3FISA

The molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular structure of wild-type and a mutant Fis protein: relationship between mutational changes and recombinational enhancer function or DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
total genus 25
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fisA00
3PO2J 4QTRA 1JT0A 1IC8A 1MH3A 4AYBN 4DYRA 2DA3A 1AHDP 3UKGA 5EEAA 5IOZA 2EZIA 1XG1A 1QRYA 2Y31A 4S0HB 1GDTA 2DA4A 2ME6A 1B72B 2JA5J 2E2JJ 1D5YA 1AKHB 5GPCA 4A3LJ 3F0CA 2E19A 3LSGA 2HDDA 2M8GX 1HLVA 3GTQJ 1B8IA 3CMYA 2NS7A 2XSDC 5EZGA 4IHYA 5IP6A 3HOXJ 1HDDC 2DMPA 5C4JJ 3H3VK 4BBSJ 3TP0A 3JRGA 4IHWA 4DYQA 1WH7A 1JKRC 4B4CA 1YRNA 2Y0SN 5JLWA 4A3EJ 1ZR4A 5M5WJ 1OCPA 3I4NJ 2XPUA 1FIAA 2COBA 3CQZJ 3HBLA 4XK4A 3B6CA 2Y9YA 3BR6A 4JX5A 5EG0A 3ZQLA 3HKZN 1PUFA 2O7OA 1R9TJ 9ANTA 2H1KA 2O9LA 1P7IA 1GV5A 2JA6J 1BW5A 1GUUA 2M2EA 3RKQA 1H8AC 1TWAJ 3SFIA 2G0EA 1IRZA 4FE7A 4C2MJ 4M3DA 3HEFA 3GTOJ 1XC5A 3GTJJ 4X6AJ 2EZKA 1H88C 1K83J 1I50J 4W97A 3TP3A 3PM1A 3VPRA 4C3JJ 3IV5A 5M3FJ 3BR5A 2FJ1A 2HOTA 1VI0A 1MBKA 3BQYA 5F04A 2JA7J 3PO3J 2ID3A 2K9QA 1FIPA 3LSRA 3LSPA 1ETXA 1X58A 2R5ZA 4W1UA 5K7HA 1LE8B 1SFOJ 4GFBA 2NVTJ 5JLXA 2MG4A 3HGYA 3SJMA 3BR1A 4ABZA 2HI3A 2DA1A 5EYRA 3S1MJ 2N8GA 2H8RA 5F0CA 4D5CA 1BL0A 2K9SA 1JUMA 1E3OC 1ETKA 4M3FA 4BXXJ 1UMQA 2YUSA 3ZOBA 1W0TA 2VUMJ 1F36A 2LLKA 1WGXA 2HQ5A 3G1LA 1H89C 3HOUJ 4XRMA 3CDLA 1ETYA 4D7MA 4MLOA 4CYCB 3GTMJ 4I6ZA 1HOMA 3ZQHA 3MN2A 5HODA 4JX6A 3BR3A 3HB9A 3WHBA 2XGEA 2FQ4A 1IUFA 1ZR2A 2ECCA 2E2IJ 2PMZN 1IV6A 3BG9A 2NS8A 1IJWC 3ZQGA 4B3AA 3GTLJ 5GPAA 1T56A 5E3LA 3S14J 3JRDA 1LFUP 3JRCA 1GV2A 4M6VA 3TW6A 1A6IA 1X2NA 5M5YJ 5M5XJ 5EDNA 3A01A 3D1NI 2X9DA 2HXOA 3WHCA 4RDUA 1JUSA 1FTTA 2QF7A 1UG2A 2VPRA 5EZHA 1QVUA 5IP9J 2L7ZA 3BQZA 4UUSA 2R93J 2B63J 2LD5A 3E7LA 3I4MJ 3BG5A 2LP0A 2NVYJ 4IHXA 1W0UA 4DW6A 1RKTA 1JJ6C 1RR7A 4A3CJ 5FLVA 3HOYJ 5IYCJ 2JA8J 3CCYA 3BTCA 5FKLA 2XB5A 1U9NA 2JWTA 3JRFA 3OOUA 2VKEA 1JTXA 3OSGA 3BG3A 3RZOJ 2VI6A 4FE4A 3HOVJ 4Y52J 2FD5A 4AC0A 4BBRJ 2R92J 1DU0A 3RQIA 2JJ7A 3LNQA 4C3HJ 1WCMJ 2DN0A 2I10A 2LKXA 1K61A 2EQRA 1JKQC 5FKKA 1U9OA 4MFEA 2EH3A 4UUSB 3JRAA 2DJNA 1EF4A 2CRGA 2DMTA 2DA5A 3K7AJ 3HDDA 2LTPA 4V2GA 5DS9A 1MBGA 3LSJA 1MBJA 3S17J 2LR8A 1RETA 5DTDA 2RAEA 3JRBA 1JGGA 3FISA 2MSYA 4IHVA 3HOZJ 1TWGJ 3FK6A 2DA2A 1LFBA 2X48A 1B72A 4MIMA 1FTZA 2XGCA 3MVPA 1MBEA 2HOAA 1Q1VA 3TEDA 1HF0A 5C4XJ 2M9HA 1CQTA 1ETQA 2R5ZB 2XGDA 2ME0A 3HGGA 1JUPA 3Q0WA 5F0HA 5BNGA 3RZDJ 2YS9A 1BJZA 1ZKGA 5EF6A 2IBDA 1IGNA 4M3EA 2LY9A 3QQAA 3O8GA 1DU6A 1IDYA 5GP9A 2IAIA 2M0CA 3QPLA 5J3LA 2NVQJ 3GTKJ 3HM5A 1GVDA 5J1RA 4JP0A 2M34A 3L1PA 1MBFA 2ID6A 5EGOB 2DA6A 3W6VA 3IH2A 3SDGA 3BT9A 3IH3A 5J1UA 5EGOA 3C2BA 1BW6A 2KDZA 1S7EA 2LK2A 3S2DJ 1MSFC 4JYKA 1QPIA 3IH4A 2L0KA 5IYBJ 2OF7A 4V2FA 2CJJA 2XPVA 3G1MA 1ORKA 2XRLA 2CUFA 3HOWJ 1P7JA 1OJLA 3H0GJ 2L7FP 1A5JA 2JN6A 4A3GJ 1VFCA 4UUTA 1HDPA 2XB0X 1YRNB 5K7FA 1JTYA 1WPKA 4A3MJ 3M4OJ 4BY7J 3JRIA 1TWFJ 4DYCA 2P81A 2GBYA 2EZHA 1ETOA 4RBOA 4J19A 2AO9A 1U8BA 4XIDA 1LE8A 5FKMA 2MW8A 2GLOA 1FEXA 1NK3P 2DMQA 1RKWA 4MFDA 1JKPC 1F43A 1ZTRA 3BTJA 5K7ZA 5FJ8J 4QSHA 2L9RA 4DZPA 3FK7A 4HNVA 3ZQIA 3S1NJ 2VKVA 3DCFA 2W48A 4EEFG 5F08A 5C3EJ 3S1RJ 2ZB9A 1O4XA 2WAQN 5F0FA 3S2HJ 4D7NA 2GM4A 5IP7J 4LOCA 1T33A 4IEJA 2R5YB 1RESA 4C3IJ 4X1EA 3K2AA 3S16J 5FKOA 2FX0A 2Y2ZA 2O8KA 4BY1J 1Z0XA 2WB1N 3JR9A 3B6AA 1PUFB 1HCRA 2DMUA 1MNMC 2IEKA 3FKIJ 3TW7A 4I76A 4L5EA 4MO7A 5M3MJ 2HOSA 1IG7A 2LFBA 3NARA 1APLC 1WH5A 2L7MP 2CQXA 4FTHA 3A01B 3DEWA 2TCTA 3ZQFA 2ECBA 4A3IJ 1Y1WJ 1POGA 1OFCX 1OCTC 2DA7A 4CYCA 3GBGA 1TC3C 1I6HJ 5IPAA 3G1OA 2XPWA 3MKLA 1QVTA 3S15J 1AU7A 1RPWA 4AUXA 1Y1VJ 4A3FJ 1JT6A 4M3GA 3BTIA 2R5YA 3GTPJ 5FKNA 1ZGWA 2X6OA 3Q0UA 1G2HA 2HXIA 1TWHJ 1VF9A 1TWCJ 1MH4A 1B8IB 2MGQA 1MBHA 4G12A 2QCOA 2K40A 1ITYA 1ETWA 1ZK8A 3Q3SA 4FCYA 1BA5A 1ZQ3P 2OPTA 5EG0B 2K9NA 2DMNA 3GTGJ 1JJ8C 4M3BA 4XRSG 3BR2A 5J1YA 4A3DJ 2LVSA 2KT0A 3ZQCA 1SANA 4JX4A 1GT0C 2E2HJ 3JREA 5E3MA 1FJLA 2D5VA 1U78A 4DZJA 5F1JA 2JMWA 3NAUA 2CQQA 4NDLA 4A3KJ 3M3YJ 2NOGA 1AKHA 3A02A 5IYDJ 4A69C 2Y9ZA 1VNDA 4FISA 1UHSA 1ENHA 4XICA 3QPSA 2AHQA 3FIWA 3LOCA 2HYJA 1MSEC 1JKOC 3S1QJ 2YU9J 5C44J 1XS9A 3BR0A 1NTCA 4XRSA 2EZLA 2CUEA 4D5FA 1Z77A 3Q0VA 5E3NA 2JK3A 2TRTA 2CU7A 1IDZA 5FLMJ 2NVXJ 3BTLA 4BKXA 1WI3A 5IOYA 2R0QC 4A93J 5E3OA 3JRHA 1ETVA 1X2MA 1NK2P 3A03A 3O8HA 3OIOA 3OSFA 5F27A 2R7ZJ 2E1OA 2DTZA 4A3JJ 2Y30A 4A3BJ 1I3QJ 4Y7NJ 4QIWN 2ELKA 2WV1A 4B1RA 2EBIA
chains in the Genus database with same CATH superfamily
2QUFA 4U0VA 1R6RA 2EFPA 4QTRA 1JT0A 5DM6F 4AYBN 3C18A 4MQ9F 2K02A 1XDUA 2Y0SA 4HYEA 3QU3A 2M1BA 1OPCA 4ZDLA 5IOZA 1ZAOA 1R7JA 1GDTA 2IPQX 3WU2C 2JA5J 2A05A 2EV5A 1RRJA 1AKHB 4V19K 1PDNC 5HS7A 1B8IA 1W36C 4A2UA 3PFYA 4IHYA 3BJOA 1CGPA 1SD4A 1TW3A 1D5VA 4BBSJ 2IS1A 4CCMA 2FA5A 3ZMDA 1OCOH 2Y0SN 3GCMA 5JLWA 2QBYA 4HF1A 5M5WJ 4CZCA 3LAPA 2A3SA 2A5YB 3I4NJ 3RYPA 1FIAA 3CQZJ 4XK4A 4BL0B 2E1CA 3BR6A 3PL8A 1REPC 3VB2A 2F5DA 3HKZN 3ZQLA 1T8IA 2O7OA 3I71A 3CUQB 5AIPA 2JA6J 1BW5A 3CJTB 3TDZC 3RKQA 3E97A 1R1UA 4ESFA 1TWAJ 4C2UA 3ROUA 1YW9A 1FBSA 3H1CA 4FE7A 4C2MJ 2B9SA 2L9SA 1LDJA 3HEFA 2VT2A 2COMA 2LBFB 3H5NA 1XC5A 1TT0A 1FNNA 3NWSA 4E7JA 1XD7A 2IA0A 2QQBA 1H88C 1G3WA 1G59A 4XN0A 2IXSA 5CYVA 3PM1A 3VPRA 4C3JJ 4YFNF 3IV5A 4AVPA 4ZTJA 2FJ1A 3G2BA 2HOTA 3I0TA 2K7LA 2VKDA 3NRVA 3BCBA 3H36A 5F04A 2JA7J 3PO3J 2K9QA 3HPGA 1FIPA 2R3SA 4NQWA 5HLTA 2FMYA 2EIMH 1MMSA 1LE8B 4GFBA 2NVTJ 5JLXA 2MG4A 3HGYA 3SJMA 1FOXA 2UXXA 4ABZA 2DA1A 3H5AA 4P5OA 3S1MJ 1SD7A 3F8BA 2M5WA 1XGMA 3OIQA 4Y33A 1JUMA 2OBPA 1LNWA 3IAM2 4M71A 4M9XA 1UMQA 4G7ZF 2Q1ZB 3FHNA 2Z3YA 3GFMA 2E5ZA 2VUMJ 4KISA 3LSHA 1WGXA 2HQ5A 4HG2A 2ZFWA 1ETYA 4RAFA 1Z91A 1KQ9A 4G9YA 3T8RA 4I6ZA 3L09A 1QHGA 3ZQHA 1BI0A 4ITVA 2CWEA 3O6BB 2LC2A 1TQPA 3HB9A 4OIOF 2CMPA 4E7LA 2CSOA 1XDSA 2Y48A 4J01A 3R60A 3DLLF 4KT5C 1HBXG 2E2IJ 2QQ8A 3MMYB 2PMZN 3KX2A 1HW1A 3S14J 3S3NA 3VYRB 1LFUP 4NC8A 1WZ2A 2KZVA 4B3XA 3L2UA 1LEBA 1X1BA 1HQCA 4QLCU 3GXOA 3DPUA 3QPTA 3D1NI 3LA3A 1TW2A 5ICEA 2Y75A 1U5TC 4RDUA 5ILSA 4HSTA 4KIGA 3D0SA 3TKYA 1UG2A 3GLLA 2IW5A 3E5QA 1VQNI 1R5ID 1V3FA 1QVUA 2XV4S 5IP9J 5H2FC 4B09A 2VIXA 3LA2A 4UUSA 4S05A 3V8KA 2R93J 2BY0A 3CCMI 2XASA 2R4GA 1R5GA 1FYMA 1Y8RB 4OIPF 4IOCF 2NVYJ 4EGYA 3PQJA 4BAYA 2X0LA 3G4SI 1A36A 4XLAA 3HG9A 1RR7A 1K4SA 1D8JA 3ABMH 4A3CJ 4RGRA 1XCVA 4F55A 2AXTC 3G3ZA 1WSUA 3FXRA 5KVRA 5EJCA 2FU4A 4LLGF 2JWTA 2YU3A 4Y17A 3JRFA 1T38A 3DU5A 2YX4A 3OSGA 1JHHA 1SD5A 4WCGA 3RZOJ 3RDIA 2ZMEA 1FC3A 4AYBA 2JT1A 3WODF 3J80Z 1YJ9I 1ACIA 4BBRJ 4YRVA 2R92J 4HLYA 1OMIA 3DXJF 3Q5FA 3GMEA 1V54H 1OQYA 1YIJI 2K4BA 1G4DA 4AWXB 1WCMJ 2DBBA 2KKOA 2GQQA 3ZMTA 3VSLA 5DCMA 5D5UB 4AIDA 3J7AY 3DTEA 3K4NA 4UUSB 1OYYA 2F2EA 4KMFA 1EF4A 1P4XA 2CYYA 2E34A 1HSJA 1ZRCA 3WTWC 2DA5A 2JQ7A 4G7OF 1QZZA 4P1WA 3CJQB 4E7HA 1Z1DA 5E1XA 1ZARA 2MLKA 2JTVA 6PAXA 2LR8A 2VONA 5DTDA 1A6QA 5HNHA 2DFHA 2EIJH 3HSFA 3OV8A 2NAZA 4ZH4F 5FROA 3CDHA 1ZG3A 2LG4A 4Y4RA 4YG2F 3FK6A 5KCMA 3FKJA 2QQ9A 4PCQA 5ILVA 4N4NB 1KQ8A 1Z3YA 1USSA 4FASD 4EATA 2XGCA 1HF0A 3EUAA 2W4SA 2P6SA 2EA2A 2X4HA 1K78A 4KNYA 2BEOA 5BNGA 3WU1B 1Q1HA 3CZ6A 3I56I 2W24A 4Y13A 2MD5A 3N05A 2DW4A 3LA7A 3HUGB 1SFUA 4XSXF 1Z9CA 2R7RA 3O8GA 4NNJA 1DU6A 1W1WE 1Z6TA 1I1SA 3DEUA 2EFOA 5LGNA 5K5QA 1UHWA 1W7PD 2QKMB 3OWTA 2WAQA 1Y39A 2M34A 3CESA 1MBFA 3Q9VA 2DLLA 3W6VA 3S93A 4ZC3A 3SDGA 5J1UA 2FQ3A 2QVOA 4LFUA 1BW6A 2W85A 3HL2A 2HNHA 2LK2A 1VQ5I 3V42A 2VJ5A 3H9QA 4EVIA 5CLSA 1YI2I 2EV0A 3IH4A 2L0KA 4HX7A 2CJJA 2XRLA 2CUFA 2LKPA 4ESBA 1T98A 3J81K 1A5JA 2JN6A 2WTEA 4CCLA 2FEZA 3BPXA 3I64A 1HDPA 1YRNB 2H27A 1N25A 1FZPB 2UXNA 4BY7J 3JRIA 1R71A 1EH7A 5KK1A 1MJBA 4IX7A 3BPVA 4XNFA 2YX7A 4J19A 4RBOA 2BVLA 2AO9A 3OYDA 3MZHA 1LE8A 3K0LA 4UUVA 1FMWA 1Z05A 2BHZA 5FKMA 2KISA 4HRIA 1NK3P 4RB0A 3CJRB 2DMQA 3BCAA 3SEZA 1VZ0A 4WXCA 2OC6A 1BR2A 2CV2A 1IXSB 2RNJA 2DT7B 1S7AA 4GYIA 1ON1A 2V1XA 2ZXWH 5KAFC 5FFZA 3BWGA 2L9RA 5B66C 3SXYA 1X3WB 4PJLA 3VWBA 3ZQIA 2J5PA 3BDDA 2DPDA 4DQ2A 2VQLA 1I6XA 1Y0NA 2W48A 4EEFG 4BGDA 1QHHD 1X3UA 2E5NA 1O4XA 3E1SA 2BOLA 2WAQN 3DEEA 5CKTA 4KITB 5JR3A 5JFRA 2UUZA 5IP7J 3OS2A 3DKXA 2DQRA 2R7SA 1V5EA 5L3FA 3L2QA 3MEXA 3S16J 3CO6C 1QA6A 1V5GA 4BE1A 1W7PA 4HNTA 3VYSB 1OCZH 1PYVA 2F5FA 3W2VA 2JA2A 3PIPF 2RREA 1FP1D 1KYWA 1UJ8A 3ABKH 2KRHA 2CW7A 2A6HF 1GXQA 3MKYB 2FUG2 3MAJA 2RN7A 4L5EA 2WBMA 4M6XA 3HRMA 4MO7A 4L18B 2KLOA 4IRIA 2L5QA 5HDKA 1D0ZA 3WGIA 2ZKZA 2V9VA 1R4MB 4UXNA 3AG2H 2DPUA 2TCTA 3HOTA 1WJFA 4RA2A 4A3IJ 4AM3A 3FZVA 1Y1WJ 1R23A 1OCTC 1VQ9I 4G6TB 4CYCA 5IPAA 5DCFA 3DQVC 3MKLA 4ZYEA 1QVTA 5A2QK 2HKOA 2VQHA 3E6DA 5FD6A 2FOWA 