3FISA

The molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
73
structure length
73
Chain Sequence
b'PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
publication title The molecular structure of wild-type and a mutant Fis protein: relationship between mutational changes and recombinational enhancer function or DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 25
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fisA00
2DA5A 1BW5A 2DN0A 2M8GX 5FKLA 1FTZA 3HGGA 1TWCJ 2GM4A 3BTIA 5GPAA 1Y1VJ 1D5YA 2L0KA 2HDDA 1PUFA 5IP6A 4UUSB 2Y9YA 3PO3J 2P81A 5FKMA 2YU9J 3A02A 3FISA 5FLMJ 2EBIA 3FK7A 3GTMJ 4M6VA 2OF7A 4MFDA 2M9HA 1HOMA 2X48A 1NK2P 2MGQA 4JX6A 1RKWA 4A93J 2NOGA 2HXOA 5IP9J 3GTPJ 1I50J 4A3EJ 1B8IA 2AO9A 2WV1A 4XRMA 1ITYA 2DMUA 3A01B 4A3MJ 4L5EA 3L1PA 3ZQFA 1VNDA 2E2JJ 4EEFG 3BQYA 3HOZJ 2ECCA 5FKOA 1ENHA 1OFCX 1P7IA 4HNVA 2R93J 1AKHB 4A3BJ 4IHWA 3BQZA 1YRNA 1OJLA 5F0CA 5IYCJ 5J1RA 1JKOC 1IJWC 4CYCA 2EZLA 4A69C 1MBEA 4C3IJ 1IRZA 3JRCA 3RKQA 5IOYA 4MIMA 2DA4A 1WCMJ 1HF0A 2E19A 2Y0SN 5EYRA 1SANA 4M3EA 2DA3A 1UMQA 2CJJA 3TEDA 2O9LA 1U9OA 1U9NA 1JUPA 1WH5A 3PO2J 4XRSG 3IH3A 1FJLA 5EF6A 1GT0C 3PM1A 1MH3A 2X6OA 1JUMA 4DZJA 4DYQA 5EGOA 1RPWA 1JUSA 3ZOBA 4AYBN 1JTXA 3Q3SA 2W48A 1IDZA 4A3DJ 2DMNA 2M34A 1FEXA 5GPCA 4BBRJ 2B63J 2DA7A 1QRYA 3BTLA 2VPRA 3HDDA 2MG4A 1GDTA 4B3AA 3GTKJ 4CYCB 2KT0A 4Y52J 1LE8A 4BY1J 4LOCA 2KDZA 1JJ6C 1FTTA 3H3VK 1RR7A 1A6IA 3BG5A 3HEFA 1MBFA 3Q0VA 2EQRA 1T56A 2E1OA 3S1NJ 5EG0A 1MH4A 1VI0A 3ZQGA 5DS9A 3M3YJ 1WPKA 4M3BA 3ZQHA 2JA5J 2LTPA 1ZKGA 2RAEA 3JRDA 2D5VA 2ZB9A 5C4XJ 2FQ4A 2IBDA 2XGEA 1AU7A 1ZTRA 3D1NI 2N8GA 2O8KA 1NTCA 4S0HB 2G0EA 3HOUJ 2I10A 1GV2A 5IYDJ 3G1MA 3MKLA 2M2EA 2ME6A 4A3KJ 5E3MA 2LR8A 5E3OA 3OSFA 1DU6A 2ELKA 2XSDC 5FKNA 2Y9ZA 2ECBA 4XK4A 4NDLA 3LSJA 3S17J 3HOVJ 4X6AJ 1JT6A 2FJ1A 1JTYA 3UKGA 2JA6J 2DMTA 1H89C 3O8GA 2XGCA 5FKKA 4FTHA 5EDNA 4IEJA 2NVYJ 3SJMA 1XC5A 2XPUA 5K7FA 4A3JJ 2H8RA 1O4XA 1TWGJ 4BXXJ 2WB1N 3IH2A 4A3LJ 2EH3A 2JJ7A 4QTRA 5C44J 1QVTA 5C4JJ 3JRFA 3NARA 1LFBA 2AHQA 4X1EA 1SFOJ 4J19A 4A3FJ 1EF4A 3HBLA 1BW6A 3E7LA 4W97A 5EG0B 3JRHA 4D7MA 2M0CA 4B1RA 5IYBJ 2VUMJ 2DA1A 2R5YA 2LKXA 1ETQA 1JJ8C 3GTQJ 2NS7A 2XPVA 4D5FA 3HOYJ 3I4MJ 2EZKA 2VKEA 3A03A 2L9RA 5F27A 1BA5A 2R7ZJ 2E2HJ 4D7NA 1PUFB 1IDYA 1HDDC 3B6CA 4DZPA 2XRLA 2NVTJ 2LP0A 1GVDA 5J1YA 1ORKA 4A3GJ 1POGA 2PMZN 4FE7A 2R5ZA 3DCFA 3JRGA 1F36A 1IV6A 5M5WJ 3LSRA 1BJZA 5M3FJ 3SDGA 2GBYA 1K83J 1ETWA 2JMWA 1K61A 1Z0XA 1B8IB 3BT9A 4XIDA 1JKRC 4BBSJ 3QPLA 3JREA 2HI3A 2ME0A 2QF7A 2MSYA 2JA7J 3IV5A 3FIWA 3TP0A 2EZHA 4B4CA 3GTOJ 3GTJJ 1MSFC 5M5YJ 1IUFA 3BR5A 1TWFJ 4I76A 2CU7A 2XB0X 4C3HJ 4MFEA 1ZQ3P 2L7ZA 3LNQA 1LFUP 2JWTA 3TW6A 1YRNB 4QIWN 1MBJA 2EZIA 2XGDA 2CQQA 3FK6A 3ZQIA 1Z77A 4DYRA 3F0CA 2HOTA 3S1MJ 4A3CJ 3ZQCA 1ZK8A 4C3JJ 3H0GJ 1JGGA 5EEAA 3BG9A 2XB5A 4UUSA 4A3IJ 5M3MJ 1R9TJ 3HKZN 1A5JA 3WHCA 2MW8A 5K7ZA 4V2FA 1NK3P 2XPWA 2LY9A 4JX5A 2K9SA 2YS9A 3JRIA 3GTGJ 1XG1A 1P7JA 1RKTA 1XS9A 2HXIA 2H1KA 3GTLJ 4MLOA 3S14J 4RDUA 1S7EA 5EZGA 3CQZJ 1G2HA 4D5CA 2CUEA 1BL0A 1FIPA 1X58A 3BR0A 4XRSA 5EGOB 4QSHA 2R0QC 2NS8A 3RQIA 5F1JA 2JK3A 2VI6A 3A01A 1U78A 1APLC 1U8BA 3O8HA 4FCYA 4FISA 3BR6A 1T33A 1MBKA 1UHSA 1ETKA 3BR3A 3B6AA 2CUFA 1AKHA 1GV5A 1IGNA 1HCRA 5J3LA 1TC3C 5IPAA 2DA2A 2L7MP 3JRAA 4G12A 3RZDJ 2VKVA 1LE8B 3S1RJ 3BG3A 1B72A 4W1UA 1RESA 3I4NJ 1OCTC 1OCPA 5EZHA 4BY7J 3M4OJ 3GBGA 5C3EJ 1Y1WJ 3SFIA 2CRGA 1ZR4A 4V2GA 1UG2A 1QVUA 2HYJA 1ZGWA 1TWAJ 2DTZA 2JN6A 1JT0A 3BTCA 5F08A 3RZOJ 9ANTA 3TP3A 3NAUA 4DYCA 4JYKA 2OPTA 3G1LA 3Q0UA 1JKQC 2JA8J 1I6HJ 5F0HA 5HODA 3LSGA 2HOSA 3DEWA 2FD5A 1Q1VA 3HGYA 3K2AA 2K40A 5E3NA 1MBHA 1X2NA 1WI3A 1QPIA 2NVQJ 4Y7NJ 4JP0A 5E3LA 1I3QJ 1HDPA 2DMQA 4MO7A 4AUXA 5JLWA 2NVXJ 5M5XJ 2FX0A 3ZQLA 4GFBA 2L7FP 1ETXA 1JKPC 4M3DA 3CMYA 2E2IJ 2O7OA 2TCTA 5BNGA 5FLVA 2Y2ZA 3S15J 2ID6A 3HOWJ 3VPRA 5F04A 1CQTA 1H88C 4IHYA 1B72B 4C2MJ 3OIOA 4UUTA 3HB9A 4IHVA 2CQXA 2DA6A 3BR1A 2K9NA 3MN2A 1F43A 3Q0WA 5GP9A 3LOCA 2HQ5A 3JRBA 3BR2A 3FKIJ 3BTJA 2X9DA 3C2BA 2LVSA 1ETOA 2Y31A 4DW6A 1FIAA 1WGXA 1X2MA 2R5YB 2K9QA 2IAIA 4ABZA 1AHDP 2TRTA 2DMPA 3IH4A 5DTDA 4RBOA 2QCOA 4IHXA 5IP7J 1GUUA 1ETYA 3OSGA 4JX4A 2DJNA 2IEKA 5IOZA 2GLOA 2YUSA 2LD5A 1MBGA 2R92J 3QPSA 3G1OA 2R5ZB 4FE4A 3CDLA 5FJ8J 3W6VA 1MNMC 3OOUA 3S1QJ 3WHBA 3CCYA 1MSEC 1VF9A 3MVPA 1WH7A 1W0TA 1E3OC 4M3GA 1IC8A 1HLVA 2LLKA 3S2HJ 3HOXJ 1RETA 2LK2A 4BKXA 3S2DJ 1ETVA 1TWHJ 5JLXA 3K7AJ 4I6ZA 1H8AC 1DU0A 1W0UA 2HOAA 3JR9A 3LSPA 2ID3A 3HM5A 3QQAA 4M3FA 2Y30A 1IG7A 5J1UA 1ZR2A 3S16J 3TW7A 4XICA 5K7HA 2COBA 2WAQN 2LFBA 1VFCA 5F0FA 4AC0A
chains in the Genus database with same CATH superfamily
3V42A 3ZMTA 3F8CA 3K0LA 1VQNI 3HGGA 3ONQA 3HL2A 1SVLA 3FX3A 4KIBA 2P7VB 3H35A 2GM4A 3GFMA 1UB9A 2DT7B 2HS5A 5DYMA 4AYBA 2XHKA 1YHQI 1D5YA 2E1NA 1YJ9I 4I7HA 5IP6A 2IGNA 5FLMJ 2EBIA 4PJMA 3FK7A 3GEZA 4RM2A 1ZRDA 5KNLA 4M6VA 2DK5A 4MFDA 2RKHA 2KIQA 1YIJI 1SAUA 1NK2P 3G2BA 1ULYA 5TJJA 1U6GA 2FU4A 2MGQA 3BG6A 3H5AA 2GXBA 2DW4A 2V1DA 3VSLA 2ETHA 2WV1A 2ZJ2A 1TBXA 4E7HA 1YW8A 4LK0F 4G6DA 4LFUA 1TQMA 1XMAA 2E35A 4A3MJ 4L5EA 4I01A 3V8LA 4BNCA 1DPUA 3HHHA 3C18A 3L2VA 1SVOA 2ZFUA 3BQYA 3NRVA 4S04A 1SAXA 2NAZA 4ZZLA 2ECCA 3HRSA 5FKOA 1ENHA 3GO5A 4L5JA 2R7VA 4OAZA 3VEPA 1WJ5A 2IS1A 1D8JA 1YW9A 4IHWA 3BQZA 4GYIA 2DQRA 2VXZA 4XLFA 2FF4A 5HLTA 4A6DA 4WXHA 5IYCJ 5K5RA 3FZVA 3CJQB 2EZLA 4A69C 1G4DA 3CTAA 2H8WA 2X6YA 4ON0A 1IXRC 2P8TA 3RJPA 1ODDA 2P5KA 1HF0A 2E19A 4RS8A 1BC8C 1XGOA 3AFHA 3EUAA 5EYRA 3RKXA 2L02A 1QHGA 3CO6C 3E6BA 3MZHA 3F23A 3S3OA 3HTUA 2BYVE 3TEDA 5BOXA 2OZ6A 2ISYA 1WZ2A 1X1CA 5DCMA 2HYGD 3OYEA 1S9HA 1JUMA 1HA8A 2KDOA 1RPWA 2IP2A 1TT5B 4AYBN 3Q3SA 4HZFA 1YLFA 2CQKA 3C1DA 3L09A 2DU9A 3VYUB 4ZZDA 1IDZA 2M34A 4UV9A 4Q47A 4DBQA 1W5SA 3WU1B 3KZZA 5IT9K 3JSPA 3OR2C 3ZP5A 4UUVA 5B1AH 1FOXA 1A04A 4IJAA 1GDTA 2LSOA 3GTKJ 2KT0A 4ESJA 5LD2C 3OYHA 4Y52J 2EV6A 3L2RA 2VBYA 1JJ6C 1FTTA 4XKWA 1RR7A 4FASD 3J7YJ 1UG0A 3N05A 4LB6B 3M7GA 4YG2F 3R4KA 5KK1A 2BOLA 2Y0SA 4E7IA 2PMZA 2VT2A 1RR8C 2W1OA 1V5EA 4BQQA 2XRNA 5EG0A 4CH7A 3MKZA 5DS9A 1WPKA 4M3BA 3FXKA 1ZKGA 5DCMB 2Z9OA 3CCRI 3K10A 1QZYA 3OOPA 4CZCA 4II2A 2ZB9A 4KICA 1N75A 3IL2A 1AU7A 1ZTRA 2B0LA 2HQRA 5FFXA 1JXSA 1VQOI 1P2FA 1N25A 1P92A 4P1WA 2IXSA 2L5QA 3KIOA 4ENJA 2M2EA 4A3KJ 5AONA 5E3OA 2HVSA 1XGNA 3WGIA 3I56I 4BQOA 2Y9ZA 2IW5A 4XK4A 1LKXA 2GXGA 2G9WA 4YIIA 4AIHA 2FJ1A 3UKGA 1JTYA 2M7BA 2JA6J 2K85A 4M71A 1YJNI 4FTHA 1UFMA 2RVCA 1QBJA 4U0WA 2XPUA 3TMOA 3N4MA 2H8RA 3KPHA 4BXXJ 3IH2A 3G73A 1X1AA 2JJ7A 2VKDA 1QZEA 3KETA 4KT6A 5C4JJ 3NARA 1H9GA 1YX3A 3OR1C 2AHQA 4X1EA 2F5DA 1YFHA 1KU7A 4J19A 1ZREA 4Z2YA 5EG0B 3JRHA 4OIPF 1K6OA 2WV0A 1FMWA 2YX4A 2LDUA 2XSJC 3R0AA 4PCQA 4NNJA 2VUMJ 2LKPA 3SQNA 4A0XA 3BC8A 3GTQJ 4HEA2 3DBLB 1IN6A 3U1DA 3I4MJ 3A03A 3LQRA 1G3YA 2DQLA 3BPXA 3DTEA 4CHUA 2BY2A 4FETA 1BA5A 3H9JA 1R1TA 5D5XB 2JPCA 2Q0OA 2OD5A 5HOOA 4MNUA 2JRMA 1ZHFA 3B6CA 3CMMA 4LG3A 4DZPA 2XRLA 3ELKA 5CVVA 1K7AA 1FLIA 3IAS2 5J1YA 1ORKA 4G6QA 3HRUA 1QGPA 3SZPA 4BACA 2PMZN 2EB7A 3ZR8X 3M8EA 3DCFA 4I0AA 5GTIC 3RCOA 1OISA 2VQHA 4ZH4F 2GBYA 2PJRA 2JMWA 2X1EA 5HVQC 2IS6A 3WTUC 3AG2H 4YIRX 1JKRC 3F72A 3JREA 3OYDA 2HI3A 5FLXZ 2JZYA 1ZRFA 2ME0A 2QF7A 3RKYA 3DTKA 1A6QA 1VQ4I 1R1UA 2ELJA 3IV5A 2R7WA 1G6NA 3FIWA 4IXAA 5FROA 1R71A 4B4CA 2L4MA 3OYAA 5M5YJ 2Q2EA 2L9SA 1QNTA 4EGZA 2OA4A 3LAPA 4HDUA 2HKOA 1K4SA 3TW6A 1G59A 3OYNA 2BW3B 2XGDA 3SXYA 1HQCA 1P4XA 4GYGA 2O03A 5BPDA 4P5OA 4PUSA 1Z21A 4DQ2A 1GLNA 3S1MJ 4A3CJ 4XORA 5LHHA 3H0GJ 4EJTA 2VB6A 1LJ9A 1K79A 3KYCB 3BG9A 4UUSA 3CD6I 1R00A 1HSTA 4C9YA 1X1BA 4JX5A 1HW1A 2MC4A 2VKHA 4XNFA 3GTGJ 1XG1A 2PJRB 2OBPA 4LIUA 2HXIA 3CCVI 3I55I 3DLLF 3GTLJ 3LL7A 4D9JA 1ONVA 3DU6A 4D5CA 1I5ZA 3BR0A 1IN8A 3K4LA 2Z99A 3L9FA 2YR2A 3IAM2 1LEBA 4HSTA 2MD5A 3RQIA 3Q9VA 5F1JA 3WE2A 1HKSA 4AM3A 1MIJA 1CF7B 4FISA 1MBKA 3QYEA 4RM3A 4HQEA 2EIKH 3BR3A 4E7SA 1J59A 3IC7A 1R4MB 2FA5A 3RIRA 2X1DA 4HAMA 1IXSB 4RGXA 3C2GA 4XLPF 1ZLKA 1GV5A 4XMYA 1HCRA 2ZXIA 2X1CA 3VYTB 3GUDA 5J47A 3K4JA 3GYHX 2W25A 4HLXA 2VKVA 2BHZA 4XN3A 1A36A 3S1RJ 2IPQX 3BG3A 4HW0A 2QENA 2V79A 1FSEA 3CZ6A 4W1UA 3VWBA 1WWXA 4ZYGA 3ECOA 3SZTA 3FM5A 5KVRA 2OC6A 3E1SA 4BUPA 4RB0A 2DO7A 2CW8A 1FBQA 2Z5UA 5C3EJ 2EFWA 4EM1A 1UG2A 1RC9A 2K9MA 1Y8QB 2XAHA 3R0JA 2VL8A 4I99C 1ZGWA 3KP5A 4QPQA 1TW2A 1JT0A 4A6EA 3RZOJ 2H09A 4B09A 1F4KA 9ANTA 3NAUA 3QOPA 2ZJPF 2CQ7A 4FT8A 2OPTA 2PX9A 2W85A 1ZG1A 3Q0UA 4OAYA 4LJZF 2JA8J 1I27A 3BLYA 3K4MA 3LSGA 1FP2A 5JR3A 1P9QC 2K40A 1MBHA 1J09A 3WGGA 4YFXF 4BQAA 4RB2C 3LQQA 2LH9A 2VC0A 2OV7A 5HS8A 3UNGC 2C6YA 1ETXA 2EFQA 4M3DA 1R5ID 4ANJA 2ID6A 5HLIA 3VPRA 5F04A 4HDVA 4IHYA 2HFHA 1W36D 