3FISA

The molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title The molecular structure of wild-type and a mutant Fis protein: relationship between mutational changes and recombinational enhancer function or DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 25
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fisA00
5F1JA 5E3NA 4FE4A 5DS9A 5J1YA 2VKVA 5IP6A 2JK3A 5J3LA 3G1MA 5K7ZA 2DA3A 2ECBA 5DTDA 4Y52J 3RKQA 2R0QC 4BY1J 2DA2A 3MN2A 3NAUA 1LFBA 4M3EA 5F27A 1QVTA 2ME6A 2DMNA 4IHVA 3G1LA 4DYCA 2E1OA 2AO9A 3E7LA 3CCYA 2EZLA 5HODA 3JR9A 4XRSG 3LNQA 1MBGA 2DA6A 4A3IJ 3CQZJ 3HOXJ 5FLVA 3JRBA 2EH3A 3TEDA 4I76A 1GV5A 5EG0A 1WPKA 3A02A 4AC0A 1XG1A 3FKIJ 1IC8A 1TC3C 1FTZA 3S2DJ 3LSPA 3TP0A 2VI6A 4V2GA 2CRGA 1U9OA 2LTPA 1AKHA 4A3LJ 2NOGA 4IHWA 1F43A 4L5EA 2CU7A 1AU7A 1B8IA 3M4OJ 2ME0A 3JRFA 3BTLA 3Q0VA 2LP0A 1MNMC 2XPVA 2XSDC 1PUFA 2JA5J 4JP0A 3JRIA 2JA6J 3I4MJ 4C3IJ 2XGEA 1HCRA 2JJ7A 2ID3A 1FEXA 3OSFA 1JJ8C 5IP9J 9ANTA 1ENHA 5F04A 1AKHB 3BTIA 1X2NA 1LE8B 5FLMJ 3TW6A 4M3FA 1WI3A 5BNGA 2NVXJ 4QSHA 3S2HJ 2WAQN 5FKKA 1H8AC 3HOUJ 1UMQA 1B8IB 2LKXA 5M3MJ 1GV2A 5F08A 5F0HA 2R93J 3HBLA 4MFDA 1ZR4A 3LSGA 3OOUA 1G2HA 2AHQA 1PUFB 5J1UA 1NK3P 2O8KA 4FISA 4M6VA 5E3MA 2VKEA 2YU9J 1WCMJ 1IGNA 4BY7J 5J1RA 1A6IA 2M0CA 2E2JJ 4BBRJ 2E19A 1F36A 1RR7A 3GBGA 2Y9ZA 3IH3A 3TP3A 5EYRA 4X1EA 1JKPC 2LR8A 2JMWA 2FD5A 3GTPJ 1B72A 3BTCA 1A5JA 3LOCA 5F0CA 4DYQA 1JKQC 1HOMA 2XGCA 3BTJA 4JYKA 5EZGA 2M34A 2DA4A 2RAEA 3IH4A 2TRTA 2Y2ZA 3RQIA 3CMYA 1X58A 1ZGWA 3QPLA 2GLOA 1TWHJ 3A01B 1IDZA 5C4XJ 4DZJA 2IEKA 3S1NJ 4B4CA 3BR0A 1OCTC 1OJLA 2IBDA 3BQYA 4JX5A 3JRAA 1B72B 3GTOJ 2G0EA 1K83J 5IPAA 3MVPA 4D5FA 2R92J 4D7NA 2HOTA 2XGDA 1HF0A 3S15J 1RPWA 2LY9A 2DMQA 1K61A 5M5YJ 1HDPA 1H88C 2JA7J 2JA8J 4BXXJ 4G12A 1FTTA 2L7MP 2K9NA 4J19A 2E2HJ 5FKOA 2EQRA 4A3DJ 1QRYA 1ZKGA 2LFBA 5EF6A 4XIDA 2OF7A 2COBA 4IHYA 3SFIA 3S1RJ 1RETA 2H1KA 2R5ZA 2X48A 1MH3A 3Q0UA 3ZQLA 4DZPA 3H3VK 1RKWA 4UUSA 2YUSA 3HGYA 2HQ5A 3HOWJ 3RZOJ 2LLKA 1ZR2A 2Y9YA 3S1MJ 1JGGA 2XPWA 1JKOC 4BBSJ 1LE8A 3O8GA 3BR2A 2ID6A 4DYRA 3VPRA 4A3KJ 1MBKA 3HM5A 1ZQ3P 1E3OC 1ZTRA 2DTZA 4W1UA 1T33A 5IYCJ 2IAIA 2HDDA 1ETXA 2M2EA 3K2AA 3QQAA 5IYBJ 4A3BJ 1MBFA 1T56A 2R5ZB 3HKZN 2JWTA 3K7AJ 1BJZA 1X2MA 3S14J 3TW7A 4LOCA 1JTYA 4W97A 3PM1A 2WB1N 1GT0C 4C3JJ 4UUSB 1JUSA 2EBIA 2N8GA 3S17J 5M5WJ 4HNVA 1O4XA 1SFOJ 1U8BA 5IYDJ 2CQQA 2L9RA 1Q1VA 3BG5A 3FK6A 3A03A 2HXIA 1BW6A 2VPRA 1I50J 3HB9A 1U9NA 1D5YA 5EDNA 1CQTA 2K40A 5GPAA 2HOSA 1POGA 1Z77A 2DMTA 2DMUA 3Q0WA 5JLXA 1FJLA 3OIOA 1R9TJ 2XB5A 1RESA 3G1OA 2NVQJ 3ZQCA 3GTLJ 5E3LA 5IOZA 4XRSA 1LFUP 4C3HJ 4A69C 2KDZA 2DA5A 3ZQHA 3JRDA 3PO2J 1ITYA 2NS7A 2MG4A 3DCFA 3A01A 1JKRC 3WHCA 5IOYA 1SANA 3BR6A 3JRHA 1JUPA 3L1PA 2L0KA 4BKXA 2FQ4A 3HGGA 1S7EA 2Y30A 3F0CA 5M5XJ 3S16J 5JLWA 5C44J 3HOVJ 4A3MJ 2M8GX 5EGOA 1QPIA 3S1QJ 2CQXA 4B1RA 1OFCX 2NVYJ 1ORKA 2NS8A 3GTKJ 4RDUA 4Y7NJ 2YS9A 2ELKA 2CJJA 4D5CA 5K7HA 3GTQJ 2GM4A 1ETQA 1FIPA 3GTGJ 2XB0X 5FKMA 4S0HB 3JREA 2GBYA 3W6VA 1VNDA 2QCOA 1I6HJ 2I10A 3UKGA 1ETKA 1IDYA 2DMPA 5EGOB 3JRGA 4A3JJ 3CDLA 2FJ1A 1MBEA 1MH4A 2X9DA 3Q3SA 4AUXA 1BL0A 3BQZA 4QTRA 4GFBA 5C3EJ 4D7MA 4CYCB 2DJNA 2EZHA 2K9SA 1TWAJ 5EZHA 4AYBN 1GVDA 1TWGJ 4JX6A 2R5YB 3LSJA 1HDDC 2NVTJ 2EZIA 1VFCA 1DU6A 2MGQA 2TCTA 3ZOBA 1JUMA 3LSRA 4A3EJ 1NTCA 1I3QJ 2MW8A 2ZB9A 3GTMJ 3D1NI 1ZK8A 2O7OA 3BG9A 3SDGA 5K7FA 2OPTA 1ETWA 4XRMA 2L7ZA 1W0UA 4FCYA 1GDTA 2XPUA 4FTHA 3HEFA 3SJMA 1AHDP 2DA1A 4FE7A 1EF4A 3WHBA 2B63J 2ECCA 3MKLA 2H8RA 3GTJJ 1VF9A 5E3OA 5F0FA 4EEFG 5FKLA 3JRCA 2LD5A 1MSEC 1MBHA 1Y1VJ 2L7FP 3FK7A 3HOYJ 3B6AA 2FX0A 4C2MJ 4B3AA 2DA7A 3BG3A 3PO3J 1VI0A 3RZDJ 2P81A 1MSFC 1IG7A 2HXOA 4UUTA 1P7JA 4M3BA 1XS9A 4NDLA 1XC5A 1BW5A 1DU0A 1UHSA 2PMZN 4MO7A 2XRLA 5IP7J 2HOAA 3NARA 2CUEA 2QF7A 2D5VA 5M3FJ 1H89C 5C4JJ 5GP9A 1TWFJ 4QIWN 1APLC 1JT6A 3IV5A 2E2IJ 1ETYA 2HYJA 1MBJA 1ETVA 2M9HA 3BR5A 3OSGA 3FISA 3IH2A 1W0TA 3H0GJ 4IHXA 5EG0B 3ZQGA 3ZQFA 3C2BA 4A3CJ 2W48A 1FIAA 1Y1WJ 2X6OA 2MSYA 1BA5A 4JX4A 3QPSA 1YRNA 3BR1A 2LK2A 3FIWA 1IV6A 2LVSA 4IEJA 2Y31A 1UG2A 1WGXA 2KT0A 2R7ZJ 1TWCJ 1ETOA 1OCPA 4I6ZA 3HDDA 4XK4A 4ABZA 1U78A 4X6AJ 1IRZA 4A3FJ 4MFEA 4M3DA 4M3GA 4DW6A 1JJ6C 1P7IA 4RBOA 5EEAA 1YRNB 4CYCA 1JTXA 1QVUA 3O8HA 2WV1A 1RKTA 1GUUA 3ZQIA 2HI3A 2CUFA 2R5YA 4V2FA 5GPCA 3BR3A 2K9QA 2EZKA 3I4NJ 3DEWA 1IJWC 1IUFA 1NK2P 1Z0XA 4MLOA 3B6CA 4MIMA 2VUMJ 4A93J 1WH7A 3HOZJ 3M3YJ 1HLVA 2DN0A 2JN6A 3BT9A 5FKNA 4XICA 5FJ8J 1JT0A 1WH5A 4A3GJ 2O9LA 2Y0SN
chains in the Genus database with same CATH superfamily
5E3NA 2DK5A 2M3AA 5IP6A 3M7GA 2BXYA 1W5CC 2FEZA 2ECBA 2FF4A 3QPHA 5ICFA 3J7AO 4A0ZA 3MN2A 3DKWA 1WZ2A 3BJAA 4U0YA 1LFBA 2BZTA 4E7KA 4GRIA 3K4JA 1PDNC 2XVCA 2A5YB 1ZG5A 1EJ9A 4L9VA 4IHSA 3G1LA 2KIUA 3QPTA 4M9ZA 2BXZA 3TOAA 2F4OB 2QKLB 5D8LB 1O3QA 3CCYA 3G3ZA 3D5SC 5HODA 4M6YA 2OZUA 3LNQA 4MEXF 2XAUA 2XASA 1TBXA 1I3AA 2CSOA 5FLVA 5DCMA 3TEDA 3DQVC 1EH6A 3ZRGA 3BP8A 4GYGA 4G6QA 4FHTA 1OCRH 3K2ZA 3SZGA 1G3WA 2K27A 1HSJA 2EIMH 3FKIJ 4I0AA 1LDKB 3TGNA 1XD7A 3V42A 3LSPA 1GLNA 1AKHA 4A3LJ 1U9OA 4HRIA 2YR2A 4IHWA 4HW0A 1FY7A 2CU7A 3I54A 1AU7A 3F8BA 2M7AA 3M4OJ 2WAQA 3Q0VA 2LY2A 2VJIA 1FWZA 2L9SA 2LP0A 1T39A 3W2VA 4QLCU 2XSDC 1PUFA 2W1OA 3EETA 4JP0A 2UZKA 5LHIA 2XGEA 1HCRA 4OMYA 4ITVA 3ABTA 2IRFG 4CICA 4AM3A 3KYLA 4BYYA 3CP8A 2OUMA 2X6XA 4BNCA 4KT6A 1XSVA 4IO9F 5FLMJ 1ZRDA 4M3FA 1WI3A 3TQNA 3DWLE 4FX0A 3S2HJ 2WAQN 2YX7A 2HVSA 4FX4A 5M3MJ 2LKXA 1GV2A 5F08A 3I4PA 3FKJA 5F0HA 2R93J 3FWEA 3LSGA 1FBUA 2AHQA 2BHYA 5J1UA 5GADJ 1D0ZA 6PAXA 2KLOA 3ASOH 3I71A 1AWCA 1P4WA 2K4JA 3IKTA 4U0WA 1A6IA 2M0CA 3IC7A 3WTVC 1V3FA 2F5EA 2E2JJ 2E19A 2E71A 2L3DA 2UXNA 2VJ5A 3L9FA 2GQQA 3TP3A 3RDIA 4X1EA 5HLIA 1JKPC 3CCEI 4BACA 1NH3A 1O3RA 2JMWA 2M8EA 4MHGA 1YFHA 1B72A 1A5JA 1X1BA 3S3NA 1VQOI 2XAGA 1ZHFA 3DLLF 4DYQA 4U88A 2WY7Q 3BTJA 3X2QH 3MMYB 1R1TA 5DUKA 5EZGA 4LITA 4RM2A 2BV6A 3IH4A 4OINF 3S32A 4I02A 5F64A 5BQTA 3RQIA 3PJRA 3QPLA 1A04A 1IDZA 3D5LA 4XLEA 2K02A 2VJ4A 5ED4A 4HAMA 4L9JA 4UUVA 1OJLA 3I59B 3R4KA 1XMXA 1W4MA 2EPFA 3H92A 5IPAA 1G3YA 3ZMZA 3LSHA 4BXUA 4EJVA 3SZTA 4HQEA 3FMSA 2KDOA 2R92J 2HOTA 3JCUC 1USSA 1UHWA 1RPWA 3LL7A 3K1MA 5M5YJ 1KU2A 1F4KA 1KONA 2E5ZA 1WVRA 4G12A 1FBSA 4L9NA 1YLFA 5D5UB 4J19A 2VT2A 2B7EA 2E2HJ 2DOAA 2OAZA 4A3DJ 1QRYA 1R6RA 4IHYA 2PX9A 3S1RJ 1RETA 4KFCA 2X48A 1XCBA 4RB3C 5FFXA 4LB5A 3G2BA 5CVUA 4HYEA 5FRMA 4R1HA 2NYXA 1F5TA 3E0JB 1R1UA 2JA2A 2XC7A 4PJJA 2CGPA 2YUSA 2E5NA 3HGYA 5K5RA 2LY1A 2ZSHB 1QGPA 2WB1A 3VFZA 4EV0A 3S1MJ 3K4CA 1JKOC 1P4XA 3FHNA 1LE8A 1O57A 4P96A 3BR2A 4O3MA 3VPRA 5KCMA 2EWNA 3HM5A 4UHTA 3V4GA 3VSLA 1IAWA 2Z1DA 3CCJI 3GZ5A 1ETXA 3GWZA 4NHJA 4A3BJ 3VSKA 1YS6A 3H1CA 3K7AJ 4OU0A 1XGNA 3J7AY 3TW7A 5LHGA 1YYVA 4ZYEA 3CDHA 4W97A 5TISC 2K3FA 3IWFA 2WB1N 3CJNA 3BPXA 4ZDPA 2ELJA 5J8FA 1S3JA 1QQIA 5FO5A 3RKYA 3LAPA 1I1SA 1D5VA 5HNHA 5FROA 3TO9A 2IT0A 3ABUA 2F2EA 2NXNB 1IO2A 1Q1VA 1XSXA 3FK6A 4NNJA 2HXIA 1ZGAA 1FP1D 2FMYA 2VPRA 2VODA 3EUHA 5DM7F 1I50J 3FBIB 1D5YA 1CQTA 4A2UA 4UXNA 1POGA 2VT3A 1Z77A 3RYPA 2DMUA 5LHHA 3CCMI 3AG2H 3OIOA 4BDYA 2WAEA 2XB5A 3ZQCA 1ULYA 1LFUP 4MNUA 4XONA 1K78B 2OTLI 3HSEA 2LF7A 2Z2SB 1ITYA 1J5YA 3KP4A 2R7XA 2MG4A 3WTZA 2FOWA 2MLGA 4I09A 5CQEA 4ENKA 4BE2A 4RLQA 5ILUA 3BR6A 4LLGF 3NEUA 4XN0A 3SQNA 1RRJA 3L1PA 1ZG3A 5FLXK 4BKXA 4C2UA 2FQ4A 3CJTB 4CCMA 3F0CA 3OIQA 1SVOA 5C44J 2PMUA 1YOVB 1MDMB 3BPVA 2V26A 2QLZA 2NVYJ 1FOWA 2NS8A 4RDUA 2R7FA 2ZFWA 5FD6A 2R7TA 1ZLJA 1QPMA 4AIKA 2F48A 2EV5A 4Y17A 5L3DA 3IUOA 1U8RA 3RYRA 1ETQA 1IRXA 2XB0X 3Q9SA 4S0HB 4N9HA 4E7JA 2BYVE 2CO5A 3KZIC 4IRGA 5LLQA 2GBYA 3OYLA 1FMVA 3W6VA 1XDUA 2QCOA 1I6HJ 1ETKA 1YHQI 2DMPA 4BQNA 3DV8A 1TT0A 2QBYB 4RB0A 1K79A 4XKVA 3PNYA 1KQ9A 4PJ0C 2HQNA 2E1MC 2LBFA 3QAHA 1W7PD 4HSRA 4BAYA 3K10A 3SZPA 2F5VA 1Z7UA 3HHHA 5BS6A 5L3FA 4CH7A 4A0XA 3ZMSA 1ZREA 3D0SA 3LSKA 3CLQA 2R7SA 2AS5F 2Z5UA 2EZIA 1VFCA 3CESA 1R1VA 2KKOA 3M9AA 3OYCA 1NTCA 2QWWA 1SC7A 2BVMA 1VQ4I 5GTHC 5FB2A 2CV0A 3V7SA 5FD5A 5LEKA 1T0FC 3WTXC 1IW7F 3QODA 4UVBA 1FT9A 4ZYDA 5DEQA 1BBYA 4LJZF 1HKQA 1WJFA 4EVIA 1AHDP 1FP2A 2DA1A 3QWLA 2CW8A 5DCFA 3J80K 1S6LA 1N77A 1UELB 1Y6IA 4L18B 1BR4A 3CC4I 3GFMA 4ZTFA 1YG2A 1P2FA 1VQ5I 4IQJA 1Z91A 3HL2A 3QOEA 3RI4A 1KU7A 3KCCA 1OYYA 1ZAOA 3JRCA 3TO7A 2E1NA 3GX4X 3ABLH 3S3OA 4QPOA 2M4GA 3T1BA 3T8RA 4C2MJ 3WGIA 1RR8C 2XAJA 4YIIA 4PJMA 2KIFA 3N05A 3AG3H 1MSFC 1VQLI 5LD2C 2VXDA 1SAXA 3LFKA 1WSUA 2HXOA 1P7JA 2FU4A 1WKMA 4M3BA 4PFPA 1XS9A 2O61A 3F23A 1SMYF 1Y8RB 2VL8A 4E7HA 1DU0A 2DQLA 1UHSA 2IW5A 2XRLA 2EV6A 2QF7A 3CUQA 1MJAA 1D1AA 2HS5A 2HDCA 1APLC 2STTA 4XOTA 3PSIA 3CCSI 3PNTA 2P8TA 4E4HA 4MGRA 1ETVA 2M9HA 3BR5A 