4QWQA 5KAIC 4QPQA 2ZSIB 1O7LA 1O3SA 3BTIA 2R5YA 1BBYA 3M1EA 2STWA 1Y6IA 2WV0A 3R61A 1ZGWA 2X6OA 2L9VA 3F8NA 2XC7A 3OR1C 1VQMI 4L5IA 3QAHA 4GDFA 1IN8A 1YQAA 4DBQA 2R7VA 3F23A 2CUZA 4D9JA 1ETWA 3OIPA 5JVTA 2P5LC 2L01A 3Q3SA 3M9AA 2KPMA 2XAHA 1L0OC 2OPTA 2K9NA 1KU3A 2DMNA 3GTGJ 3LFKA 1JJ8C 4XQFA 1PUEE 3ZMZA 3E0JB 2WB1A 4M3BA 3W6JB 2R7TA 5EEGA 1UB9A 3LFUA 4JX4A 2F4MB 2LDUA 3KYLA 3JREA 2E2HJ 4HEA2 2PN6A 3U9GA 4DNCA 1FJLA 4DZJA 2JMWA 3K4KA 2MBFA 5FRNA 2BW3B 1IAWA 4A3KJ 3M3YJ 2HVQA 1SFKA 4NC6A 3O2PE 2M30A 4A69C 1I1GA 1EJ9A 1W5SA 2X6XA 3IAS2 1UHSA 1ZLJA 3T1BA 3KPHA 3WU0A 3QPSA 2AHQA 2DXIA 3CCSI 2HVSA 1SD6A 3TOBA 4ZYHA 2HYJA 3HHHA 3RTRA 3S1QJ 1FWZA 5H6QA 3BR0A 1NTCA 3OR2C 3F72A 4RM2A 2EZLA 3X2QH 5D5VB 3L2WA 2CUEA 3OS1A 2I8DA 5FLMJ 2O8XA 1ZGAA 5GADJ 3BTLA 1GXPA 4UY8I 1VQPI 4G6QA 1LVKA 2P4WA 4HF2A 1ETVA 1X2MA 2PJPA 3DTKA 2XAJA 1NK2P 1RUNA 3D5LA 3DLAA 5JVGF 1I39A 2R7ZJ 1YW8A 4Y7NJ 2JRMA 4E70A 4EJOA 5J8CA 5LGTA 2ZJQF 5CQGA 2ZMEC 4HPQA 2EIKH 4UB6C 2IGOA 2MH9A 4YIRX 1Z7UA 4IOAF 1P4WA 3EETA 3G71I 3UKGA 5EEAA 5TGTA 4X0GA 3FXUA 1QRYA 2Y31A 3RCOA 1G3YA 3NEUA 2JSCA 4FQGA 1LPQA 4WK8F 4LJZF 4XL9A 1TT5B 4A12A 4YFKF 5ED4A 3LSMA 1SMTA 3WG7H 2M7AA 2R7QA 3F21A 2LSOA 1QNTA 4EM1A 1HLVA 3L2CA 3GFLA 2R7OA 5BQTA 4HV5A 5EZGA 5IP6A 2LKSA 2L7KA 2ICWG 1Y56A 4G6DA 3HOXJ 1FYLA 2VXDA 3KEQA 3ZMSA 5C4JJ 2STTA 3W3CA 3OYLA 4IHWA 2HWVA 3CCUI 4A3EJ 1S72I 1OCPA 1RUOA 1N78A 2XPUA 2LMDA 2RVCA 4JX5A 5HVQC 1J75A 1F9NA 5EG0A 4NC7A 1PUFA 1R9TJ 2D1VA 3CC4I 1Y8QB 2H1KA 2O9LA 1P7IA 2KIUA 2RC4A 2KIQA 1H8AC 2DOEA 3ZN0A 1X3ZB 3SFIA 2BY1A 5EEHA 1K4TA 2G7HA 1AA7A 1IRZA 3SZTA 2CUJA 2VPLA 1OR7C 3EYYA 2CQNA 3VYUB 4X6AJ 2VKHA 1I50J 4BHCA 4HAMA 4W97A 2X1EA 1SC7A 4IQJA 5L3BA 2PI0A 1HKTA 4EJWA 2ZXIA 1GVJA 1RIOH 1VI0A 3WE3A 3PNTA 4CCOA 4OIQF 3P7NA 4YFXF 3IC7A 1WKMA 1R49A 3LSRA 1X58A 3VSKA 2IA2A 2CV0A 1W7PB 4HZFA 4W1UA 3GO5A 3MQ0A 4U0WA 3HIFA 5DM7F 2FMLA 1SFOJ 1IRGA 4LITA 4KN7X 4E6KG 5LD2C 5EYRA 2BHYA 3WTSC 1B9NA 2N8GA 1JHFA 3H3UA 4G7HF 2VE9A 1ETKA 3W6KB 3OYEA 2P7CB 4BXXJ 1S5LC 4LLNA 2YUSA 4UNOA 3CUQA 3M07A 2LLKA 3RSNA 3G1LA 4HSRA 1H89C 2VBXA 2QSHX 4LG0B 2WY7Q 5LGUA 1X4PA 3AFHA 3FX3A 3AG4H 4BQOA 3LQQA 4CGZA 1HOMA 4UHTA 3KP4A 3V8LA 3MN2A 4U7BA 5HODA 3BR3A 1E2XA 1VQ7I 3QP5A 2FQ4A 1DPRA 1IUFA 2GA2A 2F48A 5TRDA 2ECCA 1WJ5A 2LNBA 3AG3H 4N9HA 4Y15A 5LEKA 4C30A 1IJWC 2NS8A 1IV6A 5GPAA 1MKMA 3BROA 2K85A 4HW0A 3ASNH 1HKSA 5LRSA 2OTLI 2QYOA 5EDNA 5M5XJ 3A01A 1OKRA 5FLXZ 2ZMEB 1VQKI 4MGRA 3U2RA 2X85A 1KGSA 1DQUA 3HRTA 4DGWB 3COAC 2VPRA 5JI6A 1DGWY 3TO9A 3MKWB 3BQZA 2A5WA 1D0YA 2HS5A 4XOPA 4BS9A 1R36A 2A6EF 2CH0A 3T0YA 2W82A 2B63J 3PSFA 3E7LA 4CXFA 3HKZA 2P6TA 2XAUA 3F8MA 2E7WA 2OU2A 2P5VA 4IHXA 3LSTA 1ODDA 2BBYA 3I3LA 3M8EA 1WWXA 1W0UA 3MKZA 2MH2A 1J9IA 1JJ6C 3HTSB 2GOXB 1MD0A 5FLVA 2ZCWA 1XN7A 1HW2A 4EQQA 3L9FA 3DBLB 1OYWA 3KYCB 3BTCA 4IRHA 5HS9A 5FKLA 2XB5A 1U9NA 2EB7A 2L4MA 3BG3A 2VI6A 4FE4A 5F64A 3OS0A 3CCEI 4JBAA 3UNGC 2W00A 4Y52J 3K4LA 2FD5A 4B44A 3GYHX 4Z6YA 1J09A 3REOA 4OMYA 4A0ZA 1PJRA 1UELB 1VQOI 5IT9Z 2VE8A 3KP7A 4LIVA 4AD9A 3V4GA 2VB6A 1JKQC 3A2KA 5E17F 2AQEA 2EV6A 2P7VB 3HSRA 2O03A 3CUOA 2ESNA 2A68F 5CVVA 3K6GA 1AOYA 2VN2A 4A5NA 2JPBA 2BGCA 3ML6A 5GAHJ 1JGSA 3K7AJ 2LTPA 3E5UA 1WQ2A 1SFEA 3W2WA 2VT3A 3PUBA 4HDVA 2RAEA 3DTIA 3T8TA 3HOSA 1XSDA 3L00A 5DUKA 4E7ZA 2JRTA 3KLOA 4IHVA 5DDGA 1XSXA 5ICGA 3V7SA 4CCNA 3JTGA 2XAFA 4ZJZA 4MIMA 2HDWA 2AS5F 2R7UA 2KL4A 1TNTA 2HOAA 4CO8A 2LOOA 4XKWA 1UAAA 1X1DA 2XF6A 4ENKA 1D1BA 1A04A 3Q0WA 3CF5F 4H0EA 3RPUA 4AVZA 1ZKGA 3QQAA 1K6YA 3IUOA 2E60A 1H0MA 1U8RA 4PGHA 3QPLA 5E1ZB 2NVQJ 3GTKJ 3HRSA 4P9FA 3FMSA 1TLHB 3HM5A 1P9QC 3FWEA 3GX4X 5EGOB 3BZKA 3R6SA 2DA6A 1WI9A 2GOMA 4F3QA 1F1ZA 4BHPA 4XLPF 3EYIA 3GEZA 1RZ4A 3IH3A 5L3EA 1KU2A 3C2BA 2KDZA 4M73A 1S29A 2ELHA 3BZ6A 4JYKA 4I98B 1QPIA 3WGGA 3GLXA 4RGXA 5IYBJ 2XPVA 1MMGA 2HYFA 2JUGA 4V2FA 5CJ9A 1ZRDA 2V9PA 2JVGA 2P0WA 2L7FP 1VFCA 1STZA 4UUTA 1HC8A 2E1MB 5K7FA 1WPKA 2VBWA 5LHHA 5GAGJ 1X1AA 2EZHA 1ETOA 3GZ5A 1DP3A 2MW8A 3F3XA 1FEXA 2VJJA 2EILH 2PFBA 4HQMA 4I01A 4MFDA 4OAYA 1BI1A 4KICA 3GZNB 5J4YA 1F43A 1ZTRA 1E3HA 3SZGA 1XPXA 3S32A 5JHUA 1QO0D 5A2QZ 2XSJC 1S7OA 1QZEA 3WG9A 3FK7A 4PJNA 3MFKA 2VKVA 1FBQA 3FXOA 2DI3A 3S1RJ 3BC8A 4GO1A 3WTXC 5F0FA 5FGMA 4D7NA 2XF7A 4P9UA 1WJCA 3OMYA 4XLNF 1T33A 2DFFA 3CUQC 1RESA 4HOBA 4IEJA 4A0XA 4C3IJ 4NQWB 2JZYA 2Y2ZA 4BY1J 1DP7P 2WB1N 3JR9A 3MZYA 1HXDA 2CQ7A 4JOMA 1PUFB 2O0YA 1J0RA 3CC7I 4U87A 1BIBA 4I76A 2VBZA 3Q9SA 1WJEA 3G6EI 2OV7A 4ON0A 5M3MJ 2BW3A 1GHCA 3NARA 5IY5H 1FYKA 2Z2SB 3A01B 2RDPA 3IWFA 3ZQFA 1MDMB 3R0JA 4AIJA 3GBGA 4UVBA 5JHFA 1LVAA 5L3GA 1I6HJ 2V26A 3G1OA 2XPWA 3QOEA 1LJ9A 3K1NA 1AU7A 1G3SA 4AUXA 2F5VA 2F4IA 4I0BA 2MC4A 2IJLA 3PSIA 1TZLA 3DKWA 2PMZA 3GTPJ 1FMVA 5FKNA 4IRGA 4EMSA 1YITI 4BU2A 1WHUA 1G2HA 2E35A 2FE3A 4ASNA 1USTA 1BN5A 2XAQA 3ZMVA 2PMHA 4G12A 4RM3A 4ZYDA 2LRDA 5LHIA 1HA8A 2K40A 2GAUA 4XLHA 1ZGJA 3GVAA 5B5EC 2IP2A 2XGXA 4O6JA 3L2VA 2K5CA 3VFZA 3K4CA 4NB5A 3BR2A 3FF5A 3ZQCA 2VJIA 3F9KA 1ON2A 4I09A 5IT9K 1SANA 1GT0C 3CCVI 4KIBA 2CV1A 5E3MA 2OJED 2PG4A 1RI7A 4ETSA 1D1AA 2D5VA 3BOQA 1XGNA 4GGGA 2E1MC 1HKQA 3OYKA 3KIOA 3QRFF 4NDLA 4YELA 3SQNA 3DPTA 3S8PA 2NOGA 2XROA 1AKHA 4PJ0C 5IYDJ 3K70C 5BPDA 4UVCA 4DBRA 4M72A 4XKCA 2DYRH 3A1YA 1KZHA 1VQLI 1YG2A 1XTAA 5KNLA 3E6CC 3OYAA 3ABLH 3FIWA 2JSPA 2DK5A 4WWCA 1FY7A 4XRSA 3DPLC 2FBIA 3ONQA 3F8FA 2JK3A 1MNEA 1OISA 3MCZA 4XLEA 4KDPA 2CU7A 2FBKA 2HTJA 2JUCA 4YIIA 2X6YA 1WI3A 2Y0MA 5IOYA 2R0QC 4MEXF 2V4JC 2Y69H 3QYEA 4KT6A 4CUGA 3JRHA 3FHZA 5GTHC 2VL8A 3O8HA 4BJ6C 3OSFA 3AG1H 1FSHA 1XSVA 5F27A 3VOEA 2E1OA 3HYIA 5DEQA 4QIWN 2ELKA 5DUIA 2WV1A 2CS3A 3PO2J 2NXNB 3FXQA 4RB2C 2BE5F 2X1DA 4DYRA 2HR3A 4IPAA 1H9TA 3CMEI 2DA3A 5D5XB 4ZZDA 1LFPA 2EZIA 1XG1A 1U5TB 2K9MA 4A6EA 1LKXA 2MLGA 3HPHA 2DA4A 5FB2A 2C6YA 1FLIA 2DU9A 1B72B 1TQMA 3U1DA 4BQAA 2OZ6A 3O3KA 1EKEA 1H9GA 1XMXA 4EJUA 2E19A 2QSFX 2M8GX 2XSDC 2PMUA 3IHUA 3B73A 1R4NB 2DAOA 4MEYF 3CMAI 2GIVA 1UZCA 2DDBA 3H3VK 3JRGA 4DYQA 1WH7A 4B4CA 1YRNA 1P92A 3M8JA 4U88A 4WX9A 2NNNA 4KYWA 3HBLA 1T0FA 3B6CA 2Y9YA 3ERED 5DYMA 2Z5UA 2KMUA 2VODA 4XLFA 1GV5A 1GUUA 2M2EA 5D4SA 4XR6A 4Q5SF 2FSWA 2BV6A 4LIUA 3H0DA 1FT9A 4M3DA 3H9GA 2ZFUA 4IZZA 1B59A 3GTJJ 1EH8A 2K4JA 3DWLE 1XMAA 2IS4A 1K83J 3JAMZ 1TP4A 2R7FA 4RLFA 3TP3A 4JK1X 2FOKA 2L2OA 4IXAA 3SFZA 2V7FA 3QP6A 1MBKA 2XKOA 1SEUA 4I99C 2MYSA 3BQYA 3C1DA 1SAXA 3JW4A 2B7EA 3LSPA 3KP3A 3H3ZA 5E20A 2G7UA 3CP8A 1MMNA 1IF1A 2A69F 3DKYA 2PQ8A 3IL2A 3BR1A 3N97A 2HI3A 3HRUA 5HNFA 3WTVC 4D1QA 2YR2A 1BL0A 2K9SA 2DT5A 1ZRFA 2GZWA 3M8FA 1W5TA 4F52A 1L3LA 2IVMA 5HDGA 1T39A 4MHGA 1EV7A 4S04A 1W0TA 1F36A 3FXMA 3KZIC 4N0BA 1LB2A 4KFCA 2E71A 1ZLKA 4EJTA 2Q2EB 2VOPA 3CDLA 4HNUA 4XKBA 3K9TA 4CYCB 1OLTA 2ZC2A 5TISC 2DFIA 2VJ4A 1MW7A 2XGEA 3OYIA 5B3SH 4Y3OA 1ZR2A 1OR7A 2QENA 1Z6RA 5CQEA 2IGKA 3BG9A 5ILUA 3ZQGA 4XRFA 3GTLJ 2V6CA 1ULYA 1T56A 2VASA 3TO7A 4EM0B 3OYJA 4L0YB 3JRDA 2X6WA 2BY3A 4EV0A 1XCBA 5GAEJ 1A6IA 1OYIA 1X2NA 3CMMA 5LEJA 5M5YJ 2L3DA 1G8XA 4PZJA 3WHCA 1JUSA 2D45A 1YOVB 2QF7A 2B0LA 1P6RA 1BM9A 3FM3A 2ACJA 1RNLA 2DJIA 5ICFA 2ISYA 2EWNA 2BVMA 1FPQA 4R8HA 1TBXA 3CLQA 4NHJA 1YLFA 2W57A 1YJNI 5D6FA 5L3CA 4HQEA 1T08B 2FBHA 2X51A 2HQAA 2DFEA 3WTZA 2OA4A 3ZP5A 1SFXA 3JAMK 2WAEA 4KA4A 1IN4A 1KU7A 3LQRA 4BXFA 2JA8J 1YS6A 2MD0A 1YE9A 4MQVA 1RC9A 4DIQA 2YSRA 3OOUA 2VKEA 2CQKA 5BMZA 3MD2A 3E6BA 2L54A 1QGPA 1J7KA 4F93B 4BXUA 3I9V2 1U0JA 3ZXSA 4AC0A 3TGNA 1DU0A 4L9VA 3TQNA 5J4VA 2KHMA 3RQIA 3CD6I 1YHQI 2XDVA 1ZHFA 3BZCA 2WAFA 4RMNA 2A07F 1SAUA 4R79A 1O57A 1FX7A 1K61A 2EQRA 1PP7U 4LB6B 3IRRA 3FBIB 1U9OA 2EH3A 1BC8C 2DJNA 3ZCOA 1IZ1A 1S3JA 1KU9A 2CG4A 2CRGA 3HDDA 2QGUA 1EH6A 5L3DA 5LFAA 3F22A 1K7AA 1N77A 3CO7C 3LSJA 3KLNA 3IKTA 2VQCA 2WADA 1KONA 1RETA 5HS8A 3JRBA 1JGGA 1HW5A 3FISA 5E1WA 2MSYA 3HOZJ 2GXAA 2QLZA 1TWGJ 3FXJA 3CF2A 1R1VA 3FMRA 2DA2A 1G3TA 4XOTA 2X48A 3C2GA 1B72A 1FOYA 2V6EA 1MBEA 1Q1VA 2PLYA 2MFZA 3RKXA 5C4XJ 2M9HA 3QYBA 4OAZA 1CQTA 1ETQA 4IO9F 2PBIA 3P5JA 3KP2A 1OCRH 2D1HA 3QWLA 4E7KA 2DO7A 2FF4A 3HGGA 5F0HA 5HLHA 4C9YA 2Q0OA 3I5UA 5EF6A 1IGNA 4M3EA 2EPFA 1XGSA 1IXCA 1DGRM 1ZELA 3KFWX 3PUFA 5GP9A 3T5XA 1IO2A 2IAIA 2M0CA 4PGGA 5J3LA 2IT0A 2HZDA 4GXOA 4RB1A 1GVDA 4IF4A 4JP0A 4L9NA 4BEHA 2ID6A 1FSEA 2ZO4A 1W5CC 1IN5A 3IH2A 1BI2A 2KP6A 1B6AA 2QZ8A 1PP8F 3RI4A 1YJWI 3I59A 1XGOA 3QODA 2OF7A 3G1MA 1S6LA 3FM5A 1Z7LA 4B47A 3H92A 3HOWJ 1P7JA 1OJLA 1O7FA 2ZNZA 4HX4A 4Q4ZF 2VC0A 3MWMA 4EGZA 5ICCA 4A3MJ 2XF5A 1SVLA 2EA4A 3GUDA 2G9WA 4LK0F 1TWFJ 4I0AA 4DYCA 3ZGKA 2OZUA 2GIZA 2P81A 3C2HA 2WY8Q 3GFJA 1R5HA 2VC1A 2GLOA 4E7SA 1RKWA 1WRJA 4KUMA 1JKPC 5FLXK 2Z1DA 3BTJA 5K7ZA 