1I1SA 3WTVC 4UY8I 2K3FA 1F1ZA 5BQTA 4NQWA 1R5HA 1BM9A 3LMMA 4E7JA 4IHVA 4BE1A 3L2QA 2WY8Q 3DPLC 5GP9A 2G7HA 3BCBA 2HQ5A 3LOCA 2XROA 3JRBA 3RYPA 1D0YA 3PFYA 2B7EA 2DCEA 3IP4B 2FOWA 5HS9A 2MFZA 4RAYA 2R7TA 3L2UA 2Y31A 1MGTA 2FBHA 2H6BA 2YX7A 3EPZA 4ZDPA 4JK1X 2GIVA 4Y17A 2OZUA 2R5YB 4ABZA 4Q5SF 4BHPA 4IHXA 4YIFA 4Q48A 1VQKI 5IP7J 2QBYB 1ETYA 2F4IA 2F5CA 5CKTA 4OMZA 4U0VA 2J5OA 1UAAA 5D8LB 5IOZA 1QU3A 4BJ5C 5BS6A 1LPQA 1R49A 3O2PE 1YG2A 4M72A 2LBFA 2VOOA 4CYDA 3ZN1A 2XUBA 4BQNA 1YITI 2M45A 2WAFA 3S1QJ 5JHUA 3CCLI 5CJ9A 3VYSB 3VFZA 3MVPA 5DD8A 1W0TA 1FYMA 3BJ6A 4I09A 2HDWA 2DFEA 4XBFA 3ZMZA 5ICEA 2KIFA 2A07F 3HHGA 3OYBA 4R8HA 5LLQA 4NQWB 3HOXJ 5FD6A 3LFUA 3S93A 3VDXA 1O3QA 2VBXA 1TWHJ 1H8AC 2PMHA 2HOAA 3BZCA 3HM5A 3HYIA 3T5XA 3QQAA 2HTSA 1MMNA 4YFKF 1UELB 2BBYA 1ZR2A 3S16J 2QYOA 5K7HA 2COBA 3BG7A 3F8NA 3NWTA 2E1MC 1MDMB 3BZ6A 5E20A 5DCFA 4QPOA 5FKLA 1K4TA 2V6EA 3G6EI 2VJ5A 3BPVA 3TO6A 4LITA 4PGHA 2K7LA 3BTIA 1Y1VJ 2L0KA 2HDDA 3OMYA 5DM7F 1PUFA 4A0ZA 5FKMA 3BROA 2YU9J 1SMYF 3FISA 3FMQA 3M1CA 3T8RA 4B48A 4IHTA 4IRGA 3FHZA 1PUEE 4IVNA 2QUFA 4Y4RA 5H6QA 2CFOA 4EJOA 5LBQA 2EFPA 2VQCA 1E17A 1RZ4A 2W7NA 4A93J 4EV0A 1M1EB 1MNDA 2NOGA 4D1QA 2H27A 5IP9J 3FXMA 2MLKA 2AO9A 3A1YA 1O7LA 4BDZA 1XDUA 4IKFA 3TKYA 1GVJA 3ZQQA 4XN0A 3IUOA 1TTYA 3L1PA 2KLOA 4QLCU 3CCSI 5GTHC 5HLGA 3HOZJ 1FOKA 1W36C 1P7IA 3ERED 1S5LC 2RDPA 2YPRA 3KEYA 4A3BJ 4CDGA 1MNEA 1X4OA 5JVTA 3OYFA 3ZQ7A 1OJLA 1SD4A 4XQFA 1IJWC 4CYCA 1F5TA 1EV7A 3RI4A 1QZZA 2DFIA 2RV8A 4IQJA 1YS7A 3VODA 2BXZA 4AIDA 2F5EA 1H9TA 2DA4A 2P6SA 5GAEJ 2P5LC 3QU3A 3PSIA 1Y8RB 1SANA 4KIGA 1B4AA 4KA4A 1UMQA 4OINF 1W5TA 2CJJA 2F6CA 2A6HF 2R7RA 4HNTA 5F1RA 3PO2J 1J7KA 2HPIA 2VJJA 2M3AA 1B9MA 3QYBA 3OY9A 3OYCA 1MJ9A 1HC8A 5EF6A 3E5UA 1KA8A 3D5LA 4UVAA 2QA4I 3ABMH 1Z3YA 5EGOA 3RSNA 5A2QZ 3GVAA 1JTXA 2CO5A 3JAMK 4UB8C 2W48A 2F48A 3P9IA 1FZPB 2DMNA 4XL9A 4A3DJ 1D5VA 1CGPA 1FEXA 1T38A 4BBRJ 2BY1A 3GCMA 3R60A 4IF4A 1O3TA 1QRYA 3BTLA 1DP7P 4KNYA 3HDDA 2MG4A 2VN2A 3LFKA 3RTRA 4P9FA 4CICA 4CYCB 3V7SA 3J81K 2DDBA 1SD7A 1LE8A 4BY1J 4HYEA 2KDZA 1FSHA 3H36A 1A6IA 3DV8A 4CCJA 3S1NJ 4XLNF 4KJZA 3DXJF 2EV0A 2R7DA 4EJUA 2FNAA 5GAGJ 2HOEA 1VI0A 1A31A 3H5RA 2BXYA 5KHDA 1SVMA 4V19K 2LTPA 5CQEA 2RAEA 3JRDA 1HW2A 4U7DA 3FXUA 3HPGA 5C4XJ 1KU9A 2IBDA 4R79A 3D1NI 1GXPA 4S0HB 1BN5A 5LGTA 3CJNA 4LIVA 2XDVA 3PIPF 2JVGA 1GV2A 1R1VA 2ME6A 5KCMA 3E5QA 2LR8A 3F8FA 4EMSA 1DU6A 2ELKA 4XONA 2XSDC 5FKNA 2HVRA 2DOFA 1PVEA 2D2WA 3WTWC 1KU2A 1QO0D 1TNTA 2R7QA 2NS0A 3J80K 1TW3A 1TP4A 4CZZA 2CGPA 1JT6A 3KP2A 3U2RA 4OIOF 2EA2A 2VC1A 2PEXA 5CVJA 3GFLA 4F55A 5FKKA 5CVRA 1XMXA 2NVYJ 3LSIA 2VBWA 3TBIA 3SJMA 3F8BA 1HSJA 2GZWA 1O3SA 1AWCA 3N97A 4A3JJ 4NHJA 3M8JA 3RKWA 1ZAOA 1RRJA 2H1LA 1RNLA 1BOBA 1OYWA 2E5ZA 5AIQA 4AVPA 3JRFA 3DKWA 4DBRA 1VQ8I 4EM0B 2VT3A 1EF4A 1BW6A 3E7LA 4EJVA 2KRFA 2MABA 4U0YA 5CVUA 3BY6A 1U3EM 3S3MA 2JT1A 3LWFA 1ETQA 1JJ8C 3RYRA 2QKMB 2L9NA 4WWCA 2Y48A 2VKEA 2JUCA 4CSWA 2X6XA 2R7ZJ 2CYYA 2E2HJ 4D7NA 5DEQA 3E97A 1IN7A 1BIAA 3SFZA 3ZCOA 2OTLI 1X19A 2NVTJ 4LG0A 3ZMUA 4EATA 4WXDA 3LSMA 1POGA 3BZKA 1WJDA 2CUZA 4FE7A 4BU2A 1KYWA 3JRGA 3AKZA 5M5WJ 3ECHA 2ZCWA 1R6RA 1DPRA 2NVUB 2BY3A 3K70D 3SDGA 1K83J 1K61A 5B66C 1B1BA 1QA6A 4XIDA 4BBSJ 2JTVA 2H6CA 5B1BH 4B43A 3WU0A 5J8FA 3H9QA 2F4OB 2MSYA 2OCCH 3LA3A 2F5VA 2ZC2A 1LDJA 2KP6A 2DJIA 3T1BA 2PLYA 3PUFA 3R61A 1TQIA 2LF7A 3GTOJ 2EK5A 3DLAA 2IS4A 5L3DA 3HXLA 4A12A 3SHFA 4I76A 4CCLA 2HZDA 1OQYA 3H0DA 2L7ZA 2CH0A 5L3BA 5H20A 2ZXHA 2JWTA 2LF8A 2BV6A 1MBJA 2M4GA 2V1UA 4P9UA 3ZQIA 2OJED 2VBZA 1Z77A 3TGNA 3SEZA 1D1CA 4WK8F 5K5QA 2OCEA 3G4SI 2ZJRF 2H94A 3ZQCA 2WC2A 1ZK8A 4C3JJ 2WY7Q 5FB2A 1XMKA 1JGGA 4A5NA 3F3XA 4Y33A 5M3MJ 4FX0A 4ZYHA 2DFHA 5K7ZA 1NK3P 1G3TA 2XPWA 1T08B 3FXLA 1ZN2A 2KHMA 4CXFA 5ICGA 1P7JA 1RKTA 2OQGA 2GAUA 4MLOA 2JA2A 3S14J 1S7EA 5EZGA 1WKMA 1BL0A 1FIPA 4BXFA 2UZKA 1X1PA 2R7OA 3ABLH 3LSTA 3J7ZI 4XSZF 2NS8A 2JK3A 3A01A 1APLC 1FOYA 3ZN0A 3HC7A 3U9GA 2KFDA 1T2KA 2FEZA 3TDZC 1X3UA 3DBHB 1KONA 2WWYA 3BR6A 1BI1A 2IA0A 3WU2C 5LEKA 5IT9Z 4M6YA 5L3CA 1AKHA 4UNOA 5J3LA 2R7UA 3MQ0A 5IPAA 2MD0A 1Z6RA 3DPTA 3M1EA 1U2WA 4WF2A 3CMEI 1B72A 4OOIA 2BVLA 5ERIA 4H0EA 2ESHA 3W6KB 3ABTA 1LUJB 3MAJA 3MWMA 4BE2A 3GBGA 4I98B 3IRRA 4LLLA 3PIOF 1WJFA 3IKVA 3LAJA 1Z3XA 1FYKA 4MEYF 3VSKA 2ELHA 2K9LA 4CGZA 4UVBA 3TP3A 3ABKH 6PAXA 4DYCA 1J2XA 3MKYB 1I6HJ 5F0HA 2HOSA 3HGYA 2E1MB 1LVKA 1R36A 4PGGA 4QWQA 3WTYC 4LGWA 3K70C 3H92A 3SDBA 5JHFA 4Y7NJ 3RQ4A 4JP0A 5E3LA 3A2KA 1NG7A 2E36A 4MO7A 5JLWA 2NVXJ 2KRCA 2O5RA 2EFNA 4F91B 4L5IA 4B8XA 1G3WA 2LNBA 3ZQLA 3I0TA 2EILH 1P6RA 4PDKA 3CMYA 1JKPC 2Y2ZA 2W57A 3I59A 4IPAA 1CQTA 4YRVA 1B72B 4LLGF 3FXRA 3I64A 2QQAA 1R7JA 4UUTA 3HB9A 3FXJA 3PNYA 3JTHA 2L2OA 3CJTB 1F43A 1PYVA 2ZNZA 4OU0A 4HG2A 3I3LA 5HNFA 3L7WA 2IGKA 3GX4X 1WRJA 2YU3A 4XLCA 1FIAA 1WGXA 2VASA 2K9QA 1YE9A 2IAIA 3F6VA 3K4CA 2GOMA 2JSCA 1ZG5A 4I0BA 2RGVA 2JVHA 2HU9A 4IX7A 2CS3A 1H0MA 5TRDA 1VQMI 2XF7A 3OSGA 1IRFA 3WTTC 4JX4A 5F6FA 2GLOA 2LY2A 2YUSA 3C3WA 2R92J 2A69F 3FHNA 3HSFA 4GGGA 4FE4A 3CDLA 5FJ8J 1Y39A 3WTSC 1ERDA 1YO5C 2LMDA 3CCYA 3HTSB 2HVQA 4HV6A 4EQQA 1WH7A 1QHHD 1PP8F 5FO5A 3K4NA 1E3OC 2NNYA 3PL8A 1IC8A 4N9IA 1RUOA 1VQ7I 2A61A 3S2HJ 1SFKA 1RETA 2CV0A 3KCCA 1W4MA 3TOBA 1I1GA 2P7CB 3S2DJ 1ETVA 1NHAA 1DU0A 2CSOA 3I54A 4U88A 4ZYEA 2BE5F 3BDDA 3GWZA 4PJ0C 1O7FA 1D1BA 3OIPA 1V54H 2ZFWA 2Q2EB 3DKYA 1IG7A 4XLHA 1IRXA 4G94A 3D0SA 2X4HA 4ZYAA 4XICA 2KIUA 2LY1A 3CC7I 1VFCA 5F0FA 3D5SC 4AU7A 2YSRA 3F22A 2DN0A 2M8GX 4GCVA 3MCZA 1FTZA 3GW2A 3V7RA 2XGXA 1UHWA 1GHCA 3PUBA 4I2OA 3OYGA 4L18B 4ENKA 4PSXA 5GPAA 3V8JA 5IT3A 4BJTA 4UUSB 2Y9YA 3PO3J 2O61A 2P81A 1R23A 5DV5A 1BR1A 3IHUA 1R5GA 3CP2A 3P7NA 3LA7A 2OF7A 4RAZA 2A68F 2OAZA 1F9NA 1ZG3A 2X48A 3K9TA 1HOMA 1DGWY 1FBSA 4JX6A 1V3FA 2IGOA 2MA3A 2HXOA 3GTPJ 4A3EJ 1B8IA 3ROUA 1AOYA 3FDYA 2QEXI 1OCZH 4XRMA 2M1BA 2DMUA 3M9AA 1D0XA 1VQ5I 3W3CA 3QAHA 4N0BA 3ZQFA 4BHCA 2QGUA 3CLOA 2HPMA 1OFCX 2E5NA 4XM3A 4HNVA 2M7AA 2ZSIB 2R93J 3FMSA 2MH9A 1TT0A 1KU3A 3AG4H 1BI0A 2GOXB 5D4SA 1USTA 2DXIA 3CF2A 1YRNA 5F0CA 4XOPA 1JKOC 3KX2A 1K6YA 2WBMA 3H3UA 4C2UA 2DPDA 4FHTA 3CUOA 1S72I 4NC8A 4BEHA 5DUIA 3K4KA 1N78A 4F7ZA 3PQKA 3JRCA 2QQ9A 3HIFA 5E8GA 1Z7LA 5IOYA 2UWMA 5ILSA 2Y0MA 3E6CC 1FPQA 2DA3A 1TZLA 2E7WA 4FQGA 2DK8A 3GZ6A 1JHHA 4NUBA 2O9LA 4EM2A 2RC4A 4M9XA 3SEQA 3GZ5A 3IH3A 2EPFA 1Y0NA 2KISA 3E3VA 1XCBA 1OYYA 2E71A 2LOOA 3PM1A 4G7ZF 1X3ZB 4KYWA 1MH3A 3QOEA 3CCUI 1BOAA 2DTRA 1XB4A 3CESA 4DZJA 4DYQA 3H1CA 4N9HA 1ZELA 5HLHA 3I53A 3W2VA 1RI7A 1U5TA 1OKRA 1Z6TA 2BEOA 2O0YA 1KZHA 2NOJB 4Y15A 3F6OA 4DGWB 2QSGX 2UXNA 1R22A 2MH2A 2HZTA 2VOPA 1IN4A 1FWZA 2EIMH 2HKXA 2V26A 1SFEA 2VPRA 2CV1A 1S29A 5LGNA 2M5WA 2R7SA 3PFIA 2R7XA 4KDPA 3S3NA 3FBIB 3BP8A 4P96A 2HDCA 2IVMA 1Z9CA 2GQQA 2W82A 2M0MA 1ON1A 1MBFA 3MD2A 1SD5A 2E1OA 1BI2A 3GLLA 1MH4A 3ZQGA 3KP6A 2HQAA 3M3YJ 4ZJZA 1IN5A 3OYMA 3HSRA 2JA5J 2D5VA 2V9PA 4HX7A 1UHMA 4EGYA 1OR7A 2FQ4A 5KAFC 3M8FA 3ERMA 4HV5A 3S2WA 3WE3A 5LFAA 3I9V2 1SEUA 2N8GA 3VB2A 2VJ4A 3ML6A 3HPHA 4JBAA 1NTCA 5GAHJ 2HGCA 3GF2A 4MTEA 3CDHA 1EH7A 3PNTA 3HOUJ 2AS5F 4N4NB 1U5TB 1XDSA 1TL8A 5E3MA 3OSFA 2LYCA 5TGTA 1FMVA 5E8IA 2LBFB 3DEUA 4CCKA 2ECBA 3UR3C 1DUXC 3LSJA 3S17J 4AWXB 4X6AJ 3EETA 5ILVA 2E7XA 1Z91A 1S7OA 3HG9A 3E6MA 2DMTA 1H89C 2XGCA 3DEEA 3R6SA 1OLTA 4KISA 1X3WB 4KITB 1D0ZA 4Z6YA 1XC5A 5K7FA 4ASNA 3KP3A 4MHGA 5AIPA 4GO1A 3KYDB 4A3LJ 2EH3A 4UXNA 3S8PA 3HRMA 4QTRA 5C44J 1XSVA 3WG9A 1YI2I 3F9KA 1RUNA 2D45A 1HXDA 4S05A 1LFBA 3HKZA 4BH9A 4A3FJ 3TO9A 4IOAF 4K2EA 1IXCA 4W97A 2K5CA 4TV7A 4D7MA 1E0EA 1ZYRF 3I71A 1UJ8A 2XAFA 5L3GA 4B1RA 4OMYA 1FY7A 1Z1DA 2DA1A 2LKXA 3EYIA 1T95A 3QODA 4MEXF 1TNSA 1D3YA 1O57A 2XPVA 3ZGKA 2EZKA 1LB2A 2L9RA 2QM3A 1W7PA 1T98A 4YFNF 1XN7A 4L9VA 1JGSA 3FKJA 4PFPA 3ZRGA 2F4MB 3U21A 2I5UA 1PUFB 1IDYA 1OCOH 4L0YB 5E17F 3OS2A 5D5UB 4U87A 1GVDA 2M87A 3IKTA 4M73A 2R5ZA 5J8CA 2X6WA 2XC7A 1U8RA 3TOAA 3DU5A 1BJZA 5M3FJ 4OIRF 3JTGA 4A0YA 1T39A 1ETWA 5D4RA 1FX7A 1Z0XA 1EKEA 4OWRB 2Z1DA 1GXQA 3BT9A 3IRQA 3KEQA 4PK4A 2L9VA 2BZTA 2A6TA 4RAFA 1G8XA 4KT5C 4G8XA 2JA7J 2L4AA 2QQBA 2V4JC 3QPHA 5IY5H 3L2WA 1JE8A 1PJRA 1E3HA 1ACIA 1X1DA 2PN6A 5TISC 1FT9A 2J5PA 3GFIA 1A35A 3LA2A 4BDYA 3OV8A 2P5VA 5E1WA 1MZBA 3GTJJ 1MSFC 1OMIA 1L3LA 3BR5A 1XPXA 3CF5F 2V1NA 4MGRA 2XB0X 2CU7A 5K1YA 1R58A 4MFEA 2LRDA 3M07A 3LNQA 4HF2A 3KFWX 2GXAA 4G6TB 2VJIA 4QIWN 2EZIA 3FK6A 2FRHA 4NC7A 2L3DA 5LRSA 3A0BC 4DYRA 2HOTA 1S6LA 2F5FA 5ICCA 4XLAA 4X0GA 5FFZA 3JSOA 2XB5A 2B9SA 3GMEA 1QQIA 3HKZN 1Z05A 1A5JA 3WHCA 3ASNH 2MW8A 2PMUA 4V2FA 2LY9A 3ZPLA 4ETSA 3GLXA 1YX5A 1BI3A 3JRIA 2KRHA 1LNWA 1LEAA 2W00A 4E70A 2H1KA 4P55A 2V9VA 