3FJ5A

Crystal structure of the c-src-sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
b'MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Intertwined dimeric structure for the SH3 domain of the c-Src tyrosine kinase induced by polyethylene glycol binding
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A01
1V1CA 1WXBA 2X3XD 2A36A 2DA9A 2CUBA 2DL5A 2CUDA 2PNIA 2DMOA 2O9VA 5IXFA 2FRYA 1S1NA 4JZ4A 3EG0A 1M8MA 4RTVA 2K2MA 1H8KA 2DX1A 4JJBA 2KE9A 2LP5A 1OPLA 1W6XA 1H92A 2ED0A 3VS6A 1ZUKA 2EPDA 2KYBA 2GTOA 2RQVA 2JM8A 1NLOC 2J6OA 1WYXA 4RTYA 2J06A 4Z8AA 2KXCA 2LJ0A 4HXJA 1FMKA 1JO8A 1MV0B 2AKLA 4RTTA 3EHQA 2AZVA 1SHFA 3M0PA 2LJ3A 1KIKA 2EGEA 3A98A 3GBQA 2O31A 1GRIA 1RI9A 1NLPC 2CH4A 4J9IA 3TVTA 2EYWA 2ENMA 2JMCA 1UHFA 3RNJA 2LJ1A 2O9SA 2EYYA 3H0FA 1BK2A 3O5ZA 2O88A 1ABQA 1PKSA 4R0KA 2VVKA 2SRCA 1M3CA 1B07A 2K3BA 2AK5A 5I11A 1UE9A 1M3BA 1X27A 1ABOA 4FSSA 1JEGA 1QWFA 4LN2A 4E6RA 1GBRA 2DJQA 1PHTA 1ZX6A 2FO0A 4F17A 1U06A 2YUNA 3H0HA 1X6BA 1BBZA 1LCKA 1MV3A 1M30A 2GQIA 3IQLA 3THKA 1WA7A 4Z89A 1PKTA 1VYUA 1NM7A 1Z9ZA 5GJVB 4X1VA 3REBB 2DL8A 2CDTA 3NHNA 2KBTA 3NGPA 1K4US 2FPEA 2KRNA 2GTJA 1J3TA 1ARKA 1NYFA 1UGVA 1ZUUA 1GL5A 4DEXA 4AFSC 2BZ8A 2CSQA 3I35A 4ZNXA 3U23A 3UF4A 2VKNA 1Y0MA 1HSQA 4JJDA 2KT8A 1YNZA 4AFUC 4F16A 2J6FA 1HD3A 2JMAA 4RTUA 2D8HA 2PZ1A 2YUOA 2DF6A 2FRWA 3M0TA 4EIKA 3H0IA 2DRMA 1ZLMA 2DNUA 1HJDA 4M4ZA 1M3AA 1PNJA 1YWOA 3I5RA 4OMNA 4J9FA 2KEAA 4OMQA 5IHIA 4HVUA 4ORZA 2K79A 2DL3A 3PVLA 4RUGA 1A0NB 1JXMA 3UATA 4RTZA 1Z9QA 2QDLA 4Y92A 2E5KA 3JV3A 2HDAA 1VYVA 2YT6A 2BTTA 4J9DA 2JT4A 1VYTA 1WI7A 3PE0A 1UFFA 4CC4B 1AD5A 1NEGA 1T0JA 2DBMA 2LMJA 4LNPA 3TSWA 1I0CA 1AWXA 1IO6A 2LNHB 4WCIA 1QKWA 1UECA 2A08A 2FEIA 2C0IA 4QT7A 3VRYA 2L0AA 2CREA 4J9EA 2EYZA 3UA6A 1QKXA 4GLMA 2EGCA 1VA7A 2BZYA 1SSHA 2OI3A 1K0XA 3TSZA 2JTEA 3VS5A 2JW4A 1SRMA 4JJCA 2LQNA 4AG1C 3REAB 2FPFA 5FWBA 5IXBA 2JM9A 