3HTUA 4ZTFA 2GA1A 2RQPA 3FDYA 2IS2A 3EUHA 4QSHA 2VBYA 4DZPA 1DDNA 3FXKA 2OCCH 3KE2A 4HNVA 3S1NJ 1JE8A 2HVRA 3HC7A 2TDXA 3RQ4A 1BI3A 3VODA 1YX3A 2RGVA 3L2RA 5C3EJ 2UV1A 1SVMA 3C7JA 1WJDA 2GM4A 4AIHA 3EDPA 3RKWA 2HYGD 2M7BA 4HDUA 1XMKA 3HZJA 4LG3A 4CH7A 5E79C 5FKOA 1SMYF 2CGPA 3R0AA 1KYZA 4ENJA 1ZH5A 2DMUA 2E7XA 1MNMC 2ZNYA 3BJAA 3TW7A 4L9TA 2VXZA 2QSGX 1WJAA 4BJ5C 2BY2A 3NQOA 4XN3A 4BJTA 2HOSA 3BLYA 2LFBA 1ZREA 1F4KA 2LBFA 4RAYA 1APLC 2L7MP 1Z21A 2K3PA 5D4RA 2F5CA 4FTHA 4BDYA 3DEWA 2KIMA 2ECBA 4O5VA 4N9IA 2DA7A 2W1OA 4PUSA 2DOAA 5CVUA 3PNVA 1UFMA 1VQ4I 1NG7A 2D2WA 1Y0UA 2EINH 1AWCA 1MZBA 3S15J 4FX0A 5FO5A 1R1TA 1RPWA 3M7GA 1Y1VJ 3WTYC 1D3YA 5F1RA 4A3FJ 1YYVA 1UG0A 5FD5A 5K1YA 1X19A 4M3GA 4KN4X 2W7NA 2W25A 1EA3A 4OU0A 1LDKB 2AXLA 3OYGA 4Q47A 1J5YA 3CDIA 2RQQA 1VF9A 2LF7A 1B8IB 5LRRA 3CCJI 4PSWA 2IRFG 1TNSA 3P9CA 2EK5A 2MGQA 5E8IA 3TO6A 4BACA 5D5WB 2QCOA 2V1DA 1ZK8A 2CW8A 4FX4A 2HZTA 1BA5A 4FCYA 4II3A 1Z3XA 1IUYA 3JSPA 2NOJB 2QKLB 3I58A 4A0YA 4FETA 4HBLA 2OTJI 3V8JA 3DBRB 3LAJA 1O3RA 3KEYA 4XRSG 1FOKA 4PJJA 4C2TA 5J1YA 4A3DJ 4GYGA 2NYXA 1IN7A 2M8EA 2L02A 2DTRA 5K5RA 3K70D 3NAUA 3CP2A 2MA3A 2AQFA 3EUHC 4CZZA 3GFIA 1B1BA 3A02A 4Z2YA 3D5RC 4KMUX 2Z33A 2HGCA 4ZZLA 4UB8C 2FRHA 3FBNB 4FISA 3OYFA 1ENHA 1IXRC 4A6DA 3F6OA 1NG6A 4BE2A 2DODA 3J7AO 1GLNA 1MSEC 2K9LA 1JKOC 4HV6A 4BQQA 1U3EM 2YU9J 2KDOA 4GCVA 4RGUA 5TJJA 3ECOA 5GTIC 4UV8A 4D5FA 3Q0VA 3RJPA 2TRTA 5K5OA 4ENNA 4RB3C 2QEXI 4BKXA 1S9HA 4A93J 2MC3A 2BXYA 4JQFA 3OYMA 3PQKA 4IVNA 4KJZA 4N4OB 3OY9A 3A03A 3OIOA 2HPIA 3J80K 4RAZA 1CF7A 1VQ8I 3DF8A 1MDMA 4A3BJ 4LK1F 4PFPA 1ZG5A 4ZYGA 1NHAA 3KZZA 4HA8A 4B1RA 2H09A 4IL6C 1IC8A 3OL3A 1MH3A 1VQ6I 1AHDP 2V1NA 3BP8A 2HEOA 5DCMB 4S0HB 3KCCA 4M6YA 3U1KA 4DOZA 2X1CA 2ME6A 1I5ZA 1WFXA 1M1EB 2YPRA 4BQNA 3A4CA 2E2JJ 4HX8A 1D5YA 5GPCA 4A3LJ 3F0CA 2HFHA 4P96A 3LSGA 2HDDA 3GTQJ 4ESJA 3CMYA 2NVUB 2NS7A 4CYDA 2MABA 4J00A 2DMPA 1HDDC 2PEXA 4CICA 1D0XA 3BJ6A 3LMMA 2EFNA 4CA0A 2R7DA 3TP0A 2ZJRF 2P5KA 3ZMUA 4XKVA 5HOOA 1JKRC 2PX9A 2EFQA 4RAGA 1N75A 3J7YJ 1ZR4A 2XUBA 4OINF 3QU6A 1E3PA 1RR8C 1G6NA 2COBA 2LYCA 4NUBA 2Q2EA 2H94A 9ANTA 4CSWA 4L9JA 4BUPA 1BJAA 1QZYA 3CLOA 1B9MA 4L5JA 1K6OA 2NNYA 3OYHA 3B02A 2EFWA 5J6XA 3ECHA 2E1NA 1I3AA 2KZGA 2G0EA 3QPHA 3SYTA 2RV8A 2ZXJA 3GTOJ 4R1HA 2DQLA 1B4AA 3EPZA 2EZKA 2KIFA 3CCRI 4Q48A 2JPCA 5D8KB 3HHGA 3OL4A 1OCCH 5M3FJ 2H1LA 2DCEA 3BR5A 3M1CA 3K4BA 3RYRA 1LDDA 4WXHA 1WJBA 3H35A 4LLLA 1IN6A 4PDKA 1U5TA 3OYCA 1C0WA 4PFOA 4G8XA 4H4KC 4B8XA 3E5XA 2ID3A 1ETXA 3KP5A 2DT6A 2HQRA 3AAFA 2R5ZA 5K7HA 2ZBKA 3PIOF 4WXDA 4BDZA 2OAZA 4IJAA 2H8RA 2PJRA 3ABTA 2Z99A 2ISZA 4U0YA 5F0CA 4D5CA 3ISPA 1S8NA 1MJAA 3WTUC 3CCLI 1E3OC 3GWZA 4M3FA 4L0ZB 2QWWA 3ZOBA 5CVIA 3VEPA 3SDBA 3SEQA 5BS6A 2L9NA 3J81Z 3HOUJ 4XRMA 2XIGA 2M4GA 4G94A 2RKHA 4D7MA 3ELKA 4MLOA 3GTMJ 4B43A 3ULQB 1X1PA 4CCJA 3WE2A 3AL0C 4JX6A 2A61A 3WHBA 4ZYAA 1U2WA 2V9KA 1LUJB 2V1UA 2XKPA 1E0EA 3ZR8X 2GXBA 5CVRA 3ZN1A 1UCRA 4RS8A 5DD4A 2UWMA 5ERIA 1ZG1A 1FBUA 3BY6A 1WVRA 4B3AA 1QQIA 2O61A 4GRIA 5E3LA 3TDUC 4OIRF 2OQGA 3JRCA 1GV2A 4I2OA 3I54A 5E18F 3I55I 4M6VA 3TW6A 1BIAA 2KRCA 3HJEA 1JXSA 2X9DA 2PJRB 4HF0A 1QBJA 2HXOA 5KHDA 3F8CA 1FTTA 2KFDA 4M9SA 1LEAA 3WGHA 2QBYB 3IKVA 2RNGA 5EZHA 4LGWA 2VOOA 2L7ZA 4K2EA 1KQ0A 3H5RA 3LWFA 2LD5A 3U21A 3KZYA 3I4MJ 3BG5A 4LG0A 1MNDA 5BOXA 2ELJA 2LP0A 1YIOA 2O6GE 3S2WA 4DW6A 1RKTA 4M74A 2UZKA 3TL4X 1MJ9A 2ADUA 3HOYJ 2K86A 3ASOH 5B1AH 4BE0A 3ZRGA 4ZDPA 5IYCJ 4ENMA 3CCYA 1BC7C 2Z9OA 5DV5A 2P8TA 3PJRA 4BEHB 5HLGA 3BG6A 1I27A 1JTXA 2M4KA 3RPUD 2QM3A 4ZDOA 3HOVJ 1DUXC 3F6VA 2M0MA 1F5TA 1T2KA 4ANJA 4F92B 2V79A 2JJ7A 2IGMA 3D5SC 3TBIA 3LNQA 4C3HJ 2K27A 3LSIA 5BPIA 2DN0A 2I10A 2LKXA 2FNPA 2DOFA 3WTTC 3LL7A 3ZQQA 4XONA 3FXLA 3RIRA 3ERMA 5FKKA 4MFEA 3JRAA 4HLXA 4YEJA 3IRQA 2LF8A 4XLCA 5H6RA 2DMTA 5E8GA 1LQ1A 1UHMA 3EQLF 5AONA 4V2GA 4QPOA 4BH9A 1MBGA 2GWRA 4II2A 5LBQA 2ZSHB 5DS9A 1MBJA 1YO5C 1W36D 3S17J 3AL0B 3KETA 3QYFA 2O5RA 3E3VA 1A35A 2ETHA 1YS7A 5HDNA 2OUMA 3DP7A 3AKZA 5F6FA 2M87A 4IKFA 2JVHA 4AU7A 1LFBA 2EJRA 2DDAA 3TMOA 1FTZA 3MVPA 3S3MA 3TEDA 3RKYA 3K10A 4E4HA 1FP2A 3FMQA 2R5ZB 2IS6A 2XGDA 3GF2A 4LD5A 4B48A 2ME0A 3C3WA 2Q8KA 1JUPA 4O3MA 3RZDJ 4PK4A 3DFGA 2YS9A 3E6MA 1BJZA 4MNUA 5DD8A 2CW0F 2CFXA 2IBDA 3HXLA 4I7HA 2LY9A 3P9KA 3K69A 5D6EA 2CO5A 2IA1A 5HLIA 1IDYA 5CPRB 1NH3A 4CHUA 4A5MA 2FNAA 3K4MA 4XBFA 5J1RA 1JI8A 3L1PA 2WWYA 2WA0A 1J59A 1K79A 2XVCA 1MIJA 4U7DA 3BT9A 2BYVE 3CJNA 1E17A 5EGOA 1S7EA 2HPMA 3ESWB 3S2DJ 1MSFC 2KJCA 5IT3A 1D1CA 2L4AA 3KYDB 2KQRA 4UVAA 1ONVA 3P9IA 1FOWA 3IWZA 4XSZF 4E7IA 2LREA 4F7ZA 1MGTA 3HSEA 1ORKA 2H6CA 3H0GJ 5B1BH 2BXZA 3BG7A 5D8LB 4A3GJ 1BOAA 4IHSA 2XAGA 2XB0X 1JTYA 3GW2A 3V7RA 3M4OJ 1V4RA 2OD5A 4OOIA 1TQIA 3VDXA 2HU9A 2GBYA 1U8BA 1O3QA 2K3FA 4XIDA 1R58A 2HKXA 2ZXHA 4D0PA 3A0HC 1ERDA 1SVOA 2OQRA 2M45A 3DBHB 2BZTA 1IV8A 1ZYRF 5FJ8J 1D8KA 4EM2A 1KA8A 4MTEA 3MZ8A 3L7WA 1XX5A 3EUKL 1P4AA 3DCFA 4PSXA 4RLQA 2Z16A 5F08A 2ZB9A 3A0BC 1K78B 2J5OA 3S2HJ 1T0FC 4LOCA 3S3OA 2R5YB 2HDCA 4CCKA 4X1EA 3K2AA 2R7WA 2FX0A 2O8KA 1Z0XA 4FHTA 1TTYA 3B6AA 4BHBA 4AIKA 1R22A 3ABUA 3J7ZI 3RPQA 1HCRA 1QPMA 2WC2A 4PJMA 2IEKA 3FKIJ 4RGSA 4KIFA 1V5FA 2F5EA 1MMDA 1X1CA 3H9JA 1IG7A 2OCEA 3KEOA 4TV7A 1J2XA 3G73A 1WH5A 5H20A 2CQXA 4LB5A 1POGA 4XORA 1OFCX 3SHFA 2A6TA 1IRFA 3KP6A 4I02A 1TC3C 3K1MA 1PVEA 4LMYA 2LH9A 2W84A 3I4PA 4FT8A 3ZQ7A 1T95A 3OYBA 2ZJPF 2XRNA 3I53A 4OMZA 4XMYA 5J40A 5J8FA 1VTNC 2H6BA 1JT6A 2HTSA 3R4KA 5FFXA 2M3AA 1QU3A 2VQGA 3LSKA 3Q0UA 2HXIA 1TWHJ 1TWCJ 2XHKA 2F6CA 4EJVA 3ZPLA 2HQNA 2ESHA 1MH4A 2CFOA 3TOAA 3CCQI 1MBHA 1X4OA 1O3TA 5LHGA 2IGNA 3N4MA 4YIFA 3HUGA 4IHTA 1ITYA 2E36A 1T6SA 3IP4B 1BR4A 4UV9A 3OOPA 4IQ4A 1ZQ3P 3JTHA 1DPUA 1R00A 2O3FA 5EG0B 3OYNA 3GZ6A 2QA4I 4NBQA 1XB4A 3V7CA 2R7XA 2DK8A 5FRMA 4CDGA 2HOEA 2KT0A 2LVSA 2VLAA 1A31A 3PNYA 4MTDA 2LY1A 4XM3A 4F91B 1YW7A 1U78A 5F1JA 2CQQA 1V55H 1HSTA 2GXGA 1CF7B 5AIQA 3JCUC 3SZPA 4BYYA 2Y9ZA 3VYTB 1VNDA 1MMAA 3CTAA 3K1PA 3I59B 4XICA 3JSOA 1IRXA 4M9ZA 2DYSH 3LOCA 3CC2I 2H8WA 3W2AA 1BOBA 4P55A 3K4JA 3DU6A 3PFIA 5LLQA 2FXAA 4BNCA 1U6GA 5C44J 1XS9A 1ZN2A 2NRAC 1YTYA 3UR3C 1Z77A 4OWRB 5E3NA 2KJBA 1W4MA 1IDZA 5J47A 2QQAA 1Z67A 2NVXJ 2F4OB 3NWTA 2NS0A 4DJAA 1IW7F 1TL8A 1BR1A 5E3OA 1YFHA 3DV8A 1P2FA 2LY2A 2KRFA 3K2ZA 1YX5A 2DTZA 4A3JJ 2Y30A 1I3QJ 2I5UA 2ZJ2A 5CVJA 2EBIA 3QOPA 4WF2A
chains in the Genus database with same CATH topology
3PO2J 4QTRA 1JT0A 1IC8A 1MH3A 4AYBN 4DYRA 2DA3A 1AHDP 3UKGA 5EEAA 5IOZA 2EZIA 1XG1A 1QRYA 2Y31A 4S0HB 1GDTA 2DA4A 2ME6A 1B72B 2JA5J 2E2JJ 1D5YA 1AKHB 5GPCA 4A3LJ 3F0CA 2E19A 3LSGA 2HDDA 2M8GX 1HLVA 3GTQJ 1B8IA 3CMYA 2NS7A 2XSDC 5EZGA 4IHYA 5IP6A 3HOXJ 1HDDC 2DMPA 5C4JJ 3H3VK 4BBSJ 3TP0A 3JRGA 4IHWA 4DYQA 1WH7A 1JKRC 4B4CA 1YRNA 2Y0SN 5JLWA 4A3EJ 1ZR4A 5M5WJ 1OCPA 3I4NJ 2XPUA 1FIAA 2COBA 3CQZJ 3HBLA 4XK4A 3B6CA 2Y9YA 3BR6A 4JX5A 5EG0A 3ZQLA 3HKZN 1PUFA 2O7OA 1R9TJ 9ANTA 2H1KA 2O9LA 1P7IA 1GV5A 2JA6J 1BW5A 1GUUA 2M2EA 3RKQA 1H8AC 1TWAJ 3SFIA 2G0EA 1IRZA 4FE7A 4C2MJ 4M3DA 3HEFA 3GTOJ 1XC5A 3GTJJ 4X6AJ 2EZKA 1H88C 1K83J 1I50J 4W97A 3TP3A 3PM1A 3VPRA 4C3JJ 3IV5A 5M3FJ 3BR5A 2FJ1A 2HOTA 1VI0A 1MBKA 3BQYA 5F04A 2JA7J 3PO3J 2ID3A 2K9QA 1FIPA 3LSRA 3LSPA 1ETXA 1X58A 2R5ZA 4W1UA 5K7HA 1LE8B 1SFOJ 4GFBA 2NVTJ 5JLXA 2MG4A 3HGYA 3SJMA 3BR1A 4ABZA 2HI3A 2DA1A 5EYRA 3S1MJ 2N8GA 2H8RA 5F0CA 4D5CA 1BL0A 2K9SA 1JUMA 1E3OC 1ETKA 4M3FA 4BXXJ 1UMQA 2YUSA 3ZOBA 1W0TA 2VUMJ 1F36A 2LLKA 1WGXA 2HQ5A 3G1LA 1H89C 3HOUJ 4XRMA 3CDLA 1ETYA 4D7MA 4MLOA 4CYCB 3GTMJ 4I6ZA 1HOMA 3ZQHA 3MN2A 5HODA 4JX6A 3BR3A 3HB9A 3WHBA 2XGEA 2FQ4A 1IUFA 1ZR2A 2ECCA 2E2IJ 2PMZN 1IV6A 3BG9A 2NS8A 1IJWC 3ZQGA 4B3AA 3GTLJ 5GPAA 1T56A 5E3LA 3S14J 3JRDA 1LFUP 3JRCA 1GV2A 4M6VA 3TW6A 1A6IA 1X2NA 5M5YJ 5M5XJ 5EDNA 3A01A 3D1NI 2X9DA 2HXOA 3WHCA 4RDUA 1JUSA 1FTTA 2QF7A 1UG2A 2VPRA 5EZHA 1QVUA 5IP9J 2L7ZA 3BQZA 4UUSA 2R93J 2B63J 2LD5A 3E7LA 3I4MJ 3BG5A 2LP0A 2NVYJ 4IHXA 1W0UA 4DW6A 1RKTA 1JJ6C 1RR7A 4A3CJ 5FLVA 3HOYJ 5IYCJ 2JA8J 3CCYA 3BTCA 5FKLA 2XB5A 1U9NA 2JWTA 3JRFA 3OOUA 2VKEA 1JTXA 3OSGA 3BG3A 3RZOJ 2VI6A 4FE4A 3HOVJ 4Y52J 2FD5A 4AC0A 4BBRJ 2R92J 1DU0A 3RQIA 2JJ7A 3LNQA 4C3HJ 1WCMJ 2DN0A 2I10A 2LKXA 1K61A 2EQRA 1JKQC 5FKKA 1U9OA 4MFEA 2EH3A 4UUSB 3JRAA 2DJNA 1EF4A 2CRGA 2DMTA 2DA5A 3K7AJ 3HDDA 2LTPA 4V2GA 5DS9A 1MBGA 3LSJA 1MBJA 3S17J 2LR8A 1RETA 5DTDA 2RAEA 3JRBA 1JGGA 3FISA 2MSYA 4IHVA 3HOZJ 1TWGJ 3FK6A 2DA2A 1LFBA 2X48A 1B72A 4MIMA 1FTZA 2XGCA 3MVPA 1MBEA 2HOAA 1Q1VA 3TEDA 1HF0A 5C4XJ 2M9HA 1CQTA 1ETQA 2R5ZB 2XGDA 2ME0A 3HGGA 1JUPA 3Q0WA 5F0HA 5BNGA 3RZDJ 2YS9A 1BJZA 1ZKGA 5EF6A 2IBDA 1IGNA 4M3EA 2LY9A 3QQAA 3O8GA 