3D5RC 4CZZA 3IH2A 1W0TA 3S2WA 1MGTA 1O3SA 2VC1A 2R7RA 1WQ2A 2NNNA 3HTUA 3ZQGA 5K5OA 2DPUA 5KVRA 4C9YA 1H0MA 4A3CJ 1FIAA 2MSYA 4OAYA 1YRNA 1RIOH 1U0JA 3BR1A 3V8LA 2LK2A 2HEOA 2VQCA 4P55A 4CZCA 4RB2C 2DW4A 2EA2A 2EFOA 4ZC3A 2BY2A 4U87A 2LVSA 4NQWB 2HZTA 2VIXA 1Z67A 2Y31A 3EPZA 3FXRA 2UV1A 1BM9A 1PJRA 3V8KA 4EATA 1LB2A 2IS2A 5LRSA 2D45A 2L5QA 3GYHX 4ABZA 1U78A 4YELA 5L3EA 4Q5SF 2VB6A 4M3DA 3KFWX 2RQQA 1JJ6C 3VWBA 2KZVA 4KN7X 4CYCA 1GHCA 3RPQA 2XIGA 3I0TA 4A12A 3O8HA 1KYZA 2PLYA 3QYFA 4RAZA 2HVRA 2CUFA 5HS8A 4D9JA 3A2KA 4EM2A 1ON2A 5D4SA 3WU2C 5K5QA 1YJNI 4Q47A 1GVJA 3ZR8X 4HNUA 3HUGB 5LGUA 2ZBKA 3P9KA 3CCVI 3LSTA 4E7ZA 1NK2P 1Z0XA 3LQQA 4IRHA 3HOZJ 2RGVA 3EYIA 4ENJA 3NWTA 1HLVA 3L7WA 2GAUA 2ZKZA 3PSFA 5FJ8J 2FMLA 2MH9A 3I9V2 2IA1A 4XSXF 1U6GA 1SVLA 5DS9A 1QHHD 5HVQC 4HA8A 3KEOA 1CGPA 2JK3A 3MAJA 2HOEA 5H2FC 5J47A 3F9KA 1A31A 1VQ9I 2GXBA 3CC2I 4Y52J 3FXJA 4UB8C 1QBJA 1D8JA 3OR1C 2R0QC 2MD5A 4BY1J 2DA2A 1R4NB 1L0OC 1HSTA 2ZJPF 3J7YJ 5F27A 3CO7C 2VBXA 3SEZA 4BJ6C 1IF1A 1STZA 2RV8A 4DNCA 2AO9A 4XN3A 3OIPA 4LK1F 4I98B 5FRNA 3JR9A 5D4RA 2DOFA 4U7DA 3HOXJ 5H6QA 3BJ6A 3TBIA 4ZZDA 2EH3A 3OYKA 4UV8A 4I76A 3PIPF 1DDNA 3ABKH 1RNLA 3CJQB 4XLFA 5EG0A 1WPKA 4XL9A 5CPRB 1BI2A 3AG1H 1SFUA 2VKHA 1IC8A 5HOOA 5BPIA 3S93A 1H9GA 3TP0A 4YEJA 2X6YA 4CCKA 4OMZA 4BE0A 3L2WA 2HR3A 3OOPA 3VEPA 1TW3A 2XF6A 2ME0A 3JRFA 2A68F 2JZYA 2KHMA 1E3PA 4HF0A 3JW4A 5B3SH 2XPVA 3AG4H 1FYMA 1ZGJA 4C3IJ 4CCLA 2EILH 2WC2A 2A6TA 2JJ7A 2ID3A 1FEXA 3BROA 1K7AA 2RC4A 2W25A 4RS8A 3TDUC 4P5OA 4XLPF 5H20A 4UVCA 3TW6A 2PJRA 1J9IA 1H8AC 3BCAA 1B8IB 2BW3B 1XB4A 4MFDA 1ZR4A 4IOAF 5F1RA 2NAZA 2O8KA 3CCRI 1KQ8A 2BEOA 3N4MA 5J1RA 2E7XA 2DDAA 3DXJF 3VYTB 2QZ8A 2JUCA 2V1NA 4U0VA 4IZZA 4BE1A 4BBRJ 4BHBA 5GAEJ 5TJJA 1RR7A 2WY8Q 4EM1A 3HRSA 1I5ZA 2JRMA 3IH3A 4I01A 4DOZA 5CVRA 4F92B 3HC7A 4RM3A 5LGTA 2K86A 4HSTA 3OY9A 4XR6A 2A6HF 2PJPA 1P9QC 1EA3A 4IXAA 3GTPJ 4NC7A 3I59A 3V8JA 2O03A 4UB6C 1HA8A 4WXCA 1SFXA 1YW8A 2CMPA 3K70D 4IRIA 2A05A 3I53A 3KE2A 3LOCA 2DI3A 3M1EA 5F0CA 2ZJQF 3H9QA 2V6CA 3ERMA 4IX7A 4JYKA 4XKWA 2DA4A 2GIVA 3A0BC 5E1XA 4A0YA 4KIGA 3K70C 2TRTA 3M8FA 2BY1A 1LDDA 1ZGWA 3OL3A 2GLOA 2QQ8A 5HDKA 4OWRB 5D8KB 3A01B 4LG0B 5C4XJ 1W5SA 2HGCA 4HG2A 4PK4A 1E0EA 4G7OF 2X0LA 2LF8A 4YRVA 4B4CA 2Q2EB 1BN5A 3FXOA 1OCTC 4JX5A 3JRAA 3GTOJ 1YI2I 3MWMA 4F52A 3MVPA 3J7ZI 4D7NA 4M73A 4HOBA 1HF0A 2FBIA 2LY9A 1PUEE 5E8GA 4E7IA 3DP7A 4HV5A 1UJ8A 1H88C 2JA7J 4Y15A 2W84A 3KP5A 1K4SA 1DP3A 3DBRB 2K9NA 2K9LA 2KP6A 1ZKGA 4KISA 2LFBA 2E1MB 2OF7A 1ONVA 2COBA 5BMZA 2L4AA 3SFIA 4HBLA 3Q5FA 2H1KA 3EDPA 5E17F 3ZQLA 1T2KA 4BU2A 3LQRA 5F6FA 4DZPA 1RKWA 2H94A 4RLFA 3OYIA 4L0YB 1G4DA 1LFPA 2EIJH 1WJ5A 2LLKA 2X1EA 4XMYA 2K5CA 2Y9YA 3E6DA 3O8GA 1Y8QB 2M87A 1VQ8I 2K9MA 3ERED 1E3OC 2MLKA 2ELHA 5JVGF 3GUDA 1T33A 2CQKA 3ONQA 4KITB 2GZWA 2JRTA 2M5WA 4HDVA 1G3TA 2B9SA 2P5KA 3BWGA 3QQAA 2MH2A 2JSCA 4GDFA 3FM3A 1XSDA 4BGDA 4ZH4F 1T56A 3ZQQA 2R5ZB 2WTEA 3AKZA 1X2MA 1VQKI 2YPRA 2DYSH 3PM1A 2KJBA 1PP7U 4XNFA 4C3JJ 3H9GA 4ESBA 3OYMA 1WJEA 3W6JB 2EBIA 1S7OA 2JVGA 1K78A 5HDNA 1XX5A 2ZXHA 2OD5A 1KZHA 3S17J 4N4OB 1KYWA 1O4XA 2KIQA 4AIJA 1LDJA 1FLIA 2L9RA 1GXQA 3BG5A 5BOXA 3A03A 4PGGA 2BOLA 1XGMA 2OQGA 4E6KG 3HB9A 2DU9A 1ACIA 1SFKA 1MDMA 2HOSA 1SEUA 4IOCF 1T08B 4RAFA 1J7KA 1BC8C 1FJLA 4M72A 4YFNF 1X1DA 1S72I 3G1OA 4BH9A 4J01A 3F8MA 1DGWY 1UFMA 4OIQF 2VOPA 3ZQHA 1FYLA 1LQ1A 3ML6A 2NS7A 3BC8A 2IS4A 1R5HA 3DKXA 3CTAA 1SANA 2IGOA 1A35A 5D5VB 2Z16A 1F1ZA 4C2TA 2L0KA 2A5WA 2XAHA 3DBHB 5M5XJ 1IZ1A 3S16J 3IAS2 3HOVJ 2HNHA 3HTSB 2OQRA 4ASNA 4AVZA 1ZRCA 2HFHA 2CQXA 2KISA 4B1RA 3K69A 4S04A 2QBYA 1HKTA 3CCUI 4D0PA 3GTKJ 2Y69H 4MQVA 1PYVA 2WADA 2EV0A 5K1YA 3GTQJ 3ECHA 3P9IA 5HLTA 1FIPA 1ZELA 5FKMA 3WODF 2ZMEC 4AYBA 1YW7A 2OU2A 3LA3A 4GCVA 2AQEA 1Z21A 5ILSA 2QUFA 3NRVA 3UKGA 4Q48A 3GFJA 1N78A 5EGOB 3JRGA 1WJCA 3CDLA 2KZGA 2KRCA 2MFZA 1G3SA 2V7FA 4QPQA 4AUXA 4GFBA 2VBWA 3HHGA 3PQKA 4RAGA 4AYBN 1GVDA 3WTSC 2R5YB 1BI0A 1CF7B 3RKWA 1NG6A 2HZDA 2MGQA 2TCTA 3ZOBA 1R71A 2NRAC 2BGCA 4ON0A 4A3EJ 1I3QJ 1BI1A 1K6YA 2CV2A 2ZB9A 5DD8A 5KAIC 1GXPA 2H6CA 1V5FA 1VZ0A 3HRUA 5K7FA 4XRMA 2L7ZA 1T98A 1P92A 3REOA 1GDTA 2ZXJA 3F8FA 1U5TC 4XLHA 3HEFA 3SJMA 5ERIA 4FE7A 2B63J 1VQ6I 4ZYAA 3KIOA 2CG4A 4WX9A 2PMZA 2HPIA 1MMNA 4HX8A 2H8RA 2HKOA 1VF9A 4M9XA 5E79C 2LMDA 1MW7A 4EEFG 2LD5A 3SEQA 1Y1VJ 2L7FP 2HU9A 4YFXF 3HOYJ 2KMUA 1HBXG 1V5EA 2P5VA 4Y13A 3HXLA 2X51A 3BG3A 1Z05A 3GLXA 3IWZA 1OYIA 1LUJB 2WV0A 3P9CA 4RMNA 1YITI 3HRTA 4HDUA 2XAQA 1BW5A 1T38A 3K1PA 2PMZN 4MO7A 2HOAA 4NQWA 2CUEA 1QHGA 3V7CA 4QIWN 1ETYA 1IN6A 3TL4X 3E1SA 4UY8I 1SD4A 5DCMB 2P5LC 1PP8F 3KZYA 2VXZA 2F5CA 4GO1A 3FISA 2EFQA 4IPAA 2NNYA 4HF2A 4IHXA 3ZQFA 3PUFA 2W48A 3KP2A 3DEUA 4JX4A 1OCZH 5DUIA 4BXFA 2CQ7A 2H09A 2QQAA 3GFLA 1MJ9A 4BQAA 3CLOA 3I5UA 3GZ6A 3FXMA 1WGXA 3U1DA 4N4NB 1Z3YA 4ESJA 3HUGA 3W2AA 1OCPA 2LNBA 2CUZA 2R7WA 4I6ZA 1JXSA 3TOBA 1HW1A 3KZZA 3C7JA 1IRGA 2CH0A 1MNDA 3B02A 1W1WE 5J4YA 4X6AJ 3OYNA 3MZYA 3CCQI 3WU0A 3ZMUA 4MFEA 3C18A 3SYTA 1M1EB 4EGZA 2M45A 1DP7P 4II2A 1JTXA 1VQNI 1U2WA 3ZQIA 2HVQA 1B59A 1TNTA 2K9QA 1T8IA 3BG7A 4HLXA 3J81K 2COMA 2V4JC 2Z33A 1S9HA 4UNOA 4EJWA 3AL0C 1FOXA 5HNFA 4JQFA 2PN6A 4MLOA 3B6CA 4A93J 1REPC 2XSJC 3M1CA 2W24A 2DQRA 3BT9A 2VPLA 3MZ8A 5D6FA 1HKSA 5DD4A 4XICA 2X85A 2F6CA 2JTVA 2PFBA 2O9LA 4EJUA 3I64A 5F1JA 2IS6A 4FE4A 3I56I 3LA2A 3ZXSA 1XMAA 3BDDA 5J3LA 3IAM2 3OYAA 5K7ZA 3BLYA 2DA3A 5DTDA 1TLHB 2XKPA 2ISYA 2R7OA 3H0DA 1D3YA 3S8PA 1G6NA 2RN7A 1PVEA 3M07A 2LG4A 3NAUA 5KNLA 4HZFA 1QVTA 3QP6A 3KPHA 2OTJI 2ZJ2A 2ME6A 3IP4B 1OR7C 1WRJA 2F4MB 1EH8A 2E1OA 3M8EA 2L54A 2GXAA 4OOIA 5JVTA 3DLAA 1H9TA 5H6RA 4I7HA 1MBGA 2DA6A 3E5QA 2CFOA 2XDVA 2X1DA 3HPHA 3PNVA 2PEXA 3CQZJ 5AONA 1X4PA 2VQLA 1DQUA 1ZRFA 3ELKA 2VBZA 3U1KA 1UCRA 3E6MA 3LMMA 5IT9K 5J40A 3A02A 1OISA 1XG1A 4IF4A 4AC0A 3RKXA 2ICWG 3FXKA 1TC3C 2FOKA 2R3SA 1FX7A 4LGWA 2PBIA 2M1BA 2LRDA 2GXGA 2NOGA 2FNAA 3BCBA 3OYJA 4HX7A 4IHTA 3CDIA 4L5EA 1B8IA 2QM3A 1VQMI 1QO0D 1MMAA 3BTLA 2FBHA 2GWRA 3K4MA 1MNMC 3LFUA 3WTUC 1BI3A 1XDSA 2JA6J 3I4MJ 5CYVA 4NC8A 1FC3A 1R23A 4KNYA 3ZMTA 5B66C 3LAJA 2DFFA 2O0YA 3OSFA 3DBLB 1X3WB 5IP9J 1ENHA 3QU6A 5F04A 2QQ9A 1J75A 3BTIA 1X2NA 1LE8B 1TQMA 2K7LA 2NVXJ 5BNGA 3FDYA 4QSHA 1TZLA 2DK8A 1V55H 5FKKA 3DPLC 1UMQA 3CCLI 2QSGX 2Q0OA 4AD9A 3KETA 3HBLA 3NQOA 1NG7A 3K0LA 3OOUA 2L7KA 3ABMH 4NC6A 1G2HA 4FISA 4M6VA 5E3MA 4AIHA 2VKEA 3OS0A 5FLXZ 1WCMJ 2W7NA 2L02A 4HV6A 1RUNA 1KU3A 3I55I 4CYDA 1F36A 2CW7A 1SMTA 3GBGA 1OCCH 4IVNA 2DYRH 2XV4S 1QZEA 5CVIA 1AA7A 2Q2EA 3ZCOA 2DCEA 3ZP5A 1X1PA 2FD5A 3CMMA 3ZN1A 4F55A 3BTCA 1FZPB 3EQLF 1S7AA 3FMRA 1IN5A 4FQGA 4RA2A 3C2GA 2O6GE 5GAGJ 3CO6C 3BOQA 1JKQC 1RI7A 1NHAA 2J5OA 1R36A 3J81Z 2RAEA 1FOYA 4CO8A 1LPQA 1YS7A 4G6TB 4ZYGA 5L3CA 1X58A 1J0RA 2IGMA 3R60A 1TWHJ 2FBKA 4PUSA 1TTYA 3PFYA 1TQIA 1OLTA 4A6DA 3PIOF 4DZJA 3KLOA 3S1NJ 5E1WA 2EFNA 2QVOA 2IBDA 3E3VA 1K83J 2KL4A 4C30A 3FZVA 2ZMEB 2JPBA 4Z2YA 4CGZA 2XF5A 2XGDA 3S15J 4G94A 2JQ7A 2DFHA 4ZDOA 3N97A 4EJTA 3WG9A 1HDPA 2BY3A 4O6JA 1T0FA 2JA8J 4BXXJ 2UXXA 2L7MP 2EQRA 5KK1A 5D5WB 2CYYA 2LC2A 4XIDA 1TNSA 3VYSB 2IA0A 4Z6YA 1MMDA 1X4OA 2R5ZA 4HF1A 3DTIA 3KEQA 4N9IA 4DGWB 1MH3A 3J80Z 1YE9A 2XHKA 2PQ8A 4F3QA 1XPXA 4DBQA 2HTSA 3OYBA 1SD5A 3RTRA 4FT8A 2HQ5A 2IA2A 3HOWJ 3RZOJ 2DLLA 1ZR2A 4IQ4A 1JGGA 2STWA 4YG2F 4GYIA 2GA1A 4YFKF 5IT9Z 4XQFA 4AWXB 1BJAA 2QGUA 5ICCA 4A3KJ 1B6AA 4I2OA 2VQGA 1QA6A 2DTZA 3HJEA 2LREA 1U5TB 5EEGA 2IAIA 5KHDA 1P6RA 2HDDA 3K2AA 4XKCA 4CA0A 1B9NA 4PJNA 2LYCA 2JWTA 3L09A 4B09A 4F91B 1BJZA 1BOAA 3S14J 2DOEA 4XLAA 2DXIA 3DU6A 1S29A 4UUSB 1JUSA 1MJBA 4PSXA 4XRFA 3GCMA 2N8GA 2DT5A 3GF2A 5M5WJ 4ZZLA 4HNVA 1D0XA 4BEHB 2EK5A 3RPUA 1SFOJ 4OIPF 3OYFA 1R5GA 2C6YA 2UUZA 3BZKA 4HEA2 3L2RA 3CF2A 4G8XA 5L3BA 1BW6A 2XAFA 2ZO4A 2CS3A 1U9NA 1EV7A 5EDNA 1K6OA 2YSRA 5BPDA 3H3UA 5GPAA 1SD7A 2IPQX 1FNNA 1G8XA 2V79A 3QOPA 2BE5F 5D6EA 2RVCA 4BL0B 4EJOA 1R9TJ 2HPMA 2NVQJ 3GTLJ 5E3LA 1Z7LA 2WBMA 4YIFA 3VYUB 4A69C 4C3HJ 5JI6A 2GIZA 5B1BH 2K85A 5E18F 2DA5A 3JRDA 4YIRX 1USTA 3DCFA 2QEXI 3FBNB 2O8XA 1JKRC 4G7HF 3WHCA 3P7NA 3JRHA 2Y75A 1JUPA 3RQ4A 1MZBA 1S7EA 2Y30A 4MTDA 2H6BA 1DGRM 5EGOA 1QPIA 4I0BA 1YIOA 3DPUA 3BZ6A 3MQ0A 1ORKA 4P9FA 3PQJA 3OWTA 2YS9A 2ELKA 4XLNF 2CJJA 4D5CA 3O3KA 1BIBA 2VLAA 4XKBA 4KA4A 3GTGJ 1Z1DA 2GOMA 2QSFX 1JHHA 2P7VB 2W00A 1CF7A 2HQRA 1WJAA 3FF5A 5HDGA 1TT5B 2D2WA 1QZZA 2V9KA 3HRMA 1VNDA 2JPCA 1Y0UA 2I10A 2XRNA 1IDYA 4LK0F 1N25A 2DODA 4RGRA 3H36A 3LWFA 1E2XA 4A3JJ 1O7FA 2FJ1A 2HTJA 1MBEA 3A4CA 4E70A 2X9DA 1YTYA 3AL0B 1WJDA 1YX5A 3KP3A 4KDPA 3Q3SA 2RQPA 4QTRA 5C3EJ 4D7MA 4CYCB 2EZHA 2K9SA 1IUYA 3E97A 4KMUX 2GA2A 