 5TJJA 1XGSA 2Z3YA 2UUZA 4PSWA 2OBPA 3Q3SA 1BIAA 3ESWB 3LA2A 3ZMUA 1ZG3A 2XDVA 2XPUA 3R0JA 4HG2A 4XSZF 5DUIA 3S15J 3L4JA 4YFNA 3GTOC 5M3FK 3IRRA 5J8CA 3I56I 2E2IJ 1Z0XA 2NNYA 3M4OC 3M8JA 2PMZL 3QQAA 1KQ8A 2VQCA 5IOYA 1WSRA 3L00A 1ETWA 4A3FJ 2BE5F 1MMSA 1X2MA 2ECBA 1F7VA 2HI3A 3FXMA 2XVCA 3BQZA 4WJ3M 3MD2A 3OIPA 4F55A 5EEGA 2GAUA 1LVKA 2Y9YA 3W6KB 3W2WA 3F22A 3GEHA 1DCHA 2M2EA 3OY9A 3CC4I 4HSRA 4BAYA 5HVQC 2M30A 3TGNA 4JX5A 4DGWB 3HEFA 2CQQA
chains in the Genus database with same CATH topology
2Q2EA 1SFEA 3FM5A 1J2XA 4Y17A 5F1RA 4HF0A 3P9IA 2F5EA 1ZYRF 2A5YB 4KATA 3GFLA 3GFJA 4L9VA 4HA8A 4Q5SF 2VBZA 1R5GA 1GXPA 4GTDA 2KIFA 3M8EA 4HLXA 4HOBA 4IF4A 2RH6A 2K86A 1P6RA 5FFZA 3QX3A 3I5UA 1TNTA 1TWAA 4U0YA 2JPCA 2W24A 1BC7C 3RKWA 1R23A 4HV6A 4XLPF 1BM9A 5HLGA 2V9VA 1J75A 5DEQA 3MAJA 5ILVA 4M6XA 5BS6A 4LR2A 1W5SA 1IXSB 3MZHA 3CLOA 3GO5A 1TQIA 2R7DA 2P7VB 3ELKA 4HF1A 1P4XA 1DDNA 2JA5A 3F6OA 2JA6A 3KP2A 4M1XA 4UNOA 1IXRC 2BV6A 1QO0D 3CUOA 1ODDA 5FGMA 2UZKA 1J7KA 2E1CA 1FLIA 4MQ9F 1KQ9A 2LKPA 3FXQA 4GO1A 1QBJA 4C2MC 1O2BA 2HKOA 1T39A 4OOIA 4QWQA 5IT9K 2EFNA 3B73A 1XSDA 3R4KA 3MFKA 1T98A 2EWNA 3TQNA 4ZZDA 4UV8A 3KP3A 1TW3A 1DP7P 2FQ3A 1ULYA 1BJTA 3SHFA 4UUVA 2R7ZA 1MJ9A 2GA2A 4EGZA 2MH2A 1FYMA 5J8FA 1RNLA 1Z91A 1IS1A 1ZLKA 1KA8A 3WTUC 5HDKA 1LB2A 2DW4A 2GWRA 4UXNA 1LVAA 2B63A 2F5CA 2E2HA 3S0XA 5JHUA 4I0AA 4WWCA 4GTLA 1K79A 2V1UA 4EV0A 5CHPA 2JRTA 4KIFA 1I5ZA 3OREA 4CO8A 2WC2A 2MLGA 1CGPA 3K1NA 3K9TA 4KDPA 3BPXA 2K4JA 2MBFA 2M87A 3L09A 2KRFA 1R1VA 4PDKA 1WRJA 2EFOA 1XDUA 2FA5A 2EK5A 2KJBA 2EV6A 5H6QA 3K69A 1TWGA 4ENNA 5HS8A 1MGTA 1SD5A 2O6GE 5CVIA 2L3DA 1FWZA 4YFXF 1ZGAA 2ZMEA 3CUQA 2J5PA 1O3QA 1FT9A 2O0YA 4HX4A 4ESBA 4MTEA 2VOPA 4OIRF 2ESHA 1DPUA 4KIGA 