1DU6A 1IDYA 5GP9A 2IAIA 2M0CA 3QPLA 5J3LA 2NVQJ 3GTKJ 3HM5A 1GVDA 5J1RA 4JP0A 2M34A 3L1PA 1MBFA 2ID6A 5EGOB 2DA6A 3W6VA 3IH2A 3SDGA 3BT9A 3IH3A 5J1UA 5EGOA 3C2BA 1BW6A 2KDZA 1S7EA 2LK2A 3S2DJ 1MSFC 4JYKA 1QPIA 3IH4A 2L0KA 5IYBJ 2OF7A 4V2FA 2CJJA 2XPVA 3G1MA 1ORKA 2XRLA 2CUFA 3HOWJ 1P7JA 1OJLA 3H0GJ 2L7FP 1A5JA 2JN6A 4A3GJ 1VFCA 4UUTA 1HDPA 2XB0X 1YRNB 5K7FA 1JTYA 1WPKA 4A3MJ 3M4OJ 4BY7J 3JRIA 1TWFJ 4DYCA 2P81A 2GBYA 2EZHA 1ETOA 4RBOA 4J19A 2AO9A 1U8BA 4XIDA 1LE8A 5FKMA 2MW8A 2GLOA 1FEXA 1NK3P 2DMQA 1RKWA 4MFDA 1JKPC 1F43A 1ZTRA 3BTJA 5K7ZA 5FJ8J 4QSHA 2L9RA 4DZPA 3FK7A 4HNVA 3ZQIA 3S1NJ 2VKVA 3DCFA 2W48A 4EEFG 5F08A 5C3EJ 3S1RJ 2ZB9A 1O4XA 2WAQN 5F0FA 3S2HJ 4D7NA 2GM4A 5IP7J 4LOCA 1T33A 4IEJA 2R5YB 1RESA 4C3IJ 4X1EA 3K2AA 3S16J 5FKOA 2FX0A 2Y2ZA 2O8KA 4BY1J 1Z0XA 2WB1N 3JR9A 3B6AA 1PUFB 1HCRA 2DMUA 1MNMC 2IEKA 3FKIJ 3TW7A 4I76A 4L5EA 4MO7A 5M3MJ 2HOSA 1IG7A 2LFBA 3NARA 1APLC 1WH5A 2L7MP 2CQXA 4FTHA 3A01B 3DEWA 2TCTA 3ZQFA 2ECBA 4A3IJ 1Y1WJ 1POGA 1OFCX 1OCTC 2DA7A 4CYCA 3GBGA 1TC3C 1I6HJ 5IPAA 3G1OA 2XPWA 3MKLA 1QVTA 3S15J 1AU7A 1RPWA 4AUXA 1Y1VJ 4A3FJ 1JT6A 4M3GA 3BTIA 2R5YA 3GTPJ 5FKNA 1ZGWA 2X6OA 3Q0UA 1G2HA 2HXIA 1TWHJ 1VF9A 1TWCJ 1MH4A 1B8IB 2MGQA 1MBHA 4G12A 2QCOA 2K40A 1ITYA 1ETWA 1ZK8A 3Q3SA 4FCYA 1BA5A 1ZQ3P 2OPTA 5EG0B 2K9NA 2DMNA 3GTGJ 1JJ8C 4M3BA 4XRSG 3BR2A 5J1YA 4A3DJ 2LVSA 2KT0A 3ZQCA 1SANA 4JX4A 1GT0C 2E2HJ 3JREA 5E3MA 1FJLA 2D5VA 1U78A 4DZJA 5F1JA 2JMWA 3NAUA 2CQQA 4NDLA 4A3KJ 3M3YJ 2NOGA 1AKHA 3A02A 5IYDJ 4A69C 2Y9ZA 1VNDA 4FISA 1UHSA 1ENHA 4XICA 3QPSA 2AHQA 3FIWA 3LOCA 2HYJA 1MSEC 1JKOC 3S1QJ 2YU9J 5C44J 1XS9A 3BR0A 1NTCA 4XRSA 2EZLA 2CUEA 4D5FA 1Z77A 3Q0VA 5E3NA 2JK3A 2TRTA 2CU7A 1IDZA 5FLMJ 2NVXJ 3BTLA 4BKXA 1WI3A 5IOYA 2R0QC 4A93J 5E3OA 3JRHA 1ETVA 1X2MA 1NK2P 3A03A 3O8HA 3OIOA 3OSFA 5F27A 2R7ZJ 2E1OA 2DTZA 4A3JJ 2Y30A 4A3BJ 1I3QJ 4Y7NJ 4QIWN 2ELKA 2WV1A 4B1RA 2EBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO2 J;  4QTR A;  1JT0 A;  1IC8 A;  1MH3 A;  4AYB N;  4DYR A;  2DA3 A;  1AHD P;  3UKG A;  5EEA A;  5IOZ A;  2EZI A;  1XG1 A;  1QRY A;  2Y31 A;  4S0H B;  1GDT A;  2DA4 A;  2ME6 A;  1B72 B;  2JA5 J;  2E2J J;  1D5Y A;  1AKH B;  5GPC A;  4A3L J;  3F0C A;  2E19 A;  3LSG A;  2HDD A;  2M8G X;  1HLV A;  3GTQ J;  1B8I A;  3CMY A;  2NS7 A;  2XSD C;  5EZG A;  4IHY A;  5IP6 A;  3HOX J;  1HDD C;  2DMP A;  5C4J J;  3H3V K;  4BBS J;  3TP0 A;  3JRG A;  4IHW A;  4DYQ A;  1WH7 A;  1JKR C;  4B4C A;  1YRN A;  2Y0S N;  5JLW A;  4A3E J;  1ZR4 A;  5M5W J;  1OCP A;  3I4N J;  2XPU A;  1FIA A;  2COB A;  3CQZ J;  3HBL A;  4XK4 A;  3B6C A;  2Y9Y A;  3BR6 A;  4JX5 A;  5EG0 A;  3ZQL A;  3HKZ N;  1PUF A;  2O7O A;  1R9T J;  9ANT A;  2H1K A;  2O9L A;  1P7I A;  1GV5 A;  2JA6 J;  1BW5 A;  1GUU A;  2M2E A;  3RKQ A;  1H8A C;  1TWA J;  3SFI A;  2G0E A;  1IRZ A;  4FE7 A;  4C2M J;  4M3D A;  3HEF A;  3GTO J;  1XC5 A;  3GTJ J;  4X6A J;  2EZK A;  1H88 C;  1K83 J;  1I50 J;  4W97 A;  3TP3 A;  3PM1 A;  3VPR A;  4C3J J;  3IV5 A;  5M3F J;  3BR5 A;  2FJ1 A;  2HOT A;  1VI0 A;  1MBK A;  3BQY A;  5F04 A;  2JA7 J;  3PO3 J;  2ID3 A;  2K9Q A;  1FIP A;  3LSR A;  3LSP A;  1ETX A;  1X58 A;  2R5Z A;  4W1U A;  5K7H A;  1LE8 B;  1SFO J;  4GFB A;  2NVT J;  5JLX A;  2MG4 A;  3HGY A;  3SJM A;  3BR1 A;  4ABZ A;  2HI3 A;  2DA1 A;  5EYR A;  3S1M J;  2N8G A;  2H8R A;  5F0C A;  4D5C A;  1BL0 A;  2K9S A;  1JUM A;  1E3O C;  1ETK A;  4M3F A;  4BXX J;  1UMQ A;  2YUS A;  3ZOB A;  1W0T A;  2VUM J;  1F36 A;  2LLK A;  1WGX A;  2HQ5 A;  3G1L A;  1H89 C;  3HOU J;  4XRM A;  3CDL A;  1ETY A;  4D7M A;  4MLO A;  4CYC B;  3GTM J;  4I6Z A;  1HOM A;  3ZQH A;  3MN2 A;  5HOD A;  4JX6 A;  3BR3 A;  3HB9 A;  3WHB A;  2XGE A;  2FQ4 A;  1IUF A;  1ZR2 A;  2ECC A;  2E2I J;  2PMZ N;  1IV6 A;  3BG9 A;  2NS8 A;  1IJW C;  3ZQG A;  4B3A A;  3GTL J;  5GPA A;  1T56 A;  5E3L A;  3S14 J;  3JRD A;  1LFU P;  3JRC A;  1GV2 A;  4M6V A;  3TW6 A;  1A6I A;  1X2N A;  5M5Y J;  5M5X J;  5EDN A;  3A01 A;  3D1N I;  2X9D A;  2HXO A;  3WHC A;  4RDU A;  1JUS A;  1FTT A;  2QF7 A;  1UG2 A;  2VPR A;  5EZH A;  1QVU A;  5IP9 J;  2L7Z A;  3BQZ A;  4UUS A;  2R93 J;  2B63 J;  2LD5 A;  3E7L A;  3I4M J;  3BG5 A;  2LP0 A;  2NVY J;  4IHX A;  1W0U A;  4DW6 A;  1RKT A;  1JJ6 C;  1RR7 A;  4A3C J;  5FLV A;  3HOY J;  5IYC J;  2JA8 J;  3CCY A;  3BTC A;  5FKL A;  2XB5 A;  1U9N A;  2JWT A;  3JRF A;  3OOU A;  2VKE A;  1JTX A;  3OSG A;  3BG3 A;  3RZO J;  2VI6 A;  4FE4 A;  3HOV J;  4Y52 J;  2FD5 A;  4AC0 A;  4BBR J;  2R92 J;  1DU0 A;  3RQI A;  2JJ7 A;  3LNQ A;  4C3H J;  1WCM J;  2DN0 A;  2I10 A;  2LKX A;  1K61 A;  2EQR A;  1JKQ C;  5FKK A;  1U9O A;  4MFE A;  2EH3 A;  4UUS B;  3JRA A;  2DJN A;  1EF4 A;  2CRG A;  2DMT A;  2DA5 A;  3K7A J;  3HDD A;  2LTP A;  4V2G A;  5DS9 A;  1MBG A;  3LSJ A;  1MBJ A;  3S17 J;  2LR8 A;  1RET A;  5DTD A;  2RAE A;  3JRB A;  1JGG A;  3FIS A;  2MSY A;  4IHV A;  3HOZ J;  1TWG J;  3FK6 A;  2DA2 A;  1LFB A;  2X48 A;  1B72 A;  4MIM A;  1FTZ A;  2XGC A;  3MVP A;  1MBE A;  2HOA A;  1Q1V A;  3TED A;  1HF0 A;  5C4X J;  2M9H A;  1CQT A;  1ETQ A;  2R5Z B;  2XGD A;  2ME0 A;  3HGG A;  1JUP A;  3Q0W A;  5F0H A;  5BNG A;  3RZD J;  2YS9 A;  1BJZ A;  1ZKG A;  5EF6 A;  2IBD A;  1IGN A;  4M3E A;  2LY9 A;  3QQA A;  3O8G A;  1DU6 A;  1IDY A;  5GP9 A;  2IAI A;  2M0C A;  3QPL A;  5J3L A;  2NVQ J;  3GTK J;  3HM5 A;  1GVD A;  5J1R A;  4JP0 A;  2M34 A;  3L1P A;  1MBF A;  2ID6 A;  5EGO B;  2DA6 A;  3W6V A;  3IH2 A;  3SDG A;  3BT9 A;  3IH3 A;  5J1U A;  5EGO A;  3C2B A;  1BW6 A;  2KDZ A;  1S7E A;  2LK2 A;  3S2D J;  1MSF C;  4JYK A;  1QPI A;  3IH4 A;  2L0K A;  5IYB J;  2OF7 A;  4V2F A;  2CJJ A;  2XPV A;  3G1M A;  1ORK A;  2XRL A;  2CUF A;  3HOW J;  1P7J A;  1OJL A;  3H0G J;  2L7F P;  1A5J A;  2JN6 A;  4A3G J;  1VFC A;  4UUT A;  1HDP A;  2XB0 X;  1YRN B;  5K7F A;  1JTY A;  1WPK A;  4A3M J;  3M4O J;  4BY7 J;  3JRI A;  1TWF J;  4DYC A;  2P81 A;  2GBY A;  2EZH A;  1ETO A;  4RBO A;  4J19 A;  2AO9 A;  1U8B A;  4XID A;  1LE8 A;  5FKM A;  2MW8 A;  2GLO A;  1FEX A;  1NK3 P;  2DMQ A;  1RKW A;  4MFD A;  1JKP C;  1F43 A;  1ZTR A;  3BTJ A;  5K7Z A;  5FJ8 J;  4QSH A;  2L9R A;  4DZP A;  3FK7 A;  4HNV A;  3ZQI A;  3S1N J;  2VKV A;  3DCF A;  2W48 A;  4EEF G;  5F08 A;  5C3E J;  3S1R J;  2ZB9 A;  1O4X A;  2WAQ N;  5F0F A;  3S2H J;  4D7N A;  2GM4 A;  5IP7 J;  4LOC A;  1T33 A;  4IEJ A;  2R5Y B;  1RES A;  4C3I J;  4X1E A;  3K2A A;  3S16 J;  5FKO A;  2FX0 A;  2Y2Z A;  2O8K A;  4BY1 J;  1Z0X A;  2WB1 N;  3JR9 A;  3B6A A;  1PUF B;  1HCR A;  2DMU A;  1MNM C;  2IEK A;  3FKI J;  3TW7 A;  4I76 A;  4L5E A;  4MO7 A;  5M3M J;  2HOS A;  1IG7 A;  2LFB A;  3NAR A;  1APL C;  1WH5 A;  2L7M P;  2CQX A;  4FTH A;  3A01 B;  3DEW A;  2TCT A;  3ZQF A;  2ECB A;  4A3I J;  1Y1W J;  1POG A;  1OFC X;  1OCT C;  2DA7 A;  4CYC A;  3GBG A;  1TC3 C;  1I6H J;  5IPA A;  3G1O A;  2XPW A;  3MKL A;  1QVT A;  3S15 J;  1AU7 A;  1RPW A;  4AUX A;  1Y1V J;  4A3F J;  1JT6 A;  4M3G A;  3BTI A;  2R5Y A;  3GTP J;  5FKN A;  1ZGW A;  2X6O A;  3Q0U A;  1G2H A;  2HXI A;  1TWH J;  1VF9 A;  1TWC J;  1MH4 A;  1B8I B;  2MGQ A;  1MBH A;  4G12 A;  2QCO A;  2K40 A;  1ITY A;  1ETW A;  1ZK8 A;  3Q3S A;  4FCY A;  1BA5 A;  1ZQ3 P;  2OPT A;  5EG0 B;  2K9N A;  2DMN A;  3GTG J;  1JJ8 C;  4M3B A;  4XRS G;  3BR2 A;  5J1Y A;  4A3D J;  2LVS A;  2KT0 A;  3ZQC A;  1SAN A;  4JX4 A;  1GT0 C;  2E2H J;  3JRE A;  5E3M A;  1FJL A;  2D5V A;  1U78 A;  4DZJ A;  5F1J A;  2JMW A;  3NAU A;  2CQQ A;  4NDL A;  4A3K J;  3M3Y J;  2NOG A;  1AKH A;  3A02 A;  5IYD J;  4A69 C;  2Y9Z A;  1VND A;  4FIS A;  1UHS A;  1ENH A;  4XIC A;  3QPS A;  2AHQ A;  3FIW A;  3LOC A;  2HYJ A;  1MSE C;  1JKO C;  3S1Q J;  2YU9 J;  5C44 J;  1XS9 A;  3BR0 A;  1NTC A;  4XRS A;  2EZL A;  2CUE A;  4D5F A;  1Z77 A;  3Q0V A;  5E3N A;  2JK3 A;  2TRT A;  2CU7 A;  1IDZ A;  5FLM J;  2NVX J;  3BTL A;  4BKX A;  1WI3 A;  5IOY A;  2R0Q C;  4A93 J;  5E3O A;  3JRH A;  1ETV A;  1X2M A;  1NK2 P;  3A03 A;  3O8H A;  3OIO A;  3OSF A;  5F27 A;  2R7Z J;  2E1O A;  2DTZ A;  4A3J J;  2Y30 A;  4A3B J;  1I3Q J;  4Y7N J;  4QIW N;  2ELK A;  2WV1 A;  4B1R A;  2EBI A; 
#chains in the Genus database with same CATH topology