2RKHA 2IS1A 3U21A 2X4HA 1I6XA 1TWGJ 3QYEA 4JX6A 1BOBA 1YJ9I 5DV5A 1HDDC 2NVTJ 2R4GA 2G7UA 1JUMA 3LSRA 1FOKA 3ASNH 3QRFF 1J2XA 2HQAA 3GTMJ 2OZ6A 3VODA 3JAMK 2O7OA 1V54H 3BG9A 4RGUA 2LSOA 3SDGA 1W7PB 2OPTA 1ETWA 2MA3A 2MYSA 2EFWA 3I58A 1W0UA 1OCOH 4G6DA 1LVAA 4F93B 2B0LA 3F6OA 4RGSA 2ZNZA 4P9UA 1O3TA 1JE8A 1UHMA 3WHBA 2ECCA 1Y56A 5LGNA 2ETHA 1WFXA 1RUOA 5E3OA 2H8WA 5F0FA 4R79A 1P4AA 5IY5H 2Z3YA 2LDUA 3ZPLA 3KX2A 2MC3A 1MBHA 3QU3A 3B6AA 1D8KA 2AXLA 2DA7A 5CLSA 4EGYA 4WXHA 3SXYA 1VI0A 1LKXA 4S05A 5CJ9A 5KAFC 3E6CC 3RZDJ 3H35A 1IG7A 3HG9A 3ESWB 2E36A 3WTTC 2H27A 4NDLA 3ZGKA 1HW5A 3LSIA 1I39A 4LD5A 3ZN0A 2V6EA 3IKVA 5CKTA 5M3FJ 2A69F 3OYEA 2Z99A 4M9SA 3F22A 5GP9A 1TWFJ 1JT6A 3MKWB 1N75A 1X1CA 2HYJA 1MBJA 3COAC 5LEJA 5LBQA 3WGGA 2M30A 1X3UA 3OYGA 2VONA 3H0GJ 5AIQA 2EIKH 5EG0B 1VTNC 2VBYA 4Y3OA 2X6OA 4NB5A 1QNTA 3QPSA 4DJAA 1K4TA 1B9MA 5TRDA 2LKSA 2G9WA 3EUHC 2AQFA 3OR2C 2FUG2 3DKYA 4I99C 3WE3A 3TKYA 3OL4A 3G73A 4HX4A 2QA4I 1FBQA 4IEJA 1UG2A 3G71I 2IJLA 2KT0A 2DPDA 5B1AH 1ETOA 1TL8A 4X0GA 4FETA 3F21A 3HDDA 4UVAA 5D5XB 3H5RA 3FXUA 2JT1A 2RNGA 4XM3A 1IRZA 2E1CA 3Q9VA 2DDBA 1UG0A 3R6SA 5GAHJ 2WWYA 3A1YA 1P7IA 5EEAA 2P0WA 1Z3XA 4PSWA 3AAFA 1QVUA 1V4RA 4Q4ZF 4D1QA 2WV1A 1RKTA 2PJRB 2HI3A 3QP5A 3BR3A 2EZKA 3I4NJ 5EEHA 3DEWA 4ZJZA 1LJ9A 3HZJA 1IUFA 1QZYA 1RZ4A 5J6XA 1J09A 2PMHA 4BJ5C 1D1CA 2IXSA 1UB9A 1R58A 4KIFA 2IGKA 5A2QK 2VUMJ 4HPQA 4LB6B 3W6KB 5GTIC 3OYDA 3M3YJ 3E5XA 4BHPA 5HS7A 5FKNA 3VDXA 2QQBA 2VOOA 2P6TA 1JT0A 2X6WA 1WH5A 4A3GJ 3GW2A 4KN4X 3L2UA 2MD0A 2A07F 4B8XA 5J1YA 2AXTC 2VKVA 1S8NA 3G1MA 3HYIA 4O5VA 4HQMA 5EJCA 3RKQA 1KU9A 4BS9A 1IN7A 3OV8A 1VQ7I 1LNWA 3LA7A 3BJOA 4M3EA 2HDWA 1WJBA 3MEXA 2DMNA 4IJAA 4IHVA 2ACJA 4AIDA 1I27A 2TDXA 4DYCA 3JAMZ 2KPMA 2Q8KA 3E7LA 4HLYA 4L9TA 3CJRB 2EZLA 5E1ZB 3HOTA 4CCNA 4LLNA 4XRSG 3KP6A 4A3IJ 3BG6A 4XOPA 1KA8A 4II3A 5J4VA 3JRBA 5FGMA 4RGXA 2P6SA 2RREA 1XCVA 3KP7A 3WE2A 4L0ZB 1GV5A 3R0JA 1T6SA 3MKYB 2K4BA 1FTZA 1E3HA 2DTRA 3S2DJ 4KYWA 2VI6A 4V2GA 2CRGA 3KYCB 2LTPA 4KT5C 4LG3A 1MNEA 1F43A 1B4AA 3G6EI 3TMOA 4DIQA 4EMSA 3CZ6A 1T95A 3KYDB 4BQQA 3L2QA 2P4WA 3GXOA 2GOXB 2V1DA 2A61A 3A0HC 1KQ0A 3DEEA 2FE3A 3O2PE 5DYMA 2JA5J 1V5GA 3AFHA 3JRIA 5HS9A 4NBQA 3F72A 2BVLA 1L3LA 1B1BA 3UNGC 3O6BB 5ICGA 3B73A 3CUQC 2CQNA 1JJ8C 1G59A 5IT3A 1DPUA 3FMQA 2F5DA 4DBRA 1X1AA 9ANTA 2KRHA 1MD0A 2MABA 2RNJA 1AKHB 5AIPA 4PCQA 1JI8A 3CD6I 3HOUJ 1OKRA 5CQGA 4PGHA 3VYRB 2VJJA 1WHUA 4M74A 4BHCA 1XGSA 2CV1A 2E60A 1PUFB 1NK3P 1YJWI 3WTWC 2FA5A 3DPTA 2YU9J 1IGNA 4BY7J 2R7UA 1BR1A 5ICEA 2IVMA 3EUAA 4N0BA 2LKPA 1X19A 2ZXWH 2V9VA 2Y9ZA 3F3XA 3UR3C 1TP4A 3GVAA 5EYRA 1Z6TA 3PFIA 2M0MA 2LR8A 2ESNA 3IL2A 1E17A 3CP2A 2XUBA 3F6VA 4GGGA 1O7LA 3DTEA 5TGTA 5J8CA 4LLLA 1YX3A 5E20A 2HYGD 1XMKA 3GLLA 2ZMEA 5CVJA 1ON1A 1WWXA 3OS2A 2UWMA 4BQOA 1LEBA 2DBBA 1HOMA 1XN7A 2QENA 1WI9A 2XGCA 1EH7A 1FYKA 2M34A 5FFZA 4E7LA 4CUGA 4OIOF 1OYWA 1ZYRF 2Y2ZA 3CMYA 2L9NA 2YX4A 5A2QZ 3GZNB 5JHFA 1I1GA 4LIUA 3H3ZA 4Y33A 1JHFA 4FASD 1AOYA 1DUXC 2IEKA 4QWQA 2LH9A 2PG4A 3BR0A 4LIVA 4RAYA 2G7HA 3JSOA 3BQYA 4KMFA 1B72B 2G0EA 1HW2A 5JHUA 1LEAA 2EFPA 2PI0A 2H1LA 4ANJA 3S3MA 4JK1X 4D5FA 3L00A 4MTEA 4CSWA 2F5FA 5LRRA 4CXFA 1R7JA 2O5RA 3C2HA 2DMQA 4OAZA 2Y0MA 2VE9A 1Z9CA 1C0WA 3ROUA 2FQ3A 1K61A 2KQRA 4B48A 3CMEI 1FTTA 4R8HA 3PL8A 4V19K 2QKMB 5FKOA 4ZDLA 1RC9A 3H5NA 3DF8A 1U5TA 3RCOA 5EF6A 3OYHA 4M71A 3T0YA 1U3EM 1Y0NA 3U2RA 1SVMA 1BIAA 3MFKA 1HQCA 4LFUA 2DFEA 3Q0UA 3CUOA 3GFIA 1OQYA 2OA4A 4Y4RA 2ZXIA 3KLNA 3HKZA 3H3VK 3T8TA 4UUSA 3BZCA 2L4MA 4GXOA 4PFOA 4WWCA 2DT7B 3HPGA 2R7QA 2JVHA 2XPWA 4BEHA 4BBSJ 4WF2A 1IN4A 4DQ2A 3FXQA 1FPQA 1ZN2A 2ID6A 2WAFA 4DYRA 1VQPI 1MBKA 2K3PA 1ZQ3P 1OPCA 1ZTRA 2IGNA 2NS0A 4W1UA 2FRHA 4NUBA 4XBFA 2KIMA 5IYCJ 2M2EA 2DAOA 2BW3A 3WGHA 5IYBJ 4ETSA 1A36A 1MBFA 2P7CB 1TW2A 2D1HA 2NOJB 2VKDA 3HKZN 4B47A 4WCGA 3TDZC 3L2CA 4LOCA 1JTYA 2VASA 2VQHA 4CCJA 4CDGA 1W5TA 3SHFA 3K4KA 1GT0C 3MZHA 4M6XA 3V7RA 4A5NA 2OJED 3FM5A 3G4SI 1IN8A 4BJTA 2X1CA 3LSMA 4PJLA 1U8BA 5IYDJ 1R4MB 5HLHA 2CQQA 2M7BA 4E7SA 3RPUD 2ADUA 2L2OA 2ZFUA 1X3ZB 4XSZF 1OMIA 2K40A 1XTAA 2DMTA 3Q0WA 3WTYC 3MD2A 1Z6RA 5JLXA 2HWVA 4ENNA 1HXDA 1FMWA 1RESA 3IRRA 2EINH 1R5ID 5IOZA 4XRSA 3R61A 5B5EC 3EUKL 2KJCA 2D1VA 2KDZA 3PO2J 2NVUB 2ISZA 1ZLKA 2QSHX 3A01A 2YU3A 4LG0A 3IHUA 1JGSA 5IOYA 3NWSA 3P5JA 2M4KA 1YW9A 3WU1B 4EQQA 2BBYA 2W57A 3HGGA 3QYBA 1IXSB 5JLWA 3TO6A 4WK8F 4OIRF 4ENMA 1FSEA 4A3MJ 3SDBA 2R7VA 2HYFA 2M8GX 3R0AA 3S1QJ 3GEZA 4RB1A 3PUBA 1OFCX 2OC6A 4G9YA 2Z9OA 4Y7NJ 2XROA 4L5IA 4AU7A 4MQ9F 4HNTA 5K7HA 1YO5C 5LFAA 2GM4A 1YQAA 4BUPA 4H4KC 3U9GA 2IP2A 2R7DA 3ZMVA 1IXRC 3JREA 3JTGA 4KJZA 1FSHA 3DTKA 1MMSA 4JOMA 3RSNA 2DJIA 3FX3A 4ZTJA 4EM0B 5HLGA 2EJRA 2WA0A 1S5LC 1W7PA 2O3FA 4L5JA 2FNPA 4H0EA 3F8NA 4ESFA 1MH4A 2DT6A 3GO5A 4P1WA 3ZQ7A 4XORA 4F7ZA 4MEYF 3HSFA 1BL0A 1HC8A 3BQZA 2ZC2A 2DJNA 2CUJA 1ERDA 1YIJI 1ODDA 3ULQB 5JR3A 1TWAJ 5EZHA 1QU3A 3W3CA 1OR7A 3LSJA 2CWEA 1UZCA 2LOOA 4JBAA 1DU6A 3HSRA 2XF7A 2MW8A 1BC7C 1ZARA 4KIBA 1ZK8A 3D1NI 1MIJA 1Q1HA 2W85A 2L9VA 2ESHA 4B3XA 3EYYA 4B43A 4FCYA 2XPUA 3IRQA 4FTHA 2LBFB 3K4NA 2OCCH 4CHUA 3OS1A 4KUMA 2E7WA 1EF4A 2OCEA 3ISPA 4U7BA 1KGSA 3MKLA 3FHZA 3GTJJ 2RDPA 5FKLA 1IRFA 1J59A 1MSEC 2OV7A 3FK7A 3MKZA 2FX0A 2V9PA 1SD6A 3MCZA 4B3AA 3PO3J 2V1XA 2JUGA 1BR2A 2P81A 4TV7A 2QYOA 4UUTA 1R22A 3I3LA 1ZH5A 2CFXA 3GMEA 1XC5A 1A6QA 2MC4A 2ZNYA 1IXCA 2W82A 5IP7J 2VE8A 4XLCA 3NARA 2D5VA 2DO7A 1TQPA 2J5PA 2Q1ZB 1H89C 5C4JJ 3CMAI 3IV5A 4A5MA 2E2IJ 4LMYA 4K2EA 2CW0F 2KRFA 2XGXA 2JSPA 3OSGA 5ILVA 1ZG1A 3BY6A 3RJPA 2HKXA 1MKMA 3C2BA 3T5XA 1Y1WJ 2OBPA 1BA5A 2I8DA 3ZMDA 3JTHA 2E35A 4KICA 3K6GA 4UV9A 3C1DA 3FIWA 2FSWA 4A6EA 2VN2A 3K4LA 2I5UA 3JSPA 1IV6A 1F9NA 2VC0A 1IV8A 5CVVA 5DDGA 3CUQB 3ECOA 3K9TA 1MMGA 4IL6C 2F4IA 1W36D 2ZSIB 4AVPA 2R7ZJ 1TWCJ 3M8JA 4WXDA 2A6EF 3WG7H 4XK4A 2V1UA 3VB2A 4PZJA 3H9JA 2W4SA 1W36C 1UAAA 2Y48A 3DU5A 3KEYA 4A3FJ 2EA4A 2L01A 4J00A 3FXLA 3W2WA 4M3GA 1LVKA 4DW6A 3CC7I 5L3GA 4RBOA 2FXAA 1YRNB 3K1NA 3L2VA 1R00A 5E8IA 1GUUA 3E6BA 3VOEA 2R5YA 2A3SA 2BHZA 2DFIA 2Y0SA 4V2FA 4CCOA 1D1BA 5GPCA 2ZJRF 2BY0A 4IKFA 3K4BA 1Y39A 1XGOA 2MBFA 3HOSA 1IJWC 4PDKA 1SFEA 1SAUA 1R49A 2E34A 3HIFA 3H5AA 5DM6F 4G7ZF 2ZCWA 2XKOA 3CF5F 3DFGA 4MIMA 1WH7A 3RIRA 2DN0A 2JN6A 3SFZA 1D0YA 4B44A 5JFRA 3F8CA 2EB7A 3OMYA 1EKEA 3E5UA 1DPRA 2KFDA 4ZYHA 4BDZA 3C3WA 2Y0SN
chains in the Genus database with same CATH topology
5F1JA 5E3NA 4FE4A 5DS9A 5J1YA 2VKVA 5IP6A 2JK3A 5J3LA 3G1MA 5K7ZA 2DA3A 2ECBA 5DTDA 4Y52J 3RKQA 2R0QC 4BY1J 2DA2A 3MN2A 3NAUA 1LFBA 4M3EA 5F27A 1QVTA 2ME6A 2DMNA 4IHVA 3G1LA 4DYCA 2E1OA 2AO9A 3E7LA 3CCYA 2EZLA 5HODA 3JR9A 4XRSG 3LNQA 1MBGA 2DA6A 4A3IJ 3CQZJ 3HOXJ 5FLVA 3JRBA 2EH3A 3TEDA 4I76A 1GV5A 5EG0A 1WPKA 3A02A 4AC0A 1XG1A 3FKIJ 1IC8A 1TC3C 1FTZA 3S2DJ 3LSPA 3TP0A 2VI6A 4V2GA 2CRGA 1U9OA 2LTPA 1AKHA 4A3LJ 2NOGA 4IHWA 1F43A 4L5EA 2CU7A 1AU7A 1B8IA 3M4OJ 2ME0A 3JRFA 3BTLA 3Q0VA 2LP0A 1MNMC 2XPVA 2XSDC 1PUFA 2JA5J 4JP0A 3JRIA 2JA6J 3I4MJ 4C3IJ 2XGEA 1HCRA 2JJ7A 2ID3A 1FEXA 3OSFA 1JJ8C 5IP9J 9ANTA 1ENHA 5F04A 1AKHB 3BTIA 1X2NA 1LE8B 5FLMJ 3TW6A 4M3FA 1WI3A 5BNGA 2NVXJ 4QSHA 3S2HJ 2WAQN 5FKKA 1H8AC 3HOUJ 1UMQA 1B8IB 2LKXA 5M3MJ 1GV2A 5F08A 5F0HA 2R93J 3HBLA 4MFDA 1ZR4A 3LSGA 3OOUA 1G2HA 2AHQA 1PUFB 5J1UA 1NK3P 2O8KA 4FISA 4M6VA 5E3MA 2VKEA 2YU9J 1WCMJ 1IGNA 4BY7J 5J1RA 1A6IA 2M0CA 2E2JJ 4BBRJ 2E19A 1F36A 1RR7A 3GBGA 2Y9ZA 3IH3A 3TP3A 5EYRA 4X1EA 1JKPC 2LR8A 2JMWA 2FD5A 3GTPJ 1B72A 3BTCA 1A5JA 3LOCA 5F0CA 4DYQA 1JKQC 1HOMA 2XGCA 3BTJA 4JYKA 5EZGA 2M34A 2DA4A 2RAEA 3IH4A 2TRTA 2Y2ZA 3RQIA 3CMYA 1X58A 1ZGWA 3QPLA 2GLOA 1TWHJ 3A01B 1IDZA 5C4XJ 4DZJA 2IEKA 3S1NJ 4B4CA 3BR0A 1OCTC 1OJLA 2IBDA 3BQYA 4JX5A 3JRAA 1B72B 3GTOJ 2G0EA 1K83J 5IPAA 3MVPA 4D5FA 2R92J 4D7NA 2HOTA 2XGDA 1HF0A 3S15J 1RPWA 2LY9A 2DMQA 1K61A 5M5YJ 1HDPA 1H88C 2JA7J 2JA8J 4BXXJ 4G12A 1FTTA 2L7MP 2K9NA 4J19A 2E2HJ 5FKOA 2EQRA 4A3DJ 1QRYA 1ZKGA 2LFBA 5EF6A 4XIDA 2OF7A 2COBA 4IHYA 3SFIA 3S1RJ 1RETA 2H1KA 2R5ZA 2X48A 1MH3A 3Q0UA 3ZQLA 4DZPA 3H3VK 1RKWA 4UUSA 2YUSA 3HGYA 2HQ5A 3HOWJ 3RZOJ 2LLKA 1ZR2A 2Y9YA 3S1MJ 1JGGA 2XPWA 1JKOC 4BBSJ 1LE8A 3O8GA 3BR2A 2ID6A 4DYRA 3VPRA 4A3KJ 1MBKA 3HM5A 1ZQ3P 1E3OC 1ZTRA 2DTZA 4W1UA 1T33A 5IYCJ 2IAIA 2HDDA 1ETXA 2M2EA 3K2AA 3QQAA 5IYBJ 4A3BJ 1MBFA 1T56A 2R5ZB 3HKZN 2JWTA 3K7AJ 1BJZA 1X2MA 3S14J 3TW7A 4LOCA 1JTYA 4W97A 3PM1A 2WB1N 1GT0C 4C3JJ 4UUSB 1JUSA 2EBIA 2N8GA 3S17J 5M5WJ 4HNVA 1O4XA 1SFOJ 1U8BA 5IYDJ 2CQQA 2L9RA 1Q1VA 3BG5A 3FK6A 3A03A 2HXIA 1BW6A 2VPRA 1I50J 3HB9A 1U9NA 1D5YA 5EDNA 1CQTA 2K40A 5GPAA 2HOSA 1POGA 1Z77A 2DMTA 2DMUA 3Q0WA 5JLXA 1FJLA 3OIOA 1R9TJ 2XB5A 