3F21A 1D5VA 4KNYA 1ON2A 2R7FA 4BH9A 1XN7A 1YIOA 2ZJ2A 1U3EM 4G0UA 4LK0F 1E17A 3ERED 1FPQA 5J6XA 2KJCA 3JTHA 1XXCA 5BPDA 1HSJA 2R3SA 3SZPA 4WF2A 3TO6A 1SD4A 4DDQA 3ABUA 2FNAA 3GTOA 1HSTA 3C3WA 2ELHA 1DD5A 2A61A 4HDUA 3TOAA 4A0XA 3I58A 4A0ZA 1T2KA 4R1HA 2YX7A 2RC4A 4BHCA 5L3CA 1EK8A 5K5OA 1O29A 5AONA 2QWWA 3HHGA 4EJTA 2G7UA 2YSRA 4Q48A 4O6JA 2E2IA 1ZVUA 2HS5A 2CW0F 4LLGF 1EH7A 5D8KB 1USTA 3I54A 2YPRA 1WQGA 2OD5A 1UB9A 3RDIA 2NAZA 3LQQA 3BROA 3DV8A 4KDDA 4GXOA 5LRRA 1I6XA 5EEHA 1WI9A 1HXDA 2K27A 3IC7A 1P4WA 3TDZC 4FT8A 4I98B 4P96A 3KP6A 2XHKA 4L9NA 2IW5A 4C3JC 1QZYA 3QOPA 2YU9A 5K5QA 2GXBA 4A0YA 2VT3A 4LQYA 2VC1A 2VT2A 2PFBA 4OMZA 2EV5A 3FMSA 3GZ6A 2VOOA 2K02A 2CFXA 4LGWA 3ULQB 1O28A 2QVOA 1H0MA 3R61A 4A5MA 1J9IA 3RKYA 1FBSA 4Z2YA 2K7LA 2Z99A 4OU0A 3CO6C 1TNSA 2W84A 4U0VA 2IPQX 3ZMZA 3IKTA 3HRMA 4IJAA 2IA1A 3RI4A 1R58A 2PBIA 1UHWA 4FHTA 2HOEA 2OU2A 3V7CA 2PMUA 1BI0A 2DK8A 5CJ9A 1R7JA 2XV4S 3LSTA 2M5WA 3IWFA 3HTSB 4NHJA 3RYRA 2VBXA 2L4AA 3CQZA 1LDDA 4L9JA 1IUYA 3I0TA 3MEXA 2JPBA 1L3LA 4P5BA 1BBYA 3E6CC 3F6VA 3WE2A 3V7RA 2V79A 4Q4ZF 1YS7A 4KMUX 3SXYA 2FNPA 5L3GA 1SMTA 1ZHFA 2DQRA 3ABTA 4KA4A 5LEKA 5JR3A 2A68F 5L3FA 1Y0UA 4L5JA 1ZN2A 3HUGA 1HBXG 4A2UA 2UXXA 1TTYA 2OZ6A 1BN5A 1KU3A 3GFMA 2RGVA 1JGSA 4I09A 1S6LA 1FOKA 3AH5A 3WGIA 3WTTC 3BJ6A 4C3HC 2QM3A 4OIQF 3KLNA 4MHGA 3OPFA 4M73A 3KP4A 1ZRFA 1YG2A 3LFKA 3J80K 3QU3A 1GHCA 2EB7A 3KETA 1B59A 5D5XB 2XCQA 3AQOA 5LEJA 4O5VA 3HIFA 2RGRA 1G3YA 2XASA 1U5TB 3PQKA 4U88A 1RUNA 2GSUA 3EYYA 2L54A 5DCMB 5HDGA 1EH8A 1IZ1A 5DCFA 4G0WA 3CUQB 4LFUA 3K1PA 3T8RA 1F9NA 3H92A 2DQLA 2Y48A 2DPDA 2VC0A 3F8CA 1HW2A 1S3JA 4ILDA 3Q9VA 1T6SA 2PN6A 3J81K 2CO5A 4M6YA 5ED4A 3GTJA 1ZRCA 2M8EA 2HWVA 2EFPA 2XIGA 2P5MA 4HX7A 2HDCA 