3HJEA 4RDUA 2R4GA 1C0WA 1G2HA 5JI6A 3T0YA 1X58A 3U1KA 4F93B 2I8DA 2BGCA 2V7FA 2Y69H 5H6RA 5EGOB 4ESFA 1MMSA 5CYVA 3CUQA 2R0QC 3JAMZ 4DNCA 4FCYA 3WTZA 1T33A 2M8EA 1Z67A 4OIQF 3B6AA 2L01A 3MZ8A 4RGUA 2JQ7A 2K4JA 1DDNA 4WCGA 3WTXC 2A6EF 1DGRM 1Y0UA 1TC3C 3J81Z 3P9KA 2L7MP 4G12A 1VTNC 1LE8B 3AL0C 2LREA 4CA0A 2XASA 1MJAA 2EIJH 1D8KA 2ZXJA 5JFRA 2WA0A 1OCPA 5EZHA 3M4OJ 2ESNA 1Y1WJ 1B6AA 3SFIA 3ZMDA 1ZR4A 4V2GA 3ASOH 4CCMA 3H9GA 5HDKA 2FBIA 2QVOA 2XF6A 4NBQA 1QVUA 4BGDA 3CCMI 3DQVC 2FE3A 5ICFA 5J40A 4MTDA 1TWAJ 2DTZA 2HWVA 2JN6A 1FOWA 1I39A 5F08A 3MKWB 1REPC 1BIBA 2COMA 3J7AO 4E4HA 4JYKA 3AG1H 3CUQB 3G1LA 3MEXA 1JKQC 2EV5A 2KZVA 3E6DA 4II3A 5HODA 3ABUA 3K2AA 1X2NA 5ILUA 1WI3A 2VODA 4WXCA 2KJBA 5B5EC 1S8NA 1UCRA 3J80Z 1HBXG 2R3SA 4ZTFA 1IUYA 1HDPA 4HX8A 4AUXA 4IRIA 1QPMA 2FSWA 2FX0A 3W6JB 4Y13A 1MMAA 1VQLI 5DUKA 2K3PA 3CCEI 4GRIA 5FRNA 2E2IJ 2O7OA 5FLVA 2UV1A 1MMDA 4AVZA 3FXOA 2EINH 2FMYA 2CG4A 2VQLA 4IL6C 3QP5A 3CCQI 2A5YB 4C2MJ 3OIOA 3Q5FA 1W7PD 3FWEA 3G71I 1LVAA 2X51A 2CQXA 3MMYB 2DA6A 2CW0F 2K9NA 5CQGA 2L54A 1SMTA 3MN2A 4ZTJA 3K4BA 3Q0WA 4Y3OA 1FBUA 2NYXA 2OQRA 2QWWA 2OUMA 2KQRA 2PG4A 5HS7A 4KMFA 3BR2A 3FKIJ 3BTJA 1YJWI 3C2BA 2Y75A 3CDIA 4FX4A 3CP8A 3HRTA 4IOCF 4HQMA 4DW6A 2NXNB 1V4RA 3KE2A 1X2MA 5EEGA 3OL3A 2IGMA 2VQGA 3IH4A 1U5TC 2L7KA 3KYLA 5J4YA 2QCOA 2MLGA 5L3EA 3PSFA 4B44A 2ZMEA 4UV8A 4U7BA 1GUUA 2AXTC 3JCUC 2VPLA 1Y6IA 2VE9A 1XCVA 2CW7A 3RDIA 3KLOA 2DJNA 2LC2A 2CFXA 1SFUA 2GA1A 2KKOA 3PQJA 2Z3YA 1D1AA 5D8KB 1NH3A 4LG0B 2V1XA 4E6KG 2DOEA 3FMRA 1BJAA 3WG7H 1VZ0A 1MNMC 1P4WA 2ADUA 2VIXA 2EJRA 2WADA 3WHBA 4PJJA 1VF9A 1IO2A 4RGRA 3OIQA 4M3GA 3I58A 4EVIA 2PJPA 2LLKA 2CUJA 3QPTA 1YTYA 4PZJA 1KQ9A 3BJOA 2RQQA 1V5GA 1WJCA 3K69A 5JLXA 1IW7F 2ZO4A 3K7AJ 4I6ZA 2QSHX 3H5NA 1W0UA 5E1ZB 1X4PA 3JR9A 1OR7C 2ID3A 2XV4S 4MQVA 3W2WA 5HNHA 1TLHB 5J1UA 1OYIA 2LFBA 3E5XA 5LHIA 4LB5A 3D5RC 4PJLA 1VQPI 4ZC3A 2A05A 5CVIA 4KUMA 2DA5A 1BW5A 2ZMEB 2IRFG 4L0ZB 4DJAA 4ZYDA 2A5WA 1BR2A 3L00A 2HYFA 4BYYA 1TWCJ 2DFFA 3V7CA 1SFXA 1O3RA 1L0OC 1HKTA 1J9IA 4KN7X 3FM3A 5CPRB 1ZARA 1WSUA 1KQ0A 2EA4A 3A02A 1WVRA 2JPBA 4KFCA 3GTMJ 1IAWA 3NQOA 2M9HA 2DT5A 2ZNYA 2BHYA 3A0HC 2Q1ZB 3C7JA 5HDNA 3Q9SA 1E3PA 1RKWA 2O3FA 5LGUA 1I50J 3MZYA 2F2EA 2KL4A 2ZXWH 1T0FA 1S3JA 5FLXK 1S7AA 4LK1F 4E7KA 1ITYA 1ZRCA 2QLZA 5LRRA 3A01B 3TO7A 1VNDA 2E2JJ 2DYRH 2HTJA 2QKLB 4EEFG 3GXOA 5JVGF 3BWGA 5D5WB 3KZIC 4RA2A 1YS6A 2KPMA 1AKHB 3ULQB 5J4VA 2UUZA 3A4CA 2G7UA 4GDFA 1B9NA 1BC7C 2BVMA 1WQ2A 2BW3A 1STZA 4ZDOA 5J1RA 2DI3A 3B73A 1Z7UA 1MBEA 4BHBA 1IZ1A 4C3IJ 3S32A 5K5OA 1IRZA 1LFPA 2DOAA 3NWSA 3RKQA 3CCJI 3CC4I 4MIMA 2VXDA 1WCMJ 3EQLF 5FGMA 2Y0SN 3F8MA 4M3EA 1OPCA 3T8TA 2DAOA 4HLYA 4HNUA 3KP4A 1U9OA 1U9NA 1JUPA 1WH5A 3E0JB 4XR6A 3WGHA 4XRSG 1PDNC 4RMNA 3LSHA 4A5MA 1FJLA 4ITVA 4XSXF 4I02A 3P5JA 1GT0C 3ZMVA 2HEOA 2JSPA 4DIQA 4ESBA 2X6OA 1ZGAA 2FNPA 4D0PA 2W4SA 3OS0A 2WB1A 1K78A 1XGMA 2QZ8A 4G7OF 3EYYA 1FYLA 4RGSA 1JUSA 1VQ6I 3ZOBA 4BS9A 1DP3A 2KJCA 3PNVA 3W2AA 1ZH5A 3GFJA 5FD5A 1WI9A 5LEJA 4BL0B 1CF7A 4XOTA 4PSWA 5GPCA 4IQ4A 2B63J 2XAUA 4M6XA 4HRIA 1EA3A 2DA7A 4RLQA 2KMUA 5D6FA 1N77A 2ISZA 3K1NA 2P0WA 2EWNA 3SYTA 3I59B 4LMYA 4C2TA 2Z33A 4B3AA 1Y56A 2GWRA 1MJBA 1YQAA 2V9KA 2ACJA 5H2FC 4LOCA 1MMGA 1HKQA 1NG6A 1YW7A 3H3VK 4LLNA 1BR4A 3BG5A 3HEFA 2IA1A 3Q0VA 2EQRA 1T56A 1EJ9A 5GADJ 3VOEA 3OL4A 4HX4A 4O6JA 3ZQHA 3CUQC 4B3XA 4XLEA 4WX9A 1IRGA 3EUHA 3K6GA 3REOA 2XGEA 2D1VA 2RNJA 1ON2A 2X0LA 1K78B 2O8KA 1E2XA 2G0EA 5BMZA 2QQ8A 4CUGA 2I10A 1LDDA 3KLNA 5IYDJ 3G1MA 3MKLA 2E34A 3H3ZA 4ENNA 1OCCH 3ISPA 4ENMA 1T8IA 3EDPA 5DDGA 3QYFA 3DPUA 4NDLA 2HR3A 2M4KA 1YOVB 2XIGA 3HOVJ 4L9NA 1U0JA 3TDUC 4L9JA 2RREA 3ZXSA 2JUGA 4HF0A 2IT0A 3O8GA 2CWEA 3G3ZA 3K1MA 5EDNA 4IEJA 3WODF 3NEUA 3BCAA 1WJAA 1W1WE 5D6EA 2WTEA 1XX5A 1R4NB 1O4XA 2DODA 4Q4ZF 1TWGJ 2WB1N 1YIOA 4E7ZA 1QVTA 3KEOA 1ZLJA 1SFOJ 3SZGA 3HBLA 2XAQA 5J6XA 3OYLA 2DBBA 1OCRH 2FMLA 1WJEA 1JI8A 2PFBA 1WFXA 2M0CA 2XKPA 4KN4X 1I3AA 5IYBJ 1KYZA 2R5YA 2NNNA 2DPUA 2OTJI 2NS7A 1EH8A 3ZMSA 4D5FA 3HOYJ 3V8KA 3AAFA 3B02A 3DF8A 5F27A 4CCNA 2WAEA 4CCOA 2QBYA 4F3QA 2IJLA 4HPQA 2MC3A 1HDDC 4RAGA 3HOSA 2LP0A 2HQNA 4KIFA 4A3GJ 2FBKA 3QWLA 3AL0B 1AA7A 1HW5A 1F36A 4A2UA 2KIMA 4R1HA 1IV6A 3LSRA 1IF1A 2STWA 3K2ZA 5EJCA 2IS2A 2STTA 1B8IB 2ZKZA 5HDGA 1VQ9I 3QU6A 3QPLA 5B3SH 4F92B 4HSRA 4NB5A 1Q1HA 4AIKA 3TP0A 1J0RA 2Z2SB 2EZHA 4JQFA 2AQFA 1MW7A 2GA2A 1IUFA 2ZMEC 3HSEA 3IWZA 4IO9F 1TWFJ 3QP6A 4C3HJ 1USSA 2HNHA 2O8XA 2M30A 1XTAA 1ZQ3P 3TQNA 1LFUP 1MDMA 3FF5A 1MD0A 2PQ8A 1YRNB 3OS1A 1J5YA 3RPUA 2CQQA 4C30A 2FXAA 4F52A 1PP7U 3CC2I 3F0CA 4GXOA 1G3SA 3RPQA 4BEHB 3I4PA 3VYRB 3ESWB 2FOKA 5EEAA 5KAIC 2UXXA 4A3IJ 1R9TJ 2E60A 4O3MA 1I6XA 4PFOA 4HF1A 3LSKA 4KMUX 2K9SA 2YS9A 3MFKA 2Q8KA 4JOMA 1XS9A 2CMPA 4IZZA 3CQZJ 2K86A 3CLQA 2CUEA 4XRSA 3C2HA 1V55H 3P9CA 3BOQA 3TL4X 4G9YA 2E1CA 3X2QH 4QSHA 4BAYA 1U78A 2VI6A 2K4BA 1U8BA 3O8HA 3IWFA 2W84A 3EUKL 3CO7C 1UZCA 1UHSA 3FXQA 4NC6A 1ETKA 3OYKA 4HOBA 2XKOA 2CUFA 2XAJA 1BBYA 2P6TA 1IGNA 4N4OB 5BPIA 1KGSA 2DYSH 4M74A 2DA2A 4CO8A 2QSFX 3JRAA 3RZDJ 2MBFA 5DD4A 4XRFA 5E1XA 3I5UA 2K02A 1RESA 2RQPA 3I4NJ 2PI0A 2ZJQF 1OCTC 1T6SA 4J01A 4E7LA 2IA2A 2ZSHB 3JW4A 3DTIA 3F21A 1YYVA 5E18F 2O6GE 4BY7J 2D1HA 1T0FC 2CRGA 2VE8A 2MYSA 3O6BB 4PJNA 3J7AY 3DP7A 3V4GA 1ZGJA 3CJRB 1FNNA 2HYJA 4UVCA 1XSDA 2V6CA 3O3KA 4XKCA 5L3FA 4B47A 2OU2A 3BTCA 3OWTA 2BY0A 4LD5A 3HUGA 2CQNA 2DLLA 4HBLA 5FRMA 2AXLA 4G7HF 3DEWA 2FD5A 1Q1VA 5A2QK 1LDKB 5E3NA 1QPIA 3DFGA 2NVQJ 3L2CA 5CLSA 4J00A 3FBNB 5D5VB 1I3QJ 2DMQA 2LKSA 2WAQA 5M5XJ 4XKVA 4MQ9F 2GIZA 1SC7A 4GFBA 2L7FP 2R7FA 5LHGA 4IHSA 1XGSA 2P4WA 2XAGA 3OYJA 3PJRA 5BNGA 2TCTA 3S15J 2KZGA 1P4AA 3DKXA 3HOWJ 3AG3H 2CV2A 1H88C 2PBIA 4ZDLA 4BXUA 3COAC 3HZJA 1FC3A 4YEJA 3BR1A 2VONA 4DOZA 4YELA 5EEHA 4AD9A 3CMAI 1DQUA 4RLFA 1TQPA 2X9DA 2Z16A 2LVSA 3OYIA 2K27A 1ETOA 1XSXA 2RN7A 3KP7A 2ICWG 2FUG2 1J75A 1V5FA 2JRTA 2TDXA 1AHDP 2TRTA 2DMPA 5DTDA 4RBOA 3HUGB 1LQ1A 1W7PB 3QRFF 1WHUA 2IEKA 5ED4A 1B59A 1RIOH 5E79C 4EJWA 2LD5A 1MBGA 2A3SA 3KZYA 4L9TA 2XVCA 3QPSA 4O5VA 3G1OA 2R5ZB 5F64A 2NRAC 4M9ZA 3W6VA 3DBRB 3OOUA 1MKMA 1KQ8A 1MSEC 4UB6C 1WJBA 4BE0A 1EH6A 3BJAA 2EFOA 1IV8A 1HLVA 3RPUD 2ZBKA 3HOTA 4AIJA 1W5CC 2XF5A 4H4KC 4IRHA 2DDAA 1FP1D 2RNGA 2AQEA 2X85A 3DWLE 4HA8A 2LK2A 4BKXA 4RB1A 1SD6A 3EUHC 3GZNB 3LSPA 3K1PA 2VLAA 4M3FA 2Y30A 2W24A 4BJ6C 3TW7A 4UHTA 5DM6F 2LG4A 2WAQN 1XD7A 4XKBA 2FQ3A 4M9SA 1JHFA 4RB3C 4AC0A 2DT6A
chains in the Genus database with same CATH topology
2DA5A 1BW5A 2DN0A 2M8GX 5FKLA 1FTZA 3HGGA 1TWCJ 2GM4A 3BTIA 5GPAA 1Y1VJ 1D5YA 2L0KA 2HDDA 1PUFA 5IP6A 4UUSB 2Y9YA 3PO3J 2P81A 5FKMA 2YU9J 3A02A 3FISA 5FLMJ 2EBIA 3FK7A 3GTMJ 4M6VA 2OF7A 4MFDA 2M9HA 1HOMA 2X48A 1NK2P 2MGQA 4JX6A 1RKWA 4A93J 2NOGA 2HXOA 5IP9J 3GTPJ 1I50J 4A3EJ 1B8IA 2AO9A 2WV1A 4XRMA 1ITYA 2DMUA 3A01B 4A3MJ 4L5EA 3L1PA 3ZQFA 1VNDA 2E2JJ 4EEFG 3BQYA 3HOZJ 2ECCA 5FKOA 1ENHA 1OFCX 1P7IA 4HNVA 2R93J 1AKHB 4A3BJ 4IHWA 3BQZA 1YRNA 1OJLA 5F0CA 5IYCJ 5J1RA 1JKOC 1IJWC 4CYCA 2EZLA 4A69C 1MBEA 4C3IJ 1IRZA 3JRCA 3RKQA 5IOYA 4MIMA 2DA4A 1WCMJ 1HF0A 2E19A 2Y0SN 5EYRA 1SANA 4M3EA 2DA3A 1UMQA 2CJJA 3TEDA 2O9LA 1U9OA 1U9NA 1JUPA 1WH5A 3PO2J 4XRSG 3IH3A 1FJLA 5EF6A 1GT0C 3PM1A 1MH3A 2X6OA 1JUMA 4DZJA 4DYQA 5EGOA 1RPWA 1JUSA 3ZOBA 4AYBN 1JTXA 3Q3SA 2W48A 1IDZA 4A3DJ 2DMNA 2M34A 1FEXA 5GPCA 4BBRJ 2B63J 2DA7A 1QRYA 3BTLA 2VPRA 3HDDA 2MG4A 1GDTA 4B3AA 3GTKJ 4CYCB 2KT0A 4Y52J 1LE8A 4BY1J 4LOCA 2KDZA 1JJ6C 1FTTA 3H3VK 1RR7A 1A6IA 3BG5A 3HEFA 1MBFA 3Q0VA 2EQRA 1T56A 2E1OA 3S1NJ 5EG0A 1MH4A 1VI0A 3ZQGA 5DS9A 3M3YJ 1WPKA 4M3BA 3ZQHA 2JA5J 2LTPA 1ZKGA 2RAEA 3JRDA 2D5VA 2ZB9A 5C4XJ 2FQ4A 2IBDA 2XGEA 1AU7A 1ZTRA 3D1NI 2N8GA 2O8KA 1NTCA 4S0HB 2G0EA 3HOUJ 2I10A 1GV2A 5IYDJ 3G1MA 3MKLA 2M2EA 2ME6A 4A3KJ 5E3MA 2LR8A 5E3OA 3OSFA 1DU6A 2ELKA 2XSDC 5FKNA 2Y9ZA 2ECBA 4XK4A 4NDLA 3LSJA 3S17J 3HOVJ 4X6AJ 1JT6A 2FJ1A 1JTYA 3UKGA 2JA6J 2DMTA 1H89C 3O8GA 2XGCA 5FKKA 4FTHA 5EDNA 4IEJA 2NVYJ 3SJMA 1XC5A 2XPUA 5K7FA 4A3JJ 2H8RA 1O4XA 1TWGJ 4BXXJ 2WB1N 3IH2A 4A3LJ 2EH3A 2JJ7A 4QTRA 5C44J 1QVTA 5C4JJ 3JRFA 3NARA 1LFBA 2AHQA 4X1EA 1SFOJ 4J19A 4A3FJ 1EF4A 3HBLA 1BW6A 3E7LA 4W97A 5EG0B 3JRHA 4D7MA 2M0CA 4B1RA 5IYBJ 2VUMJ 2DA1A 2R5YA 2LKXA 1ETQA 1JJ8C 3GTQJ 2NS7A 2XPVA 4D5FA 3HOYJ 3I4MJ 2EZKA 2VKEA 3A03A 2L9RA 5F27A 1BA5A 2R7ZJ 2E2HJ 4D7NA 1PUFB 1IDYA 1HDDC 3B6CA 4DZPA 2XRLA 2NVTJ 2LP0A 1GVDA 5J1YA 1ORKA 4A3GJ 1POGA 2PMZN 4FE7A 2R5ZA 3DCFA 3JRGA 1F36A 1IV6A 5M5WJ 3LSRA 1BJZA 5M3FJ 3SDGA 2GBYA 1K83J 1ETWA 2JMWA 1K61A 1Z0XA 1B8IB 3BT9A 4XIDA 1JKRC 4BBSJ 3QPLA 3JREA 2HI3A 2ME0A 2QF7A 2MSYA 2JA7J 3IV5A 3FIWA 3TP0A 2EZHA 4B4CA 3GTOJ 3GTJJ 