 2QUF A;  4U0V A;  1R6R A;  2EFP A;  4QTR A;  1JT0 A;  5DM6 F;  4AYB N;  3C18 A;  4MQ9 F;  2K02 A;  1XDU A;  2Y0S A;  4HYE A;  3QU3 A;  2M1B A;  1OPC A;  4ZDL A;  5IOZ A;  1ZAO A;  1R7J A;  1GDT A;  2IPQ X;  3WU2 C;  2JA5 J;  2A05 A;  2EV5 A;  1RRJ A;  1AKH B;  4V19 K;  1PDN C;  5HS7 A;  1B8I A;  1W36 C;  4A2U A;  3PFY A;  4IHY A;  3BJO A;  1CGP A;  1SD4 A;  1TW3 A;  1D5V A;  4BBS J;  2IS1 A;  4CCM A;  2FA5 A;  3ZMD A;  1OCO H;  2Y0S N;  3GCM A;  5JLW A;  2QBY A;  4HF1 A;  5M5W J;  4CZC A;  3LAP A;  2A3S A;  2A5Y B;  3I4N J;  3RYP A;  1FIA A;  3CQZ J;  4XK4 A;  4BL0 B;  2E1C A;  3BR6 A;  3PL8 A;  1REP C;  3VB2 A;  2F5D A;  3HKZ N;  3ZQL A;  1T8I A;  2O7O A;  3I71 A;  3CUQ B;  5AIP A;  2JA6 J;  1BW5 A;  3CJT B;  3TDZ C;  3RKQ A;  3E97 A;  1R1U A;  4ESF A;  1TWA J;  4C2U A;  3ROU A;  1YW9 A;  1FBS A;  3H1C A;  4FE7 A;  4C2M J;  2B9S A;  2L9S A;  1LDJ A;  3HEF A;  2VT2 A;  2COM A;  2LBF B;  3H5N A;  1XC5 A;  1TT0 A;  1FNN A;  3NWS A;  4E7J A;  1XD7 A;  2IA0 A;  2QQB A;  1H88 C;  1G3W A;  1G59 A;  4XN0 A;  2IXS A;  5CYV A;  3PM1 A;  3VPR A;  4C3J J;  4YFN F;  3IV5 A;  4AVP A;  4ZTJ A;  2FJ1 A;  3G2B A;  2HOT A;  3I0T A;  2K7L A;  2VKD A;  3NRV A;  3BCB A;  3H36 A;  5F04 A;  2JA7 J;  3PO3 J;  2K9Q A;  3HPG A;  1FIP A;  2R3S A;  4NQW A;  5HLT A;  2FMY A;  2EIM H;  1MMS A;  1LE8 B;  4GFB A;  2NVT J;  5JLX A;  2MG4 A;  3HGY A;  3SJM A;  1FOX A;  2UXX A;  4ABZ A;  2DA1 A;  3H5A A;  4P5O A;  3S1M J;  1SD7 A;  3F8B A;  2M5W A;  1XGM A;  3OIQ A;  4Y33 A;  1JUM A;  2OBP A;  1LNW A;  3IAM 2;  4M71 A;  4M9X A;  1UMQ A;  4G7Z F;  2Q1Z B;  3FHN A;  2Z3Y A;  3GFM A;  2E5Z A;  2VUM J;  4KIS A;  3LSH A;  1WGX A;  2HQ5 A;  4HG2 A;  2ZFW A;  1ETY A;  4RAF A;  1Z91 A;  1KQ9 A;  4G9Y A;  3T8R A;  4I6Z A;  3L09 A;  1QHG A;  3ZQH A;  1BI0 A;  4ITV A;  2CWE A;  3O6B B;  2LC2 A;  1TQP A;  3HB9 A;  4OIO F;  2CMP A;  4E7L A;  2CSO A;  1XDS A;  2Y48 A;  4J01 A;  3R60 A;  3DLL F;  4KT5 C;  1HBX G;  2E2I J;  2QQ8 A;  3MMY B;  2PMZ N;  3KX2 A;  1HW1 A;  3S14 J;  3S3N A;  3VYR B;  1LFU P;  4NC8 A;  1WZ2 A;  2KZV A;  4B3X A;  3L2U A;  1LEB A;  1X1B A;  1HQC A;  4QLC U;  3GXO A;  3DPU A;  3QPT A;  3D1N I;  3LA3 A;  1TW2 A;  5ICE A;  2Y75 A;  1U5T C;  4RDU A;  5ILS A;  4HST A;  4KIG A;  3D0S A;  3TKY A;  1UG2 A;  3GLL A;  2IW5 A;  3E5Q A;  1VQN I;  1R5I D;  1V3F A;  1QVU A;  2XV4 S;  5IP9 J;  5H2F C;  4B09 A;  2VIX A;  3LA2 A;  4UUS A;  4S05 A;  3V8K A;  2R93 J;  2BY0 A;  3CCM I;  2XAS A;  2R4G A;  1R5G A;  1FYM A;  1Y8R B;  4OIP F;  4IOC F;  2NVY J;  4EGY A;  3PQJ A;  4BAY A;  2X0L A;  3G4S I;  1A36 A;  4XLA A;  3HG9 A;  1RR7 A;  1K4S A;  1D8J A;  3ABM H;  4A3C J;  4RGR A;  1XCV A;  4F55 A;  2AXT C;  3G3Z A;  1WSU A;  3FXR A;  5KVR A;  5EJC A;  2FU4 A;  4LLG F;  2JWT A;  2YU3 A;  4Y17 A;  3JRF A;  1T38 A;  3DU5 A;  2YX4 A;  3OSG A;  1JHH A;  1SD5 A;  4WCG A;  3RZO J;  3RDI A;  2ZME A;  1FC3 A;  4AYB A;  2JT1 A;  3WOD F;  3J80 Z;  1YJ9 I;  1ACI A;  4BBR J;  4YRV A;  2R92 J;  4HLY A;  1OMI A;  3DXJ F;  3Q5F A;  3GME A;  1V54 H;  1OQY A;  1YIJ I;  2K4B A;  1G4D A;  4AWX B;  1WCM J;  2DBB A;  2KKO A;  2GQQ A;  3ZMT A;  3VSL A;  5DCM A;  5D5U B;  4AID A;  3J7A Y;  3DTE A;  3K4N A;  4UUS B;  1OYY A;  2F2E A;  4KMF A;  1EF4 A;  1P4X A;  2CYY A;  2E34 A;  1HSJ A;  1ZRC A;  3WTW C;  2DA5 A;  2JQ7 A;  4G7O F;  1QZZ A;  4P1W A;  3CJQ B;  4E7H A;  1Z1D A;  5E1X A;  1ZAR A;  2MLK A;  2JTV A;  6PAX A;  2LR8 A;  2VON A;  5DTD A;  1A6Q A;  5HNH A;  2DFH A;  2EIJ H;  3HSF A;  3OV8 A;  2NAZ A;  4ZH4 F;  5FRO A;  3CDH A;  1ZG3 A;  2LG4 A;  4Y4R A;  4YG2 F;  3FK6 A;  5KCM A;  3FKJ A;  2QQ9 A;  4PCQ A;  5ILV A;  4N4N B;  1KQ8 A;  1Z3Y A;  1USS A;  4FAS D;  4EAT A;  2XGC A;  1HF0 A;  3EUA A;  2W4S A;  2P6S A;  2EA2 A;  2X4H A;  1K78 A;  4KNY A;  2BEO A;  5BNG A;  3WU1 B;  1Q1H A;  3CZ6 A;  3I56 I;  2W24 A;  4Y13 A;  2MD5 A;  3N05 A;  2DW4 A;  3LA7 A;  3HUG B;  1SFU A;  4XSX F;  1Z9C A;  2R7R A;  3O8G A;  4NNJ A;  1DU6 A;  1W1W E;  1Z6T A;  1I1S A;  3DEU A;  2EFO A;  5LGN A;  5K5Q A;  1UHW A;  1W7P D;  2QKM B;  3OWT A;  2WAQ A;  1Y39 A;  2M34 A;  3CES A;  1MBF A;  3Q9V A;  2DLL A;  3W6V A;  3S93 A;  4ZC3 A;  3SDG A;  5J1U A;  2FQ3 A;  2QVO A;  4LFU A;  1BW6 A;  2W85 A;  3HL2 A;  2HNH A;  2LK2 A;  1VQ5 I;  3V42 A;  2VJ5 A;  3H9Q A;  4EVI A;  5CLS A;  1YI2 I;  2EV0 A;  3IH4 A;  2L0K A;  4HX7 A;  2CJJ A;  2XRL A;  2CUF A;  2LKP A;  4ESB A;  1T98 A;  3J81 K;  1A5J A;  2JN6 A;  2WTE A;  4CCL A;  2FEZ A;  3BPX A;  3I64 A;  1HDP A;  1YRN B;  2H27 A;  1N25 A;  1FZP B;  2UXN A;  4BY7 J;  3JRI A;  1R71 A;  1EH7 A;  5KK1 A;  1MJB A;  4IX7 A;  3BPV A;  4XNF A;  2YX7 A;  4J19 A;  4RBO A;  2BVL A;  2AO9 A;  3OYD A;  3MZH A;  1LE8 A;  3K0L A;  4UUV A;  1FMW A;  1Z05 A;  2BHZ A;  5FKM A;  2KIS A;  4HRI A;  1NK3 P;  4RB0 A;  3CJR B;  2DMQ A;  3BCA A;  3SEZ A;  1VZ0 A;  4WXC A;  2OC6 A;  1BR2 A;  2CV2 A;  1IXS B;  2RNJ A;  2DT7 B;  1S7A A;  4GYI A;  1ON1 A;  2V1X A;  2ZXW H;  5KAF C;  5FFZ A;  3BWG A;  2L9R A;  5B66 C;  3SXY A;  1X3W B;  4PJL A;  3VWB A;  3ZQI A;  2J5P A;  3BDD A;  2DPD A;  4DQ2 A;  2VQL A;  1I6X A;  1Y0N A;  2W48 A;  4EEF G;  4BGD A;  1QHH D;  1X3U A;  2E5N A;  1O4X A;  3E1S A;  2BOL A;  2WAQ N;  3DEE A;  5CKT A;  4KIT B;  5JR3 A;  5JFR A;  2UUZ A;  5IP7 J;  3OS2 A;  3DKX A;  2DQR A;  2R7S A;  1V5E A;  5L3F A;  3L2Q A;  3MEX A;  3S16 J;  3CO6 C;  1QA6 A;  1V5G A;  4BE1 A;  1W7P A;  4HNT A;  3VYS B;  1OCZ H;  1PYV A;  2F5F A;  3W2V A;  2JA2 A;  3PIP F;  2RRE A;  1FP1 D;  1KYW A;  1UJ8 A;  3ABK H;  2KRH A;  2CW7 A;  2A6H F;  1GXQ A;  3MKY B;  2FUG 2;  3MAJ A;  2RN7 A;  4L5E A;  2WBM A;  4M6X A;  3HRM A;  4MO7 A;  4L18 B;  2KLO A;  4IRI A;  2L5Q A;  5HDK A;  1D0Z A;  3WGI A;  2ZKZ A;  2V9V A;  1R4M B;  4UXN A;  3AG2 H;  2DPU A;  2TCT A;  3HOT A;  1WJF A;  4RA2 A;  4A3I J;  4AM3 A;  3FZV A;  1Y1W J;  1R23 A;  1OCT C;  1VQ9 I;  4G6T B;  4CYC A;  5IPA A;  5DCF A;  3DQV C;  3MKL A;  4ZYE A;  1QVT A;  5A2Q K;  2HKO A;  2VQH A;  3E6D A;  5FD6 A;  2FOW A;  4QWQ A;  5KAI C;  4QPQ A;  2ZSI B;  1O7L A;  1O3S A;  3BTI A;  2R5Y A;  1BBY A;  3M1E A;  2STW A;  1Y6I A;  2WV0 A;  3R61 A;  1ZGW A;  2X6O A;  2L9V A;  3F8N A;  2XC7 A;  3OR1 C;  1VQM I;  4L5I A;  3QAH A;  4GDF A;  1IN8 A;  1YQA A;  4DBQ A;  2R7V A;  3F23 A;  2CUZ A;  4D9J A;  1ETW A;  3OIP A;  5JVT A;  2P5L C;  2L01 A;  3Q3S A;  3M9A A;  2KPM A;  2XAH A;  1L0O C;  2OPT A;  2K9N A;  1KU3 A;  2DMN A;  3GTG J;  3LFK A;  1JJ8 C;  4XQF A;  1PUE E;  3ZMZ A;  3E0J B;  2WB1 A;  4M3B A;  3W6J B;  2R7T A;  5EEG A;  1UB9 A;  3LFU A;  4JX4 A;  2F4M B;  2LDU A;  3KYL A;  3JRE A;  2E2H J;  4HEA 2;  2PN6 A;  3U9G A;  4DNC A;  1FJL A;  4DZJ A;  2JMW A;  3K4K A;  2MBF A;  5FRN A;  2BW3 B;  1IAW A;  4A3K J;  3M3Y J;  2HVQ A;  1SFK A;  4NC6 A;  3O2P E;  2M30 A;  4A69 C;  1I1G A;  1EJ9 A;  1W5S A;  2X6X A;  3IAS 2;  1UHS A;  1ZLJ A;  3T1B A;  3KPH A;  3WU0 A;  3QPS A;  2AHQ A;  2DXI A;  3CCS I;  2HVS A;  1SD6 A;  3TOB A;  4ZYH A;  2HYJ A;  3HHH A;  3RTR A;  3S1Q J;  1FWZ A;  5H6Q A;  3BR0 A;  1NTC A;  3OR2 C;  3F72 A;  4RM2 A;  2EZL A;  3X2Q H;  5D5V B;  3L2W A;  2CUE A;  3OS1 A;  2I8D A;  5FLM J;  2O8X A;  1ZGA A;  5GAD J;  3BTL A;  1GXP A;  4UY8 I;  1VQP I;  4G6Q A;  1LVK A;  2P4W A;  4HF2 A;  1ETV A;  1X2M A;  2PJP A;  3DTK A;  2XAJ A;  1NK2 P;  1RUN A;  3D5L A;  3DLA A;  5JVG F;  1I39 A;  2R7Z J;  1YW8 A;  4Y7N J;  2JRM A;  4E70 A;  4EJO A;  5J8C A;  5LGT A;  2ZJQ F;  5CQG A;  2ZME C;  4HPQ A;  2EIK H;  4UB6 C;  2IGO A;  2MH9 A;  4YIR X;  1Z7U A;  4IOA F;  1P4W A;  3EET A;  3G71 I;  3UKG A;  5EEA A;  5TGT A;  4X0G A;  3FXU A;  1QRY A;  2Y31 A;  3RCO A;  1G3Y A;  3NEU A;  2JSC A;  4FQG A;  1LPQ A;  4WK8 F;  4LJZ F;  4XL9 A;  1TT5 B;  4A12 A;  4YFK F;  5ED4 A;  3LSM A;  1SMT A;  3WG7 H;  2M7A A;  2R7Q A;  3F21 A;  2LSO A;  1QNT A;  4EM1 A;  1HLV A;  3L2C A;  3GFL A;  2R7O A;  5BQT A;  4HV5 A;  5EZG A;  5IP6 A;  2LKS A;  2L7K A;  2ICW G;  1Y56 A;  4G6D A;  3HOX J;  1FYL A;  2VXD A;  3KEQ A;  3ZMS A;  5C4J J;  2STT A;  3W3C A;  3OYL A;  4IHW A;  2HWV A;  3CCU I;  4A3E J;  1S72 I;  1OCP A;  1RUO A;  1N78 A;  2XPU A;  2LMD A;  2RVC A;  4JX5 A;  5HVQ C;  1J75 A;  1F9N A;  5EG0 A;  4NC7 A;  1PUF A;  1R9T J;  2D1V A;  3CC4 I;  1Y8Q B;  2H1K A;  2O9L A;  1P7I A;  2KIU A;  2RC4 A;  2KIQ A;  1H8A C;  2DOE A;  3ZN0 A;  1X3Z B;  3SFI A;  2BY1 A;  5EEH A;  1K4T A;  2G7H A;  1AA7 A;  1IRZ A;  3SZT A;  2CUJ A;  2VPL A;  1OR7 C;  3EYY A;  2CQN A;  3VYU B;  4X6A J;  2VKH A;  1I50 J;  4BHC A;  4HAM A;  4W97 A;  2X1E A;  1SC7 A;  4IQJ A;  5L3B A;  2PI0 A;  1HKT A;  4EJW A;  2ZXI A;  1GVJ A;  1RIO H;  1VI0 A;  3WE3 A;  3PNT A;  4CCO A;  4OIQ F;  3P7N A;  4YFX F;  3IC7 A;  1WKM A;  1R49 A;  3LSR A;  1X58 A;  3VSK A;  2IA2 A;  2CV0 A;  1W7P B;  4HZF A;  4W1U A;  3GO5 A;  3MQ0 A;  4U0W A;  3HIF A;  5DM7 F;  2FML A;  1SFO J;  1IRG A;  4LIT