5JFRA 4GFQA 3O2PE 4NB5A 2VONA 1I27A 1WQ2A 2OZUA 2RVCA 2QQAA 3ECOA 1K83A 4RB3C 2ACJA 4BLBA 2R92A 1YS6A 3V8JA 4BYYA 3E97A 3DXJF 2RDPA 3FX3A 4D0PA 5FLXK 4WX9A 4HDVA 4RGUA 2FMYA 5LHIA 2XAJA 4PZJA 2K4BA 1FNNA 3FF5A 4L18B 3FXUA 2HZTA 2CSOA 4CHUA 4KB2A 2ESNA 4A6EA 5AIQA 3WGGA 1UHMA 4LJZF 1VTNC 2P5VA 2V6CA 4JQFA 5FD6A 3NQOA 1XGMA 1GVJA 1OKRA 5AIPA 5HLIA 5LGUA 1NHAA 4G0VA 2XKPA 4BNCA 3FMRA 4GYIA 2D1VA 3I4PA 3J80Z 2STWA 2VBYA 2HKXA 1FC3A 4KM8A 1IN6A 1AB4A 4EM1A 5HS7A 4EJOA 5EGHA 1YO5C 4AD9A 2DI3A 2FSWA 2XAGA 4Q47A 2TDXA 1XMKA 2HYFA 3P9KA 2IVMA 1OMIA 4BHBA 3RPUA 2FEZA 1JHHA 1S7AA 2DT5A 5D4SA 2ZBKA 2EV0A 3CTAA 1LEAA 3U2RA 1MD0A 4ON0A 3J81Z 3T5XA 5D6FA 2D2WA 3NUHA 3H0GA 3COAC 3FMQA 3RKXA 4KASA 1ZXOA 2JTVA 3G73A 3LAPA 2DFIA 4BHPA 4ENKA 4S05A 4PGGA 1HW5A 2FBHA 1CF7A 5LHHA 3R60A 4ZYDA 1YW9A 3GTPA 3D5LA 3G3ZA 4BXUA 1PP7U 4UVCA 1HKTA 4JK1X 2H09A 2D45A 3GLXA 2E7WA 2UWMA 5D5VB 5FLXZ 3V4GA 4EVIA 2AXLA 1XD7A 2Y75A 3GTGA 3N4MA 1H9GA 1S8NA 1B4BA 3LPXA 3SQNA 2M45A 2QBYB 1KU7A 1HKQA 4EMSA 2ISZA 2O61A 1AWCA 3TOBA 1TQPA 2COMA 2R93A 1U5TA 4AIKA 2P4WA 1U2WA 1YLFA 5KK1A 2L02A 5DCMA 2Q0OA 1G3WA 5K5RA 2HTSA 2LF8A 3F8NA 4I7HA 2KIUA 4ENJA 1X3UA 5LGTA 1T38A 3IRQA 1OYYA 4N9IA 5DYMA 4AIHA 1HKSA 1TWCA 1XGNA 5ICEA 3KLOA 3MQ0A 1IXCA 3MWMA 1B9MA 5FD5A 4KICA 3I71A 4AVPA 3HRUA 1ZG1A 3ZMSA 2H6CA 1TQMA 3VFZA 3E5UA 3C18A 4OIPF 3Q5FA 2JT1A 4ESFA 1W7PD 5DD8A 1I1SA 1TWFA 4LB5A 2FU4A 1K78B 1LJ9A 1IRGA 3F23A 4MTDA 2DPUA 1WWXA 4G7HF 2BBYA 2ISYA 4LG0A 1S7OA 2YX4A 3KFWX 1LQ1A 4LB6B 3BDDA 3K2ZA 1Z6TA 5E1XA 4HX8A 2BEOA 4EJWA 2Y0MA 4I02A 4CGZA 1UCRA 4ZYHA 4IHTA 3KP7A 2IP2A 1U78A 4KC6A 1QQIA 1BI2A 4G9YA 3ZPLA 1BI3A 4WCGA 1BI1A 2GSNA 1R1UA 1A04A 3EDPA 3QAHA 1P2FA 3RYPA 2G9WA 4MGRA 2IRFG 2P5LC 1WQFA 