1RESA 3G1OA 2NVQJ 3ZQCA 3GTLJ 5E3LA 5IOZA 4XRSA 1LFUP 4C3HJ 4A69C 2KDZA 2DA5A 3ZQHA 3JRDA 3PO2J 1ITYA 2NS7A 2MG4A 3DCFA 3A01A 1JKRC 3WHCA 5IOYA 1SANA 3BR6A 3JRHA 1JUPA 3L1PA 2L0KA 4BKXA 2FQ4A 3HGGA 1S7EA 2Y30A 3F0CA 5M5XJ 3S16J 5JLWA 5C44J 3HOVJ 4A3MJ 2M8GX 5EGOA 1QPIA 3S1QJ 2CQXA 4B1RA 1OFCX 2NVYJ 1ORKA 2NS8A 3GTKJ 4RDUA 4Y7NJ 2YS9A 2ELKA 2CJJA 4D5CA 5K7HA 3GTQJ 2GM4A 1ETQA 1FIPA 3GTGJ 2XB0X 5FKMA 4S0HB 3JREA 2GBYA 3W6VA 1VNDA 2QCOA 1I6HJ 2I10A 3UKGA 1ETKA 1IDYA 2DMPA 5EGOB 3JRGA 4A3JJ 3CDLA 2FJ1A 1MBEA 1MH4A 2X9DA 3Q3SA 4AUXA 1BL0A 3BQZA 4QTRA 4GFBA 5C3EJ 4D7MA 4CYCB 2DJNA 2EZHA 2K9SA 1TWAJ 5EZHA 4AYBN 1GVDA 1TWGJ 4JX6A 2R5YB 3LSJA 1HDDC 2NVTJ 2EZIA 1VFCA 1DU6A 2MGQA 2TCTA 3ZOBA 1JUMA 3LSRA 4A3EJ 1NTCA 1I3QJ 2MW8A 2ZB9A 3GTMJ 3D1NI 1ZK8A 2O7OA 3BG9A 3SDGA 5K7FA 2OPTA 1ETWA 4XRMA 2L7ZA 1W0UA 4FCYA 1GDTA 2XPUA 4FTHA 3HEFA 3SJMA 1AHDP 2DA1A 4FE7A 1EF4A 3WHBA 2B63J 2ECCA 3MKLA 2H8RA 3GTJJ 1VF9A 5E3OA 5F0FA 4EEFG 5FKLA 3JRCA 2LD5A 1MSEC 1MBHA 1Y1VJ 2L7FP 3FK7A 3HOYJ 3B6AA 2FX0A 4C2MJ 4B3AA 2DA7A 3BG3A 3PO3J 1VI0A 3RZDJ 2P81A 1MSFC 1IG7A 2HXOA 4UUTA 1P7JA 4M3BA 1XS9A 4NDLA 1XC5A 1BW5A 1DU0A 1UHSA 2PMZN 4MO7A 2XRLA 5IP7J 2HOAA 3NARA 2CUEA 2QF7A 2D5VA 5M3FJ 1H89C 5C4JJ 5GP9A 1TWFJ 4QIWN 1APLC 1JT6A 3IV5A 2E2IJ 1ETYA 2HYJA 1MBJA 1ETVA 2M9HA 3BR5A 3OSGA 3FISA 3IH2A 1W0TA 3H0GJ 4IHXA 5EG0B 3ZQGA 3ZQFA 3C2BA 4A3CJ 2W48A 1FIAA 1Y1WJ 2X6OA 2MSYA 1BA5A 4JX4A 3QPSA 1YRNA 3BR1A 2LK2A 3FIWA 1IV6A 2LVSA 4IEJA 2Y31A 1UG2A 1WGXA 2KT0A 2R7ZJ 1TWCJ 1ETOA 1OCPA 4I6ZA 3HDDA 4XK4A 4ABZA 1U78A 4X6AJ 1IRZA 4A3FJ 4MFEA 4M3DA 4M3GA 4DW6A 1JJ6C 1P7IA 4RBOA 5EEAA 1YRNB 4CYCA 1JTXA 1QVUA 3O8HA 2WV1A 1RKTA 1GUUA 3ZQIA 2HI3A 2CUFA 2R5YA 4V2FA 5GPCA 3BR3A 2K9QA 2EZKA 3I4NJ 3DEWA 1IJWC 1IUFA 1NK2P 1Z0XA 4MLOA 3B6CA 4MIMA 2VUMJ 4A93J 1WH7A 3HOZJ 3M3YJ 1HLVA 2DN0A 2JN6A 3BT9A 5FKNA 4XICA 5FJ8J 1JT0A 1WH5A 4A3GJ 2O9LA 2Y0SN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F1J A;  5E3N A;  4FE4 A;  5DS9 A;  5J1Y A;  2VKV A;  5IP6 A;  2JK3 A;  5J3L A;  3G1M A;  5K7Z A;  2DA3 A;  2ECB A;  5DTD A;  4Y52 J;  3RKQ A;  2R0Q C;  4BY1 J;  2DA2 A;  3MN2 A;  3NAU A;  1LFB A;  4M3E A;  5F27 A;  1QVT A;  2ME6 A;  2DMN A;  4IHV A;  3G1L A;  4DYC A;  2E1O A;  2AO9 A;  3E7L A;  3CCY A;  2EZL A;  5HOD A;  3JR9 A;  4XRS G;  3LNQ A;  1MBG A;  2DA6 A;  4A3I J;  3CQZ J;  3HOX J;  5FLV A;  3JRB A;  2EH3 A;  3TED A;  4I76 A;  1GV5 A;  5EG0 A;  1WPK A;  3A02 A;  4AC0 A;  1XG1 A;  3FKI J;  1IC8 A;  1TC3 C;  1FTZ A;  3S2D J;  3LSP A;  3TP0 A;  2VI6 A;  4V2G A;  2CRG A;  1U9O A;  2LTP A;  1AKH A;  4A3L J;  2NOG A;  4IHW A;  1F43 A;  4L5E A;  2CU7 A;  1AU7 A;  1B8I A;  3M4O J;  2ME0 A;  3JRF A;  3BTL A;  3Q0V A;  2LP0 A;  1MNM C;  2XPV A;  2XSD C;  1PUF A;  2JA5 J;  4JP0 A;  3JRI A;  2JA6 J;  3I4M J;  4C3I J;  2XGE A;  1HCR A;  2JJ7 A;  2ID3 A;  1FEX A;  3OSF A;  1JJ8 C;  5IP9 J;  9ANT A;  1ENH A;  5F04 A;  1AKH B;  3BTI A;  1X2N A;  1LE8 B;  5FLM J;  3TW6 A;  4M3F A;  1WI3 A;  5BNG A;  2NVX J;  4QSH A;  3S2H J;  2WAQ N;  5FKK A;  1H8A C;  3HOU J;  1UMQ A;  1B8I B;  2LKX A;  5M3M J;  1GV2 A;  5F08 A;  5F0H A;  2R93 J;  3HBL A;  4MFD A;  1ZR4 A;  3LSG A;  3OOU A;  1G2H A;  2AHQ A;  1PUF B;  5J1U A;  1NK3 P;  2O8K A;  4FIS A;  4M6V A;  5E3M A;  2VKE A;  2YU9 J;  1WCM J;  1IGN A;  4BY7 J;  5J1R A;  1A6I A;  2M0C A;  2E2J J;  4BBR J;  2E19 A;  1F36 A;  1RR7 A;  3GBG A;  2Y9Z A;  3IH3 A;  3TP3 A;  5EYR A;  4X1E A;  1JKP C;  2LR8 A;  2JMW A;  2FD5 A;  3GTP J;  1B72 A;  3BTC A;  1A5J A;  3LOC A;  5F0C A;  4DYQ A;  1JKQ C;  1HOM A;  2XGC A;  3BTJ A;  4JYK A;  5EZG A;  2M34 A;  2DA4 A;  2RAE A;  3IH4 A;  2TRT A;  2Y2Z A;  3RQI A;  3CMY A;  1X58 A;  1ZGW A;  3QPL A;  2GLO A;  1TWH J;  3A01 B;  1IDZ A;  5C4X J;  4DZJ A;  2IEK A;  3S1N J;  4B4C A;  3BR0 A;  1OCT C;  1OJL A;  2IBD A;  3BQY A;  4JX5 A;  3JRA A;  1B72 B;  3GTO J;  2G0E A;  1K83 J;  5IPA A;  3MVP A;  4D5F A;  2R92 J;  4D7N A;  2HOT A;  2XGD A;  1HF0 A;  3S15 J;  1RPW A;  2LY9 A;  2DMQ A;  1K61 A;  5M5Y J;  1HDP A;  1H88 C;  2JA7 J;  2JA8 J;  4BXX J;  4G12 A;  1FTT A;  2L7M P;  2K9N A;  4J19 A;  2E2H J;  5FKO A;  2EQR A;  4A3D J;  1QRY A;  1ZKG A;  2LFB A;  5EF6 A;  4XID A;  2OF7 A;  2COB A;  4IHY A;  3SFI A;  3S1R J;  1RET A;  2H1K A;  2R5Z A;  2X48 A;  1MH3 A;  3Q0U A;  3ZQL A;  4DZP A;  3H3V K;  1RKW A;  4UUS A;  2YUS A;  3HGY A;  2HQ5 A;  3HOW J;  3RZO J;  2LLK A;  1ZR2 A;  2Y9Y A;  3S1M J;  1JGG A;  2XPW A;  1JKO C;  4BBS J;  1LE8 A;  3O8G A;  3BR2 A;  2ID6 A;  4DYR A;  3VPR A;  4A3K J;  1MBK A;  3HM5 A;  1ZQ3 P;  1E3O C;  1ZTR A;  2DTZ A;  4W1U A;  1T33 A;  5IYC J;  2IAI A;  2HDD A;  1ETX A;  2M2E A;  3K2A A;  3QQA A;  5IYB J;  4A3B J;  1MBF A;  1T56 A;  2R5Z B;  3HKZ N;  2JWT A;  3K7A J;  1BJZ A;  1X2M A;  3S14 J;  3TW7 A;  4LOC A;  1JTY A;  4W97 A;  3PM1 A;  2WB1 N;  1GT0 C;  4C3J J;  4UUS B;  1JUS A;  2EBI A;  2N8G A;  3S17 J;  5M5W J;  4HNV A;  1O4X A;  1SFO J;  1U8B A;  5IYD J;  2CQQ A;  2L9R A;  1Q1V A;  3BG5 A;  3FK6 A;  3A03 A;  2HXI A;  1BW6 A;  2VPR A;  1I50 J;  3HB9 A;  1U9N A;  1D5Y A;  5EDN A;  1CQT A;  2K40 A;  5GPA A;  2HOS A;  1POG A;  1Z77 A;  2DMT A;  2DMU A;  3Q0W A;  5JLX A;  1FJL A;  3OIO A;  1R9T J;  2XB5 A;  1RES A;  3G1O A;  2NVQ J;  3ZQC A;  3GTL J;  5E3L A;  5IOZ A;  4XRS A;  1LFU P;  4C3H J;  4A69 C;  2KDZ A;  2DA5 A;  3ZQH A;  3JRD A;  3PO2 J;  1ITY A;  2NS7 A;  2MG4 A;  3DCF A;  3A01 A;  1JKR C;  3WHC A;  5IOY A;  1SAN A;  3BR6 A;  3JRH A;  1JUP A;  3L1P A;  2L0K A;  4BKX A;  2FQ4 A;  3HGG A;  1S7E A;  2Y30 A;  3F0C A;  5M5X J;  3S16 J;  5JLW A;  5C44 J;  3HOV J;  4A3M J;  2M8G X;  5EGO A;  1QPI A;  3S1Q J;  2CQX A;  4B1R A;  1OFC X;  2NVY J;  1ORK A;  2NS8 A;  3GTK J;  4RDU A;  4Y7N J;  2YS9 A;  2ELK A;  2CJJ A;  4D5C A;  5K7H A;  3GTQ J;  2GM4 A;  1ETQ A;  1FIP A;  3GTG J;  2XB0 X;  5FKM A;  4S0H B;  3JRE A;  2GBY A;  3W6V A;  1VND A;  2QCO A;  1I6H J;  2I10 A;  3UKG A;  1ETK A;  1IDY A;  2DMP A;  5EGO B;  3JRG A;  4A3J J;  3CDL A;  2FJ1 A;  1MBE A;  1MH4 A;  2X9D A;  3Q3S A;  4AUX A;  1BL0 A;  3BQZ A;  4QTR A;  4GFB A;  5C3E J;  4D7M A;  4CYC B;  2DJN A;  2EZH A;  2K9S A;  1TWA J;  5EZH A;  4AYB N;  1GVD A;  1TWG J;  4JX6 A;  2R5Y B;  3LSJ A;  1HDD C;  2NVT J;  2EZI A;  1VFC A;  1DU6 A;  2MGQ A;  2TCT A;  3ZOB A;  1JUM A;  3LSR A;  4A3E J;  1NTC A;  1I3Q J;  2MW8 A;  2ZB9 A;  3GTM J;  3D1N I;  1ZK8 A;  2O7O A;  3BG9 A;  3SDG A;  5K7F A;  2OPT A;  1ETW A;  4XRM A;  2L7Z A;  1W0U A;  4FCY A;  1GDT A;  2XPU A;  4FTH A;  3HEF A;  3SJM A;  1AHD P;  2DA1 A;  4FE7 A;  1EF4 A;  3WHB A;  2B63 J;  2ECC A;  3MKL A;  2H8R A;  3GTJ J;  1VF9 A;  5E3O A;  5F0F A;  4EEF G;  5FKL A;  3JRC A;  2LD5 A;  1MSE C;  1MBH A;  1Y1V J;  2L7F P;  3FK7 A;  3HOY J;  3B6A A;  2FX0 A;  4C2M J;  4B3A A;  2DA7 A;  3BG3 A;  3PO3 J;  1VI0 A;  3RZD J;  2P81 A;  1MSF C;  1IG7 A;  2HXO A;  4UUT A;  1P7J A;  4M3B A;  1XS9 A;  4NDL A;  1XC5 A;  1BW5 A;  1DU0 A;  1UHS A;  2PMZ N;  4MO7 A;  2XRL A;  5IP7 J;  2HOA A;  3NAR A;  2CUE A;  2QF7 A;  2D5V A;  5M3F J;  1H89 C;  5C4J J;  5GP9 A;  1TWF J;  4QIW N;  1APL C;  1JT6 A;  3IV5 A;  2E2I J;  1ETY A;  2HYJ A;  1MBJ A;  1ETV A;  2M9H A;  3BR5 A;  3OSG A;  3FIS A;  3IH2 A;  1W0T A;  3H0G J;  4IHX A;  5EG0 B;  3ZQG A;  3ZQF A;  3C2B A;  4A3C J;  2W48 A;  1FIA A;  1Y1W J;  2X6O A;  2MSY A;  1BA5 A;  4JX4 A;  3QPS A;  1YRN A;  3BR1 A;  2LK2 A;  3FIW A;  1IV6 A;  2LVS A;  4IEJ A;  2Y31 A;  1UG2 A;  1WGX A;  2KT0 A;  2R7Z J;  1TWC J;  1ETO A;  1OCP A;  4I6Z A;  3HDD A;  4XK4 A;  4ABZ A;  1U78 A;  4X6A J;  1IRZ A;  4A3F J;  4MFE A;  4M3D A;  4M3G A;  4DW6 A;  1JJ6 C;  1P7I A;  4RBO A;  5EEA A;  1YRN B;  4CYC A;  1JTX A;  1QVU A;  3O8H A;  2WV1 A;  1RKT A;  1GUU A;  3ZQI A;  2HI3 A;  2CUF A;  2R5Y A;  4V2F A;  5GPC A;  3BR3 A;  2K9Q A;  2EZK A;  3I4N J;  3DEW A;  1IJW C;  1IUF A;  1NK2 P;  1Z0X A;  4MLO A;  3B6C A;  4MIM A;  2VUM J;  4A93 J;  1WH7 A;  3HOZ J;  3M3Y J;  1HLV A;  2DN0 A;  2JN6 A;  3BT9 A;  5FKN A;  4XIC A;  5FJ8 J;  1JT0 A;  1WH5 A;  4A3G J;  2O9L A;  2Y0S N; 
#chains in the Genus database with same CATH topology