A;  4KN7 X;  4E6K G;  5LD2 C;  5EYR A;  2BHY A;  3WTS C;  1B9N A;  2N8G A;  1JHF A;  3H3U A;  4G7H F;  2VE9 A;  1ETK A;  3W6K B;  3OYE A;  2P7C B;  4BXX J;  1S5L C;  4LLN A;  2YUS A;  4UNO A;  3CUQ A;  3M07 A;  2LLK A;  3RSN A;  3G1L A;  4HSR A;  1H89 C;  2VBX A;  2QSH X;  4LG0 B;  2WY7 Q;  5LGU A;  1X4P A;  3AFH A;  3FX3 A;  3AG4 H;  4BQO A;  3LQQ A;  4CGZ A;  1HOM A;  4UHT A;  3KP4 A;  3V8L A;  3MN2 A;  4U7B A;  5HOD A;  3BR3 A;  1E2X A;  1VQ7 I;  3QP5 A;  2FQ4 A;  1DPR A;  1IUF A;  2GA2 A;  2F48 A;  5TRD A;  2ECC A;  1WJ5 A;  2LNB A;  3AG3 H;  4N9H A;  4Y15 A;  5LEK A;  4C30 A;  1IJW C;  2NS8 A;  1IV6 A;  5GPA A;  1MKM A;  3BRO A;  2K85 A;  4HW0 A;  3ASN H;  1HKS A;  5LRS A;  2OTL I;  2QYO A;  5EDN A;  5M5X J;  3A01 A;  1OKR A;  5FLX Z;  2ZME B;  1VQK I;  4MGR A;  3U2R A;  2X85 A;  1KGS A;  1DQU A;  3HRT A;  4DGW B;  3COA C;  2VPR A;  5JI6 A;  1DGW Y;  3TO9 A;  3MKW B;  3BQZ A;  2A5W A;  1D0Y A;  2HS5 A;  4XOP A;  4BS9 A;  1R36 A;  2A6E F;  2CH0 A;  3T0Y A;  2W82 A;  2B63 J;  3PSF A;  3E7L A;  4CXF A;  3HKZ A;  2P6T A;  2XAU A;  3F8M A;  2E7W A;  2OU2 A;  2P5V A;  4IHX A;  3LST A;  1ODD A;  2BBY A;  3I3L A;  3M8E A;  1WWX A;  1W0U A;  3MKZ A;  2MH2 A;  1J9I A;  1JJ6 C;  3HTS B;  2GOX B;  1MD0 A;  5FLV A;  2ZCW A;  1XN7 A;  1HW2 A;  4EQQ A;  3L9F A;  3DBL B;  1OYW A;  3KYC B;  3BTC A;  4IRH A;  5HS9 A;  5FKL A;  2XB5 A;  1U9N A;  2EB7 A;  2L4M A;  3BG3 A;  2VI6 A;  4FE4 A;  5F64 A;  3OS0 A;  3CCE I;  4JBA A;  3UNG C;  2W00 A;  4Y52 J;  3K4L A;  2FD5 A;  4B44 A;  3GYH X;  4Z6Y A;  1J09 A;  3REO A;  4OMY A;  4A0Z A;  1PJR A;  1UEL B;  1VQO I;  5IT9 Z;  2VE8 A;  3KP7 A;  4LIV A;  4AD9 A;  3V4G A;  2VB6 A;  1JKQ C;  3A2K A;  5E17 F;  2AQE A;  2EV6 A;  2P7V B;  3HSR A;  2O03 A;  3CUO A;  2ESN A;  2A68 F;  5CVV A;  3K6G A;  1AOY A;  2VN2 A;  4A5N A;  2JPB A;  2BGC A;  3ML6 A;  5GAH J;  1JGS A;  3K7A J;  2LTP A;  3E5U A;  1WQ2 A;  1SFE A;  3W2W A;  2VT3 A;  3PUB A;  4HDV A;  2RAE A;  3DTI A;  3T8T A;  3HOS A;  1XSD A;  3L00 A;  5DUK A;  4E7Z A;  2JRT A;  3KLO A;  4IHV A;  5DDG A;  1XSX A;  5ICG A;  3V7S A;  4CCN A;  3JTG A;  2XAF A;  4ZJZ A;  4MIM A;  2HDW A;  2AS5 F;  2R7U A;  2KL4 A;  1TNT A;  2HOA A;  4CO8 A;  2LOO A;  4XKW A;  1UAA A;  1X1D A;  2XF6 A;  4ENK A;  1D1B A;  1A04 A;  3Q0W A;  3CF5 F;  4H0E A;  3RPU A;  4AVZ A;  1ZKG A;  3QQA A;  1K6Y A;  3IUO A;  2E60 A;  1H0M A;  1U8R A;  4PGH A;  3QPL A;  5E1Z B;  2NVQ J;  3GTK J;  3HRS A;  4P9F A;  3FMS A;  1TLH B;  3HM5 A;  1P9Q C;  3FWE A;  3GX4 X;  5EGO B;  3BZK A;  3R6S A;  2DA6 A;  1WI9 A;  2GOM A;  4F3Q A;  1F1Z A;  4BHP A;  4XLP F;  3EYI A;  3GEZ A;  1RZ4 A;  3IH3 A;  5L3E A;  1KU2 A;  3C2B A;  2KDZ A;  4M73 A;  1S29 A;  2ELH A;  3BZ6 A;  4JYK A;  4I98 B;  1QPI A;  3WGG A;  3GLX A;  4RGX A;  5IYB J;  2XPV A;  1MMG A;  2HYF A;  2JUG A;  4V2F A;  5CJ9 A;  1ZRD A;  2V9P A;  2JVG A;  2P0W A;  2L7F P;  1VFC A;  1STZ A;  4UUT A;  1HC8 A;  2E1M B;  5K7F A;  1WPK A;  2VBW A;  5LHH A;  5GAG J;  1X1A A;  2EZH A;  1ETO A;  3GZ5 A;  1DP3 A;  2MW8 A;  3F3X A;  1FEX A;  2VJJ A;  2EIL H;  2PFB A;  4HQM A;  4I01 A;  4MFD A;  4OAY A;  1BI1 A;  4KIC A;  3GZN B;  5J4Y A;  1F43 A;  1ZTR A;  1E3H A;  3SZG A;  1XPX A;  3S32 A;  5JHU A;  1QO0 D;  5A2Q Z;  2XSJ C;  1S7O A;  1QZE A;  3WG9 A;  3FK7 A;  4PJN A;  3MFK A;  2VKV A;  1FBQ A;  3FXO A;  2DI3 A;  3S1R J;  3BC8 A;  4GO1 A;  3WTX C;  5F0F A;  5FGM A;  4D7N A;  2XF7 A;  4P9U A;  1WJC A;  3OMY A;  4XLN F;  1T33 A;  2DFF A;  3CUQ C;  1RES A;  4HOB A;  4IEJ A;  4A0X A;  4C3I J;  4NQW B;  2JZY A;  2Y2Z A;  4BY1 J;  1DP7 P;  2WB1 N;  3JR9 A;  3MZY A;  1HXD A;  2CQ7 A;  4JOM A;  1PUF B;  2O0Y A;  1J0R A;  3CC7 I;  4U87 A;  1BIB A;  4I76 A;  2VBZ A;  3Q9S A;  1WJE A;  3G6E I;  2OV7 A;  4ON0 A;  5M3M J;  2BW3 A;  1GHC A;  3NAR A;  5IY5 H;  1FYK A;  2Z2S B;  3A01 B;  2RDP A;  3IWF A;  3ZQF A;  1MDM B;  3R0J A;  4AIJ A;  3GBG A;  4UVB A;  5JHF A;  1LVA A;  5L3G A;  1I6H J;  2V26 A;  3G1O A;  2XPW A;  3QOE A;  1LJ9 A;  3K1N A;  1AU7 A;  1G3S A;  4AUX A;  2F5V A;  2F4I A;  4I0B A;  2MC4 A;  2IJL A;  3PSI A;  1TZL A;  3DKW A;  2PMZ A;  3GTP J;  1FMV A;  5FKN A;  4IRG A;  4EMS A;  1YIT I;  4BU2 A;  1WHU A;  1G2H A;  2E35 A;  2FE3 A;  4ASN A;  1UST A;  1BN5 A;  2XAQ A;  3ZMV A;  2PMH A;  4G12 A;  4RM3 A;  4ZYD A;  2LRD A;  5LHI A;  1HA8 A;  2K40 A;  2GAU A;  4XLH A;  1ZGJ A;  3GVA A;  5B5E C;  2IP2 A;  2XGX A;  4O6J A;  3L2V A;  2K5C A;  3VFZ A;  3K4C A;  4NB5 A;  3BR2 A;  3FF5 A;  3ZQC A;  2VJI A;  3F9K A;  1ON2 A;  4I09 A;  5IT9 K;  1SAN A;  1GT0 C;  3CCV I;  4KIB A;  2CV1 A;  5E3M A;  2OJE D;  2PG4 A;  1RI7 A;  4ETS A;  1D1A A;  2D5V A;  3BOQ A;  1XGN A;  4GGG A;  2E1M C;  1HKQ A;  3OYK A;  3KIO A;  3QRF F;  4NDL A;  4YEL A;  3SQN A;  3DPT A;  3S8P A;  2NOG A;  2XRO A;  1AKH A;  4PJ0 C;  5IYD J;  3K70 C;  5BPD A;  4UVC A;  4DBR A;  4M72 A;  4XKC A;  2DYR H;  3A1Y A;  1KZH A;  1VQL I;  1YG2 A;  1XTA A;  5KNL A;  3E6C C;  3OYA A;  3ABL H;  3FIW A;  2JSP A;  2DK5 A;  4WWC A;  1FY7 A;  4XRS A;  3DPL C;  2FBI A;  3ONQ A;  3F8F A;  2JK3 A;  1MNE A;  1OIS A;  3MCZ A;  4XLE A;  4KDP A;  2CU7 A;  2FBK A;  2HTJ A;  2JUC A;  4YII A;  2X6Y A;  1WI3 A;  2Y0M A;  5IOY A;  2R0Q C;  4MEX F;  2V4J C;  2Y69 H;  3QYE A;  4KT6 A;  4CUG A;  3JRH A;  3FHZ A;  5GTH C;  2VL8 A;  3O8H A;  4BJ6 C;  3OSF A;  3AG1 H;  1FSH A;  1XSV A;  5F27 A;  3VOE A;  2E1O A;  3HYI A;  5DEQ A;  4QIW N;  2ELK A;  5DUI A;  2WV1 A;  2CS3 A;  3PO2 J;  2NXN B;  3FXQ A;  4RB2 C;  2BE5 F;  2X1D A;  4DYR A;  2HR3 A;  4IPA A;  1H9T A;  3CME I;  2DA3 A;  5D5X B;  4ZZD A;  1LFP A;  2EZI A;  1XG1 A;  1U5T B;  2K9M A;  4A6E A;  1LKX A;  2MLG A;  3HPH A;  2DA4 A;  5FB2 A;  2C6Y A;  1FLI A;  2DU9 A;  1B72 B;  1TQM A;  3U1D A;  4BQA A;  2OZ6 A;  3O3K A;  1EKE A;  1H9G A;  1XMX A;  4EJU A;  2E19 A;  2QSF X;  2M8G X;  2XSD C;  2PMU A;  3IHU A;  3B73 A;  1R4N B;  2DAO A;  4MEY F;  3CMA I;  2GIV A;  1UZC A;  2DDB A;  3H3V K;  3JRG A;  4DYQ A;  1WH7 A;  4B4C A;  1YRN A;  1P92 A;  3M8J A;  4U88 A;  4WX9 A;  2NNN A;  4KYW A;  3HBL A;  1T0F A;  3B6C A;  2Y9Y A;  3ERE D;  5DYM A;  2Z5U A;  2KMU A;  2VOD A;  4XLF A;  1GV5 A;  1GUU A;  2M2E A;  5D4S A;  4XR6 A;  4Q5S F;  2FSW A;  2BV6 A;  4LIU A;  3H0D A;  1FT9 A;  4M3D A;  3H9G A;  2ZFU A;  4IZZ A;  1B59 A;  3GTJ J;  1EH8 A;  2K4J A;  3DWL E;  1XMA A;  2IS4 A;  1K83 J;  3JAM Z;  1TP4 A;  2R7F A;  4RLF A;  3TP3 A;  4JK1 X;  2FOK A;  2L2O A;  4IXA A;  3SFZ A;  2V7F A;  3QP6 A;  1MBK A;  2XKO A;  1SEU A;  4I99 C;  2MYS A;  3BQY A;  3C1D A;  1SAX A;  3JW4 A;  2B7E A;  3LSP A;  3KP3 A;  3H3Z A;  5E20 A;  2G7U A;  3CP8 A;  1MMN A;  1IF1 A;  2A69 F;  3DKY A;  2PQ8 A;  3IL2 A;  3BR1 A;  3N97 A;  2HI3 A;  3HRU A;  5HNF A;  3WTV C;  4D1Q A;  2YR2 A;  1BL0 A;  2K9S A;  2DT5 A;  1ZRF A;  2GZW A;  3M8F A;  1W5T A;  4F52 A;  1L3L A;  2IVM A;  5HDG A;  1T39 A;  4MHG A;  1EV7 A;  4S04 A;  1W0T A;  1F36 A;  3FXM A;  3KZI C;  4N0B A;  1LB2 A;  4KFC A;  2E71 A;  1ZLK A;  4EJT A;  2Q2E B;  2VOP A;  3CDL A;  4HNU A;  4XKB A;  3K9T A;  4CYC B;  1OLT A;  2ZC2 A;  5TIS C;  2DFI A;  2VJ4 A;  1MW7 A;  2XGE A;  3OYI A;  5B3S H;  4Y3O A;  1ZR2 A;  1OR7 A;  2QEN A;  1Z6R A;  5CQE A;  2IGK A;  3BG9 A;  5ILU A;  3ZQG A;  4XRF A;  3GTL J;  2V6C A;  1ULY A;  1T56 A;  2VAS A;  3TO7 A;  4EM0 B;  3OYJ A;  4L0Y B;  3JRD A;  2X6W A;  2BY3 A;  4EV0 A;  1XCB A;  5GAE J;  1A6I A;  1OYI A;  1X2N A;  3CMM A;  5LEJ A;  5M5Y J;  2L3D A;  1G8X A;  4PZJ A;  3WHC A;  1JUS A;  2D45 A;  1YOV B;  2QF7 A;  2B0L A;  1P6R A;  1BM9 A;  3FM3 A;  2ACJ A;  1RNL A;  2DJI A;  5ICF A;  2ISY A;  2EWN A;  2BVM A;  1FPQ A;  4R8H A;  1TBX A;  3CLQ A;  4NHJ A;  1YLF A;  2W57 A;  1YJN I;  5D6F A;  5L3C A;  4HQE A;  1T08 B;  2FBH A;  2X51 A;  2HQA A;  2DFE A;  3WTZ A;  2OA4 A;  3ZP5 A;  1SFX A;  3JAM K;  2WAE A;  4KA4 A;  1IN4 A;  1KU7 A;  3LQR A;  4BXF A;  2JA8 J;  1YS6 A;  2MD0 A;  1YE9 A;  4MQV A;  1RC9 A;  4DIQ A;  2YSR A;  3OOU A;  2VKE A;  2CQK A;  5BMZ A;  3MD2 A;  3E6B A;  2L54 A;  1QGP A;  1J7K A;  4F93 B;  4BXU A;  3I9V 2;  1U0J A;  3ZXS A;  4AC0 A;  3TGN A;  1DU0 A;  4L9V A;  3TQN A;  5J4V A;  2KHM A;  3RQI A;  3CD6 I;  1YHQ I;  2XDV A;  1ZHF A;  3BZC A;  2WAF A;  4RMN A;  2A07 F;  1SAU A;  4R79 A;  1O57 A;  1FX7 A;  1K61 A;  2EQR A;  1PP7 U;  4LB6 B;  3IRR A;  3FBI B;  1U9O A;  2EH3 A;  1BC8 C;  2DJN A;  3ZCO A;  1IZ1 A;  1S3J A;  1KU9 A;  2CG4 A;  2CRG A;  3HDD A;  2QGU A;  1EH6 A;  5L3D A;  5LFA A;  3F22 A;  1K7A