2C0TA 2B86A 2DE0X 4ESRA 4OMOA 2SEMA 2D8JA 3SHWA 5ECAA 4D8KA 1T3LA 3VS2A 1Y57A 1ZBJA 4IIOA 1GCQA 1GCPA 2KNBB 1AWJA 1GCQC 1T0HA 4LE9A 5GJWB 1ZSGA 2PTKA 1M27C 2RN8A 2J7IA 1JXOA 3ZL7C 1CKBA 1NG2A 2DYBA 2YDLA 2X3WD 1N5ZA 1ZUYA 3VRZA 2LX7A 2DILA 4CC2A 2DM1A 4OMLA 2ED1A 1K9AA 2RQWA 3M0UA 4J9HA 1AWWA 1RUWA 4D8DA 3QWYA 2KROA 2I0NA 4AFZC 2KYMA 2GNCA 3QWXX 1YCSB 2K7AA 2JXBA 3M0RA 2GGRA 3I5SA 4J9CA 2DBKA 1JU5C 4RTXA 1WFWA 2BZXA 2ROTA 4KRTA 2CSIA 4CC3A 2HEQA 2NWMA 5FWCA 4GBQA 4LUEA 2IIMA 1AOJA 3VS3A 2DLPA 2LQWA 2L3QA 2YUPA 2MCNA 2J05A 1UJYA 1CSKA 1SEMA 1TUCA 2ROLA 4HVVA 4J9GA 1KFZA 2C0OA 1W70A 1YN8A 2EQIA 1QWEA 2RQUA 2EGAA 2F2XA 1QCFA 1UJ0A 1CKAA 1U5SA 2FG0A 3NMZC 4F14A 3VS1A 2W0ZA 3VS4A 1PWTA 1I07A 3FJ5A 2MIOA 2KGTA 1UHCA 2K9GA 2A37A 3R6NA 1JQQA 1OOTA 1GFCA 2F2VA 1B3QA 1AEYA 1KJWA 2AZSA 2DL7A 1T3SA 3M0QA 3EGUA 1YWPA 2D1XA 3EHRA 1H3HA 2EBPA 2J6KA 3VS7A 2EYXA 4CC7A 2MOXA 4HCKA 3LH5A 1WX6A 2CT4A 2CT3A 3UA7A 1NYGA 1X6GA 1RLPC 2EVRA 1GBQA 1TUDA 2M51A 1AZEA 1WLPB 3H41A 4RTWA 2L2PA 2F2WA 4Z88A 5FW9A 3RBBB 2CH4W 3VS0A 4JZ3A 1TG0A 1K1ZA 2ABLA 2ESWA 2EW3A 2M0YA 1FYNA 1PRLC 1UDLA 2KRMA 4LUDA 1OV3A 4IIMA 5HCKA 4A63B 1BB9A 1UG1A 2JS2A 2KT1A 2KXDA 2KR3A 1I1JA 1OEBA 1UUEA 4HVWA 2V1QA 4K11A 2FPDA 1K0SA 2W10A 1X43A 3PVQA 2OJ2A 1AZGB 1YP5A 3CQTA 2NUZA 2V1RA 1UTIA 2RQRA 1GFDA 2EKHA 1WXTA 2LZ6B 5EC7A 1SHGA 2JS0A 1MUZA 1XOVA 2O2OA 3NPFA 4JPBW 2ECZA 4DEYA 2P4RA 2H8HA 2DRKA 2HSPA 1E6HA 2DL4A 2YSQA 1SPKA 3ULRB 1E6GA 1K76A 2RQTA 5IH2A 3SEMA 1AVZC 3KFVA 3M0SA 4J9BA 3C0CA 2RF0A 2GBQA 1WDXA 1NEBA 1G83A 2HCKA 2DVJA 1W1FA 3EG3A 1E7OA 1SRLA 1G2BA 1WXUA 2K6DA 1BU1A 1PRMC 2RPNA 3I9QA 1X2KA 2AKKA 2XMFA 2L3SA 1OPKA 5I22A 4AG2C 2VWFA 3EG1A 2YUQA 3EG2A 4OMPA 2RNAA 1EFNA 2RMOA 1KSWA 2A28A 5IHKA 1U3OA 2G6FX 1AWOA 2OAWA 5L23A 1X2QA 1QLYA 2LCSA 4AFQC 2D0NA 4OMMA 2KRSA 5IHNA 1WIEA 2HBWA 1X69A 2L3PA 1RLQC
chains in the Genus database with same CATH superfamily