1MSFC 5M5YJ 1IUFA 3BR5A 1TWFJ 4I76A 2CU7A 2XB0X 4C3HJ 4MFEA 1ZQ3P 2L7ZA 3LNQA 1LFUP 2JWTA 3TW6A 1YRNB 4QIWN 1MBJA 2EZIA 2XGDA 2CQQA 3FK6A 3ZQIA 1Z77A 4DYRA 3F0CA 2HOTA 3S1MJ 4A3CJ 3ZQCA 1ZK8A 4C3JJ 3H0GJ 1JGGA 5EEAA 3BG9A 2XB5A 4UUSA 4A3IJ 5M3MJ 1R9TJ 3HKZN 1A5JA 3WHCA 2MW8A 5K7ZA 4V2FA 1NK3P 2XPWA 2LY9A 4JX5A 2K9SA 2YS9A 3JRIA 3GTGJ 1XG1A 1P7JA 1RKTA 1XS9A 2HXIA 2H1KA 3GTLJ 4MLOA 3S14J 4RDUA 1S7EA 5EZGA 3CQZJ 1G2HA 4D5CA 2CUEA 1BL0A 1FIPA 1X58A 3BR0A 4XRSA 5EGOB 4QSHA 2R0QC 2NS8A 3RQIA 5F1JA 2JK3A 2VI6A 3A01A 1U78A 1APLC 1U8BA 3O8HA 4FCYA 4FISA 3BR6A 1T33A 1MBKA 1UHSA 1ETKA 3BR3A 3B6AA 2CUFA 1AKHA 1GV5A 1IGNA 1HCRA 5J3LA 1TC3C 5IPAA 2DA2A 2L7MP 3JRAA 4G12A 3RZDJ 2VKVA 1LE8B 3S1RJ 3BG3A 1B72A 4W1UA 1RESA 3I4NJ 1OCTC 1OCPA 5EZHA 4BY7J 3M4OJ 3GBGA 5C3EJ 1Y1WJ 3SFIA 2CRGA 1ZR4A 4V2GA 1UG2A 1QVUA 2HYJA 1ZGWA 1TWAJ 2DTZA 2JN6A 1JT0A 3BTCA 5F08A 3RZOJ 9ANTA 3TP3A 3NAUA 4DYCA 4JYKA 2OPTA 3G1LA 3Q0UA 1JKQC 2JA8J 1I6HJ 5F0HA 5HODA 3LSGA 2HOSA 3DEWA 2FD5A 1Q1VA 3HGYA 3K2AA 2K40A 5E3NA 1MBHA 1X2NA 1WI3A 1QPIA 2NVQJ 4Y7NJ 4JP0A 5E3LA 1I3QJ 1HDPA 2DMQA 4MO7A 4AUXA 5JLWA 2NVXJ 5M5XJ 2FX0A 3ZQLA 4GFBA 2L7FP 1ETXA 1JKPC 4M3DA 3CMYA 2E2IJ 2O7OA 2TCTA 5BNGA 5FLVA 2Y2ZA 3S15J 2ID6A 3HOWJ 3VPRA 5F04A 1CQTA 1H88C 4IHYA 1B72B 4C2MJ 3OIOA 4UUTA 3HB9A 4IHVA 2CQXA 2DA6A 3BR1A 2K9NA 3MN2A 1F43A 3Q0WA 5GP9A 3LOCA 2HQ5A 3JRBA 3BR2A 3FKIJ 3BTJA 2X9DA 3C2BA 2LVSA 1ETOA 2Y31A 4DW6A 1FIAA 1WGXA 1X2MA 2R5YB 2K9QA 2IAIA 4ABZA 1AHDP 2TRTA 2DMPA 3IH4A 5DTDA 4RBOA 2QCOA 4IHXA 5IP7J 1GUUA 1ETYA 3OSGA 4JX4A 2DJNA 2IEKA 5IOZA 2GLOA 2YUSA 2LD5A 1MBGA 2R92J 3QPSA 3G1OA 2R5ZB 4FE4A 3CDLA 5FJ8J 3W6VA 1MNMC 3OOUA 3S1QJ 3WHBA 3CCYA 1MSEC 1VF9A 3MVPA 1WH7A 1W0TA 1E3OC 4M3GA 1IC8A 1HLVA 2LLKA 3S2HJ 3HOXJ 1RETA 2LK2A 4BKXA 3S2DJ 1ETVA 1TWHJ 5JLXA 3K7AJ 4I6ZA 1H8AC 1DU0A 1W0UA 2HOAA 3JR9A 3LSPA 2ID3A 3HM5A 3QQAA 4M3FA 2Y30A 1IG7A 5J1UA 1ZR2A 3S16J 3TW7A 4XICA 5K7HA 2COBA 2WAQN 2LFBA 1VFCA 5F0FA 4AC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA5 A;  1BW5 A;  2DN0 A;  2M8G X;  5FKL A;  1FTZ A;  3HGG A;  1TWC J;  2GM4 A;  3BTI A;  5GPA A;  1Y1V J;  1D5Y A;  2L0K A;  2HDD A;  1PUF A;  5IP6 A;  4UUS B;  2Y9Y A;  3PO3 J;  2P81 A;  5FKM A;  2YU9 J;  3A02 A;  3FIS A;  5FLM J;  2EBI A;  3FK7 A;  3GTM J;  4M6V A;  2OF7 A;  4MFD A;  2M9H A;  1HOM A;  2X48 A;  1NK2 P;  2MGQ A;  4JX6 A;  1RKW A;  4A93 J;  2NOG A;  2HXO A;  5IP9 J;  3GTP J;  1I50 J;  4A3E J;  1B8I A;  2AO9 A;  2WV1 A;  4XRM A;  1ITY A;  2DMU A;  3A01 B;  4A3M J;  4L5E A;  3L1P A;  3ZQF A;  1VND A;  2E2J J;  4EEF G;  3BQY A;  3HOZ J;  2ECC A;  5FKO A;  1ENH A;  1OFC X;  1P7I A;  4HNV A;  2R93 J;  1AKH B;  4A3B J;  4IHW A;  3BQZ A;  1YRN A;  1OJL A;  5F0C A;  5IYC J;  5J1R A;  1JKO C;  1IJW C;  4CYC A;  2EZL A;  4A69 C;  1MBE A;  4C3I J;  1IRZ A;  3JRC A;  3RKQ A;  5IOY A;  4MIM A;  2DA4 A;  1WCM J;  1HF0 A;  2E19 A;  2Y0S N;  5EYR A;  1SAN A;  4M3E A;  2DA3 A;  1UMQ A;  2CJJ A;  3TED A;  2O9L A;  1U9O A;  1U9N A;  1JUP A;  1WH5 A;  3PO2 J;  4XRS G;  3IH3 A;  1FJL A;  5EF6 A;  1GT0 C;  3PM1 A;  1MH3 A;  2X6O A;  1JUM A;  4DZJ A;  4DYQ A;  5EGO A;  1RPW A;  1JUS A;  3ZOB A;  4AYB N;  1JTX A;  3Q3S A;  2W48 A;  1IDZ A;  4A3D J;  2DMN A;  2M34 A;  1FEX A;  5GPC A;  4BBR J;  2B63 J;  2DA7 A;  1QRY A;  3BTL A;  2VPR A;  3HDD A;  2MG4 A;  1GDT A;  4B3A A;  3GTK J;  4CYC B;  2KT0 A;  4Y52 J;  1LE8 A;  4BY1 J;  4LOC A;  2KDZ A;  1JJ6 C;  1FTT A;  3H3V K;  1RR7 A;  1A6I A;  3BG5 A;  3HEF A;  1MBF A;  3Q0V A;  2EQR A;  1T56 A;  2E1O A;  3S1N J;  5EG0 A;  1MH4 A;  1VI0 A;  3ZQG A;  5DS9 A;  3M3Y J;  1WPK A;  4M3B A;  3ZQH A;  2JA5 J;  2LTP A;  1ZKG A;  2RAE A;  3JRD A;  2D5V A;  2ZB9 A;  5C4X J;  2FQ4 A;  2IBD A;  2XGE A;  1AU7 A;  1ZTR A;  3D1N I;  2N8G A;  2O8K A;  1NTC A;  4S0H B;  2G0E A;  3HOU J;  2I10 A;  1GV2 A;  5IYD J;  3G1M A;  3MKL A;  2M2E A;  2ME6 A;  4A3K J;  5E3M A;  2LR8 A;  5E3O A;  3OSF A;  1DU6 A;  2ELK A;  2XSD C;  5FKN A;  2Y9Z A;  2ECB A;  4XK4 A;  4NDL A;  3LSJ A;  3S17 J;  3HOV J;  4X6A J;  1JT6 A;  2FJ1 A;  1JTY A;  3UKG A;  2JA6 J;  2DMT A;  1H89 C;  3O8G A;  2XGC A;  5FKK A;  4FTH A;  5EDN A;  4IEJ A;  2NVY J;  3SJM A;  1XC5 A;  2XPU A;  5K7F A;  4A3J J;  2H8R A;  1O4X A;  1TWG J;  4BXX J;  2WB1 N;  3IH2 A;  4A3L J;  2EH3 A;  2JJ7 A;  4QTR A;  5C44 J;  1QVT A;  5C4J J;  3JRF A;  3NAR A;  1LFB A;  2AHQ A;  4X1E A;  1SFO J;  4J19 A;  4A3F J;  1EF4 A;  3HBL A;  1BW6 A;  3E7L A;  4W97 A;  5EG0 B;  3JRH A;  4D7M A;  2M0C A;  4B1R A;  5IYB J;  2VUM J;  2DA1 A;  2R5Y A;  2LKX A;  1ETQ A;  1JJ8 C;  3GTQ J;  2NS7 A;  2XPV A;  4D5F A;  3HOY J;  3I4M J;  2EZK A;  2VKE A;  3A03 A;  2L9R A;  5F27 A;  1BA5 A;  2R7Z J;  2E2H J;  4D7N A;  1PUF B;  1IDY A;  1HDD C;  3B6C A;  4DZP A;  2XRL A;  2NVT J;  2LP0 A;  1GVD A;  5J1Y A;  1ORK A;  4A3G J;  1POG A;  2PMZ N;  4FE7 A;  2R5Z A;  3DCF A;  3JRG A;  1F36 A;  1IV6 A;  5M5W J;  3LSR A;  1BJZ A;  5M3F J;  3SDG A;  2GBY A;  1K83 J;  1ETW A;  2JMW A;  1K61 A;  1Z0X A;  1B8I B;  3BT9 A;  4XID A;  1JKR C;  4BBS J;  3QPL A;  3JRE A;  2HI3 A;  2ME0 A;  2QF7 A;  2MSY A;  2JA7 J;  3IV5 A;  3FIW A;  3TP0 A;  2EZH A;  4B4C A;  3GTO J;  3GTJ J;  1MSF C;  5M5Y J;  1IUF A;  3BR5 A;  1TWF J;  4I76 A;  2CU7 A;  2XB0 X;  4C3H J;  4MFE A;  1ZQ3 P;  2L7Z A;  3LNQ A;  1LFU P;  2JWT A;  3TW6 A;  1YRN B;  4QIW N;  1MBJ A;  2EZI A;  2XGD A;  2CQQ A;  3FK6 A;  3ZQI A;  1Z77 A;  4DYR A;  3F0C A;  2HOT A;  3S1M J;  4A3C J;  3ZQC A;  1ZK8 A;  4C3J J;  3H0G J;  1JGG A;  5EEA A;  3BG9 A;  2XB5 A;  4UUS A;  4A3I J;  5M3M J;  1R9T J;  3HKZ N;  1A5J A;  3WHC A;  2MW8 A;  5K7Z A;  4V2F A;  1NK3 P;  2XPW A;  2LY9 A;  4JX5 A;  2K9S A;  2YS9 A;  3JRI A;  3GTG J;  1XG1 A;  1P7J A;  1RKT A;  1XS9 A;  2HXI A;  2H1K A;  3GTL J;  4MLO A;  3S14 J;  4RDU A;  1S7E A;  5EZG A;  3CQZ J;  1G2H A;  4D5C A;  2CUE A;  1BL0 A;  1FIP A;  1X58 A;  3BR0 A;  4XRS A;  5EGO B;  4QSH A;  2R0Q C;  2NS8 A;  3RQI A;  5F1J A;  2JK3 A;  2VI6 A;  3A01 A;  1U78 A;  1APL C;  1U8B A;  3O8H A;  4FCY A;  4FIS A;  3BR6 A;  1T33 A;  1MBK A;  1UHS A;  1ETK A;  3BR3 A;  3B6A A;  2CUF A;  1AKH A;  1GV5 A;  1IGN A;  1HCR A;  5J3L A;  1TC3 C;  5IPA A;  2DA2 A;  2L7M P;  3JRA A;  4G12 A;  3RZD J;  2VKV A;  1LE8 B;  3S1R J;  3BG3 A;  1B72 A;  4W1U A;  1RES A;  3I4N J;  1OCT C;  1OCP A;  5EZH A;  4BY7 J;  3M4O J;  3GBG A;  5C3E J;  1Y1W J;  3SFI A;  2CRG A;  1ZR4 A;  4V2G A;  1UG2 A;  1QVU A;  2HYJ A;  1ZGW A;  1TWA J;  2DTZ A;  2JN6 A;  1JT0 A;  3BTC A;  5F08 A;  3RZO J;  9ANT A;  3TP3 A;  3NAU A;  4DYC A;  4JYK A;  2OPT A;  3G1L A;  3Q0U A;  1JKQ C;  2JA8 J;  1I6H J;  5F0H A;  5HOD A;  3LSG A;  2HOS A;  3DEW A;  2FD5 A;  1Q1V A;  3HGY A;  3K2A A;  2K40 A;  5E3N A;  1MBH A;  1X2N A;  1WI3 A;  1QPI A;  2NVQ J;  4Y7N J;  4JP0 A;  5E3L A;  1I3Q J;  1HDP A;  2DMQ A;  4MO7 A;  4AUX A;  5JLW A;  2NVX J;  5M5X J;  2FX0 A;  3ZQL A;  4GFB A;  2L7F P;  1ETX A;  1JKP C;  4M3D A;  3CMY A;  2E2I J;  2O7O A;  2TCT A;  5BNG A;  5FLV A;  2Y2Z A;  3S15 J;  2ID6 A;  3HOW J;  3VPR A;  5F04 A;  1CQT A;  1H88 C;  4IHY A;  1B72 B;  4C2M J;  3OIO A;  4UUT A;  3HB9 A;  4IHV A;  2CQX A;  2DA6 A;  3BR1 A;  2K9N A;  3MN2 A;  1F43 A;  3Q0W A;  5GP9 A;  3LOC A;  2HQ5 A;  3JRB A;  3BR2 A;  3FKI J;  3BTJ A;  2X9D A;  3C2B A;  2LVS A;  1ETO A;  2Y31 A;  4DW6 A;  1FIA A;  1WGX A;  1X2M A;  2R5Y B;  2K9Q A;  2IAI A;  4ABZ A;  1AHD P;  2TRT A;  2DMP A;  3IH4 A;  5DTD A;  4RBO A;  2QCO A;  4IHX A;  5IP7 J;  1GUU A;  1ETY A;  3OSG A;  4JX4 A;  2DJN A;  2IEK A;  5IOZ A;  2GLO A;  2YUS A;  2LD5 A;  1MBG A;  2R92 J;  3QPS A;  3G1O A;  2R5Z B;  4FE4 A;  3CDL A;  5FJ8 J;  3W6V A;  1MNM C;  3OOU A;  3S1Q J;  3WHB A;  3CCY A;  1MSE C;  1VF9 A;  3MVP A;  1WH7 A;  1W0T A;  1E3O C;  4M3G A;  1IC8 A;  1HLV A;  2LLK A;  3S2H J;  3HOX J;  1RET A;  2LK2 A;  4BKX A;  3S2D J;  1ETV A;  1TWH J;  5JLX A;  3K7A J;  4I6Z A;  1H8A C;  1DU0 A;  1W0U A;  2HOA A;  3JR9 A;  3LSP A;  2ID3 A;  3HM5 A;  3QQA A;  4M3F A;  2Y30 A;  1IG7 A;  5J1U A;  1ZR2 A;  3S16 J;  3TW7 A;  4XIC A;  5K7H A;  2COB A;  2WAQ N;  2LFB A;  1VFC A;  5F0F A;  4AC0 A; 
#chains in the Genus database with same CATH topology