4HW0A 1SAXA 3CAGA 3OEPA 3R0AA 4IHSA 5H6RA 2GIVA 2DAOA 1XB4A 1SD7A 1I50A 2QUFA 4JBAA 3BY6A 4L5IA 4BQAA 2E1NA 4RAYA 5CVRA 1RIOH 2XUBA 1BC8C 1IRFA 3G4CA 3IL2A 3H3UA 3JW4A 1U8RA 1HW1A 3FXRA 3WGHA 4G8XA 1BIBA 1WCMA 4GT9A 1R36A 3F8MA 4G6QA 3M8FA 4RS8A 4L0YB 4P5OA 2EFQA 1ZRDA 1WSUA 1QZZA 2YR2A 3GEZA 1BJAA 2H6BA 2OA4A 1D8JA 2XAQA 3T8TA 2KWAA 4M9XA 2F5FA 3WTWC 4G7OF 3Q3QA 4U0WA 3S2WA 4ESJA 5D6EA 2VE8A 2XRNA 2P7CB 1KU2A 3LAJA 3ZN1A 1FX7A 1OYIA 2IJLA 5CVJA 4R79A 4B8XA 3CDHA 5D4RA 1K6OA 3DKWA 5CYVA 4EGYA 2CQKA 2UXNA 1MJAA 4NQWA 3WU1B 4ZH4F 2XGXA 1LEBA 1Y1WA 5D5WB 2GZWA 1JXSA 1O3SA 1IN7A 1KQ4A 4LLNA 3N97A 3E6MA 3WG9A 2MLKA 3WTXC 5HS9A 2D1HA 3QP5A 1XGOA 1SFXA 3BJAA 4IRHA 2ZFZA 1Q1HA 4GTBA 2QBYA 3DPLC 1I3QA 3RIRA 3EQLF 1PUEE 3DF8A 3C1DA 4C3IC 1FYKA 4PCQA 1XSVA 3HTUA 4YIFA 5BMZA 4AIJA 1YYVA 4OIOF 1CF7B 2ZNYA 2PJPA 2VE9A 2QYOA 2BYVE 2KKOA 3TO7A 3PQJA 4P9UA 3SZTA 2W25A 2O8XA 4CICA 3RJPA 4ETSA 1U6GA 5L3DA 3ZQ7A 2WWYA 2P5KA 2XAHA 4E70A 1JHFA 2GA1A 2WTEA 3DFGA 5D5UB 3WTSC 3F8FA 2P6TA 3LQRA 2A07F 3TKYA 5DD4A 3M1EA 2OAZA 1MDMB 2A6HF 4RGSA 1K78A 3TDUC 4L9TA 1OR7A 3OOPA 4MEYF 2ZFWA 2V1XA 4AWXB 3HOSA 2HEOA 4A5NA 2CFAA 2FXAA 1G3SA 4UVBA 1IW7F 2HFHA 4LK1F 4HF2A 4S04A 4RB2C 2DK5A 4MNUA 1H9TA 2GQQA 2OQGA 3VB2A 2HQNA 3EYIA 1YW8A 1USSA 5HOOA 1TW2A 1ISEA 1XSXA 2XCRB 1SFOA 5CVUA 1ZREA 1ZARA 3REOA 3AAFA 4I2OA 3BWGA 4KMDA 4KUMA 2RKHA 2STTA 1SFUA 1S29A 2NVYA 1J59A 2NYXA 3IKVA 3MZYA 4XBFA 3LA7A 4YIIA 1PP8F 4WXHA 3DQVC 5FFXA 4LG0B 4KARA 2DU9A 2LNBA 1BOAA 1XCBA 4FM9A 1OPCA 5F64A 5TJ3A 3P9CA 5LBQA 2XAFA 3DEUA 4N9HA 1RUOA 1P4AA 1R9TA 1KQ0A 1R1TA 1BGWA 1OYWA 4RGRA 3M9AA 1XCVA 2KIMA 3BP8A 4DNCA 3NRVA 3GTLA 1EH6A 4HZFA 1GXQA 5BOXA 3K1MA 1KYZA 1G3TA 2EA2A 5IORA 3HHHA 4YFKF 4GTAA 4WXDA 2FBKA 