2CP7A 1S72T 1WHLA 1WXBA 2X3XD 5GAOm 1R0BG 2VGNA 2HMAA 1QP3A 2DK3A 2FRYA 3BFMA 4J6WA 3C95A 3QBYA 1Q86U 2DTIA 2MAMA 2KE9A 2RO0A 2EJGA 5GAOn 1AHJB 2D9TA 3VS6A 2X35A 3I55A 3S3NA 3R6OA 4KGZB 2KYBA 3SWNA 2GTOA 3OQ5A 3SWNC 1VQKQ 2NYSA 4F7UE 2E10A 3JCMh 2KSSA 3MP1A 3L42A 1VQ8T 3CCVT 1RAEB 4MDWA 1JO8A 1SF9A 4RTTA 3VJPA 3EHQA 2EKOA 2RM4A 5GANf 2E6ZA 3M0PA 5I2MA 4XAXB 3GBQA 3CCSQ 1KC8C 2O31A 4C92A 1KQSA 3GOXA 4C92C 1NJIU 3OYEA 1QVFA 1OX9A 5LJ3f 3BW1A 1M4ZA 3H0FA 1IRXA 3O5ZA 2O88A 1ABQA 2G3RA 1M90U 1VQ4A 2SRCA 3PMIA 3MO8A 4NL2A 1U1SA 4KUIA 4JRKA 3RIRA 2IVWA 1X27A 1PG5B 4FSSA 1QWFA 1S72Q 2OTJT 2CZ0B 2PUOB 1PHTA 1ZX6A 1VQOT 5A0GA 2EQJA 2FHDA 4FYWB 5GAN4 3PMTA 3H0HA 5GAN6 1M30A 2GQIA 2CP3A 3OS2A 3IQLA 4BUGA 4BDYA 1VYUA 5GJVB 4X1VA 3REBB 2RHXA 2MYSA 3MEWA 4DOWA 4C0GA 3HL8A 1NYFA 1WHJA 1ZUUA 4BI3A 1M1FA 4F7UA 4AFSC 1VQ8Q 4ZNXA 5LJ5e 3CCVQ 3UF4A 2Y90A 5KCOA 3CMAT 5IN1A 4XQ3A 2Y4XA 4JJDA 1YNZA 4OB2B 1K9MU 4AFUC 2ZPFB 2FZCB 1HD3A 2JMAA 3P8DA 1UGQB 1LPLA 5KH6A 2CP0A 2DF6A 3BDLA 4WTOB 2K4YA 3M0TA 4J7IA 4EIKA 3H0IA 5D6YA 4M75B 1HJDA 2HSEB 1KG1A 4M4ZA 1M3AA 1YJNA 4OMQA 4A54A 4C8QG 3O8VA 3PVLA 4XTUA 2MWPA 2FZGB 4M77G 1Z9QA 3DLMA 2OTJQ 1D1AA 3QSUA 2K57A 2HKNA 1VQOQ 1RABB 2JT4A 1YI2A 1YIJA 3PE0A 4CC4B 2LMJA 4M75D 1I0CA 2LNHB 2HQEA 1QKWA 1QVGP 2YWWA 5CKHA 1WPYA 2E5QA 2L0AA 4FYVB 2QEXT 2MK5A 3CCEQ 3DB4A 5GAOp 1QKXA 4GLMA 4QVZA 5GAMf 2OI3A 4KH1B 3SWNB 3TSZA 4XTYA 3JCMP 5CQXA 2JW4A 3MP6A 2QTXA 2XDPA 2LQNA 4N4HA 4AG1C 1M9SA 2NUPA 3L2QA 3C4SA 2B86A 4J8OA 5ECAA 3CMAQ 1TSFA 1U1TA 2JVVA 2ZZDA 1T3LA 3QYGB 1YJWA 1AWJA 3CXCA 2PTKA 3UDCA 1M27C 2J7IA 3M5AA 1Q95G 3CC2A 5I21A 2X3WD 3AT1B 2HL3A 1BI0A 4C92B 1ZUYA 2LX7A 1RAGB 4RCBA 4CC2A 4E7HA 1M8VA 3QIIA 3M0UA 4J9HA 1AWWA 3M59A 4JS5A 4MMKA 4C0FA 1C1AA 2KYMA 2LRQA 5LJ5j 3NTKA 3GNGA 4BE2A 2EWNA 5GANh 4J9CA 1JU5C 3OBYA 4C92D 4KRTA 4CC3A 2LT1A 1IXDA 4GBQA 1AOJA 1VQKA 3VS3A 2DLPA 