 3V42 A;  3ZMT A;  3F8C A;  3K0L A;  1VQN I;  3HGG A;  3ONQ A;  3HL2 A;  1SVL A;  3FX3 A;  4KIB A;  2P7V B;  3H35 A;  2GM4 A;  3GFM A;  1UB9 A;  2DT7 B;  2HS5 A;  5DYM A;  4AYB A;  2XHK A;  1YHQ I;  1D5Y A;  2E1N A;  1YJ9 I;  4I7H A;  5IP6 A;  2IGN A;  5FLM J;  2EBI A;  4PJM A;  3FK7 A;  3GEZ A;  4RM2 A;  1ZRD A;  5KNL A;  4M6V A;  2DK5 A;  4MFD A;  2RKH A;  2KIQ A;  1YIJ I;  1SAU A;  1NK2 P;  3G2B A;  1ULY A;  5TJJ A;  1U6G A;  2FU4 A;  2MGQ A;  3BG6 A;  3H5A A;  2GXB A;  2DW4 A;  2V1D A;  3VSL A;  2ETH A;  2WV1 A;  2ZJ2 A;  1TBX A;  4E7H A;  1YW8 A;  4LK0 F;  4G6D A;  4LFU A;  1TQM A;  1XMA A;  2E35 A;  4A3M J;  4L5E A;  4I01 A;  3V8L A;  4BNC A;  1DPU A;  3HHH A;  3C18 A;  3L2V A;  1SVO A;  2ZFU A;  3BQY A;  3NRV A;  4S04 A;  1SAX A;  2NAZ A;  4ZZL A;  2ECC A;  3HRS A;  5FKO A;  1ENH A;  3GO5 A;  4L5J A;  2R7V A;  4OAZ A;  3VEP A;  1WJ5 A;  2IS1 A;  1D8J A;  1YW9 A;  4IHW A;  3BQZ A;  4GYI A;  2DQR A;  2VXZ A;  4XLF A;  2FF4 A;  5HLT A;  4A6D A;  4WXH A;  5IYC J;  5K5R A;  3FZV A;  3CJQ B;  2EZL A;  4A69 C;  1G4D A;  3CTA A;  2H8W A;  2X6Y A;  4ON0 A;  1IXR C;  2P8T A;  3RJP A;  1ODD A;  2P5K A;  1HF0 A;  2E19 A;  4RS8 A;  1BC8 C;  1XGO A;  3AFH A;  3EUA A;  5EYR A;  3RKX A;  2L02 A;  1QHG A;  3CO6 C;  3E6B A;  3MZH A;  3F23 A;  3S3O A;  3HTU A;  2BYV E;  3TED A;  5BOX A;  2OZ6 A;  2ISY A;  1WZ2 A;  1X1C A;  5DCM A;  2HYG D;  3OYE A;  1S9H A;  1JUM A;  1HA8 A;  2KDO A;  1RPW A;  2IP2 A;  1TT5 B;  4AYB N;  3Q3S A;  4HZF A;  1YLF A;  2CQK A;  3C1D A;  3L09 A;  2DU9 A;  3VYU B;  4ZZD A;  1IDZ A;  2M34 A;  4UV9 A;  4Q47 A;  4DBQ A;  1W5S A;  3WU1 B;  3KZZ A;  5IT9 K;  3JSP A;  3OR2 C;  3ZP5 A;  4UUV A;  5B1A H;  1FOX A;  1A04 A;  4IJA A;  1GDT A;  2LSO A;  3GTK J;  2KT0 A;  4ESJ A;  5LD2 C;  3OYH A;  4Y52 J;  2EV6 A;  3L2R A;  2VBY A;  1JJ6 C;  1FTT A;  4XKW A;  1RR7 A;  4FAS D;  3J7Y J;  1UG0 A;  3N05 A;  4LB6 B;  3M7G A;  4YG2 F;  3R4K A;  5KK1 A;  2BOL A;  2Y0S A;  4E7I A;  2PMZ A;  2VT2 A;  1RR8 C;  2W1O A;  1V5E A;  4BQQ A;  2XRN A;  5EG0 A;  4CH7 A;  3MKZ A;  5DS9 A;  1WPK A;  4M3B A;  3FXK A;  1ZKG A;  5DCM B;  2Z9O A;  3CCR I;  3K10 A;  1QZY A;  3OOP A;  4CZC A;  4II2 A;  2ZB9 A;  4KIC A;  1N75 A;  3IL2 A;  1AU7 A;  1ZTR A;  2B0L A;  2HQR A;  5FFX A;  1JXS A;  1VQO I;  1P2F A;  1N25 A;  1P92 A;  4P1W A;  2IXS A;  2L5Q A;  3KIO A;  4ENJ A;  2M2E A;  4A3K J;  5AON A;  5E3O A;  2HVS A;  1XGN A;  3WGI A;  3I56 I;  4BQO A;  2Y9Z A;  2IW5 A;  4XK4 A;  1LKX A;  2GXG A;  2G9W A;  4YII A;  4AIH A;  2FJ1 A;  3UKG A;  1JTY A;  2M7B A;  2JA6 J;  2K85 A;  4M71 A;  1YJN I;  4FTH A;  1UFM A;  2RVC A;  1QBJ A;  4U0W A;  2XPU A;  3TMO A;  3N4M A;  2H8R A;  3KPH A;  4BXX J;  3IH2 A;  3G73 A;  1X1A A;  2JJ7 A;  2VKD A;  1QZE A;  3KET A;  4KT6 A;  5C4J J;  3NAR A;  1H9G A;  1YX3 A;  3OR1 C;  2AHQ A;  4X1E A;  2F5D A;  1YFH A;  1KU7 A;  4J19 A;  1ZRE A;  4Z2Y A;  5EG0 B;  3JRH A;  4OIP F;  1K6O A;  2WV0 A;  1FMW A;  2YX4 A;  2LDU A;  2XSJ C;  3R0A A;  4PCQ A;  4NNJ A;  2VUM J;  2LKP A;  3SQN A;  4A0X A;  3BC8 A;  3GTQ J;  4HEA 2;  3DBL B;  1IN6 A;  3U1D A;  3I4M J;  3A03 A;  3LQR A;  1G3Y A;  2DQL A;  3BPX A;  3DTE A;  4CHU A;  2BY2 A;  4FET A;  1BA5 A;  3H9J A;  1R1T A;  5D5X B;  2JPC A;  2Q0O A;  2OD5 A;  5HOO A;  4MNU A;  2JRM A;  1ZHF A;  3B6C A;  3CMM A;  4LG3 A;  4DZP A;  2XRL A;  3ELK A;  5CVV A;  1K7A A;  1FLI A;  3IAS 2;  5J1Y A;  1ORK A;  4G6Q A;  3HRU A;  1QGP A;  3SZP A;  4BAC A;  2PMZ N;  2EB7 A;  3ZR8 X;  3M8E A;  3DCF A;  4I0A A;  5GTI C;  3RCO A;  1OIS A;  2VQH A;  4ZH4 F;  2GBY A;  2PJR A;  2JMW A;  2X1E A;  5HVQ C;  2IS6 A;  3WTU C;  3AG2 H;  4YIR X;  1JKR C;  3F72 A;  3JRE A;  3OYD A;  2HI3 A;  5FLX Z;  2JZY A;  1ZRF A;  2ME0 A;  2QF7 A;  3RKY A;  3DTK A;  1A6Q A;  1VQ4 I;  1R1U A;  2ELJ A;  3IV5 A;  2R7W A;  1G6N A;  3FIW A;  4IXA A;  5FRO A;  1R71 A;  4B4C A;  2L4M A;  3OYA A;  5M5Y J;  2Q2E A;  2L9S A;  1QNT A;  4EGZ A;  2OA4 A;  3LAP A;  4HDU A;  2HKO A;  1K4S A;  3TW6 A;  1G59 A;  3OYN A;  2BW3 B;  2XGD A;  3SXY A;  1HQC A;  1P4X A;  4GYG A;  2O03 A;  5BPD A;  4P5O A;  4PUS A;  1Z21 A;  4DQ2 A;  1GLN A;  3S1M J;  4A3C J;  4XOR A;  5LHH A;  3H0G J;  4EJT A;  2VB6 A;  1LJ9 A;  1K79 A;  3KYC B;  3BG9 A;  4UUS A;  3CD6 I;  1R00 A;  1HST A;  4C9Y A;  1X1B A;  4JX5 A;  1HW1 A;  2MC4 A;  2VKH A;  4XNF A;  3GTG J;  1XG1 A;  2PJR B;  2OBP A;  4LIU A;  2HXI A;  3CCV I;  3I55 I;  3DLL F;  3GTL J;  3LL7 A;  4D9J A;  1ONV A;  3DU6 A;  4D5C A;  1I5Z A;  3BR0 A;  1IN8 A;  3K4L A;  2Z99 A;  3L9F A;  2YR2 A;  3IAM 2;  1LEB A;  4HST A;  2MD5 A;  3RQI A;  3Q9V A;  5F1J A;  3WE2 A;  1HKS A;  4AM3 A;  1MIJ A;  1CF7 B;  4FIS A;  1MBK A;  3QYE A;  4RM3 A;  4HQE A;  2EIK H;  3BR3 A;  4E7S A;  1J59 A;  3IC7 A;  1R4M B;  2FA5 A;  3RIR A;  2X1D A;  4HAM A;  1IXS B;  4RGX A;  3C2G A;  4XLP F;  1ZLK A;  1GV5 A;  4XMY A;  1HCR A;  2ZXI A;  2X1C A;  3VYT B;  3GUD A;  5J47 A;  3K4J A;  3GYH X;  2W25 A;  4HLX A;  2VKV A;  2BHZ A;  4XN3 A;  1A36 A;  3S1R J;  2IPQ X;  3BG3 A;  4HW0 A;  2QEN A;  2V79 A;  1FSE A;  3CZ6 A;  4W1U A;  3VWB A;  1WWX A;  4ZYG A;  3ECO A;  3SZT A;  3FM5 A;  5KVR A;  2OC6 A;  3E1S A;  4BUP A;  4RB0 A;  2DO7 A;  2CW8 A;  1FBQ A;  2Z5U A;  5C3E J;  2EFW A;  4EM1 A;  1UG2 A;  1RC9 A;  2K9M A;  1Y8Q B;  2XAH A;  3R0J A;  2VL8 A;  4I99 C;  1ZGW A;  3KP5 A;  4QPQ A;  1TW2 A;  1JT0 A;  4A6E A;  3RZO J;  2H09 A;  4B09 A;  1F4K A;  9ANT A;  3NAU A;  3QOP A;  2ZJP F;  2CQ7 A;  4FT8 A;  2OPT A;  2PX9 A;  2W85 A;  1ZG1 A;  3Q0U A;  4OAY A;  4LJZ F;  2JA8 J;  1I27 A;  3BLY A;  3K4M A;  3LSG A;  1FP2 A;  5JR3 A;  1P9Q C;  2K40 A;  1MBH A;  1J09 A;  3WGG A;  4YFX F;  4BQA A;  4RB2 C;  3LQQ A;  2LH9 A;  2VC0 A;  2OV7 A;  5HS8 A;  3UNG C;  2C6Y A;  1ETX A;  2EFQ A;  4M3D A;  1R5I D;  4ANJ A;  2ID6 A;  5HLI A;  3VPR A;  5F04 A;  4HDV A;  4IHY A;  2HFH A;  1W36 D;  1I1S A;  3WTV C;  4UY8 I;  2K3F A;  1F1Z A;  5BQT A;  4NQW A;  1R5H A;  1BM9 A;  3LMM A;  4E7J A;  4IHV A;  4BE1 A;  3L2Q A;  2WY8 Q;  3DPL C;  5GP9 A;  2G7H A;  3BCB A;  2HQ5 A;  3LOC A;  2XRO A;  3JRB A;  3RYP A;  1D0Y A;  3PFY A;  2B7E A;  2DCE A;  3IP4 B;  2FOW A;  5HS9 A;  2MFZ A;  4RAY A;  2R7T A;  3L2U A;  2Y31 A;  1MGT A;  2FBH A;  2H6B A;  2YX7 A;  3EPZ A;  4ZDP A;  4JK1 X;  2GIV A;  4Y17 A;  2OZU A;  2R5Y B;  4ABZ A;  4Q5S F;  4BHP A;  4IHX A;  4YIF A;  4Q48 A;  1VQK I;  5IP7 J;  2QBY B;  1ETY A;  2F4I A;  2F5C A;  5CKT A;  4OMZ A;  4U0V A;  2J5O A;  1UAA A;  5D8L B;  5IOZ A;  1QU3 A;  4BJ5 C;  5BS6 A;  1LPQ A;  1R49 A;  3O2P E;  1YG2 A;  4M72 A;  2LBF A;  2VOO A;  4CYD A;  3ZN1 A;  2XUB A;  4BQN A;  1YIT I;  2M45 A;  2WAF A;  3S1Q J;  5JHU A;  3CCL I;  5CJ9 A;  3VYS B;  3VFZ A;  3MVP A;  5DD8 A;  1W0T A;  1FYM A;  3BJ6 A;  4I09 A;  2HDW A;  2DFE A;  4XBF A;  3ZMZ A;  5ICE A;  2KIF A;  2A07 F;  3HHG A;  3OYB A;  4R8H A;  5LLQ A;  4NQW B;  3HOX J;  5FD6 A;  3LFU A;  3S93 A;  3VDX A;  1O3Q A;  2VBX A;  1TWH J;  1H8A C;  2PMH A;  2HOA A;  3BZC A;  3HM5 A;  3HYI A;  3T5X A;  3QQA A;  2HTS A;  1MMN A;  4YFK F;  1UEL B;  2BBY A;  1ZR2 A;  3S16 J;  2QYO A;  5K7H A;  2COB A;  3BG7 A;  3F8N A;  3NWT A;  2E1M C;  1MDM B;  3BZ6 A;  5E20 A;  5DCF A;  4QPO A;  5FKL A;  1K4T A;  2V6E A;  3G6E I;  2VJ5 A;  3BPV A;  3TO6 A;  4LIT A;  4PGH A;  2K7L A;  3BTI A;  1Y1V J;  2L0K A;  2HDD A;  3OMY A;  5DM7 F;  1PUF A;  4A0Z A;  5FKM A;  3BRO A;  2YU9 J;  1SMY F;  3FIS A;  3FMQ A;  3M1C A;  3T8R A;  4B48 A;  4IHT A;  4IRG A;  3FHZ A;  1PUE E;  4IVN A;  2QUF A;  4Y4R A;  5H6Q A;  2CFO A;  4EJO A;  5LBQ A;  2EFP A;  2VQC A;  1E17 A;  1RZ4 A;  2W7N A;  4A93 J;  4EV0 A;  1M1E B;  1MND A;  2NOG A;  4D1Q A;  2H27 A;  5IP9 J;  3FXM A;  2MLK A;  2AO9 A;  3A1Y A;  1O7L A;  4BDZ A;  1XDU A;  4IKF A;  3TKY A;  1GVJ A;  3ZQQ A;  4XN0 A;  3IUO A;  1TTY A;  3L1P A;  2KLO A;  4QLC U;  3CCS I;  5GTH C;  5HLG A;  3HOZ J;  1FOK A;  1W36 C;  1P7I A;  3ERE D;  1S5L C;  2RDP A;  2YPR A;  3KEY A;  4A3B J;  4CDG A;  1MNE A;  1X4O A;  5JVT A;  3OYF A;  3ZQ7 A;  1OJL A;  1SD4 A;  4XQF A;  1IJW C;  4CYC A;  1F5T A;  1EV7 A;  3RI4 A;  1QZZ A;  2DFI A;  2RV8 A;  4IQJ A;  1YS7 A;  3VOD A;  2BXZ A;  4AID A;  2F5E A;  1H9T A;  2DA4 A;  2P6S A;  5GAE J;  2P5L C;  3QU3 A;  3PSI A;  1Y8R B;  1SAN A;  4KIG A;  1B4A A;  4KA4 A;  1UMQ A;  4OIN F;  1W5T A;  2CJJ A;  2F6C A;  2A6H F;  2R7R A;  4HNT A;  5F1R A;  3PO2 J;  1J7K A;  2HPI A;  2VJJ A;  2M3A A;  1B9M A;  3QYB A;  3OY9 A;  3OYC A;  1MJ9 A;  1HC8 A;  5EF6 A;  3E5U A;  1KA8 A;  3D5L A;  4UVA A;  2QA4 I;  3ABM H;  1Z3Y A;  5EGO A;  3RSN A;  5A2Q Z;  3GVA A;  1JTX A;  2CO5 A;  3JAM K;  4UB8 C;  2W48 A;  2F48 A;  3P9I A;  1FZP B;  2DMN A;  4XL9 A;  4A3D J;  1D5V A;  1CGP A;  1FEX A;  1T38 A;  4BBR J;  2BY1 A;  3GCM A;  3R60 A;  4IF4 A;  1O3T A;  1QRY A;  3BTL A;  1DP7 P;  4KNY A;  3HDD A;  2MG4 A;  