 5E3N A;  2DK5 A;  2M3A A;  5IP6 A;  3M7G A;  2BXY A;  1W5C C;  2FEZ A;  2ECB A;  2FF4 A;  3QPH A;  5ICF A;  3J7A O;  4A0Z A;  3MN2 A;  3DKW A;  1WZ2 A;  3BJA A;  4U0Y A;  1LFB A;  2BZT A;  4E7K A;  4GRI A;  3K4J A;  1PDN C;  2XVC A;  2A5Y B;  1ZG5 A;  1EJ9 A;  4L9V A;  4IHS A;  3G1L A;  2KIU A;  3QPT A;  4M9Z A;  2BXZ A;  3TOA A;  2F4O B;  2QKL B;  5D8L B;  1O3Q A;  3CCY A;  3G3Z A;  3D5S C;  5HOD A;  4M6Y A;  2OZU A;  3LNQ A;  4MEX F;  2XAU A;  2XAS A;  1TBX A;  1I3A A;  2CSO A;  5FLV A;  5DCM A;  3TED A;  3DQV C;  1EH6 A;  3ZRG A;  3BP8 A;  4GYG A;  4G6Q A;  4FHT A;  1OCR H;  3K2Z A;  3SZG A;  1G3W A;  2K27 A;  1HSJ A;  2EIM H;  3FKI J;  4I0A A;  1LDK B;  3TGN A;  1XD7 A;  3V42 A;  3LSP A;  1GLN A;  1AKH A;  4A3L J;  1U9O A;  4HRI A;  2YR2 A;  4IHW A;  4HW0 A;  1FY7 A;  2CU7 A;  3I54 A;  1AU7 A;  3F8B A;  2M7A A;  3M4O J;  2WAQ A;  3Q0V A;  2LY2 A;  2VJI A;  1FWZ A;  2L9S A;  2LP0 A;  1T39 A;  3W2V A;  4QLC U;  2XSD C;  1PUF A;  2W1O A;  3EET A;  4JP0 A;  2UZK A;  5LHI A;  2XGE A;  1HCR A;  4OMY A;  4ITV A;  3ABT A;  2IRF G;  4CIC A;  4AM3 A;  3KYL A;  4BYY A;  3CP8 A;  2OUM A;  2X6X A;  4BNC A;  4KT6 A;  1XSV A;  4IO9 F;  5FLM J;  1ZRD A;  4M3F A;  1WI3 A;  3TQN A;  3DWL E;  4FX0 A;  3S2H J;  2WAQ N;  2YX7 A;  2HVS A;  4FX4 A;  5M3M J;  2LKX A;  1GV2 A;  5F08 A;  3I4P A;  3FKJ A;  5F0H A;  2R93 J;  3FWE A;  3LSG A;  1FBU A;  2AHQ A;  2BHY A;  5J1U A;  5GAD J;  1D0Z A;  6PAX A;  2KLO A;  3ASO H;  3I71 A;  1AWC A;  1P4W A;  2K4J A;  3IKT A;  4U0W A;  1A6I A;  2M0C A;  3IC7 A;  3WTV C;  1V3F A;  2F5E A;  2E2J J;  2E19 A;  2E71 A;  2L3D A;  2UXN A;  2VJ5 A;  3L9F A;  2GQQ A;  3TP3 A;  3RDI A;  4X1E A;  5HLI A;  1JKP C;  3CCE I;  4BAC A;  1NH3 A;  1O3R A;  2JMW A;  2M8E A;  4MHG A;  1YFH A;  1B72 A;  1A5J A;  1X1B A;  3S3N A;  1VQO I;  2XAG A;  1ZHF A;  3DLL F;  4DYQ A;  4U88 A;  2WY7 Q;  3BTJ A;  3X2Q H;  3MMY B;  1R1T A;  5DUK A;  5EZG A;  4LIT A;  4RM2 A;  2BV6 A;  3IH4 A;  4OIN F;  3S32 A;  4I02 A;  5F64 A;  5BQT A;  3RQI A;  3PJR A;  3QPL A;  1A04 A;  1IDZ A;  3D5L A;  4XLE A;  2K02 A;  2VJ4 A;  5ED4 A;  4HAM A;  4L9J A;  4UUV A;  1OJL A;  3I59 B;  3R4K A;  1XMX A;  1W4M A;  2EPF A;  3H92 A;  5IPA A;  1G3Y A;  3ZMZ A;  3LSH A;  4BXU A;  4EJV A;  3SZT A;  4HQE A;  3FMS A;  2KDO A;  2R92 J;  2HOT A;  3JCU C;  1USS A;  1UHW A;  1RPW A;  3LL7 A;  3K1M A;  5M5Y J;  1KU2 A;  1F4K A;  1KON A;  2E5Z A;  1WVR A;  4G12 A;  1FBS A;  4L9N A;  1YLF A;  5D5U B;  4J19 A;  2VT2 A;  2B7E A;  2E2H J;  2DOA A;  2OAZ A;  4A3D J;  1QRY A;  1R6R A;  4IHY A;  2PX9 A;  3S1R J;  1RET A;  4KFC A;  2X48 A;  1XCB A;  4RB3 C;  5FFX A;  4LB5 A;  3G2B A;  5CVU A;  4HYE A;  5FRM A;  4R1H A;  2NYX A;  1F5T A;  3E0J B;  1R1U A;  2JA2 A;  2XC7 A;  4PJJ A;  2CGP A;  2YUS A;  2E5N A;  3HGY A;  5K5R A;  2LY1 A;  2ZSH B;  1QGP A;  2WB1 A;  3VFZ A;  4EV0 A;  3S1M J;  3K4C A;  1JKO C;  1P4X A;  3FHN A;  1LE8 A;  1O57 A;  4P96 A;  3BR2 A;  4O3M A;  3VPR A;  5KCM A;  2EWN A;  3HM5 A;  4UHT A;  3V4G A;  3VSL A;  1IAW A;  2Z1D A;  3CCJ I;  3GZ5 A;  1ETX A;  3GWZ A;  4NHJ A;  4A3B J;  3VSK A;  1YS6 A;  3H1C A;  3K7A J;  4OU0 A;  1XGN A;  3J7A Y;  3TW7 A;  5LHG A;  1YYV A;  4ZYE A;  3CDH A;  4W97 A;  5TIS C;  2K3F A;  3IWF A;  2WB1 N;  3CJN A;  3BPX A;  4ZDP A;  2ELJ A;  5J8F A;  1S3J A;  1QQI A;  5FO5 A;  3RKY A;  3LAP A;  1I1S A;  1D5V A;  5HNH A;  5FRO A;  3TO9 A;  2IT0 A;  3ABU A;  2F2E A;  2NXN B;  1IO2 A;  1Q1V A;  1XSX A;  3FK6 A;  4NNJ A;  2HXI A;  1ZGA A;  1FP1 D;  2FMY A;  2VPR A;  2VOD A;  3EUH A;  5DM7 F;  1I50 J;  3FBI B;  1D5Y A;  1CQT A;  4A2U A;  4UXN A;  1POG A;  2VT3 A;  1Z77 A;  3RYP A;  2DMU A;  5LHH A;  3CCM I;  3AG2 H;  3OIO A;  4BDY A;  2WAE A;  2XB5 A;  3ZQC A;  1ULY A;  1LFU P;  4MNU A;  4XON A;  1K78 B;  2OTL I;  3HSE A;  2LF7 A;  2Z2S B;  1ITY A;  1J5Y A;  3KP4 A;  2R7X A;  2MG4 A;  3WTZ A;  2FOW A;  2MLG A;  4I09 A;  5CQE A;  4ENK A;  4BE2 A;  4RLQ A;  5ILU A;  3BR6 A;  4LLG F;  3NEU A;  4XN0 A;  3SQN A;  1RRJ A;  3L1P A;  1ZG3 A;  5FLX K;  4BKX A;  4C2U A;  2FQ4 A;  3CJT B;  4CCM A;  3F0C A;  3OIQ A;  1SVO A;  5C44 J;  2PMU A;  1YOV B;  1MDM B;  3BPV A;  2V26 A;  2QLZ A;  2NVY J;  1FOW A;  2NS8 A;  4RDU A;  2R7F A;  2ZFW A;  5FD6 A;  2R7T A;  1ZLJ A;  1QPM A;  4AIK A;  2F48 A;  2EV5 A;  4Y17 A;  5L3D A;  3IUO A;  1U8R A;  3RYR A;  1ETQ A;  1IRX A;  2XB0 X;  3Q9S A;  4S0H B;  4N9H A;  4E7J A;  2BYV E;  2CO5 A;  3KZI C;  4IRG A;  5LLQ A;  2GBY A;  3OYL A;  1FMV A;  3W6V A;  1XDU A;  2QCO A;  1I6H J;  1ETK A;  1YHQ I;  2DMP A;  4BQN A;  3DV8 A;  1TT0 A;  2QBY B;  4RB0 A;  1K79 A;  4XKV A;  3PNY A;  1KQ9 A;  4PJ0 C;  2HQN A;  2E1M C;  2LBF A;  3QAH A;  1W7P D;  4HSR A;  4BAY A;  3K10 A;  3SZP A;  2F5V A;  1Z7U A;  3HHH A;  5BS6 A;  5L3F A;  4CH7 A;  4A0X A;  3ZMS A;  1ZRE A;  3D0S A;  3LSK A;  3CLQ A;  2R7S A;  2AS5 F;  2Z5U A;  2EZI A;  1VFC A;  3CES A;  1R1V A;  2KKO A;  3M9A A;  3OYC A;  1NTC A;  2QWW A;  1SC7 A;  2BVM A;  1VQ4 I;  5GTH C;  5FB2 A;  2CV0 A;  3V7S A;  5FD5 A;  5LEK A;  1T0F C;  3WTX C;  1IW7 F;  3QOD A;  4UVB A;  1FT9 A;  4ZYD A;  5DEQ A;  1BBY A;  4LJZ F;  1HKQ A;  1WJF A;  4EVI A;  1AHD P;  1FP2 A;  2DA1 A;  3QWL A;  2CW8 A;  5DCF A;  3J80 K;  1S6L A;  1N77 A;  1UEL B;  1Y6I A;  4L18 B;  1BR4 A;  3CC4 I;  3GFM A;  4ZTF A;  1YG2 A;  1P2F A;  1VQ5 I;  4IQJ A;  1Z91 A;  3HL2 A;  3QOE A;  3RI4 A;  1KU7 A;  3KCC A;  1OYY A;  1ZAO A;  3JRC A;  3TO7 A;  2E1N A;  3GX4 X;  3ABL H;  3S3O A;  4QPO A;  2M4G A;  3T1B A;  3T8R A;  4C2M J;  3WGI A;  1RR8 C;  2XAJ A;  4YII A;  4PJM A;  2KIF A;  3N05 A;  3AG3 H;  1MSF C;  1VQL I;  5LD2 C;  2VXD A;  1SAX A;  3LFK A;  1WSU A;  2HXO A;  1P7J A;  2FU4 A;  1WKM A;  4M3B A;  4PFP A;  1XS9 A;  2O61 A;  3F23 A;  1SMY F;  1Y8R B;  2VL8 A;  4E7H A;  1DU0 A;  2DQL A;  1UHS A;  2IW5 A;  2XRL A;  2EV6 A;  2QF7 A;  3CUQ A;  1MJA A;  1D1A A;  2HS5 A;  2HDC A;  1APL C;  2STT A;  4XOT A;  3PSI A;  3CCS I;  3PNT A;  2P8T A;  4E4H A;  4MGR A;  1ETV A;  2M9H A;  3BR5 A;  3D5R C;  4CZZ A;  3IH2 A;  1W0T A;  3S2W A;  1MGT A;  1O3S A;  2VC1 A;  2R7R A;  1WQ2 A;  2NNN A;  3HTU A;  3ZQG A;  5K5O A;  2DPU A;  5KVR A;  4C9Y A;  1H0M A;  4A3C J;  1FIA A;  2MSY A;  4OAY A;  1YRN A;  1RIO H;  1U0J A;  3BR1 A;  3V8L A;  2LK2 A;  2HEO A;  2VQC A;  4P55 A;  4CZC A;  4RB2 C;  2DW4 A;  2EA2 A;  2EFO A;  4ZC3 A;  2BY2 A;  4U87 A;  2LVS A;  4NQW B;  2HZT A;  2VIX A;  1Z67 A;  2Y31 A;  3EPZ A;  3FXR A;  2UV1 A;  1BM9 A;  1PJR A;  3V8K A;  4EAT A;  1LB2 A;  2IS2 A;  5LRS A;  2D45 A;  2L5Q A;  3GYH X;  4ABZ A;  1U78 A;  4YEL A;  5L3E A;  4Q5S F;  2VB6 A;  4M3D A;  3KFW X;  2RQQ A;  1JJ6 C;  3VWB A;  2KZV A;  4KN7 X;  4CYC A;  1GHC A;  3RPQ A;  2XIG A;  3I0T A;  4A12 A;  3O8H A;  1KYZ A;  2PLY A;  3QYF A;  4RAZ A;  2HVR A;  2CUF A;  5HS8 A;  4D9J A;  3A2K A;  4EM2 A;  1ON2 A;  5D4S A;  3WU2 C;  5K5Q A;  1YJN I;  4Q47 A;  1GVJ A;  3ZR8 X;  4HNU A;  3HUG B;  5LGU A;  2ZBK A;  3P9K A;  3CCV I;  3LST A;  4E7Z A;  1NK2 P;  1Z0X A;  3LQQ A;  4IRH A;  3HOZ J;  2RGV A;  3EYI A;  4ENJ A;  3NWT A;  1HLV A;  3L7W A;  2GAU A;  2ZKZ A;  3PSF A;  5FJ8 J;  2FML A;  2MH9 A;  3I9V 2;  2IA1 A;  4XSX F;  1U6G A;  1SVL A;  5DS9 A;  1QHH D;  5HVQ C;  4HA8 A;  3KEO A;  1CGP A;  2JK3 A;  3MAJ A;  2HOE A;  5H2F C;  5J47 A;  3F9K A;  1A31 A;  1VQ9 I;  2GXB A;  3CC2 I;  4Y52 J;  3FXJ A;  4UB8 C;  1QBJ A;  1D8J A;  3OR1 C;  2R0Q C;  2MD5 A;  4BY1 J;  2DA2 A;  1R4N B;  1L0O C;  1HST A;  2ZJP F;  3J7Y J;  5F27 A;  3CO7 C;  2VBX A;  3SEZ A;  4BJ6 C;  1IF1 A;  1STZ A;  2RV8 A;  4DNC A;  2AO9 A;  4XN3 A;  3OIP A;  4LK1 F;  4I98 B;  5FRN A;  3JR9 A;  5D4R A;  2DOF A;  4U7D A;  3HOX J;  5H6Q A;  3BJ6 A;  3TBI A;  4ZZD A;  2EH3 A;  3OYK A;  4UV8 A;  4I76 A;  3PIP F;  1DDN A;  3ABK H;  1RNL A;  3CJQ B;  4XLF A;  5EG0 A;  1WPK A;  4XL9 A;  5CPR B;  1BI2 A;  3AG1 H;  1SFU A;  2VKH A;  1IC8 A;  5HOO A;  5BPI A;  3S93 A;  1H9G A;  3TP0 A;  4YEJ A;  2X6Y A;  4CCK A;  4OMZ A;  4BE0 A;  3L2W A;  2HR3 A;  3OOP A;  3VEP A;  1TW3 A;  2XF6 A;  2ME0 A;  3JRF A;  2A68 F;  2JZY A;  2KHM A;  1E3P A;  4HF0 A;  3JW4 A;  5B3S H;  2XPV A;  3AG4 H;  1FYM A;  1ZGJ A;  4C3I J;  4CCL A;  2EIL H;  2WC2 A;  2A6T A;  2JJ7 A;  2ID3 A;  1FEX A;  3BRO A;  1K7A A;  2RC4 A;  2W25 A;  4RS8 A;  3TDU C;  4P5O A;  4XLP F;  5H20 A;  4UVC A;  3TW6 A;  2PJR A;  1J9I A;  1H8A C;  3BCA A;  1B8I B;  2BW3 B;  1XB4 A;  4MFD A;  1ZR4 A;  4IOA F;  5F1R A;  2NAZ A;  2O8K A;  3CCR I;  1KQ8 A;  2BEO A;  3N4M A;  5J1R A;  2E7X A;  2DDA A;  3DXJ F;  3VYT B;  2QZ8 A;  2JUC A;  2V1N A;  4U0V A;  4IZZ A;  4BE1 A;  4BBR J;  4BHB A;  5GAE J;  5TJJ A;  1RR7 A;  2WY8 Q;  4EM1 A;  3HRS A;  1I5Z A;  2JRM A;  3IH3 A;  4I01 A;  4DOZ A;  5CVR A;  4F92 B;  3HC7 A;  4RM3 A;  5LGT A;  2K86 A;  4HST A;  3OY9 A;  4XR6 A;  2A6H F;  2PJP A;  1P9Q C;  1EA3 A;  4IXA A;  3GTP J;  4NC7 A;  3I59 