A;  1N77 A;  3CO7 C;  3LSJ A;  3KLN A;  3IKT A;  2VQC A;  2WAD A;  1KON A;  1RET A;  5HS8 A;  3JRB A;  1JGG A;  1HW5 A;  3FIS A;  5E1W A;  2MSY A;  3HOZ J;  2GXA A;  2QLZ A;  1TWG J;  3FXJ A;  3CF2 A;  1R1V A;  3FMR A;  2DA2 A;  1G3T A;  4XOT A;  2X48 A;  3C2G A;  1B72 A;  1FOY A;  2V6E A;  1MBE A;  1Q1V A;  2PLY A;  2MFZ A;  3RKX A;  5C4X J;  2M9H A;  3QYB A;  4OAZ A;  1CQT A;  1ETQ A;  4IO9 F;  2PBI A;  3P5J A;  3KP2 A;  1OCR H;  2D1H A;  3QWL A;  4E7K A;  2DO7 A;  2FF4 A;  3HGG A;  5F0H A;  5HLH A;  4C9Y A;  2Q0O A;  3I5U A;  5EF6 A;  1IGN A;  4M3E A;  2EPF A;  1XGS A;  1IXC A;  1DGR M;  1ZEL A;  3KFW X;  3PUF A;  5GP9 A;  3T5X A;  1IO2 A;  2IAI A;  2M0C A;  4PGG A;  5J3L A;  2IT0 A;  2HZD A;  4GXO A;  4RB1 A;  1GVD A;  4IF4 A;  4JP0 A;  4L9N A;  4BEH A;  2ID6 A;  1FSE A;  2ZO4 A;  1W5C C;  1IN5 A;  3IH2 A;  1BI2 A;  2KP6 A;  1B6A A;  2QZ8 A;  1PP8 F;  3RI4 A;  1YJW I;  3I59 A;  1XGO A;  3QOD A;  2OF7 A;  3G1M A;  1S6L A;  3FM5 A;  1Z7L A;  4B47 A;  3H92 A;  3HOW J;  1P7J A;  1OJL A;  1O7F A;  2ZNZ A;  4HX4 A;  4Q4Z F;  2VC0 A;  3MWM A;  4EGZ A;  5ICC A;  4A3M J;  2XF5 A;  1SVL A;  2EA4 A;  3GUD A;  2G9W A;  4LK0 F;  1TWF J;  4I0A A;  4DYC A;  3ZGK A;  2OZU A;  2GIZ A;  2P81 A;  3C2H A;  2WY8 Q;  3GFJ A;  1R5H A;  2VC1 A;  2GLO A;  4E7S A;  1RKW A;  1WRJ A;  4KUM A;  1JKP C;  5FLX K;  2Z1D A;  3BTJ A;  5K7Z A;  3HTU A;  4ZTF A;  2GA1 A;  2RQP A;  3FDY A;  2IS2 A;  3EUH A;  4QSH A;  2VBY A;  4DZP A;  1DDN A;  3FXK A;  2OCC H;  3KE2 A;  4HNV A;  3S1N J;  1JE8 A;  2HVR A;  3HC7 A;  2TDX A;  3RQ4 A;  1BI3 A;  3VOD A;  1YX3 A;  2RGV A;  3L2R A;  5C3E J;  2UV1 A;  1SVM A;  3C7J A;  1WJD A;  2GM4 A;  4AIH A;  3EDP A;  3RKW A;  2HYG D;  2M7B A;  4HDU A;  1XMK A;  3HZJ A;  4LG3 A;  4CH7 A;  5E79 C;  5FKO A;  1SMY F;  2CGP A;  3R0A A;  1KYZ A;  4ENJ A;  1ZH5 A;  2DMU A;  2E7X A;  1MNM C;  2ZNY A;  3BJA A;  3TW7 A;  4L9T A;  2VXZ A;  2QSG X;  1WJA A;  4BJ5 C;  2BY2 A;  3NQO A;  4XN3 A;  4BJT A;  2HOS A;  3BLY A;  2LFB A;  1ZRE A;  1F4K A;  2LBF A;  4RAY A;  1APL C;  2L7M P;  1Z21 A;  2K3P A;  5D4R A;  2F5C A;  4FTH A;  4BDY A;  3DEW A;  2KIM A;  2ECB A;  4O5V A;  4N9I A;  2DA7 A;  2W1O A;  4PUS A;  2DOA A;  5CVU A;  3PNV A;  1UFM A;  1VQ4 I;  1NG7 A;  2D2W A;  1Y0U A;  2EIN H;  1AWC A;  1MZB A;  3S15 J;  4FX0 A;  5FO5 A;  1R1T A;  1RPW A;  3M7G A;  1Y1V J;  3WTY C;  1D3Y A;  5F1R A;  4A3F J;  1YYV A;  1UG0 A;  5FD5 A;  5K1Y A;  1X19 A;  4M3G A;  4KN4 X;  2W7N A;  2W25 A;  1EA3 A;  4OU0 A;  1LDK B;  2AXL A;  3OYG A;  4Q47 A;  1J5Y A;  3CDI A;  2RQQ A;  1VF9 A;  2LF7 A;  1B8I B;  5LRR A;  3CCJ I;  4PSW A;  2IRF G;  1TNS A;  3P9C A;  2EK5 A;  2MGQ A;  5E8I A;  3TO6 A;  4BAC A;  5D5W B;  2QCO A;  2V1D A;  1ZK8 A;  2CW8 A;  4FX4 A;  2HZT A;  1BA5 A;  4FCY A;  4II3 A;  1Z3X A;  1IUY A;  3JSP A;  2NOJ B;  2QKL B;  3I58 A;  4A0Y A;  4FET A;  4HBL A;  2OTJ I;  3V8J A;  3DBR B;  3LAJ A;  1O3R A;  3KEY A;  4XRS G;  1FOK A;  4PJJ A;  4C2T A;  5J1Y A;  4A3D J;  4GYG A;  2NYX A;  1IN7 A;  2M8E A;  2L02 A;  2DTR A;  5K5R A;  3K70 D;  3NAU A;  3CP2 A;  2MA3 A;  2AQF A;  3EUH C;  4CZZ A;  3GFI A;  1B1B A;  3A02 A;  4Z2Y A;  3D5R C;  4KMU X;  2Z33 A;  2HGC A;  4ZZL A;  4UB8 C;  2FRH A;  3FBN B;  4FIS A;  3OYF A;  1ENH A;  1IXR C;  4A6D A;  3F6O A;  1NG6 A;  4BE2 A;  2DOD A;  3J7A O;  1GLN A;  1MSE C;  2K9L A;  1JKO C;  4HV6 A;  4BQQ A;  1U3E M;  2YU9 J;  2KDO A;  4GCV A;  4RGU A;  5TJJ A;  3ECO A;  5GTI C;  4UV8 A;  4D5F A;  3Q0V A;  3RJP A;  2TRT A;  5K5O A;  4ENN A;  4RB3 C;  2QEX I;  4BKX A;  1S9H A;  4A93 J;  2MC3 A;  2BXY A;  4JQF A;  3OYM A;  3PQK A;  4IVN A;  4KJZ A;  4N4O B;  3OY9 A;  3A03 A;  3OIO A;  2HPI A;  3J80 K;  4RAZ A;  1CF7 A;  1VQ8 I;  3DF8 A;  1MDM A;  4A3B J;  4LK1 F;  4PFP A;  1ZG5 A;  4ZYG A;  1NHA A;  3KZZ A;  4HA8 A;  4B1R A;  2H09 A;  4IL6 C;  1IC8 A;  3OL3 A;  1MH3 A;  1VQ6 I;  1AHD P;  2V1N A;  3BP8 A;  2HEO A;  5DCM B;  4S0H B;  3KCC A;  4M6Y A;  3U1K A;  4DOZ A;  2X1C A;  2ME6 A;  1I5Z A;  1WFX A;  1M1E B;  2YPR A;  4BQN A;  3A4C A;  2E2J J;  4HX8 A;  1D5Y A;  5GPC A;  4A3L J;  3F0C A;  2HFH A;  4P96 A;  3LSG A;  2HDD A;  3GTQ J;  4ESJ A;  3CMY A;  2NVU B;  2NS7 A;  4CYD A;  2MAB A;  4J00 A;  2DMP A;  1HDD C;  2PEX A;  4CIC A;  1D0X A;  3BJ6 A;  3LMM A;  2EFN A;  4CA0 A;  2R7D A;  3TP0 A;  2ZJR F;  2P5K A;  3ZMU A;  4XKV A;  5HOO A;  1JKR C;  2PX9 A;  2EFQ A;  4RAG A;  1N75 A;  3J7Y J;  1ZR4 A;  2XUB A;  4OIN F;  3QU6 A;  1E3P A;  1RR8 C;  1G6N A;  2COB A;  2LYC A;  4NUB A;  2Q2E A;  2H94 A;  9ANT A;  4CSW A;  4L9J A;  4BUP A;  1BJA A;  1QZY A;  3CLO A;  1B9M A;  4L5J A;  1K6O A;  2NNY A;  3OYH A;  3B02 A;  2EFW A;  5J6X A;  3ECH A;  2E1N A;  1I3A A;  2KZG A;  2G0E A;  3QPH A;  3SYT A;  2RV8 A;  2ZXJ A;  3GTO J;  4R1H A;  2DQL A;  1B4A A;  3EPZ A;  2EZK A;  2KIF A;  3CCR I;  4Q48 A;  2JPC A;  5D8K B;  3HHG A;  3OL4 A;  1OCC H;  5M3F J;  2H1L A;  2DCE A;  3BR5 A;  3M1C A;  3K4B A;  3RYR A;  1LDD A;  4WXH A;  1WJB A;  3H35 A;  4LLL A;  1IN6 A;  4PDK A;  1U5T A;  3OYC A;  1C0W A;  4PFO A;  4G8X A;  4H4K C;  4B8X A;  3E5X A;  2ID3 A;  1ETX A;  3KP5 A;  2DT6 A;  2HQR A;  3AAF A;  2R5Z A;  5K7H A;  2ZBK A;  3PIO F;  4WXD A;  4BDZ A;  2OAZ A;  4IJA A;  2H8R A;  2PJR A;  3ABT A;  2Z99 A;  2ISZ A;  4U0Y A;  5F0C A;  4D5C A;  3ISP A;  1S8N A;  1MJA A;  3WTU C;  3CCL I;  1E3O C;  3GWZ A;  4M3F A;  4L0Z B;  2QWW A;  3ZOB A;  5CVI A;  3VEP A;  3SDB A;  3SEQ A;  5BS6 A;  2L9N A;  3J81 Z;  3HOU J;  4XRM A;  2XIG A;  2M4G A;  4G94 A;  2RKH A;  4D7M A;  3ELK A;  4MLO A;  3GTM J;  4B43 A;  3ULQ B;  1X1P A;  4CCJ A;  3WE2 A;  3AL0 C;  4JX6 A;  2A61 A;  3WHB A;  4ZYA A;  1U2W A;  2V9K A;  1LUJ B;  2V1U A;  2XKP A;  1E0E A;  3ZR8 X;  2GXB A;  5CVR A;  3ZN1 A;  1UCR A;  4RS8 A;  5DD4 A;  2UWM A;  5ERI A;  1ZG1 A;  1FBU A;  3BY6 A;  1WVR A;  4B3A A;  1QQI A;  2O61 A;  4GRI A;  5E3L A;  3TDU C;  4OIR F;  2OQG A;  3JRC A;  1GV2 A;  4I2O A;  3I54 A;  5E18 F;  3I55 I;  4M6V A;  3TW6 A;  1BIA A;  2KRC A;  3HJE A;  1JXS A;  2X9D A;  2PJR B;  4HF0 A;  1QBJ A;  2HXO A;  5KHD A;  3F8C A;  1FTT A;  2KFD A;  4M9S A;  1LEA A;  3WGH A;  2QBY B;  3IKV A;  2RNG A;  5EZH A;  4LGW A;  2VOO A;  2L7Z A;  4K2E A;  1KQ0 A;  3H5R A;  3LWF A;  2LD5 A;  3U21 A;  3KZY A;  3I4M J;  3BG5 A;  4LG0 A;  1MND A;  5BOX A;  2ELJ A;  2LP0 A;  1YIO A;  2O6G E;  3S2W A;  4DW6 A;  1RKT A;  4M74 A;  2UZK A;  3TL4 X;  1MJ9 A;  2ADU A;  3HOY J;  2K86 A;  3ASO H;  5B1A H;  4BE0 A;  3ZRG A;  4ZDP A;  5IYC J;  4ENM A;  3CCY A;  1BC7 C;  2Z9O A;  5DV5 A;  2P8T A;  3PJR A;  4BEH B;  5HLG A;  3BG6 A;  1I27 A;  1JTX A;  2M4K A;  3RPU D;  2QM3 A;  4ZDO A;  3HOV J;  1DUX C;  3F6V A;  2M0M A;  1F5T A;  1T2K A;  4ANJ A;  4F92 B;  2V79 A;  2JJ7 A;  2IGM A;  3D5S C;  3TBI A;  3LNQ A;  4C3H J;  2K27 A;  3LSI A;  5BPI A;  2DN0 A;  2I10 A;  2LKX A;  2FNP A;  2DOF A;  3WTT C;  3LL7 A;  3ZQQ A;  4XON A;  3FXL A;  3RIR A;  3ERM A;  5FKK A;  4MFE A;  3JRA A;  4HLX A;  4YEJ A;  3IRQ A;  2LF8 A;  4XLC A;  5H6R A;  2DMT A;  5E8G A;  1LQ1 A;  1UHM A;  3EQL F;  5AON A;  4V2G A;  4QPO A;  4BH9 A;  1MBG A;  2GWR A;  4II2 A;  5LBQ A;  2ZSH B;  5DS9 A;  1MBJ A;  1YO5 C;  1W36 D;  3S17 J;  3AL0 B;  3KET A;  3QYF A;  2O5R A;  3E3V A;  1A35 A;  2ETH A;  1YS7 A;  5HDN A;  2OUM A;  3DP7 A;  3AKZ A;  5F6F A;  2M87 A;  4IKF A;  2JVH A;  4AU7 A;  1LFB A;  2EJR A;  2DDA A;  3TMO A;  1FTZ A;  3MVP A;  3S3M A;  3TED A;  3RKY A;  3K10 A;  4E4H A;  1FP2 A;  3FMQ A;  2R5Z B;  2IS6 A;  2XGD A;  3GF2 A;  4LD5 A;  4B48 A;  2ME0 A;  3C3W A;  2Q8K A;  1JUP A;  4O3M A;  3RZD J;  4PK4 A;  3DFG A;  2YS9 A;  3E6M A;  1BJZ A;  4MNU A;  5DD8 A;  2CW0 F;  2CFX A;  2IBD A;  3HXL A;  4I7H A;  2LY9 A;  3P9K A;  3K69 A;  5D6E A;  2CO5 A;  2IA1 A;  5HLI A;  1IDY A;  5CPR B;  1NH3 A;  4CHU A;  4A5M A;  2FNA A;  3K4M A;  4XBF A;  5J1R A;  1JI8 A;  3L1P A;  2WWY A;  2WA0 A;  1J59 A;  1K79 A;  2XVC A;  1MIJ A;  4U7D A;  3BT9 A;  2BYV E;  3CJN A;  1E17 A;  5EGO A;  1S7E A;  2HPM A;  3ESW B;  3S2D J;  1MSF C;  2KJC A;  5IT3 A;  1D1C A;  2L4A A;  3KYD B;  2KQR A;  4UVA A;  1ONV A;  3P9I A;  1FOW A;  3IWZ A;  4XSZ F;  4E7I A;  2LRE A;  4F7Z A;  1MGT A;  3HSE A;  1ORK A;  2H6C A;  3H0G J;  5B1B H;  2BXZ A;  3BG7 A;  5D8L B;  4A3G J;  1BOA A;  4IHS A;  2XAG A;  2XB0 X;  1JTY A;  3GW2 A;  3V7R A;  3M4O J;  1V4R A;  2OD5 A;  4OOI A;  1TQI A;  3VDX A;  2HU9 A;  2GBY A;  1U8B A;  1O3Q A;  2K3F A;  4XID A;  1R58 A;  2HKX A;  2ZXH A;  4D0P A;  3A0H