1MNEA 4LD6A 5KE2A 2GCXA 2MCNA 4MDXA 5LJ3h 3PIOA 4JLGA 2EYQA 1X75C 2OX7A 1R0CB 4F7UB 3NTHA 2L8DA 2EQIA 1OX8A 3CCSA 2P84A 2BE7D 2F5KA 4F14A 3VS1A 1KD1C 1I07A 2DXCA 3EAEA 3OW2P 1O75A 3FRNA 2X4XA 3FJ5A 5J3BA 5GMKj 2K9GA 3P8HA 2A37A 5CCAA 2RK1A 4BACA 1B3QA 1S72A 4BD3A 4XTXA 1B7TA 3CPFA 2EBPA 3VS7A 3META 2Y4YA 2MOXA 4HCKA 3H8ZA 2CT4A 1ACMB 2EVRA 1GBQA 3I55T 2PU9B 1AZEA 4RTWA 6AT1B 4OGCA 2QGGA 2CH4W 4JZ3A 3RERA 1DJ7B 2EW3A 4XU1A 3C94A 1QVGS 1UDLA 3FLGA 3QG1A 4LUDA 1OV3A 3CD6T 1VQ8A 3CCVA 2KT1A 1EX4A 2QAZA 1M2VA 5D7UA 3JCMJ 1UUEA 3L2VA 2NUPB 2V1QA 2W10A 1X43A 4B6MA 1AZGB 4C5GA 4LDYA 3H6ZA 1VQ4T 3OYKA 2RQRA 1I8FA 2DJZA 4EPCA 2OTJA 1SHGA 3M9QA 2JS0A 1VUBA 2O2OA 4C5EA 3DLLA 5GAMh 1VQOA 4XU2A 5FU7C 4DEYA 4IUPA 2OTLQ 2P4RA 2DVEA 2GF7A 2E6NA 4KGXB 2DIQA 1E6GA 4A4KA 5IH2A 1AVZC 4RG8A 2RI3A 3CCEA 4J9BA 3C0CA 1WJQA 3VUZA 1RACB 1K8AR 1D3BA 1RAAB 2DVJA 2EQKA 1IGQA 4PJOA 3CD6Q 4M7DG 3CBOA 1SRLA 4PJOC 2K6DA 1BU1A 1X01A 5FRMA 1Q81U 3CMAA 4AG2C 1PCXA 3V7CA 2RNAA 4BY6B 3QUIA 2RHZA 4MMLA 2C06A 3HHTB 2A28A 4M7AG 3VUBA 4EMKA 1AWOA 4FW2A 1LNXA 4J83A 4C8QF 1R77A 1G3SA 4EMKC 3UWNA 8ATCB 3OYCA 3M4GA 3MEVA 4EMHA 2L3PA 2LCLA 2RA2A 3OW2S 2P0PA 1V1CA 3RMSA 2DFUA 1YI2T 2CUBA 2DL5A 3BY7A 1BI2A 2DMOA 5IXFA 2F1LA 1S1NA 1BCMA 3EG0A 1M8MA 2LT4A 4JJBA 5GAOq 3RR6A 1OULA 2XHCA 3X28B 3UPUA 1ZUKA 2MMPA 1MMDA 2NLUA 4N0AA 2RQVA 4DA4A 4N0AC 5HK3A 1WYXA 3QJ6A 3L2RA 4A4FA 2KXCA 4HXJA 4C8QE 1IREB 3HRTA 2E41A 4M77E 1OU9A 2PVDB 2LJ3A 4JJNK 5CVIA 3LX7A 1QVGA 1M2VB 3JCMb 1VIEA 1GRIA 1Y71A 1M1GA 3TVTA 4F04B 3RKWA 4ZGEB 2O01E 1UHFA 2JZ2A 1KHIA 3RKYA 1PKSA 3J7AF 2RD1A 2GFUA 2VVKA 3EH1A 1M3CA 3OY9A 1LOJA 2AK5A 3SFMA 5I11A 1JEGA 4LN2A 2QQSA 2DJQA 4BDZA 1N27A 4F17A 3HFNA 3OMCA 3E19A 5FU7B 1BBZA 1XNIA 2HBPA 4Z89A 3ER0A 4UC4A 2K3XA 2X4JA 2DL8A 3J81E 1BIAA 1IGUA 3OYBA 1W2BP 1K4US 2FPEA 2FB7A 2MI6A 1ARKA 2CP6A 1UGVA 2VV5A 5LJ5d 7AT1B 1GL5A 4DEXA 1MHNA 3M54A 