2VN2 A;  3LFK A;  3RTR A;  4P9F A;  4CIC A;  4CYC B;  3V7S A;  3J81 K;  2DDB A;  1SD7 A;  1LE8 A;  4BY1 J;  4HYE A;  2KDZ A;  1FSH A;  3H36 A;  1A6I A;  3DV8 A;  4CCJ A;  3S1N J;  4XLN F;  4KJZ A;  3DXJ F;  2EV0 A;  2R7D A;  4EJU A;  2FNA A;  5GAG J;  2HOE A;  1VI0 A;  1A31 A;  3H5R A;  2BXY A;  5KHD A;  1SVM A;  4V19 K;  2LTP A;  5CQE A;  2RAE A;  3JRD A;  1HW2 A;  4U7D A;  3FXU A;  3HPG A;  5C4X J;  1KU9 A;  2IBD A;  4R79 A;  3D1N I;  1GXP A;  4S0H B;  1BN5 A;  5LGT A;  3CJN A;  4LIV A;  2XDV A;  3PIP F;  2JVG A;  1GV2 A;  1R1V A;  2ME6 A;  5KCM A;  3E5Q A;  2LR8 A;  3F8F A;  4EMS A;  1DU6 A;  2ELK A;  4XON A;  2XSD C;  5FKN A;  2HVR A;  2DOF A;  1PVE A;  2D2W A;  3WTW C;  1KU2 A;  1QO0 D;  1TNT A;  2R7Q A;  2NS0 A;  3J80 K;  1TW3 A;  1TP4 A;  4CZZ A;  2CGP A;  1JT6 A;  3KP2 A;  3U2R A;  4OIO F;  2EA2 A;  2VC1 A;  2PEX A;  5CVJ A;  3GFL A;  4F55 A;  5FKK A;  5CVR A;  1XMX A;  2NVY J;  3LSI A;  2VBW A;  3TBI A;  3SJM A;  3F8B A;  1HSJ A;  2GZW A;  1O3S A;  1AWC A;  3N97 A;  4A3J J;  4NHJ A;  3M8J A;  3RKW A;  1ZAO A;  1RRJ A;  2H1L A;  1RNL A;  1BOB A;  1OYW A;  2E5Z A;  5AIQ A;  4AVP A;  3JRF A;  3DKW A;  4DBR A;  1VQ8 I;  4EM0 B;  2VT3 A;  1EF4 A;  1BW6 A;  3E7L A;  4EJV A;  2KRF A;  2MAB A;  4U0Y A;  5CVU A;  3BY6 A;  1U3E M;  3S3M A;  2JT1 A;  3LWF A;  1ETQ A;  1JJ8 C;  3RYR A;  2QKM B;  2L9N A;  4WWC A;  2Y48 A;  2VKE A;  2JUC A;  4CSW A;  2X6X A;  2R7Z J;  2CYY A;  2E2H J;  4D7N A;  5DEQ A;  3E97 A;  1IN7 A;  1BIA A;  3SFZ A;  3ZCO A;  2OTL I;  1X19 A;  2NVT J;  4LG0 A;  3ZMU A;  4EAT A;  4WXD A;  3LSM A;  1POG A;  3BZK A;  1WJD A;  2CUZ A;  4FE7 A;  4BU2 A;  1KYW A;  3JRG A;  3AKZ A;  5M5W J;  3ECH A;  2ZCW A;  1R6R A;  1DPR A;  2NVU B;  2BY3 A;  3K70 D;  3SDG A;  1K83 J;  1K61 A;  5B66 C;  1B1B A;  1QA6 A;  4XID A;  4BBS J;  2JTV A;  2H6C A;  5B1B H;  4B43 A;  3WU0 A;  5J8F A;  3H9Q A;  2F4O B;  2MSY A;  2OCC H;  3LA3 A;  2F5V A;  2ZC2 A;  1LDJ A;  2KP6 A;  2DJI A;  3T1B A;  2PLY A;  3PUF A;  3R61 A;  1TQI A;  2LF7 A;  3GTO J;  2EK5 A;  3DLA A;  2IS4 A;  5L3D A;  3HXL A;  4A12 A;  3SHF A;  4I76 A;  4CCL A;  2HZD A;  1OQY A;  3H0D A;  2L7Z A;  2CH0 A;  5L3B A;  5H20 A;  2ZXH A;  2JWT A;  2LF8 A;  2BV6 A;  1MBJ A;  2M4G A;  2V1U A;  4P9U A;  3ZQI A;  2OJE D;  2VBZ A;  1Z77 A;  3TGN A;  3SEZ A;  1D1C A;  4WK8 F;  5K5Q A;  2OCE A;  3G4S I;  2ZJR F;  2H94 A;  3ZQC A;  2WC2 A;  1ZK8 A;  4C3J J;  2WY7 Q;  5FB2 A;  1XMK A;  1JGG A;  4A5N A;  3F3X A;  4Y33 A;  5M3M J;  4FX0 A;  4ZYH A;  2DFH A;  5K7Z A;  1NK3 P;  1G3T A;  2XPW A;  1T08 B;  3FXL A;  1ZN2 A;  2KHM A;  4CXF A;  5ICG A;  1P7J A;  1RKT A;  2OQG A;  2GAU A;  4MLO A;  2JA2 A;  3S14 J;  1S7E A;  5EZG A;  1WKM A;  1BL0 A;  1FIP A;  4BXF A;  2UZK A;  1X1P A;  2R7O A;  3ABL H;  3LST A;  3J7Z I;  4XSZ F;  2NS8 A;  2JK3 A;  3A01 A;  1APL C;  1FOY A;  3ZN0 A;  3HC7 A;  3U9G A;  2KFD A;  1T2K A;  2FEZ A;  3TDZ C;  1X3U A;  3DBH B;  1KON A;  2WWY A;  3BR6 A;  1BI1 A;  2IA0 A;  3WU2 C;  5LEK A;  5IT9 Z;  4M6Y A;  5L3C A;  1AKH A;  4UNO A;  5J3L A;  2R7U A;  3MQ0 A;  5IPA A;  2MD0 A;  1Z6R A;  3DPT A;  3M1E A;  1U2W A;  4WF2 A;  3CME I;  1B72 A;  4OOI A;  2BVL A;  5ERI A;  4H0E A;  2ESH A;  3W6K B;  3ABT A;  1LUJ B;  3MAJ A;  3MWM A;  4BE2 A;  3GBG A;  4I98 B;  3IRR A;  4LLL A;  3PIO F;  1WJF A;  3IKV A;  3LAJ A;  1Z3X A;  1FYK A;  4MEY F;  3VSK A;  2ELH A;  2K9L A;  4CGZ A;  4UVB A;  3TP3 A;  3ABK H;  6PAX A;  4DYC A;  1J2X A;  3MKY B;  1I6H J;  5F0H A;  2HOS A;  3HGY A;  2E1M B;  1LVK A;  1R36 A;  4PGG A;  4QWQ A;  3WTY C;  4LGW A;  3K70 C;  3H92 A;  3SDB A;  5JHF A;  4Y7N J;  3RQ4 A;  4JP0 A;  5E3L A;  3A2K A;  1NG7 A;  2E36 A;  4MO7 A;  5JLW A;  2NVX J;  2KRC A;  2O5R A;  2EFN A;  4F91 B;  4L5I A;  4B8X A;  1G3W A;  2LNB A;  3ZQL A;  3I0T A;  2EIL H;  1P6R A;  4PDK A;  3CMY A;  1JKP C;  2Y2Z A;  2W57 A;  3I59 A;  4IPA A;  1CQT A;  4YRV A;  1B72 B;  4LLG F;  3FXR A;  3I64 A;  2QQA A;  1R7J A;  4UUT A;  3HB9 A;  3FXJ A;  3PNY A;  3JTH A;  2L2O A;  3CJT B;  1F43 A;  1PYV A;  2ZNZ A;  4OU0 A;  4HG2 A;  3I3L A;  5HNF A;  3L7W A;  2IGK A;  3GX4 X;  1WRJ A;  2YU3 A;  4XLC A;  1FIA A;  1WGX A;  2VAS A;  2K9Q A;  1YE9 A;  2IAI A;  3F6V A;  3K4C A;  2GOM A;  2JSC A;  1ZG5 A;  4I0B A;  2RGV A;  2JVH A;  2HU9 A;  4IX7 A;  2CS3 A;  1H0M A;  5TRD A;  1VQM I;  2XF7 A;  3OSG A;  1IRF A;  3WTT C;  4JX4 A;  5F6F A;  2GLO A;  2LY2 A;  2YUS A;  3C3W A;  2R92 J;  2A69 F;  3FHN A;  3HSF A;  4GGG A;  4FE4 A;  3CDL A;  5FJ8 J;  1Y39 A;  3WTS C;  1ERD A;  1YO5 C;  2LMD A;  3CCY A;  3HTS B;  2HVQ A;  4HV6 A;  4EQQ A;  1WH7 A;  1QHH D;  1PP8 F;  5FO5 A;  3K4N A;  1E3O C;  2NNY A;  3PL8 A;  1IC8 A;  4N9I A;  1RUO A;  1VQ7 I;  2A61 A;  3S2H J;  1SFK A;  1RET A;  2CV0 A;  3KCC A;  1W4M A;  3TOB A;  1I1G A;  2P7C B;  3S2D J;  1ETV A;  1NHA A;  1DU0 A;  2CSO A;  3I54 A;  4U88 A;  4ZYE A;  2BE5 F;  3BDD A;  3GWZ A;  4PJ0 C;  1O7F A;  1D1B A;  3OIP A;  1V54 H;  2ZFW A;  2Q2E B;  3DKY A;  1IG7 A;  4XLH A;  1IRX A;  4G94 A;  3D0S A;  2X4H A;  4ZYA A;  4XIC A;  2KIU A;  2LY1 A;  3CC7 I;  1VFC A;  5F0F A;  3D5S C;  4AU7 A;  2YSR A;  3F22 A;  2DN0 A;  2M8G X;  4GCV A;  3MCZ A;  1FTZ A;  3GW2 A;  3V7R A;  2XGX A;  1UHW A;  1GHC A;  3PUB A;  4I2O A;  3OYG A;  4L18 B;  4ENK A;  4PSX A;  5GPA A;  3V8J A;  5IT3 A;  4BJT A;  4UUS B;  2Y9Y A;  3PO3 J;  2O61 A;  2P81 A;  1R23 A;  5DV5 A;  1BR1 A;  3IHU A;  1R5G A;  3CP2 A;  3P7N A;  3LA7 A;  2OF7 A;  4RAZ A;  2A68 F;  2OAZ A;  1F9N A;  1ZG3 A;  2X48 A;  3K9T A;  1HOM A;  1DGW Y;  1FBS A;  4JX6 A;  1V3F A;  2IGO A;  2MA3 A;  2HXO A;  3GTP J;  4A3E J;  1B8I A;  3ROU A;  1AOY A;  3FDY A;  2QEX I;  1OCZ H;  4XRM A;  2M1B A;  2DMU A;  3M9A A;  1D0X A;  1VQ5 I;  3W3C A;  3QAH A;  4N0B A;  3ZQF A;  4BHC A;  2QGU A;  3CLO A;  2HPM A;  1OFC X;  2E5N A;  4XM3 A;  4HNV A;  2M7A A;  2ZSI B;  2R93 J;  3FMS A;  2MH9 A;  1TT0 A;  1KU3 A;  3AG4 H;  1BI0 A;  2GOX B;  5D4S A;  1UST A;  2DXI A;  3CF2 A;  1YRN A;  5F0C A;  4XOP A;  1JKO C;  3KX2 A;  1K6Y A;  2WBM A;  3H3U A;  4C2U A;  2DPD A;  4FHT A;  3CUO A;  1S72 I;  4NC8 A;  4BEH A;  5DUI A;  3K4K A;  1N78 A;  4F7Z A;  3PQK A;  3JRC A;  2QQ9 A;  3HIF A;  5E8G A;  1Z7L A;  5IOY A;  2UWM A;  5ILS A;  2Y0M A;  3E6C C;  1FPQ A;  2DA3 A;  1TZL A;  2E7W A;  4FQG A;  2DK8 A;  3GZ6 A;  1JHH A;  4NUB A;  2O9L A;  4EM2 A;  2RC4 A;  4M9X A;  3SEQ A;  3GZ5 A;  3IH3 A;  2EPF A;  1Y0N A;  2KIS A;  3E3V A;  1XCB A;  1OYY A;  2E71 A;  2LOO A;  3PM1 A;  4G7Z F;  1X3Z B;  4KYW A;  1MH3 A;  3QOE A;  3CCU I;  1BOA A;  2DTR A;  1XB4 A;  3CES A;  4DZJ A;  4DYQ A;  3H1C A;  4N9H A;  1ZEL A;  5HLH A;  3I53 A;  3W2V A;  1RI7 A;  1U5T A;  1OKR A;  1Z6T A;  2BEO A;  2O0Y A;  1KZH A;  2NOJ B;  4Y15 A;  3F6O A;  4DGW B;  2QSG X;  2UXN A;  1R22 A;  2MH2 A;  2HZT A;  2VOP A;  1IN4 A;  1FWZ A;  2EIM H;  2HKX A;  2V26 A;  1SFE A;  2VPR A;  2CV1 A;  1S29 A;  5LGN A;  2M5W A;  2R7S A;  3PFI A;  2R7X A;  4KDP A;  3S3N A;  3FBI B;  3BP8 A;  4P96 A;  2HDC A;  2IVM A;  1Z9C A;  2GQQ A;  2W82 A;  2M0M A;  1ON1 A;  1MBF A;  3MD2 A;  1SD5 A;  2E1O A;  1BI2 A;  3GLL A;  1MH4 A;  3ZQG A;  3KP6 A;  2HQA A;  3M3Y J;  4ZJZ A;  1IN5 A;  3OYM A;  3HSR A;  2JA5 J;  2D5V A;  2V9P A;  4HX7 A;  1UHM A;  4EGY A;  1OR7 A;  2FQ4 A;  5KAF C;  3M8F A;  3ERM A;  4HV5 A;  3S2W A;  3WE3 A;  5LFA A;  3I9V 2;  1SEU A;  2N8G A;  3VB2 A;  2VJ4 A;  3ML6 A;  3HPH A;  4JBA A;  1NTC A;  5GAH J;  2HGC A;  3GF2 A;  4MTE A;  3CDH A;  1EH7 A;  3PNT A;  3HOU J;  2AS5 F;  4N4N B;  1U5T B;  1XDS A;  1TL8 A;  5E3M A;  3OSF A;  2LYC A;  5TGT A;  1FMV A;  5E8I A;  2LBF B;  3DEU A;  4CCK A;  2ECB A;  3UR3 C;  1DUX C;  3LSJ A;  3S17 J;  4AWX B;  4X6A J;  3EET A;  5ILV A;  2E7X A;  1Z91 A;  1S7O A;  3HG9 A;  3E6M A;  2DMT A;  1H89 C;  2XGC A;  3DEE A;  3R6S A;  1OLT A;  4KIS A;  1X3W B;  4KIT B;  1D0Z A;  4Z6Y A;  1XC5 A;  5K7F A;  4ASN A;  3KP3 A;  4MHG A;  5AIP A;  4GO1 A;  3KYD B;  4A3L J;  2EH3 A;  4UXN A;  3S8P A;  3HRM A;  4QTR A;  5C44 J;  1XSV A;  3WG9 A;  1YI2 I;  3F9K A;  1RUN A;  2D45 A;  1HXD A;  4S05 A;  1LFB A;  3HKZ A;  4BH9 A;  4A3F J;  3TO9 A;  4IOA F;  4K2E A;  1IXC A;  4W97 A;  2K5C A;  4TV7 A;  4D7M A;  1E0E A;  1ZYR F;  3I71 A;  1UJ8 A;  2XAF A;  5L3G A;  4B1R A;  4OMY A;  1FY7 A;  1Z1D A;  2DA1 A;  2LKX A;  3EYI A;  1T95 A;  3QOD A;  4MEX F;  1TNS A;  1D3Y A;  1O57 A;  2XPV A;  3ZGK A;  2EZK A;  1LB2 A;  2L9R A;  2QM3 A;  1W7P A;  1T98 A;  4YFN F;  1XN7 A;  4L9V A;  1JGS A;  3FKJ A;  4PFP A;  3ZRG