C;  1ERD A;  1SVO A;  2OQR A;  2M45 A;  3DBH B;  2BZT A;  1IV8 A;  1ZYR F;  5FJ8 J;  1D8K A;  4EM2 A;  1KA8 A;  4MTE A;  3MZ8 A;  3L7W A;  1XX5 A;  3EUK L;  1P4A A;  3DCF A;  4PSX A;  4RLQ A;  2Z16 A;  5F08 A;  2ZB9 A;  3A0B C;  1K78 B;  2J5O A;  3S2H J;  1T0F C;  4LOC A;  3S3O A;  2R5Y B;  2HDC A;  4CCK A;  4X1E A;  3K2A A;  2R7W A;  2FX0 A;  2O8K A;  1Z0X A;  4FHT A;  1TTY A;  3B6A A;  4BHB A;  4AIK A;  1R22 A;  3ABU A;  3J7Z I;  3RPQ A;  1HCR A;  1QPM A;  2WC2 A;  4PJM A;  2IEK A;  3FKI J;  4RGS A;  4KIF A;  1V5F A;  2F5E A;  1MMD A;  1X1C A;  3H9J A;  1IG7 A;  2OCE A;  3KEO A;  4TV7 A;  1J2X A;  3G73 A;  1WH5 A;  5H20 A;  2CQX A;  4LB5 A;  1POG A;  4XOR A;  1OFC X;  3SHF A;  2A6T A;  1IRF A;  3KP6 A;  4I02 A;  1TC3 C;  3K1M A;  1PVE A;  4LMY A;  2LH9 A;  2W84 A;  3I4P A;  4FT8 A;  3ZQ7 A;  1T95 A;  3OYB A;  2ZJP F;  2XRN A;  3I53 A;  4OMZ A;  4XMY A;  5J40 A;  5J8F A;  1VTN C;  2H6B A;  1JT6 A;  2HTS A;  3R4K A;  5FFX A;  2M3A A;  1QU3 A;  2VQG A;  3LSK A;  3Q0U A;  2HXI A;  1TWH J;  1TWC J;  2XHK A;  2F6C A;  4EJV A;  3ZPL A;  2HQN A;  2ESH A;  1MH4 A;  2CFO A;  3TOA A;  3CCQ I;  1MBH A;  1X4O A;  1O3T A;  5LHG A;  2IGN A;  3N4M A;  4YIF A;  3HUG A;  4IHT A;  1ITY A;  2E36 A;  1T6S A;  3IP4 B;  1BR4 A;  4UV9 A;  3OOP A;  4IQ4 A;  1ZQ3 P;  3JTH A;  1DPU A;  1R00 A;  2O3F A;  5EG0 B;  3OYN A;  3GZ6 A;  2QA4 I;  4NBQ A;  1XB4 A;  3V7C A;  2R7X A;  2DK8 A;  5FRM A;  4CDG A;  2HOE A;  2KT0 A;  2LVS A;  2VLA A;  1A31 A;  3PNY A;  4MTD A;  2LY1 A;  4XM3 A;  4F91 B;  1YW7 A;  1U78 A;  5F1J A;  2CQQ A;  1V55 H;  1HST A;  2GXG A;  1CF7 B;  5AIQ A;  3JCU C;  3SZP A;  4BYY A;  2Y9Z A;  3VYT B;  1VND A;  1MMA A;  3CTA A;  3K1P A;  3I59 B;  4XIC A;  3JSO A;  1IRX A;  4M9Z A;  2DYS H;  3LOC A;  3CC2 I;  2H8W A;  3W2A A;  1BOB A;  4P55 A;  3K4J A;  3DU6 A;  3PFI A;  5LLQ A;  2FXA A;  4BNC A;  1U6G A;  5C44 J;  1XS9 A;  1ZN2 A;  2NRA C;  1YTY A;  3UR3 C;  1Z77 A;  4OWR B;  5E3N A;  2KJB A;  1W4M A;  1IDZ A;  5J47 A;  2QQA A;  1Z67 A;  2NVX J;  2F4O B;  3NWT A;  2NS0 A;  4DJA A;  1IW7 F;  1TL8 A;  1BR1 A;  5E3O A;  1YFH A;  3DV8 A;  1P2F A;  2LY2 A;  2KRF A;  3K2Z A;  1YX5 A;  2DTZ A;  4A3J J;  2Y30 A;  1I3Q J;  2I5U A;  2ZJ2 A;  5CVJ A;  2EBI A;  3QOP A;  4WF2 A; 
#chains in the Genus database with same CATH homology
 3PO2 J;  4QTR A;  1JT0 A;  1IC8 A;  1MH3 A;  4AYB N;  4DYR A;  2DA3 A;  1AHD P;  3UKG A;  5EEA A;  5IOZ A;  2EZI A;  1XG1 A;  1QRY A;  2Y31 A;  4S0H B;  1GDT A;  2DA4 A;  2ME6 A;  1B72 B;  2JA5 J;  2E2J J;  1D5Y A;  1AKH B;  5GPC A;  4A3L J;  3F0C A;  2E19 A;  3LSG A;  2HDD A;  2M8G X;  1HLV A;  3GTQ J;  1B8I A;  3CMY A;  2NS7 A;  2XSD C;  5EZG A;  4IHY A;  5IP6 A;  3HOX J;  1HDD C;  2DMP A;  5C4J J;  3H3V K;  4BBS J;  3TP0 A;  3JRG A;  4IHW A;  4DYQ A;  1WH7 A;  1JKR C;  4B4C A;  1YRN A;  2Y0S N;  5JLW A;  4A3E J;  1ZR4 A;  5M5W J;  1OCP A;  3I4N J;  2XPU A;  1FIA A;  2COB A;  3CQZ J;  3HBL A;  4XK4 A;  3B6C A;  2Y9Y A;  3BR6 A;  4JX5 A;  5EG0 A;  3ZQL A;  3HKZ N;  1PUF A;  2O7O A;  1R9T J;  9ANT A;  2H1K A;  2O9L A;  1P7I A;  1GV5 A;  2JA6 J;  1BW5 A;  1GUU A;  2M2E A;  3RKQ A;  1H8A C;  1TWA J;  3SFI A;  2G0E A;  1IRZ A;  4FE7 A;  4C2M J;  4M3D A;  3HEF A;  3GTO J;  1XC5 A;  3GTJ J;  4X6A J;  2EZK A;  1H88 C;  1K83 J;  1I50 J;  4W97 A;  3TP3 A;  3PM1 A;  3VPR A;  4C3J J;  3IV5 A;  5M3F J;  3BR5 A;  2FJ1 A;  2HOT A;  1VI0 A;  1MBK A;  3BQY A;  5F04 A;  2JA7 J;  3PO3 J;  2ID3 A;  2K9Q A;  1FIP A;  3LSR A;  3LSP A;  1ETX A;  1X58 A;  2R5Z A;  4W1U A;  5K7H A;  1LE8 B;  1SFO J;  4GFB A;  2NVT J;  5JLX A;  2MG4 A;  3HGY A;  3SJM A;  3BR1 A;  4ABZ A;  2HI3 A;  2DA1 A;  5EYR A;  3S1M J;  2N8G A;  2H8R A;  5F0C A;  4D5C A;  1BL0 A;  2K9S A;  1JUM A;  1E3O C;  1ETK A;  4M3F A;  4BXX J;  1UMQ A;  2YUS A;  3ZOB A;  1W0T A;  2VUM J;  1F36 A;  2LLK A;  1WGX A;  2HQ5 A;  3G1L A;  1H89 C;  3HOU J;  4XRM A;  3CDL A;  1ETY A;  4D7M A;  4MLO A;  4CYC B;  3GTM J;  4I6Z A;  1HOM A;  3ZQH A;  3MN2 A;  5HOD A;  4JX6 A;  3BR3 A;  3HB9 A;  3WHB A;  2XGE A;  2FQ4 A;  1IUF A;  1ZR2 A;  2ECC A;  2E2I J;  2PMZ N;  1IV6 A;  3BG9 A;  2NS8 A;  1IJW C;  3ZQG A;  4B3A A;  3GTL J;  5GPA A;  1T56 A;  5E3L A;  3S14 J;  3JRD A;  1LFU P;  3JRC A;  1GV2 A;  4M6V A;  3TW6 A;  1A6I A;  1X2N A;  5M5Y J;  5M5X J;  5EDN A;  3A01 A;  3D1N I;  2X9D A;  2HXO A;  3WHC A;  4RDU A;  1JUS A;  1FTT A;  2QF7 A;  1UG2 A;  2VPR A;  5EZH A;  1QVU A;  5IP9 J;  2L7Z A;  3BQZ A;  4UUS A;  2R93 J;  2B63 J;  2LD5 A;  3E7L A;  3I4M J;  3BG5 A;  2LP0 A;  2NVY J;  4IHX A;  1W0U A;  4DW6 A;  1RKT A;  1JJ6 C;  1RR7 A;  4A3C J;  5FLV A;  3HOY J;  5IYC J;  2JA8 J;  3CCY A;  3BTC A;  5FKL A;  2XB5 A;  1U9N A;  2JWT A;  3JRF A;  3OOU A;  2VKE A;  1JTX A;  3OSG A;  3BG3 A;  3RZO J;  2VI6 A;  4FE4 A;  3HOV J;  4Y52 J;  2FD5 A;  4AC0 A;  4BBR J;  2R92 J;  1DU0 A;  3RQI A;  2JJ7 A;  3LNQ A;  4C3H J;  1WCM J;  2DN0 A;  2I10 A;  2LKX A;  1K61 A;  2EQR A;  1JKQ C;  5FKK A;  1U9O A;  4MFE A;  2EH3 A;  4UUS B;  3JRA A;  2DJN A;  1EF4 A;  2CRG A;  2DMT A;  2DA5 A;  3K7A J;  3HDD A;  2LTP A;  4V2G A;  5DS9 A;  1MBG A;  3LSJ A;  1MBJ A;  3S17 J;  2LR8 A;  1RET A;  5DTD A;  2RAE A;  3JRB A;  1JGG A;  3FIS A;  2MSY A;  4IHV A;  3HOZ J;  1TWG J;  3FK6 A;  2DA2 A;  1LFB A;  2X48 A;  1B72 A;  4MIM A;  1FTZ A;  2XGC A;  3MVP A;  1MBE A;  2HOA A;  1Q1V A;  3TED A;  1HF0 A;  5C4X J;  2M9H A;  1CQT A;  1ETQ A;  2R5Z B;  2XGD A;  2ME0 A;  3HGG A;  1JUP A;  3Q0W A;  5F0H A;  5BNG A;  3RZD J;  2YS9 A;  1BJZ A;  1ZKG A;  5EF6 A;  2IBD A;  1IGN A;  4M3E A;  2LY9 A;  3QQA A;  3O8G A;  1DU6 A;  1IDY A;  5GP9 A;  2IAI A;  2M0C A;  3QPL A;  5J3L A;  2NVQ J;  3GTK J;  3HM5 A;  1GVD A;  5J1R A;  4JP0 A;  2M34 A;  3L1P A;  1MBF A;  2ID6 A;  5EGO B;  2DA6 A;  3W6V A;  3IH2 A;  3SDG A;  3BT9 A;  3IH3 A;  5J1U A;  5EGO A;  3C2B A;  1BW6 A;  2KDZ A;  1S7E A;  2LK2 A;  3S2D J;  1MSF C;  4JYK A;  1QPI A;  3IH4 A;  2L0K A;  5IYB J;  2OF7 A;  4V2F A;  2CJJ A;  2XPV A;  3G1M A;  1ORK A;  2XRL A;  2CUF A;  3HOW J;  1P7J A;  1OJL A;  3H0G J;  2L7F P;  1A5J A;  2JN6 A;  4A3G J;  1VFC A;  4UUT A;  1HDP A;  2XB0 X;  1YRN B;  5K7F A;  1JTY A;  1WPK A;  4A3M J;  3M4O J;  4BY7 J;  3JRI A;  1TWF J;  4DYC A;  2P81 A;  2GBY A;  2EZH A;  1ETO A;  4RBO A;  4J19 A;  2AO9 A;  1U8B A;  4XID A;  1LE8 A;  5FKM A;  2MW8 A;  2GLO A;  1FEX A;  1NK3 P;  2DMQ A;  1RKW A;  4MFD A;  1JKP C;  1F43 A;  1ZTR A;  3BTJ A;  5K7Z A;  5FJ8 J;  4QSH A;  2L9R A;  4DZP A;  3FK7 A;  4HNV A;  3ZQI A;  3S1N J;  2VKV A;  3DCF A;  2W48 A;  4EEF G;  5F08 A;  5C3E J;  3S1R J;  2ZB9 A;  1O4X A;  2WAQ N;  5F0F A;  3S2H J;  4D7N A;  2GM4 A;  5IP7 J;  4LOC A;  1T33 A;  4IEJ A;  2R5Y B;  1RES A;  4C3I J;  4X1E A;  3K2A A;  3S16 J;  5FKO A;  2FX0 A;  2Y2Z A;  2O8K A;  4BY1 J;  1Z0X A;  2WB1 N;  3JR9 A;  3B6A A;  1PUF B;  1HCR A;  2DMU A;  1MNM C;  2IEK A;  3FKI J;  3TW7 A;  4I76 A;  4L5E A;  4MO7 A;  5M3M J;  2HOS A;  1IG7 A;  2LFB A;  3NAR A;  1APL C;  1WH5 A;  2L7M P;  2CQX A;  4FTH A;  3A01 B;  3DEW A;  2TCT A;  3ZQF A;  2ECB A;  4A3I J;  1Y1W J;  1POG A;  1OFC X;  1OCT C;  2DA7 A;  4CYC A;  3GBG A;  1TC3 C;  1I6H J;  5IPA A;  3G1O A;  2XPW A;  3MKL A;  1QVT A;  3S15 J;  1AU7 A;  1RPW A;  4AUX A;  1Y1V J;  4A3F J;  1JT6 A;  4M3G A;  3BTI A;  2R5Y A;  3GTP J;  5FKN A;  1ZGW A;  2X6O A;  3Q0U A;  1G2H A;  2HXI A;  1TWH J;  1VF9 A;  1TWC J;  1MH4 A;  1B8I B;  2MGQ A;  1MBH A;  4G12 A;  2QCO A;  2K40 A;  1ITY A;  1ETW A;  1ZK8 A;  3Q3S A;  4FCY A;  1BA5 A;  1ZQ3 P;  2OPT A;  5EG0 B;  2K9N A;  2DMN A;  3GTG J;  1JJ8 C;  4M3B A;  4XRS G;  3BR2 A;  5J1Y A;  4A3D J;  2LVS A;  2KT0 A;  3ZQC A;  1SAN A;  4JX4 A;  1GT0 C;  2E2H J;  3JRE A;  5E3M A;  1FJL A;  2D5V A;  1U78 A;  4DZJ A;  5F1J A;  2JMW A;  3NAU A;  2CQQ A;  4NDL A;  4A3K J;  3M3Y J;  2NOG A;  1AKH A;  3A02 A;  5IYD J;  4A69 C;  2Y9Z A;  1VND A;  4FIS A;  1UHS A;  1ENH A;  4XIC A;  3QPS A;  2AHQ A;  3FIW A;  3LOC A;  2HYJ A;  1MSE C;  1JKO C;  3S1Q J;  2YU9 J;  5C44 J;  1XS9 A;  3BR0 A;  1NTC A;  4XRS A;  2EZL A;  2CUE A;  4D5F A;  1Z77 A;  3Q0V A;  5E3N A;  2JK3 A;  2TRT A;  2CU7 A;  1IDZ A;  5FLM J;  2NVX J;  3BTL A;  4BKX A;  1WI3 A;  5IOY A;  2R0Q C;  4A93 J;  5E3O A;  3JRH A;  1ETV A;  1X2M A;  1NK2 P;  3A03 A;  3O8H A;  3OIO A;  3OSF A;  5F27 A;  2R7Z J;  2E1O A;  2DTZ A;  4A3J J;  2Y30 A;  4A3B J;  1I3Q J;  4Y7N J;  4QIW N;  2ELK A;  2WV1 A;  4B1R A;  2EBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...