A;  3V8J A;  2O03 A;  4UB6 C;  1HA8 A;  4WXC A;  1SFX A;  1YW8 A;  2CMP A;  3K70 D;  4IRI A;  2A05 A;  3I53 A;  3KE2 A;  3LOC A;  2DI3 A;  3M1E A;  5F0C A;  2ZJQ F;  3H9Q A;  2V6C A;  3ERM A;  4IX7 A;  4JYK A;  4XKW A;  2DA4 A;  2GIV A;  3A0B C;  5E1X A;  4A0Y A;  4KIG A;  3K70 C;  2TRT A;  3M8F A;  2BY1 A;  1LDD A;  1ZGW A;  3OL3 A;  2GLO A;  2QQ8 A;  5HDK A;  4OWR B;  5D8K B;  3A01 B;  4LG0 B;  5C4X J;  1W5S A;  2HGC A;  4HG2 A;  4PK4 A;  1E0E A;  4G7O F;  2X0L A;  2LF8 A;  4YRV A;  4B4C A;  2Q2E B;  1BN5 A;  3FXO A;  1OCT C;  4JX5 A;  3JRA A;  3GTO J;  1YI2 I;  3MWM A;  4F52 A;  3MVP A;  3J7Z I;  4D7N A;  4M73 A;  4HOB A;  1HF0 A;  2FBI A;  2LY9 A;  1PUE E;  5E8G A;  4E7I A;  3DP7 A;  4HV5 A;  1UJ8 A;  1H88 C;  2JA7 J;  4Y15 A;  2W84 A;  3KP5 A;  1K4S A;  1DP3 A;  3DBR B;  2K9N A;  2K9L A;  2KP6 A;  1ZKG A;  4KIS A;  2LFB A;  2E1M B;  2OF7 A;  1ONV A;  2COB A;  5BMZ A;  2L4A A;  3SFI A;  4HBL A;  3Q5F A;  2H1K A;  3EDP A;  5E17 F;  3ZQL A;  1T2K A;  4BU2 A;  3LQR A;  5F6F A;  4DZP A;  1RKW A;  2H94 A;  4RLF A;  3OYI A;  4L0Y B;  1G4D A;  1LFP A;  2EIJ H;  1WJ5 A;  2LLK A;  2X1E A;  4XMY A;  2K5C A;  2Y9Y A;  3E6D A;  3O8G A;  1Y8Q B;  2M87 A;  1VQ8 I;  2K9M A;  3ERE D;  1E3O C;  2MLK A;  2ELH A;  5JVG F;  3GUD A;  1T33 A;  2CQK A;  3ONQ A;  4KIT B;  2GZW A;  2JRT A;  2M5W A;  4HDV A;  1G3T A;  2B9S A;  2P5K A;  3BWG A;  3QQA A;  2MH2 A;  2JSC A;  4GDF A;  3FM3 A;  1XSD A;  4BGD A;  4ZH4 F;  1T56 A;  3ZQQ A;  2R5Z B;  2WTE A;  3AKZ A;  1X2M A;  1VQK I;  2YPR A;  2DYS H;  3PM1 A;  2KJB A;  1PP7 U;  4XNF A;  4C3J J;  3H9G A;  4ESB A;  3OYM A;  1WJE A;  3W6J B;  2EBI A;  1S7O A;  2JVG A;  1K78 A;  5HDN A;  1XX5 A;  2ZXH A;  2OD5 A;  1KZH A;  3S17 J;  4N4O B;  1KYW A;  1O4X A;  2KIQ A;  4AIJ A;  1LDJ A;  1FLI A;  2L9R A;  1GXQ A;  3BG5 A;  5BOX A;  3A03 A;  4PGG A;  2BOL A;  1XGM A;  2OQG A;  4E6K G;  3HB9 A;  2DU9 A;  1ACI A;  1SFK A;  1MDM A;  2HOS A;  1SEU A;  4IOC F;  1T08 B;  4RAF A;  1J7K A;  1BC8 C;  1FJL A;  4M72 A;  4YFN F;  1X1D A;  1S72 I;  3G1O A;  4BH9 A;  4J01 A;  3F8M A;  1DGW Y;  1UFM A;  4OIQ F;  2VOP A;  3ZQH A;  1FYL A;  1LQ1 A;  3ML6 A;  2NS7 A;  3BC8 A;  2IS4 A;  1R5H A;  3DKX A;  3CTA A;  1SAN A;  2IGO A;  1A35 A;  5D5V B;  2Z16 A;  1F1Z A;  4C2T A;  2L0K A;  2A5W A;  2XAH A;  3DBH B;  5M5X J;  1IZ1 A;  3S16 J;  3IAS 2;  3HOV J;  2HNH A;  3HTS B;  2OQR A;  4ASN A;  4AVZ A;  1ZRC A;  2HFH A;  2CQX A;  2KIS A;  4B1R A;  3K69 A;  4S04 A;  2QBY A;  1HKT A;  3CCU I;  4D0P A;  3GTK J;  2Y69 H;  4MQV A;  1PYV A;  2WAD A;  2EV0 A;  5K1Y A;  3GTQ J;  3ECH A;  3P9I A;  5HLT A;  1FIP A;  1ZEL A;  5FKM A;  3WOD F;  2ZME C;  4AYB A;  1YW7 A;  2OU2 A;  3LA3 A;  4GCV A;  2AQE A;  1Z21 A;  5ILS A;  2QUF A;  3NRV A;  3UKG A;  4Q48 A;  3GFJ A;  1N78 A;  5EGO B;  3JRG A;  1WJC A;  3CDL A;  2KZG A;  2KRC A;  2MFZ A;  1G3S A;  2V7F A;  4QPQ A;  4AUX A;  4GFB A;  2VBW A;  3HHG A;  3PQK A;  4RAG A;  4AYB N;  1GVD A;  3WTS C;  2R5Y B;  1BI0 A;  1CF7 B;  3RKW A;  1NG6 A;  2HZD A;  2MGQ A;  2TCT A;  3ZOB A;  1R71 A;  2NRA C;  2BGC A;  4ON0 A;  4A3E J;  1I3Q J;  1BI1 A;  1K6Y A;  2CV2 A;  2ZB9 A;  5DD8 A;  5KAI C;  1GXP A;  2H6C A;  1V5F A;  1VZ0 A;  3HRU A;  5K7F A;  4XRM A;  2L7Z A;  1T98 A;  1P92 A;  3REO A;  1GDT A;  2ZXJ A;  3F8F A;  1U5T C;  4XLH A;  3HEF A;  3SJM A;  5ERI A;  4FE7 A;  2B63 J;  1VQ6 I;  4ZYA A;  3KIO A;  2CG4 A;  4WX9 A;  2PMZ A;  2HPI A;  1MMN A;  4HX8 A;  2H8R A;  2HKO A;  1VF9 A;  4M9X A;  5E79 C;  2LMD A;  1MW7 A;  4EEF G;  2LD5 A;  3SEQ A;  1Y1V J;  2L7F P;  2HU9 A;  4YFX F;  3HOY J;  2KMU A;  1HBX G;  1V5E A;  2P5V A;  4Y13 A;  3HXL A;  2X51 A;  3BG3 A;  1Z05 A;  3GLX A;  3IWZ A;  1OYI A;  1LUJ B;  2WV0 A;  3P9C A;  4RMN A;  1YIT I;  3HRT A;  4HDU A;  2XAQ A;  1BW5 A;  1T38 A;  3K1P A;  2PMZ N;  4MO7 A;  2HOA A;  4NQW A;  2CUE A;  1QHG A;  3V7C A;  4QIW N;  1ETY A;  1IN6 A;  3TL4 X;  3E1S A;  4UY8 I;  1SD4 A;  5DCM B;  2P5L C;  1PP8 F;  3KZY A;  2VXZ A;  2F5C A;  4GO1 A;  3FIS A;  2EFQ A;  4IPA A;  2NNY A;  4HF2 A;  4IHX A;  3ZQF A;  3PUF A;  2W48 A;  3KP2 A;  3DEU A;  4JX4 A;  1OCZ H;  5DUI A;  4BXF A;  2CQ7 A;  2H09 A;  2QQA A;  3GFL A;  1MJ9 A;  4BQA A;  3CLO A;  3I5U A;  3GZ6 A;  3FXM A;  1WGX A;  3U1D A;  4N4N B;  1Z3Y A;  4ESJ A;  3HUG A;  3W2A A;  1OCP A;  2LNB A;  2CUZ A;  2R7W A;  4I6Z A;  1JXS A;  3TOB A;  1HW1 A;  3KZZ A;  3C7J A;  1IRG A;  2CH0 A;  1MND A;  3B02 A;  1W1W E;  5J4Y A;  4X6A J;  3OYN A;  3MZY A;  3CCQ I;  3WU0 A;  3ZMU A;  4MFE A;  3C18 A;  3SYT A;  1M1E B;  4EGZ A;  2M45 A;  1DP7 P;  4II2 A;  1JTX A;  1VQN I;  1U2W A;  3ZQI A;  2HVQ A;  1B59 A;  1TNT A;  2K9Q A;  1T8I A;  3BG7 A;  4HLX A;  3J81 K;  2COM A;  2V4J C;  2Z33 A;  1S9H A;  4UNO A;  4EJW A;  3AL0 C;  1FOX A;  5HNF A;  4JQF A;  2PN6 A;  4MLO A;  3B6C A;  4A93 J;  1REP C;  2XSJ C;  3M1C A;  2W24 A;  2DQR A;  3BT9 A;  2VPL A;  3MZ8 A;  5D6F A;  1HKS A;  5DD4 A;  4XIC A;  2X85 A;  2F6C A;  2JTV A;  2PFB A;  2O9L A;  4EJU A;  3I64 A;  5F1J A;  2IS6 A;  4FE4 A;  3I56 I;  3LA2 A;  3ZXS A;  1XMA A;  3BDD A;  5J3L A;  3IAM 2;  3OYA A;  5K7Z A;  3BLY A;  2DA3 A;  5DTD A;  1TLH B;  2XKP A;  2ISY A;  2R7O A;  3H0D A;  1D3Y A;  3S8P A;  1G6N A;  2RN7 A;  1PVE A;  3M07 A;  2LG4 A;  3NAU A;  5KNL A;  4HZF A;  1QVT A;  3QP6 A;  3KPH A;  2OTJ I;  2ZJ2 A;  2ME6 A;  3IP4 B;  1OR7 C;  1WRJ A;  2F4M B;  1EH8 A;  2E1O A;  3M8E A;  2L54 A;  2GXA A;  4OOI A;  5JVT A;  3DLA A;  1H9T A;  5H6R A;  4I7H A;  1MBG A;  2DA6 A;  3E5Q A;  2CFO A;  2XDV A;  2X1D A;  3HPH A;  3PNV A;  2PEX A;  3CQZ J;  5AON A;  1X4P A;  2VQL A;  1DQU A;  1ZRF A;  3ELK A;  2VBZ A;  3U1K A;  1UCR A;  3E6M A;  3LMM A;  5IT9 K;  5J40 A;  3A02 A;  1OIS A;  1XG1 A;  4IF4 A;  4AC0 A;  3RKX A;  2ICW G;  3FXK A;  1TC3 C;  2FOK A;  2R3S A;  1FX7 A;  4LGW A;  2PBI A;  2M1B A;  2LRD A;  2GXG A;  2NOG A;  2FNA A;  3BCB A;  3OYJ A;  4HX7 A;  4IHT A;  3CDI A;  4L5E A;  1B8I A;  2QM3 A;  1VQM I;  1QO0 D;  1MMA A;  3BTL A;  2FBH A;  2GWR A;  3K4M A;  1MNM C;  3LFU A;  3WTU C;  1BI3 A;  1XDS A;  2JA6 J;  3I4M J;  5CYV A;  4NC8 A;  1FC3 A;  1R23 A;  4KNY A;  3ZMT A;  5B66 C;  3LAJ A;  2DFF A;  2O0Y A;  3OSF A;  3DBL B;  1X3W B;  5IP9 J;  1ENH A;  3QU6 A;  5F04 A;  2QQ9 A;  1J75 A;  3BTI A;  1X2N A;  1LE8 B;  1TQM A;  2K7L A;  2NVX J;  5BNG A;  3FDY A;  4QSH A;  1TZL A;  2DK8 A;  1V55 H;  5FKK A;  3DPL C;  1UMQ A;  3CCL I;  2QSG X;  2Q0O A;  4AD9 A;  3KET A;  3HBL A;  3NQO A;  1NG7 A;  3K0L A;  3OOU A;  2L7K A;  3ABM H;  4NC6 A;  1G2H A;  4FIS A;  4M6V A;  5E3M A;  4AIH A;  2VKE A;  3OS0 A;  5FLX Z;  1WCM J;  2W7N A;  2L02 A;  4HV6 A;  1RUN A;  1KU3 A;  3I55 I;  4CYD A;  1F36 A;  2CW7 A;  1SMT A;  3GBG A;  1OCC H;  4IVN A;  2DYR H;  2XV4 S;  1QZE A;  5CVI A;  1AA7 A;  2Q2E A;  3ZCO A;  2DCE A;  3ZP5 A;  1X1P A;  2FD5 A;  3CMM A;  3ZN1 A;  4F55 A;  3BTC A;  1FZP B;  3EQL F;  1S7A A;  3FMR A;  1IN5 A;  4FQG A;  4RA2 A;  3C2G A;  2O6G E;  5GAG J;  3CO6 C;  3BOQ A;  1JKQ C;  1RI7 A;  1NHA A;  2J5O A;  1R36 A;  3J81 Z;  2RAE A;  1FOY A;  4CO8 A;  1LPQ A;  1YS7 A;  4G6T B;  4ZYG A;  5L3C A;  1X58 A;  1J0R A;  2IGM A;  3R60 A;  1TWH J;  2FBK A;  4PUS A;  1TTY A;  3PFY A;  1TQI A;  1OLT A;  4A6D A;  3PIO F;  4DZJ A;  3KLO A;  3S1N J;  5E1W A;  2EFN A;  2QVO A;  2IBD A;  3E3V A;  1K83 J;  2KL4 A;  4C30 A;  3FZV A;  2ZME B;  2JPB A;  4Z2Y A;  4CGZ A;  2XF5 A;  2XGD A;  3S15 J;  4G94 A;  2JQ7 A;  2DFH A;  4ZDO A;  3N97 A;  4EJT A;  3WG9 A;  1HDP A;  2BY3 A;  4O6J A;  1T0F A;  2JA8 J;  4BXX J;  2UXX A;  2L7M P;  2EQR A;  5KK1 A;  5D5W B;  2CYY A;  2LC2 A;  4XID A;  1TNS A;  3VYS B;  2IA0 A;  4Z6Y A;  1MMD A;  1X4O A;  2R5Z A;  4HF1 A;  3DTI A;  3KEQ A;  4N9I A;  4DGW B;  1MH3 A;  3J80 Z;  1YE9 A;  2XHK A;  2PQ8 A;  4F3Q A;  1XPX A;  4DBQ A;  2HTS A;  3OYB A;  1SD5 A;  3RTR A;  4FT8 A;  2HQ5 A;  2IA2 A;  3HOW J;  3RZO J;  2DLL A;  1ZR2 A;  4IQ4 A;  1JGG A;  2STW A;  4YG2 F;  4GYI A;  2GA1 A;  4YFK F;  5IT9 Z;  4XQF A;  4AWX B;  1BJA A;  2QGU A;  5ICC A;  4A3K J;  1B6A A;  4I2O A;  2VQG A;  1QA6 A;  2DTZ A;  3HJE A;  2LRE A;  1U5T B;  5EEG A;  2IAI A;  5KHD A;  1P6R A;  2HDD A;  3K2A A;  4XKC A;  4CA0 A;  1B9N A;  4PJN A;  2LYC A;  2JWT A;  3L09 A;  4B09 A;  4F91 B;  1BJZ A;  1BOA A;  3S14 J;  2DOE A;  4XLA A;  2DXI A;  3DU6 A;  1S29 A;  4UUS B;  1JUS A;  1MJB A;  4PSX A;  4XRF A;  3GCM A;  2N8G A;  2DT5 A;  3GF2 A;  5M5W J;  4ZZL A;  4HNV A;  1D0X A;  4BEH B;  2EK5 A;  3RPU A;  1SFO J;  4OIP F;  