A;  2F4M B;  3U21 A;  2I5U A;  1PUF B;  1IDY A;  1OCO H;  4L0Y B;  5E17 F;  3OS2 A;  5D5U B;  4U87 A;  1GVD A;  2M87 A;  3IKT A;  4M73 A;  2R5Z A;  5J8C A;  2X6W A;  2XC7 A;  1U8R A;  3TOA A;  3DU5 A;  1BJZ A;  5M3F J;  4OIR F;  3JTG A;  4A0Y A;  1T39 A;  1ETW A;  5D4R A;  1FX7 A;  1Z0X A;  1EKE A;  4OWR B;  2Z1D A;  1GXQ A;  3BT9 A;  3IRQ A;  3KEQ A;  4PK4 A;  2L9V A;  2BZT A;  2A6T A;  4RAF A;  1G8X A;  4KT5 C;  4G8X A;  2JA7 J;  2L4A A;  2QQB A;  2V4J C;  3QPH A;  5IY5 H;  3L2W A;  1JE8 A;  1PJR A;  1E3H A;  1ACI A;  1X1D A;  2PN6 A;  5TIS C;  1FT9 A;  2J5P A;  3GFI A;  1A35 A;  3LA2 A;  4BDY A;  3OV8 A;  2P5V A;  5E1W A;  1MZB A;  3GTJ J;  1MSF C;  1OMI A;  1L3L A;  3BR5 A;  1XPX A;  3CF5 F;  2V1N A;  4MGR A;  2XB0 X;  2CU7 A;  5K1Y A;  1R58 A;  4MFE A;  2LRD A;  3M07 A;  3LNQ A;  4HF2 A;  3KFW X;  2GXA A;  4G6T B;  2VJI A;  4QIW N;  2EZI A;  3FK6 A;  2FRH A;  4NC7 A;  2L3D A;  5LRS A;  3A0B C;  4DYR A;  2HOT A;  1S6L A;  2F5F A;  5ICC A;  4XLA A;  4X0G A;  5FFZ A;  3JSO A;  2XB5 A;  2B9S A;  3GME A;  1QQI A;  3HKZ N;  1Z05 A;  1A5J A;  3WHC A;  3ASN H;  2MW8 A;  2PMU A;  4V2F A;  2LY9 A;  3ZPL A;  4ETS A;  3GLX A;  1YX5 A;  1BI3 A;  3JRI A;  2KRH A;  1LNW A;  1LEA A;  2W00 A;  4E70 A;  2H1K A;  4P55 A;  2V9V A;  3HJE A;  4RDU A;  2R4G A;  1C0W A;  1G2H A;  5JI6 A;  3T0Y A;  1X58 A;  3U1K A;  4F93 B;  2I8D A;  2BGC A;  2V7F A;  2Y69 H;  5H6R A;  5EGO B;  4ESF A;  1MMS A;  5CYV A;  3CUQ A;  2R0Q C;  3JAM Z;  4DNC A;  4FCY A;  3WTZ A;  1T33 A;  2M8E A;  1Z67 A;  4OIQ F;  3B6A A;  2L01 A;  3MZ8 A;  4RGU A;  2JQ7 A;  2K4J A;  1DDN A;  4WCG A;  3WTX C;  2A6E F;  1DGR M;  1Y0U A;  1TC3 C;  3J81 Z;  3P9K A;  2L7M P;  4G12 A;  1VTN C;  1LE8 B;  3AL0 C;  2LRE A;  4CA0 A;  2XAS A;  1MJA A;  2EIJ H;  1D8K A;  2ZXJ A;  5JFR A;  2WA0 A;  1OCP A;  5EZH A;  3M4O J;  2ESN A;  1Y1W J;  1B6A A;  3SFI A;  3ZMD A;  1ZR4 A;  4V2G A;  3ASO H;  4CCM A;  3H9G A;  5HDK A;  2FBI A;  2QVO A;  2XF6 A;  4NBQ A;  1QVU A;  4BGD A;  3CCM I;  3DQV C;  2FE3 A;  5ICF A;  5J40 A;  4MTD A;  1TWA J;  2DTZ A;  2HWV A;  2JN6 A;  1FOW A;  1I39 A;  5F08 A;  3MKW B;  1REP C;  1BIB A;  2COM A;  3J7A O;  4E4H A;  4JYK A;  3AG1 H;  3CUQ B;  3G1L A;  3MEX A;  1JKQ C;  2EV5 A;  2KZV A;  3E6D A;  4II3 A;  5HOD A;  3ABU A;  3K2A A;  1X2N A;  5ILU A;  1WI3 A;  2VOD A;  4WXC A;  2KJB A;  5B5E C;  1S8N A;  1UCR A;  3J80 Z;  1HBX G;  2R3S A;  4ZTF A;  1IUY A;  1HDP A;  4HX8 A;  4AUX A;  4IRI A;  1QPM A;  2FSW A;  2FX0 A;  3W6J B;  4Y13 A;  1MMA A;  1VQL I;  5DUK A;  2K3P A;  3CCE I;  4GRI A;  5FRN A;  2E2I J;  2O7O A;  5FLV A;  2UV1 A;  1MMD A;  4AVZ A;  3FXO A;  2EIN H;  2FMY A;  2CG4 A;  2VQL A;  4IL6 C;  3QP5 A;  3CCQ I;  2A5Y B;  4C2M J;  3OIO A;  3Q5F A;  1W7P D;  3FWE A;  3G71 I;  1LVA A;  2X51 A;  2CQX A;  3MMY B;  2DA6 A;  2CW0 F;  2K9N A;  5CQG A;  2L54 A;  1SMT A;  3MN2 A;  4ZTJ A;  3K4B A;  3Q0W A;  4Y3O A;  1FBU A;  2NYX A;  2OQR A;  2QWW A;  2OUM A;  2KQR A;  2PG4 A;  5HS7 A;  4KMF A;  3BR2 A;  3FKI J;  3BTJ A;  1YJW I;  3C2B A;  2Y75 A;  3CDI A;  4FX4 A;  3CP8 A;  3HRT A;  4IOC F;  4HQM A;  4DW6 A;  2NXN B;  1V4R A;  3KE2 A;  1X2M A;  5EEG A;  3OL3 A;  2IGM A;  2VQG A;  3IH4 A;  1U5T C;  2L7K A;  3KYL A;  5J4Y A;  2QCO A;  2MLG A;  5L3E A;  3PSF A;  4B44 A;  2ZME A;  4UV8 A;  4U7B A;  1GUU A;  2AXT C;  3JCU C;  2VPL A;  1Y6I A;  2VE9 A;  1XCV A;  2CW7 A;  3RDI A;  3KLO A;  2DJN A;  2LC2 A;  2CFX A;  1SFU A;  2GA1 A;  2KKO A;  3PQJ A;  2Z3Y A;  1D1A A;  5D8K B;  1NH3 A;  4LG0 B;  2V1X A;  4E6K G;  2DOE A;  3FMR A;  1BJA A;  3WG7 H;  1VZ0 A;  1MNM C;  1P4W A;  2ADU A;  2VIX A;  2EJR A;  2WAD A;  3WHB A;  4PJJ A;  1VF9 A;  1IO2 A;  4RGR A;  3OIQ A;  4M3G A;  3I58 A;  4EVI A;  2PJP A;  2LLK A;  2CUJ A;  3QPT A;  1YTY A;  4PZJ A;  1KQ9 A;  3BJO A;  2RQQ A;  1V5G A;  1WJC A;  3K69 A;  5JLX A;  1IW7 F;  2ZO4 A;  3K7A J;  4I6Z A;  2QSH X;  3H5N A;  1W0U A;  5E1Z B;  1X4P A;  3JR9 A;  1OR7 C;  2ID3 A;  2XV4 S;  4MQV A;  3W2W A;  5HNH A;  1TLH B;  5J1U A;  1OYI A;  2LFB A;  3E5X A;  5LHI A;  4LB5 A;  3D5R C;  4PJL A;  1VQP I;  4ZC3 A;  2A05 A;  5CVI A;  4KUM A;  2DA5 A;  1BW5 A;  2ZME B;  2IRF G;  4L0Z B;  4DJA A;  4ZYD A;  2A5W A;  1BR2 A;  3L00 A;  2HYF A;  4BYY A;  1TWC J;  2DFF A;  3V7C A;  1SFX A;  1O3R A;  1L0O C;  1HKT A;  1J9I A;  4KN7 X;  3FM3 A;  5CPR B;  1ZAR A;  1WSU A;  1KQ0 A;  2EA4 A;  3A02 A;  1WVR A;  2JPB A;  4KFC A;  3GTM J;  1IAW A;  3NQO A;  2M9H A;  2DT5 A;  2ZNY A;  2BHY A;  3A0H C;  2Q1Z B;  3C7J A;  5HDN A;  3Q9S A;  1E3P A;  1RKW A;  2O3F A;  5LGU A;  1I50 J;  3MZY A;  2F2E A;  2KL4 A;  2ZXW H;  1T0F A;  1S3J A;  5FLX K;  1S7A A;  4LK1 F;  4E7K A;  1ITY A;  1ZRC A;  2QLZ A;  5LRR A;  3A01 B;  3TO7 A;  1VND A;  2E2J J;  2DYR H;  2HTJ A;  2QKL B;  4EEF G;  3GXO A;  5JVG F;  3BWG A;  5D5W B;  3KZI C;  4RA2 A;  1YS6 A;  2KPM A;  1AKH B;  3ULQ B;  5J4V A;  2UUZ A;  3A4C A;  2G7U A;  4GDF A;  1B9N A;  1BC7 C;  2BVM A;  1WQ2 A;  2BW3 A;  1STZ A;  4ZDO A;  5J1R A;  2DI3 A;  3B73 A;  1Z7U A;  1MBE A;  4BHB A;  1IZ1 A;  4C3I J;  3S32 A;  5K5O A;  1IRZ A;  1LFP A;  2DOA A;  3NWS A;  3RKQ A;  3CCJ I;  3CC4 I;  4MIM A;  2VXD A;  1WCM J;  3EQL F;  5FGM A;  2Y0S N;  3F8M A;  4M3E A;  1OPC A;  3T8T A;  2DAO A;  4HLY A;  4HNU A;  3KP4 A;  1U9O A;  1U9N A;  1JUP A;  1WH5 A;  3E0J B;  4XR6 A;  3WGH A;  4XRS G;  1PDN C;  4RMN A;  3LSH A;  4A5M A;  1FJL A;  4ITV A;  4XSX F;  4I02 A;  3P5J A;  1GT0 C;  3ZMV A;  2HEO A;  2JSP A;  4DIQ A;  4ESB A;  2X6O A;  1ZGA A;  2FNP A;  4D0P A;  2W4S A;  3OS0 A;  2WB1 A;  1K78 A;  1XGM A;  2QZ8 A;  4G7O F;  3EYY A;  1FYL A;  4RGS A;  1JUS A;  1VQ6 I;  3ZOB A;  4BS9 A;  1DP3 A;  2KJC A;  3PNV A;  3W2A A;  1ZH5 A;  3GFJ A;  5FD5 A;  1WI9 A;  5LEJ A;  4BL0 B;  1CF7 A;  4XOT A;  4PSW A;  5GPC A;  4IQ4 A;  2B63 J;  2XAU A;  4M6X A;  4HRI A;  1EA3 A;  2DA7 A;  4RLQ A;  2KMU A;  5D6F A;  1N77 A;  2ISZ A;  3K1N A;  2P0W A;  2EWN A;  3SYT A;  3I59 B;  4LMY A;  4C2T A;  2Z33 A;  4B3A A;  1Y56 A;  2GWR A;  1MJB A;  1YQA A;  2V9K A;  2ACJ A;  5H2F C;  4LOC A;  1MMG A;  1HKQ A;  1NG6 A;  1YW7 A;  3H3V K;  4LLN A;  1BR4 A;  3BG5 A;  3HEF A;  2IA1 A;  3Q0V A;  2EQR A;  1T56 A;  1EJ9 A;  5GAD J;  3VOE A;  3OL4 A;  4HX4 A;  4O6J A;  3ZQH A;  3CUQ C;  4B3X A;  4XLE A;  4WX9 A;  1IRG A;  3EUH A;  3K6G A;  3REO A;  2XGE A;  2D1V A;  2RNJ A;  1ON2 A;  2X0L A;  1K78 B;  2O8K A;  1E2X A;  2G0E A;  5BMZ A;  2QQ8 A;  4CUG A;  2I10 A;  1LDD A;  3KLN A;  5IYD J;  3G1M A;  3MKL A;  2E34 A;  3H3Z A;  4ENN A;  1OCC H;  3ISP A;  4ENM A;  1T8I A;  3EDP A;  5DDG A;  3QYF A;  3DPU A;  4NDL A;  2HR3 A;  2M4K A;  1YOV B;  2XIG A;  3HOV J;  4L9N A;  1U0J A;  3TDU C;  4L9J A;  2RRE A;  3ZXS A;  2JUG A;  4HF0 A;  2IT0 A;  3O8G A;  2CWE A;  3G3Z A;  3K1M A;  5EDN A;  4IEJ A;  3WOD F;  3NEU A;  3BCA A;  1WJA A;  1W1W E;  5D6E A;  2WTE A;  1XX5 A;  1R4N B;  1O4X A;  2DOD A;  4Q4Z F;  1TWG J;  2WB1 N;  1YIO A;  4E7Z A;  1QVT A;  3KEO A;  1ZLJ A;  1SFO J;  3SZG A;  3HBL A;  2XAQ A;  5J6X A;  3OYL A;  2DBB A;  1OCR H;  2FML A;  1WJE A;  1JI8 A;  2PFB A;  1WFX A;  2M0C A;  2XKP A;  4KN4 X;  1I3A A;  5IYB J;  1KYZ A;  2R5Y A;  2NNN A;  2DPU A;  2OTJ I;  2NS7 A;  1EH8 A;  3ZMS A;  4D5F A;  3HOY J;  3V8K A;  3AAF A;  3B02 A;  3DF8 A;  5F27 A;  4CCN A;  2WAE A;  4CCO A;  2QBY A;  4F3Q A;  2IJL A;  4HPQ A;  2MC3 A;  1HDD C;  4RAG A;  3HOS A;  2LP0 A;  2HQN A;  4KIF A;  4A3G J;  2FBK A;  3QWL A;  3AL0 B;  1AA7 A;  1HW5 A;  1F36 A;  4A2U A;  2KIM A;  4R1H A;  1IV6 A;  3LSR A;  1IF1 A;  2STW A;  3K2Z A;  5EJC A;  2IS2 A;  2STT A;  1B8I B;  2ZKZ A;  5HDG A;  1VQ9 I;  3QU6 A;  3QPL A;  5B3S H;  4F92 B;  4HSR A;  4NB5 A;  1Q1H A;  4AIK A;  3TP0 A;  1J0R A;  2Z2S B;  2EZH A;  4JQF A;  2AQF A;  1MW7 A;  2GA2 A;  1IUF A;  2ZME C;  3HSE A;  3IWZ A;  4IO9 F;  1TWF J;  3QP6 A;  4C3H J;  1USS A;  2HNH A;  2O8X A;  2M30 A;  1XTA A;  1ZQ3 P;  3TQN A;  1LFU P;  1MDM A;  3FF5 A;  1MD0 A;  2PQ8 A;  1YRN B;  3OS1 A;  1J5Y A;  3RPU A;  2CQQ A;  4C30 A;  2FXA A;  4F52 A;  1PP7 U;  3CC2 I;  3F0C A;  4GXO A;  1G3S A;  3RPQ A;  4BEH B;  3I4P A;  3VYR B;  3ESW B;  2FOK A;  5EEA A;  5KAI C;  2UXX A;  4A3I J;  1R9T J;  2E60 A;  4O3M A;  1I6X A;  4PFO A;  4HF1 A;  3LSK A;  4KMU X;  2K9S A;  2YS9 A;  3MFK A;  2Q8K A;  4JOM A;  1XS9 A;  2CMP A;  4IZZ A;  3CQZ J;  2K86 A;  3CLQ A;  2CUE A;  4XRS A;  3C2H A;  1V55 H;  3P9C A;  3BOQ A;  3TL4 X;  4G9Y A;  2E1C A;  3X2Q H;  4QSH A;  4BAY A;  1U78 A;  2VI6 A;  2K4B A;  