4FIBA 5GMKi 3I35A 1D3BB 2KQWA 2COZA 3KUFA 1OI1A 4PJOB 4C8QA 3OYIA 4C8QC 2R5AA 4M77A 1XTDA 4M77C 5CKBA 3LGLA 5GANe 4TVRA 2J6FA 4RTUA 4R56A 2X4YA 4ZN3A 2PZ1A 2VASA 1NJIR 2DEUA 4EMKB 3CC4Q 3GIBA 3LWHA 4M78G 1M90R 3I5RA 4J9FA 5IHIA 4HKEA 4PJOD 4J7FA 4ORZA 2BIVA 5GAOl 2EIFA 2M02A 4RUGA 3DKMA 3UATA 4BI8B 2OTLA 2YT6A 4HCCA 1WI7A 2ZAEA 2K5IA 3TSWA 2P4TA 5KYWA 3OYGA 2A08A 5DLOA 3OYJA 4QT7A 1NBEB 1FWZA 1WZOA 1M1KU 3M55A 4J9EA 2HNIA 1RI0A 2YXYA 3UA6A 5FLXE 3CD6A 2BZYA 2LCCA 2JTEA 3MCAB 1SRMA 1WGSA 1WNLA 3REAB 5FWBA 2LNVA 2DE0X 2P0QA 3OYAA 2D8JA 4D8KA 2XIDA 2ZPGB 2HD0A 1K9MR 4LE9A 1ZSGA 1H641 1N9SA 4A4EA 1JXOA 4XK8E 1D09B 5CQYA 2DYBA 1N5ZA 1Y07A 1WHHA 2R5MA 2DILA 3CMET 2WSEE 3A8LB 2RI5A 2R57A 2ED1A 2X51A 2RQWA 3CBMA 2XDDA 1RUWA 3VU3C 3OSVA 2QQ9A 2GNCA 1K73U 2VGMA 1WQ7A 4L59A 3OBWA 5KE3A 1GXIE 3FEOA 2DKGA 2HAXA 4PJJA 4RTXA 2BZXA 5CO7A 3CCET 1WHMA 3EGDA 4M7DF 3QZ5B 5GANj 4LUEA 2IIMA 1RAIB 1TXQA 3NTIA 4NOYA 4L5GA 3OB9A 4FT2A 5KYXA 2L3QA 1VQNT 1ZBXA 2RB6A 2J05A 9ATCB 1CSKA 2LDMA 4M7AF 2ROLA 4HVVA 3VKIA 1W2BS 2XKOC 1KFZA 1W70A 2DD5A 1QWEA 1OZ2A 2VB6A 2E70A 2F2XA 2EJFA 1UJ0A 2RJDA 1CKAA 4C8QB 3NMZC 1NJIC 2LTOA 4M77B 2W0ZA 1PWTA 1FXXA 2MIOA 3I56T 1UHCA 1TU0B 2RJFA 1JQQA 1OOTA 2DPPB 2JTFA 3CMEQ 4RCCA 1AEYA 3LGFA 1KJWA 2DZ9A 2DL7A 4M7DE 3M0QA 3EHRA 4CC7A 4M77D 3LH5A 5GMKe 4FSXA 2EFIA 3NFCA 1WLPB 3CPWS 2L2PA 3E9FA 4M7AE 2AHJB 3M57A 4ZGDB 3RBBB 4ZTJA 1KK7A 3VS0A 5KYWB 3GLXA 1AT1B 4PJLA 1XJWB 3L2ZA 1QCOA 1VQNQ 1YCYA 3QO3A 1BB9A 2JS2A 3ME9A 5J39A 4PK4A 1PD0A 1K9MC 3EG9B 4ZN1A 4PJMA 4FCYA 3EFOA 1K0SA 4DBRA 1YP5A 4FL6A 3CQTA 1HXDA 3MKDA 3I56Q 1VQPT 1GFDA 5L8RE 2EKHA 1D0XA 3JCMd 2K5LA 1KD1U 2JJ9A 1IHVA 4LD9K 3M58A 3JCMc 1MUZA 3NPFA 1JRIA 2YRCA 2E12A 5GAN3 2EJ9A 1Y7XA 3TQ7P 2FZKB 4VUBA 4A4HA 5CKFA 2YSQA 2DL4A 3EH2A 3ULRB 5GAMj 3M56A 2LX9A 1ZA2B 4NL3A 1SKUB 2RF0A 3EGDB 3SDZA 2GBQA 3EGXA 1D0YA 1NEBA 3SD4A 4C5IA 1G83A 1M5Q1 1FMWA 