3OYF A;  1R5G A;  2C6Y A;  2UUZ A;  3BZK A;  4HEA 2;  3L2R A;  3CF2 A;  4G8X A;  5L3B A;  1BW6 A;  2XAF A;  2ZO4 A;  2CS3 A;  1U9N A;  1EV7 A;  5EDN A;  1K6O A;  2YSR A;  5BPD A;  3H3U A;  5GPA A;  1SD7 A;  2IPQ X;  1FNN A;  1G8X A;  2V79 A;  3QOP A;  2BE5 F;  5D6E A;  2RVC A;  4BL0 B;  4EJO A;  1R9T J;  2HPM A;  2NVQ J;  3GTL J;  5E3L A;  1Z7L A;  2WBM A;  4YIF A;  3VYU B;  4A69 C;  4C3H J;  5JI6 A;  2GIZ A;  5B1B H;  2K85 A;  5E18 F;  2DA5 A;  3JRD A;  4YIR X;  1UST A;  3DCF A;  2QEX I;  3FBN B;  2O8X A;  1JKR C;  4G7H F;  3WHC A;  3P7N A;  3JRH A;  2Y75 A;  1JUP A;  3RQ4 A;  1MZB A;  1S7E A;  2Y30 A;  4MTD A;  2H6B A;  1DGR M;  5EGO A;  1QPI A;  4I0B A;  1YIO A;  3DPU A;  3BZ6 A;  3MQ0 A;  1ORK A;  4P9F A;  3PQJ A;  3OWT A;  2YS9 A;  2ELK A;  4XLN F;  2CJJ A;  4D5C A;  3O3K A;  1BIB A;  2VLA A;  4XKB A;  4KA4 A;  3GTG J;  1Z1D A;  2GOM A;  2QSF X;  1JHH A;  2P7V B;  2W00 A;  1CF7 A;  2HQR A;  1WJA A;  3FF5 A;  5HDG A;  1TT5 B;  2D2W A;  1QZZ A;  2V9K A;  3HRM A;  1VND A;  2JPC A;  1Y0U A;  2I10 A;  2XRN A;  1IDY A;  4LK0 F;  1N25 A;  2DOD A;  4RGR A;  3H36 A;  3LWF A;  1E2X A;  4A3J J;  1O7F A;  2FJ1 A;  2HTJ A;  1MBE A;  3A4C A;  4E70 A;  2X9D A;  1YTY A;  3AL0 B;  1WJD A;  1YX5 A;  3KP3 A;  4KDP A;  3Q3S A;  2RQP A;  4QTR A;  5C3E J;  4D7M A;  4CYC B;  2EZH A;  2K9S A;  1IUY A;  3E97 A;  4KMU X;  2GA2 A;  2RKH A;  2IS1 A;  3U21 A;  2X4H A;  1I6X A;  1TWG J;  3QYE A;  4JX6 A;  1BOB A;  1YJ9 I;  5DV5 A;  1HDD C;  2NVT J;  2R4G A;  2G7U A;  1JUM A;  3LSR A;  1FOK A;  3ASN H;  3QRF F;  1J2X A;  2HQA A;  3GTM J;  2OZ6 A;  3VOD A;  3JAM K;  2O7O A;  1V54 H;  3BG9 A;  4RGU A;  2LSO A;  3SDG A;  1W7P B;  2OPT A;  1ETW A;  2MA3 A;  2MYS A;  2EFW A;  3I58 A;  1W0U A;  1OCO H;  4G6D A;  1LVA A;  4F93 B;  2B0L A;  3F6O A;  4RGS A;  2ZNZ A;  4P9U A;  1O3T A;  1JE8 A;  1UHM A;  3WHB A;  2ECC A;  1Y56 A;  5LGN A;  2ETH A;  1WFX A;  1RUO A;  5E3O A;  2H8W A;  5F0F A;  4R79 A;  1P4A A;  5IY5 H;  2Z3Y A;  2LDU A;  3ZPL A;  3KX2 A;  2MC3 A;  1MBH A;  3QU3 A;  3B6A A;  1D8K A;  2AXL A;  2DA7 A;  5CLS A;  4EGY A;  4WXH A;  3SXY A;  1VI0 A;  1LKX A;  4S05 A;  5CJ9 A;  5KAF C;  3E6C C;  3RZD J;  3H35 A;  1IG7 A;  3HG9 A;  3ESW B;  2E36 A;  3WTT C;  2H27 A;  4NDL A;  3ZGK A;  1HW5 A;  3LSI A;  1I39 A;  4LD5 A;  3ZN0 A;  2V6E A;  3IKV A;  5CKT A;  5M3F J;  2A69 F;  3OYE A;  2Z99 A;  4M9S A;  3F22 A;  5GP9 A;  1TWF J;  1JT6 A;  3MKW B;  1N75 A;  1X1C A;  2HYJ A;  1MBJ A;  3COA C;  5LEJ A;  5LBQ A;  3WGG A;  2M30 A;  1X3U A;  3OYG A;  2VON A;  3H0G J;  5AIQ A;  2EIK H;  5EG0 B;  1VTN C;  2VBY A;  4Y3O A;  2X6O A;  4NB5 A;  1QNT A;  3QPS A;  4DJA A;  1K4T A;  1B9M A;  5TRD A;  2LKS A;  2G9W A;  3EUH C;  2AQF A;  3OR2 C;  2FUG 2;  3DKY A;  4I99 C;  3WE3 A;  3TKY A;  3OL4 A;  3G73 A;  4HX4 A;  2QA4 I;  1FBQ A;  4IEJ A;  1UG2 A;  3G71 I;  2IJL A;  2KT0 A;  2DPD A;  5B1A H;  1ETO A;  1TL8 A;  4X0G A;  4FET A;  3F21 A;  3HDD A;  4UVA A;  5D5X B;  3H5R A;  3FXU A;  2JT1 A;  2RNG A;  4XM3 A;  1IRZ A;  2E1C A;  3Q9V A;  2DDB A;  1UG0 A;  3R6S A;  5GAH J;  2WWY A;  3A1Y A;  1P7I A;  5EEA A;  2P0W A;  1Z3X A;  4PSW A;  3AAF A;  1QVU A;  1V4R A;  4Q4Z F;  4D1Q A;  2WV1 A;  1RKT A;  2PJR B;  2HI3 A;  3QP5 A;  3BR3 A;  2EZK A;  3I4N J;  5EEH A;  3DEW A;  4ZJZ A;  1LJ9 A;  3HZJ A;  1IUF A;  1QZY A;  1RZ4 A;  5J6X A;  1J09 A;  2PMH A;  4BJ5 C;  1D1C A;  2IXS A;  1UB9 A;  1R58 A;  4KIF A;  2IGK A;  5A2Q K;  2VUM J;  4HPQ A;  4LB6 B;  3W6K B;  5GTI C;  3OYD A;  3M3Y J;  3E5X A;  4BHP A;  5HS7 A;  5FKN A;  3VDX A;  2QQB A;  2VOO A;  2P6T A;  1JT0 A;  2X6W A;  1WH5 A;  4A3G J;  3GW2 A;  4KN4 X;  3L2U A;  2MD0 A;  2A07 F;  4B8X A;  5J1Y A;  2AXT C;  2VKV A;  1S8N A;  3G1M A;  3HYI A;  4O5V A;  4HQM A;  5EJC A;  3RKQ A;  1KU9 A;  4BS9 A;  1IN7 A;  3OV8 A;  1VQ7 I;  1LNW A;  3LA7 A;  3BJO A;  4M3E A;  2HDW A;  1WJB A;  3MEX A;  2DMN A;  4IJA A;  4IHV A;  2ACJ A;  4AID A;  1I27 A;  2TDX A;  4DYC A;  3JAM Z;  2KPM A;  2Q8K A;  3E7L A;  4HLY A;  4L9T A;  3CJR B;  2EZL A;  5E1Z B;  3HOT A;  4CCN A;  4LLN A;  4XRS G;  3KP6 A;  4A3I J;  3BG6 A;  4XOP A;  1KA8 A;  4II3 A;  5J4V A;  3JRB A;  5FGM A;  4RGX A;  2P6S A;  2RRE A;  1XCV A;  3KP7 A;  3WE2 A;  4L0Z B;  1GV5 A;  3R0J A;  1T6S A;  3MKY B;  2K4B A;  1FTZ A;  1E3H A;  2DTR A;  3S2D J;  4KYW A;  2VI6 A;  4V2G A;  2CRG A;  3KYC B;  2LTP A;  4KT5 C;  4LG3 A;  1MNE A;  1F43 A;  1B4A A;  3G6E I;  3TMO A;  4DIQ A;  4EMS A;  3CZ6 A;  1T95 A;  3KYD B;  4BQQ A;  3L2Q A;  2P4W A;  3GXO A;  2GOX B;  2V1D A;  2A61 A;  3A0H C;  1KQ0 A;  3DEE A;  2FE3 A;  3O2P E;  5DYM A;  2JA5 J;  1V5G A;  3AFH A;  3JRI A;  5HS9 A;  4NBQ A;  3F72 A;  2BVL A;  1L3L A;  1B1B A;  3UNG C;  3O6B B;  5ICG A;  3B73 A;  3CUQ C;  2CQN A;  1JJ8 C;  1G59 A;  5IT3 A;  1DPU A;  3FMQ A;  2F5D A;  4DBR A;  1X1A A;  9ANT A;  2KRH A;  1MD0 A;  2MAB A;  2RNJ A;  1AKH B;  5AIP A;  4PCQ A;  1JI8 A;  3CD6 I;  3HOU J;  1OKR A;  5CQG A;  4PGH A;  3VYR B;  2VJJ A;  1WHU A;  4M74 A;  4BHC A;  1XGS A;  2CV1 A;  2E60 A;  1PUF B;  1NK3 P;  1YJW I;  3WTW C;  2FA5 A;  3DPT A;  2YU9 J;  1IGN A;  4BY7 J;  2R7U A;  1BR1 A;  5ICE A;  2IVM A;  3EUA A;  4N0B A;  2LKP A;  1X19 A;  2ZXW H;  2V9V A;  2Y9Z A;  3F3X A;  3UR3 C;  1TP4 A;  3GVA A;  5EYR A;  1Z6T A;  3PFI A;  2M0M A;  2LR8 A;  2ESN A;  3IL2 A;  1E17 A;  3CP2 A;  2XUB A;  3F6V A;  4GGG A;  1O7L A;  3DTE A;  5TGT A;  5J8C A;  4LLL A;  1YX3 A;  5E20 A;  2HYG D;  1XMK A;  3GLL A;  2ZME A;  5CVJ A;  1ON1 A;  1WWX A;  3OS2 A;  2UWM A;  4BQO A;  1LEB A;  2DBB A;  1HOM A;  1XN7 A;  2QEN A;  1WI9 A;  2XGC A;  1EH7 A;  1FYK A;  2M34 A;  5FFZ A;  4E7L A;  4CUG A;  4OIO F;  1OYW A;  1ZYR F;  2Y2Z A;  3CMY A;  2L9N A;  2YX4 A;  5A2Q Z;  3GZN B;  5JHF A;  1I1G A;  4LIU A;  3H3Z A;  4Y33 A;  1JHF A;  4FAS D;  1AOY A;  1DUX C;  2IEK A;  4QWQ A;  2LH9 A;  2PG4 A;  3BR0 A;  4LIV A;  4RAY A;  2G7H A;  3JSO A;  3BQY A;  4KMF A;  1B72 B;  2G0E A;  1HW2 A;  5JHU A;  1LEA A;  2EFP A;  2PI0 A;  2H1L A;  4ANJ A;  3S3M A;  4JK1 X;  4D5F A;  3L00 A;  4MTE A;  4CSW A;  2F5F A;  5LRR A;  4CXF A;  1R7J A;  2O5R A;  3C2H A;  2DMQ A;  4OAZ A;  2Y0M A;  2VE9 A;  1Z9C A;  1C0W A;  3ROU A;  2FQ3 A;  1K61 A;  2KQR A;  4B48 A;  3CME I;  1FTT A;  4R8H A;  3PL8 A;  4V19 K;  2QKM B;  5FKO A;  4ZDL A;  1RC9 A;  3H5N A;  3DF8 A;  1U5T A;  3RCO A;  5EF6 A;  3OYH A;  4M71 A;  3T0Y A;  1U3E M;  1Y0N A;  3U2R A;  1SVM A;  1BIA A;  3MFK A;  1HQC A;  4LFU A;  2DFE A;  3Q0U A;  3CUO A;  3GFI A;  1OQY A;  2OA4 A;  4Y4R A;  2ZXI A;  3KLN A;  3HKZ A;  3H3V K;  3T8T A;  4UUS A;  3BZC A;  2L4M A;  4GXO A;  4PFO A;  4WWC A;  2DT7 B;  3HPG A;  2R7Q A;  2JVH A;  2XPW A;  4BEH A;  4BBS J;  4WF2 A;  1IN4 A;  4DQ2 A;  3FXQ A;  1FPQ A;  1ZN2 A;  2ID6 A;  2WAF A;  4DYR A;  1VQP I;  1MBK A;  2K3P A;  1ZQ3 P;  1OPC A;  1ZTR A;  2IGN A;  2NS0 A;  4W1U A;  2FRH A;  4NUB A;  4XBF A;  2KIM A;  5IYC J;  2M2E A;  2DAO A;  2BW3 A;  3WGH A;  5IYB J;  4ETS A;  1A36 A;  1MBF A;  2P7C B;  1TW2 A;  2D1H A;  2NOJ B;  2VKD A;  3HKZ N;  4B47 A;  4WCG A;  3TDZ C;  3L2C A;  4LOC A;  1JTY A;  2VAS A;  2VQH A;  4CCJ A;  4CDG A;  1W5T A;  3SHF A;  3K4K A;  1GT0 C;  3MZH A;  4M6X A;  3V7R A;  4A5N A;  2OJE D;  3FM5 A;  3G4S I;  1IN8 A;  4BJT A;  2X1C A;  3LSM A;  4PJL A;  1U8B A;  5IYD J;  1R4M B;  5HLH A;  2CQQ A;  2M7B A;  4E7S A;  3RPU D;  2ADU A;  2L2O A;  2ZFU A;  1X3Z B;  4XSZ F;  1OMI A;  2K40 A;  1XTA A;  2DMT A;  3Q0W A;  3WTY C;  3MD2 A;  1Z6R A;  5JLX A;  2HWV A;  4ENN A;  1HXD A;  1FMW A;  1RES A;  3IRR A;  2EIN H;  1R5I D;  5IOZ A;  4XRS A;  3R61 A;  5B5E C;  3EUK L;  2KJC A;  2D1V A;  2KDZ A;  3PO2 J;  2NVU B;  2ISZ A;  1ZLK A;  2QSH X;  3A01 A;  2YU3 A;  4LG0 A;  3IHU A;  1JGS A;  5IOY A;  3NWS A;  3P5J A;  2M4K A;  1YW9 A;  3WU1 B;  4EQQ A;  2BBY A;  2W57 A;  3HGG A;  3QYB A;  1IXS B;  5JLW A;  3TO6 A;  4WK8 F;  4OIR F;  4ENM A;  1FSE A;  4A3M J;  3SDB A;  2R7V A;  2HYF A;  2M8G X;  3R0A A;  3S1Q J;  3GEZ A;  4RB1 A;  3PUB A;  1OFC X;  2OC6 A;  4G9Y A;  2Z9O A;  4Y7N J;  2XRO A;  4L5I A;  4AU7 A;  4MQ9 F;  4HNT A;  5K7H A;  1YO5 C;  5LFA A;  2GM4 A;  1YQA A;  4BUP A;  4H4K C;  3U9G A;  2IP2 A;  2R7D A;  3ZMV A;  1IXR C;  3JRE A;  3JTG A;  4KJZ A;  1FSH A;  3DTK A;  1MMS A;  4JOM A;  3RSN A;  2DJI A;  3FX3 A;  4ZTJ A;  4EM0 B;  5HLG A;  2EJR A;  2WA0 A;  1S5L C;  1W7P A;  2O3F A;  4L5J A;  2FNP A;  4H0E A;  3F8N A;  4ESF A;  1MH4 A;  2DT6 A;  3GO5 A;  4P1W A;  3ZQ7 A;  4XOR A;  4F7Z A;  