1U8B A;  3O8H A;  3IWF A;  2W84 A;  3EUK L;  3CO7 C;  1UZC A;  1UHS A;  3FXQ A;  4NC6 A;  1ETK A;  3OYK A;  4HOB A;  2XKO A;  2CUF A;  2XAJ A;  1BBY A;  2P6T A;  1IGN A;  4N4O B;  5BPI A;  1KGS A;  2DYS H;  4M74 A;  2DA2 A;  4CO8 A;  2QSF X;  3JRA A;  3RZD J;  2MBF A;  5DD4 A;  4XRF A;  5E1X A;  3I5U A;  2K02 A;  1RES A;  2RQP A;  3I4N J;  2PI0 A;  2ZJQ F;  1OCT C;  1T6S A;  4J01 A;  4E7L A;  2IA2 A;  2ZSH B;  3JW4 A;  3DTI A;  3F21 A;  1YYV A;  5E18 F;  2O6G E;  4BY7 J;  2D1H A;  1T0F C;  2CRG A;  2VE8 A;  2MYS A;  3O6B B;  4PJN A;  3J7A Y;  3DP7 A;  3V4G A;  1ZGJ A;  3CJR B;  1FNN A;  2HYJ A;  4UVC A;  1XSD A;  2V6C A;  3O3K A;  4XKC A;  5L3F A;  4B47 A;  2OU2 A;  3BTC A;  3OWT A;  2BY0 A;  4LD5 A;  3HUG A;  2CQN A;  2DLL A;  4HBL A;  5FRM A;  2AXL A;  4G7H F;  3DEW A;  2FD5 A;  1Q1V A;  5A2Q K;  1LDK B;  5E3N A;  1QPI A;  3DFG A;  2NVQ J;  3L2C A;  5CLS A;  4J00 A;  3FBN B;  5D5V B;  1I3Q J;  2DMQ A;  2LKS A;  2WAQ A;  5M5X J;  4XKV A;  4MQ9 F;  2GIZ A;  1SC7 A;  4GFB A;  2L7F P;  2R7F A;  5LHG A;  4IHS A;  1XGS A;  2P4W A;  2XAG A;  3OYJ A;  3PJR A;  5BNG A;  2TCT A;  3S15 J;  2KZG A;  1P4A A;  3DKX A;  3HOW J;  3AG3 H;  2CV2 A;  1H88 C;  2PBI A;  4ZDL A;  4BXU A;  3COA C;  3HZJ A;  1FC3 A;  4YEJ A;  3BR1 A;  2VON A;  4DOZ A;  4YEL A;  5EEH A;  4AD9 A;  3CMA I;  1DQU A;  4RLF A;  1TQP A;  2X9D A;  2Z16 A;  2LVS A;  3OYI A;  2K27 A;  1ETO A;  1XSX A;  2RN7 A;  3KP7 A;  2ICW G;  2FUG 2;  1J75 A;  1V5F A;  2JRT A;  2TDX A;  1AHD P;  2TRT A;  2DMP A;  5DTD A;  4RBO A;  3HUG B;  1LQ1 A;  1W7P B;  3QRF F;  1WHU A;  2IEK A;  5ED4 A;  1B59 A;  1RIO H;  5E79 C;  4EJW A;  2LD5 A;  1MBG A;  2A3S A;  3KZY A;  4L9T A;  2XVC A;  3QPS A;  4O5V A;  3G1O A;  2R5Z B;  5F64 A;  2NRA C;  4M9Z A;  3W6V A;  3DBR B;  3OOU A;  1MKM A;  1KQ8 A;  1MSE C;  4UB6 C;  1WJB A;  4BE0 A;  1EH6 A;  3BJA A;  2EFO A;  1IV8 A;  1HLV A;  3RPU D;  2ZBK A;  3HOT A;  4AIJ A;  1W5C C;  2XF5 A;  4H4K C;  4IRH A;  2DDA A;  1FP1 D;  2RNG A;  2AQE A;  2X85 A;  3DWL E;  4HA8 A;  2LK2 A;  4BKX A;  4RB1 A;  1SD6 A;  3EUH C;  3GZN B;  3LSP A;  3K1P A;  2VLA A;  4M3F A;  2Y30 A;  2W24 A;  4BJ6 C;  3TW7 A;  4UHT A;  5DM6 F;  2LG4 A;  2WAQ N;  1XD7 A;  4XKB A;  2FQ3 A;  4M9S A;  1JHF A;  4RB3 C;  4AC0 A;  2DT6 A; 
#chains in the Genus database with same CATH homology
 2DA5 A;  1BW5 A;  2DN0 A;  2M8G X;  5FKL A;  1FTZ A;  3HGG A;  1TWC J;  2GM4 A;  3BTI A;  5GPA A;  1Y1V J;  1D5Y A;  2L0K A;  2HDD A;  1PUF A;  5IP6 A;  4UUS B;  2Y9Y A;  3PO3 J;  2P81 A;  5FKM A;  2YU9 J;  3A02 A;  3FIS A;  5FLM J;  2EBI A;  3FK7 A;  3GTM J;  4M6V A;  2OF7 A;  4MFD A;  2M9H A;  1HOM A;  2X48 A;  1NK2 P;  2MGQ A;  4JX6 A;  1RKW A;  4A93 J;  2NOG A;  2HXO A;  5IP9 J;  3GTP J;  1I50 J;  4A3E J;  1B8I A;  2AO9 A;  2WV1 A;  4XRM A;  1ITY A;  2DMU A;  3A01 B;  4A3M J;  4L5E A;  3L1P A;  3ZQF A;  1VND A;  2E2J J;  4EEF G;  3BQY A;  3HOZ J;  2ECC A;  5FKO A;  1ENH A;  1OFC X;  1P7I A;  4HNV A;  2R93 J;  1AKH B;  4A3B J;  4IHW A;  3BQZ A;  1YRN A;  1OJL A;  5F0C A;  5IYC J;  5J1R A;  1JKO C;  1IJW C;  4CYC A;  2EZL A;  4A69 C;  1MBE A;  4C3I J;  1IRZ A;  3JRC A;  3RKQ A;  5IOY A;  4MIM A;  2DA4 A;  1WCM J;  1HF0 A;  2E19 A;  2Y0S N;  5EYR A;  1SAN A;  4M3E A;  2DA3 A;  1UMQ A;  2CJJ A;  3TED A;  2O9L A;  1U9O A;  1U9N A;  1JUP A;  1WH5 A;  3PO2 J;  4XRS G;  3IH3 A;  1FJL A;  5EF6 A;  1GT0 C;  3PM1 A;  1MH3 A;  2X6O A;  1JUM A;  4DZJ A;  4DYQ A;  5EGO A;  1RPW A;  1JUS A;  3ZOB A;  4AYB N;  1JTX A;  3Q3S A;  2W48 A;  1IDZ A;  4A3D J;  2DMN A;  2M34 A;  1FEX A;  5GPC A;  4BBR J;  2B63 J;  2DA7 A;  1QRY A;  3BTL A;  2VPR A;  3HDD A;  2MG4 A;  1GDT A;  4B3A A;  3GTK J;  4CYC B;  2KT0 A;  4Y52 J;  1LE8 A;  4BY1 J;  4LOC A;  2KDZ A;  1JJ6 C;  1FTT A;  3H3V K;  1RR7 A;  1A6I A;  3BG5 A;  3HEF A;  1MBF A;  3Q0V A;  2EQR A;  1T56 A;  2E1O A;  3S1N J;  5EG0 A;  1MH4 A;  1VI0 A;  3ZQG A;  5DS9 A;  3M3Y J;  1WPK A;  4M3B A;  3ZQH A;  2JA5 J;  2LTP A;  1ZKG A;  2RAE A;  3JRD A;  2D5V A;  2ZB9 A;  5C4X J;  2FQ4 A;  2IBD A;  2XGE A;  1AU7 A;  1ZTR A;  3D1N I;  2N8G A;  2O8K A;  1NTC A;  4S0H B;  2G0E A;  3HOU J;  2I10 A;  1GV2 A;  5IYD J;  3G1M A;  3MKL A;  2M2E A;  2ME6 A;  4A3K J;  5E3M A;  2LR8 A;  5E3O A;  3OSF A;  1DU6 A;  2ELK A;  2XSD C;  5FKN A;  2Y9Z A;  2ECB A;  4XK4 A;  4NDL A;  3LSJ A;  3S17 J;  3HOV J;  4X6A J;  1JT6 A;  2FJ1 A;  1JTY A;  3UKG A;  2JA6 J;  2DMT A;  1H89 C;  3O8G A;  2XGC A;  5FKK A;  4FTH A;  5EDN A;  4IEJ A;  2NVY J;  3SJM A;  1XC5 A;  2XPU A;  5K7F A;  4A3J J;  2H8R A;  1O4X A;  1TWG J;  4BXX J;  2WB1 N;  3IH2 A;  4A3L J;  2EH3 A;  2JJ7 A;  4QTR A;  5C44 J;  1QVT A;  5C4J J;  3JRF A;  3NAR A;  1LFB A;  2AHQ A;  4X1E A;  1SFO J;  4J19 A;  4A3F J;  1EF4 A;  3HBL A;  1BW6 A;  3E7L A;  4W97 A;  5EG0 B;  3JRH A;  4D7M A;  2M0C A;  4B1R A;  5IYB J;  2VUM J;  2DA1 A;  2R5Y A;  2LKX A;  1ETQ A;  1JJ8 C;  3GTQ J;  2NS7 A;  2XPV A;  4D5F A;  3HOY J;  3I4M J;  2EZK A;  2VKE A;  3A03 A;  2L9R A;  5F27 A;  1BA5 A;  2R7Z J;  2E2H J;  4D7N A;  1PUF B;  1IDY A;  1HDD C;  3B6C A;  4DZP A;  2XRL A;  2NVT J;  2LP0 A;  1GVD A;  5J1Y A;  1ORK A;  4A3G J;  1POG A;  2PMZ N;  4FE7 A;  2R5Z A;  3DCF A;  3JRG A;  1F36 A;  1IV6 A;  5M5W J;  3LSR A;  1BJZ A;  5M3F J;  3SDG A;  2GBY A;  1K83 J;  1ETW A;  2JMW A;  1K61 A;  1Z0X A;  1B8I B;  3BT9 A;  4XID A;  1JKR C;  4BBS J;  3QPL A;  3JRE A;  2HI3 A;  2ME0 A;  2QF7 A;  2MSY A;  2JA7 J;  3IV5 A;  3FIW A;  3TP0 A;  2EZH A;  4B4C A;  3GTO J;  3GTJ J;  1MSF C;  5M5Y J;  1IUF A;  3BR5 A;  1TWF J;  4I76 A;  2CU7 A;  2XB0 X;  4C3H J;  4MFE A;  1ZQ3 P;  2L7Z A;  3LNQ A;  1LFU P;  2JWT A;  3TW6 A;  1YRN B;  4QIW N;  1MBJ A;  2EZI A;  2XGD A;  2CQQ A;  3FK6 A;  3ZQI A;  1Z77 A;  4DYR A;  3F0C A;  2HOT A;  3S1M J;  4A3C J;  3ZQC A;  1ZK8 A;  4C3J J;  3H0G J;  1JGG A;  5EEA A;  3BG9 A;  2XB5 A;  4UUS A;  4A3I J;  5M3M J;  1R9T J;  3HKZ N;  1A5J A;  3WHC A;  2MW8 A;  5K7Z A;  4V2F A;  1NK3 P;  2XPW A;  2LY9 A;  4JX5 A;  2K9S A;  2YS9 A;  3JRI A;  3GTG J;  1XG1 A;  1P7J A;  1RKT A;  1XS9 A;  2HXI A;  2H1K A;  3GTL J;  4MLO A;  3S14 J;  4RDU A;  1S7E A;  5EZG A;  3CQZ J;  1G2H A;  4D5C A;  2CUE A;  1BL0 A;  1FIP A;  1X58 A;  3BR0 A;  4XRS A;  5EGO B;  4QSH A;  2R0Q C;  2NS8 A;  3RQI A;  5F1J A;  2JK3 A;  2VI6 A;  3A01 A;  1U78 A;  1APL C;  1U8B A;  3O8H A;  4FCY A;  4FIS A;  3BR6 A;  1T33 A;  1MBK A;  1UHS A;  1ETK A;  3BR3 A;  3B6A A;  2CUF A;  1AKH A;  1GV5 A;  1IGN A;  1HCR A;  5J3L A;  1TC3 C;  5IPA A;  2DA2 A;  2L7M P;  3JRA A;  4G12 A;  3RZD J;  2VKV A;  1LE8 B;  3S1R J;  3BG3 A;  1B72 A;  4W1U A;  1RES A;  3I4N J;  1OCT C;  1OCP A;  5EZH A;  4BY7 J;  3M4O J;  3GBG A;  5C3E J;  1Y1W J;  3SFI A;  2CRG A;  1ZR4 A;  4V2G A;  1UG2 A;  1QVU A;  2HYJ A;  1ZGW A;  1TWA J;  2DTZ A;  2JN6 A;  1JT0 A;  3BTC A;  5F08 A;  3RZO J;  9ANT A;  3TP3 A;  3NAU A;  4DYC A;  4JYK A;  2OPT A;  3G1L A;  3Q0U A;  1JKQ C;  2JA8 J;  1I6H J;  5F0H A;  5HOD A;  3LSG A;  2HOS A;  3DEW A;  2FD5 A;  1Q1V A;  3HGY A;  3K2A A;  2K40 A;  5E3N A;  1MBH A;  1X2N A;  1WI3 A;  1QPI A;  2NVQ J;  4Y7N J;  4JP0 A;  5E3L A;  1I3Q J;  1HDP A;  2DMQ A;  4MO7 A;  4AUX A;  5JLW A;  2NVX J;  5M5X J;  2FX0 A;  3ZQL A;  4GFB A;  2L7F P;  1ETX A;  1JKP C;  4M3D A;  3CMY A;  2E2I J;  2O7O A;  2TCT A;  5BNG A;  5FLV A;  2Y2Z A;  3S15 J;  2ID6 A;  3HOW J;  3VPR A;  5F04 A;  1CQT A;  1H88 C;  4IHY A;  1B72 B;  4C2M J;  3OIO A;  4UUT A;  3HB9 A;  4IHV A;  2CQX A;  2DA6 A;  3BR1 A;  2K9N A;  3MN2 A;  1F43 A;  3Q0W A;  5GP9 A;  3LOC A;  2HQ5 A;  3JRB A;  3BR2 A;  3FKI J;  3BTJ A;  2X9D A;  3C2B A;  2LVS A;  1ETO A;  2Y31 A;  4DW6 A;  1FIA A;  1WGX A;  1X2M A;  2R5Y B;  2K9Q A;  2IAI A;  4ABZ A;  1AHD P;  2TRT A;  2DMP A;  3IH4 A;  5DTD A;  4RBO A;  2QCO A;  4IHX A;  5IP7 J;  1GUU A;  1ETY A;  3OSG A;  4JX4 A;  2DJN A;  2IEK A;  5IOZ A;  2GLO A;  2YUS A;  2LD5 A;  1MBG A;  2R92 J;  3QPS A;  3G1O A;  2R5Z B;  4FE4 A;  3CDL A;  5FJ8 J;  3W6V A;  1MNM C;  3OOU A;  3S1Q J;  3WHB A;  3CCY A;  1MSE C;  1VF9 A;  3MVP A;  1WH7 A;  1W0T A;  1E3O C;  4M3G A;  1IC8 A;  1HLV A;  2LLK A;  3S2H J;  3HOX J;  1RET A;  2LK2 A;  4BKX A;  3S2D J;  1ETV A;  1TWH J;  5JLX A;  3K7A J;  4I6Z A;  1H8A C;  1DU0 A;  1W0U A;  2HOA A;  3JR9 A;  3LSP A;  2ID3 A;  3HM5 A;  3QQA A;  4M3F A;  2Y30 A;  1IG7 A;  5J1U A;  1ZR2 A;  3S16 J;  3TW7 A;  4XIC A;  5K7H A;  2COB A;  2WAQ N;  2LFB A;  1VFC A;  5F0F A;  4AC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...