3GTMA 2QENA 2MD5A 3GUDA 1MKMA 3IWZA 4EJUA 3KP5A 5ILSA 3FM3A 5E8GA 3QPHA 4CYDA 3O3KA 1HQCA 4IXAA 3M7GA 3VODA 2PMHA 1XMAA 4EQQA 1SD6A 3BUEA 4YFNF 1FY7A 3WE3A 4H0EA 1TBXA 1YW7A 3ECHA 3L9FA 3WTVC 1O2AA 3N3YA 2P6SA 2M1BA 2GSOA 4UV9A 3E6BA 3F3XA 2JSCA 4I0BA 3F8BA 3D0SA 2A3SA 1AOYA 4U7BA 3FHZA 2HQRA 2EJRA 3SFZA 1O7FA 4M74A 3T1BA 1YTYA 1FP1D 4XSXF 4KMAA 5A2QZ 3FOFA 1FP2A 5DV5A 2LDUA 4HLYA 5LLQA 5HDNA 1W7PB 1G4DA 3GX4X 1O26A 3CJNA 4ENMA 3RPQA 4HBLA 1YQAA 2W57A 3F72A 4WK8F 3N0BA 5K1YA 1O3RA 1RI7A 2H94A 2Z5UA 3J7AO 2FE3A 2RQPA 3C7JA 4LLLA 3N0CA 1KU9A 2H27A 3AQPA 5IOSA 1B4AA 2Q8KA 1Z7UA 3LA3A 5ILUA 1ZAOA 3KZYA 3G4AA 1FZPB 4GTFA 2VN2A 2IA0A 1PDNC 2OQRA 2VBWA 3GTQA 3FWEA 3LWFA 1R5HA 4ZYGA 4EM0B 2ZKZA 4UHTA 3WTZA 2PI0A 3VEPA 3ZMVA 1B6AA 3BZ6A 4MEXF 2JH3A 3GF2A 2RN7A 1IN4A 2ZCWA 3HSEA 1B1BA 1TLHB 1B9NA 4KMHA 1MDMA 2ETHA 5TRDA 4HYEA 1ZLJA 5LHGA 2AS5F 3TO9A 3U9GA 2HR3A 4RAZA 2HTJA 3QRFF 3I59B 4R8HA 2XROA 1Y1VA 4GCVA 1W5TA 2O3FA 3KEQA 4OINF 4HV5A 2X4HA 1D8KA 2LF7A 3GFIA 2ADUA 2Z33A 1REPC 4IRGA 3RTRA 1P92A 2HYGD 3E6DA 3KCCA 2NS0A 5ICCA 4CXFA 5D8LB 5L3EA 6PAXA 3V8KA 2C6YA 2Z9OA 1LDJA 3P7NA 1EV7A 1K7AA 2QQBA 4ZYEA 4N0BA 4UVAA 1WIHA 4WXCA 4U7DA 1C0WA 1DPRA 5FO5A 5LRSA 5DDGA 3HRTA 4PGHA 4RB0A 5ICGA 4RB1A 2CFAB 3KZZA 3HSFA 1EH1A 1R00A 1UFMA 3I53A 1RZ4A 5E8IA 1FSHA 4G7ZF 4FZBA 5IT9Z 3H3ZA 3HYIA 4HAMA 5E1WA 1SMYF 4CZZA 3DP7A 1E2XA 1FSEA 2F5DA 4L0ZB 5F6FA 2IA2A 2X0LA 3ROUA 2E7XA 1XXAA 3MMLB 5DUKA 4P55A 4HQMA 3R6SA 4A12A 1ZH5A 4LD5A 2JA7A 3BPVA 1V3FA 1Z6RA 4KYWA 2VXZA 2JZYA 2HGCA 4XLNF 3GYHX 4I01A 5CVVA 1V4RA 2NVXA 2MA3A 3JTGA 4M71A 4B09A 2FMLA 2O03A 5ICFA 3NEUA 2QLZA 3WODF 2LSOA 3ZN0A 3QPTA 1F1ZA 3T0YA 1QNTA 1YFHA 3JAMK 4RGXA 3EETA 3K0LA 4FX0A 3WTYC 3GVAA 4KM9A 3EUHA