4MEY F;  3HSF A;  1BL0 A;  1HC8 A;  3BQZ A;  2ZC2 A;  2DJN A;  2CUJ A;  1ERD A;  1YIJ I;  1ODD A;  3ULQ B;  5JR3 A;  1TWA J;  5EZH A;  1QU3 A;  3W3C A;  1OR7 A;  3LSJ A;  2CWE A;  1UZC A;  2LOO A;  4JBA A;  1DU6 A;  3HSR A;  2XF7 A;  2MW8 A;  1BC7 C;  1ZAR A;  4KIB A;  1ZK8 A;  3D1N I;  1MIJ A;  1Q1H A;  2W85 A;  2L9V A;  2ESH A;  4B3X A;  3EYY A;  4B43 A;  4FCY A;  2XPU A;  3IRQ A;  4FTH A;  2LBF B;  3K4N A;  2OCC H;  4CHU A;  3OS1 A;  4KUM A;  2E7W A;  1EF4 A;  2OCE A;  3ISP A;  4U7B A;  1KGS A;  3MKL A;  3FHZ A;  3GTJ J;  2RDP A;  5FKL A;  1IRF A;  1J59 A;  1MSE C;  2OV7 A;  3FK7 A;  3MKZ A;  2FX0 A;  2V9P A;  1SD6 A;  3MCZ A;  4B3A A;  3PO3 J;  2V1X A;  2JUG A;  1BR2 A;  2P81 A;  4TV7 A;  2QYO A;  4UUT A;  1R22 A;  3I3L A;  1ZH5 A;  2CFX A;  3GME A;  1XC5 A;  1A6Q A;  2MC4 A;  2ZNY A;  1IXC A;  2W82 A;  5IP7 J;  2VE8 A;  4XLC A;  3NAR A;  2D5V A;  2DO7 A;  1TQP A;  2J5P A;  2Q1Z B;  1H89 C;  5C4J J;  3CMA I;  3IV5 A;  4A5M A;  2E2I J;  4LMY A;  4K2E A;  2CW0 F;  2KRF A;  2XGX A;  2JSP A;  3OSG A;  5ILV A;  1ZG1 A;  3BY6 A;  3RJP A;  2HKX A;  1MKM A;  3C2B A;  3T5X A;  1Y1W J;  2OBP A;  1BA5 A;  2I8D A;  3ZMD A;  3JTH A;  2E35 A;  4KIC A;  3K6G A;  4UV9 A;  3C1D A;  3FIW A;  2FSW A;  4A6E A;  2VN2 A;  3K4L A;  2I5U A;  3JSP A;  1IV6 A;  1F9N A;  2VC0 A;  1IV8 A;  5CVV A;  5DDG A;  3CUQ B;  3ECO A;  3K9T A;  1MMG A;  4IL6 C;  2F4I A;  1W36 D;  2ZSI B;  4AVP A;  2R7Z J;  1TWC J;  3M8J A;  4WXD A;  2A6E F;  3WG7 H;  4XK4 A;  2V1U A;  3VB2 A;  4PZJ A;  3H9J A;  2W4S A;  1W36 C;  1UAA A;  2Y48 A;  3DU5 A;  3KEY A;  4A3F J;  2EA4 A;  2L01 A;  4J00 A;  3FXL A;  3W2W A;  4M3G A;  1LVK A;  4DW6 A;  3CC7 I;  5L3G A;  4RBO A;  2FXA A;  1YRN B;  3K1N A;  3L2V A;  1R00 A;  5E8I A;  1GUU A;  3E6B A;  3VOE A;  2R5Y A;  2A3S A;  2BHZ A;  2DFI A;  2Y0S A;  4V2F A;  4CCO A;  1D1B A;  5GPC A;  2ZJR F;  2BY0 A;  4IKF A;  3K4B A;  1Y39 A;  1XGO A;  2MBF A;  3HOS A;  1IJW C;  4PDK A;  1SFE A;  1SAU A;  1R49 A;  2E34 A;  3HIF A;  3H5A A;  5DM6 F;  4G7Z F;  2ZCW A;  2XKO A;  3CF5 F;  3DFG A;  4MIM A;  1WH7 A;  3RIR A;  2DN0 A;  2JN6 A;  3SFZ A;  1D0Y A;  4B44 A;  5JFR A;  3F8C A;  2EB7 A;  3OMY A;  1EKE A;  3E5U A;  1DPR A;  2KFD A;  4ZYH A;  4BDZ A;  3C3W A;  2Y0S N; 
#chains in the Genus database with same CATH homology
 5F1J A;  5E3N A;  4FE4 A;  5DS9 A;  5J1Y A;  2VKV A;  5IP6 A;  2JK3 A;  5J3L A;  3G1M A;  5K7Z A;  2DA3 A;  2ECB A;  5DTD A;  4Y52 J;  3RKQ A;  2R0Q C;  4BY1 J;  2DA2 A;  3MN2 A;  3NAU A;  1LFB A;  4M3E A;  5F27 A;  1QVT A;  2ME6 A;  2DMN A;  4IHV A;  3G1L A;  4DYC A;  2E1O A;  2AO9 A;  3E7L A;  3CCY A;  2EZL A;  5HOD A;  3JR9 A;  4XRS G;  3LNQ A;  1MBG A;  2DA6 A;  4A3I J;  3CQZ J;  3HOX J;  5FLV A;  3JRB A;  2EH3 A;  3TED A;  4I76 A;  1GV5 A;  5EG0 A;  1WPK A;  3A02 A;  4AC0 A;  1XG1 A;  3FKI J;  1IC8 A;  1TC3 C;  1FTZ A;  3S2D J;  3LSP A;  3TP0 A;  2VI6 A;  4V2G A;  2CRG A;  1U9O A;  2LTP A;  1AKH A;  4A3L J;  2NOG A;  4IHW A;  1F43 A;  4L5E A;  2CU7 A;  1AU7 A;  1B8I A;  3M4O J;  2ME0 A;  3JRF A;  3BTL A;  3Q0V A;  2LP0 A;  1MNM C;  2XPV A;  2XSD C;  1PUF A;  2JA5 J;  4JP0 A;  3JRI A;  2JA6 J;  3I4M J;  4C3I J;  2XGE A;  1HCR A;  2JJ7 A;  2ID3 A;  1FEX A;  3OSF A;  1JJ8 C;  5IP9 J;  9ANT A;  1ENH A;  5F04 A;  1AKH B;  3BTI A;  1X2N A;  1LE8 B;  5FLM J;  3TW6 A;  4M3F A;  1WI3 A;  5BNG A;  2NVX J;  4QSH A;  3S2H J;  2WAQ N;  5FKK A;  1H8A C;  3HOU J;  1UMQ A;  1B8I B;  2LKX A;  5M3M J;  1GV2 A;  5F08 A;  5F0H A;  2R93 J;  3HBL A;  4MFD A;  1ZR4 A;  3LSG A;  3OOU A;  1G2H A;  2AHQ A;  1PUF B;  5J1U A;  1NK3 P;  2O8K A;  4FIS A;  4M6V A;  5E3M A;  2VKE A;  2YU9 J;  1WCM J;  1IGN A;  4BY7 J;  5J1R A;  1A6I A;  2M0C A;  2E2J J;  4BBR J;  2E19 A;  1F36 A;  1RR7 A;  3GBG A;  2Y9Z A;  3IH3 A;  3TP3 A;  5EYR A;  4X1E A;  1JKP C;  2LR8 A;  2JMW A;  2FD5 A;  3GTP J;  1B72 A;  3BTC A;  1A5J A;  3LOC A;  5F0C A;  4DYQ A;  1JKQ C;  1HOM A;  2XGC A;  3BTJ A;  4JYK A;  5EZG A;  2M34 A;  2DA4 A;  2RAE A;  3IH4 A;  2TRT A;  2Y2Z A;  3RQI A;  3CMY A;  1X58 A;  1ZGW A;  3QPL A;  2GLO A;  1TWH J;  3A01 B;  1IDZ A;  5C4X J;  4DZJ A;  2IEK A;  3S1N J;  4B4C A;  3BR0 A;  1OCT C;  1OJL A;  2IBD A;  3BQY A;  4JX5 A;  3JRA A;  1B72 B;  3GTO J;  2G0E A;  1K83 J;  5IPA A;  3MVP A;  4D5F A;  2R92 J;  4D7N A;  2HOT A;  2XGD A;  1HF0 A;  3S15 J;  1RPW A;  2LY9 A;  2DMQ A;  1K61 A;  5M5Y J;  1HDP A;  1H88 C;  2JA7 J;  2JA8 J;  4BXX J;  4G12 A;  1FTT A;  2L7M P;  2K9N A;  4J19 A;  2E2H J;  5FKO A;  2EQR A;  4A3D J;  1QRY A;  1ZKG A;  2LFB A;  5EF6 A;  4XID A;  2OF7 A;  2COB A;  4IHY A;  3SFI A;  3S1R J;  1RET A;  2H1K A;  2R5Z A;  2X48 A;  1MH3 A;  3Q0U A;  3ZQL A;  4DZP A;  3H3V K;  1RKW A;  4UUS A;  2YUS A;  3HGY A;  2HQ5 A;  3HOW J;  3RZO J;  2LLK A;  1ZR2 A;  2Y9Y A;  3S1M J;  1JGG A;  2XPW A;  1JKO C;  4BBS J;  1LE8 A;  3O8G A;  3BR2 A;  2ID6 A;  4DYR A;  3VPR A;  4A3K J;  1MBK A;  3HM5 A;  1ZQ3 P;  1E3O C;  1ZTR A;  2DTZ A;  4W1U A;  1T33 A;  5IYC J;  2IAI A;  2HDD A;  1ETX A;  2M2E A;  3K2A A;  3QQA A;  5IYB J;  4A3B J;  1MBF A;  1T56 A;  2R5Z B;  3HKZ N;  2JWT A;  3K7A J;  1BJZ A;  1X2M A;  3S14 J;  3TW7 A;  4LOC A;  1JTY A;  4W97 A;  3PM1 A;  2WB1 N;  1GT0 C;  4C3J J;  4UUS B;  1JUS A;  2EBI A;  2N8G A;  3S17 J;  5M5W J;  4HNV A;  1O4X A;  1SFO J;  1U8B A;  5IYD J;  2CQQ A;  2L9R A;  1Q1V A;  3BG5 A;  3FK6 A;  3A03 A;  2HXI A;  1BW6 A;  2VPR A;  1I50 J;  3HB9 A;  1U9N A;  1D5Y A;  5EDN A;  1CQT A;  2K40 A;  5GPA A;  2HOS A;  1POG A;  1Z77 A;  2DMT A;  2DMU A;  3Q0W A;  5JLX A;  1FJL A;  3OIO A;  1R9T J;  2XB5 A;  1RES A;  3G1O A;  2NVQ J;  3ZQC A;  3GTL J;  5E3L A;  5IOZ A;  4XRS A;  1LFU P;  4C3H J;  4A69 C;  2KDZ A;  2DA5 A;  3ZQH A;  3JRD A;  3PO2 J;  1ITY A;  2NS7 A;  2MG4 A;  3DCF A;  3A01 A;  1JKR C;  3WHC A;  5IOY A;  1SAN A;  3BR6 A;  3JRH A;  1JUP A;  3L1P A;  2L0K A;  4BKX A;  2FQ4 A;  3HGG A;  1S7E A;  2Y30 A;  3F0C A;  5M5X J;  3S16 J;  5JLW A;  5C44 J;  3HOV J;  4A3M J;  2M8G X;  5EGO A;  1QPI A;  3S1Q J;  2CQX A;  4B1R A;  1OFC X;  2NVY J;  1ORK A;  2NS8 A;  3GTK J;  4RDU A;  4Y7N J;  2YS9 A;  2ELK A;  2CJJ A;  4D5C A;  5K7H A;  3GTQ J;  2GM4 A;  1ETQ A;  1FIP A;  3GTG J;  2XB0 X;  5FKM A;  4S0H B;  3JRE A;  2GBY A;  3W6V A;  1VND A;  2QCO A;  1I6H J;  2I10 A;  3UKG A;  1ETK A;  1IDY A;  2DMP A;  5EGO B;  3JRG A;  4A3J J;  3CDL A;  2FJ1 A;  1MBE A;  1MH4 A;  2X9D A;  3Q3S A;  4AUX A;  1BL0 A;  3BQZ A;  4QTR A;  4GFB A;  5C3E J;  4D7M A;  4CYC B;  2DJN A;  2EZH A;  2K9S A;  1TWA J;  5EZH A;  4AYB N;  1GVD A;  1TWG J;  4JX6 A;  2R5Y B;  3LSJ A;  1HDD C;  2NVT J;  2EZI A;  1VFC A;  1DU6 A;  2MGQ A;  2TCT A;  3ZOB A;  1JUM A;  3LSR A;  4A3E J;  1NTC A;  1I3Q J;  2MW8 A;  2ZB9 A;  3GTM J;  3D1N I;  1ZK8 A;  2O7O A;  3BG9 A;  3SDG A;  5K7F A;  2OPT A;  1ETW A;  4XRM A;  2L7Z A;  1W0U A;  4FCY A;  1GDT A;  2XPU A;  4FTH A;  3HEF A;  3SJM A;  1AHD P;  2DA1 A;  4FE7 A;  1EF4 A;  3WHB A;  2B63 J;  2ECC A;  3MKL A;  2H8R A;  3GTJ J;  1VF9 A;  5E3O A;  5F0F A;  4EEF G;  5FKL A;  3JRC A;  2LD5 A;  1MSE C;  1MBH A;  1Y1V J;  2L7F P;  3FK7 A;  3HOY J;  3B6A A;  2FX0 A;  4C2M J;  4B3A A;  2DA7 A;  3BG3 A;  3PO3 J;  1VI0 A;  3RZD J;  2P81 A;  1MSF C;  1IG7 A;  2HXO A;  4UUT A;  1P7J A;  4M3B A;  1XS9 A;  4NDL A;  1XC5 A;  1BW5 A;  1DU0 A;  1UHS A;  2PMZ N;  4MO7 A;  2XRL A;  5IP7 J;  2HOA A;  3NAR A;  2CUE A;  2QF7 A;  2D5V A;  5M3F J;  1H89 C;  5C4J J;  5GP9 A;  1TWF J;  4QIW N;  1APL C;  1JT6 A;  3IV5 A;  2E2I J;  1ETY A;  2HYJ A;  1MBJ A;  1ETV A;  2M9H A;  3BR5 A;  3OSG A;  3FIS A;  3IH2 A;  1W0T A;  3H0G J;  4IHX A;  5EG0 B;  3ZQG A;  3ZQF A;  3C2B A;  4A3C J;  2W48 A;  1FIA A;  1Y1W J;  2X6O A;  2MSY A;  1BA5 A;  4JX4 A;  3QPS A;  1YRN A;  3BR1 A;  2LK2 A;  3FIW A;  1IV6 A;  2LVS A;  4IEJ A;  2Y31 A;  1UG2 A;  1WGX A;  2KT0 A;  2R7Z J;  1TWC J;  1ETO A;  1OCP A;  4I6Z A;  3HDD A;  4XK4 A;  4ABZ A;  1U78 A;  4X6A J;  1IRZ A;  4A3F J;  4MFE A;  4M3D A;  4M3G A;  4DW6 A;  1JJ6 C;  1P7I A;  4RBO A;  5EEA A;  1YRN B;  4CYC A;  1JTX A;  1QVU A;  3O8H A;  2WV1 A;  1RKT A;  1GUU A;  3ZQI A;  2HI3 A;  2CUF A;  2R5Y A;  4V2F A;  5GPC A;  3BR3 A;  2K9Q A;  2EZK A;  3I4N J;  3DEW A;  1IJW C;  1IUF A;  1NK2 P;  1Z0X A;  4MLO A;  3B6C A;  4MIM A;  2VUM J;  4A93 J;  1WH7 A;  3HOZ J;  3M3Y J;  1HLV A;  2DN0 A;  2JN6 A;  3BT9 A;  5FKN A;  4XIC A;  5FJ8 J;  1JT0 A;  1WH5 A;  4A3G J;  2O9L A;  2Y0S N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...