5GAN2 1G2BA 4HCZA 3OS5A 5KYXB 3L2WA 3QJYA 3X24B 2L3SA 1OPKA 5I22A 5HKCA 3JB9D 3EG1A 1JJ2S 2RMOA 5M9OA 4M78F 5IHKA 1U3OA 1MMGA 4HT8A 1X2QA 1QLYA 1W2BA 1R8OB 2HL5C 3JCMQ 2D0NA 2KRSA 5IHNA 2GFAA 5GAN5 1WIEA 4V2SA 1VQPQ 2A3LA 4OGEA 3CCLQ 4B9WA 2OTLT 2A36A 2DA9A 2JOYA 2F69A 3MPUB 3G71T 2CUDA 2K2VA 2PNIA 3TCJA 2O9VA 2YLCA 4JZ4A 4RTVA 2K2MA 4KBMB 2DX1A 2LP5A 3JCMX 1OPLA 2WACA 1G5VA 3LLRA 3AHUA 4II1A 2EPDA 2JM8A 1NPRA 2CYZB 4QW2A 1NLOC 4N4GA 3LWIA 1KQSP 1WQWA 4M78E 3OYLA 2J06A 3BE3A 4Z8AA 2LJ0A 1QVFP 1FMKA 4FYXB 1F1BB 2KVQG 2ZPEB 1Q81R 2AZVA 2QQRA 2DTOA 3X26B 1KIKA 2EGEA 1XQHA 5J26A 3A98A 3INZA 4QVDA 1W4SA 1OQKA 2XK0A 4J9IA 3EFOB 1Q82U 2JMCA 4X9DA 3RNJA 3HTRA 2XU8A 1UB4A 2O9SA 2CZ1B 3G7ZA 1BK2A 3LYIA 4OF1A 4R0KA 3JCMe 1Q7YU 3CMEA 3CCMT 3QZ9B 1B07A 1WHGA 4J5YA 1GBRA 3FJPA 3RDVA 4AT1B 2AT1B 2VYTA 3G71Q 1BKBA 3WVDB 2YUNA 1G8XA 1TOVA 1LCKA 1MV3A 3THKA 1WA7A 4FYYB 1PKTA 3LW5E 3PFSA 2V26A 3V7SA 4QKUA 1Y96A 2DIGA 1I5LA 2CDTA 2FL7A 3A1PA 3NGPA 3SB2A 2KRNA 5LJ5g 2GTJA 1VQNA 3CCUT 1J3TA 3GP8A 3QDRB 3EGXB 2OAUA 3U23A 2VKNA 4BE1A 4M78C 2NUTA 2O4XA 4XTWA 2KT8A 2QQBA 4RKUE 3MEUA 5GANd 2ZPBB 3T9NA 4KH0B 2HKQB 4E2FB 4F16A 1D1BA 5D6WA 3WVEB 4QVCA 3I56A 2DNUA 3OSSC 3URGA 1PNJA 1BI1A 4OMNA 2KEAA 4XTVA 1NE8A 5LJ3d 4HVUA 3CCMQ 4BB7A 1A0NB 3KXTA 2BUDA 4M75F 4ANJA 2QDLA 4Y92A 2E5KA 1IB8A 2L5QA 2HDAA 1VYVA 2H3EB 1RAFB 4X9CA 4J9DA 1VYTA 4KUDK 3CBPA 3JAME 1AD5A 4PL6A 1T0JA 1C6VX 2HQHA 4O5VA 2FVUA 4WCIA 2CKKA 3RUXA 1UECA 2LQKA 4PLIA 2C0IA 4C0DC 3VRYA 1VQ5T 3KBGA 2EYZA 3OYMA 4QQ6A 2EGCA 1VA7A 3CCUQ 4EDUA 1SSHA 1K0XA 3HKSA 1FX7A 3OMGA 3VS5A 2VC8A 1Q81C 4E47A 2CP5A 1UGRB 1BYMA 1PM3A 2C0TA 4ESRA 4OMOA 2SEMA 4LDXA 4X34A 1KQSS 1VQMQ 1Y57A 3CCQT 2DAQA 1ZBJA 1N8RU 1GCQA 1VQ6T 1QVFS 2XI9A 4HA8A 1GCQC 1T0HA 4OP0A 1N9RA 3FIFA 3CC4T 4KT0E 4RMOA 4M75E 4A53A 1NG2A 1ZQ1A 2YDLA 5A0LA 1VQPA 1TUGB 4O6JA 5CK9A 2QK0A 3S3OA 2VXEA 2BKDN 2DM1A 4OMLA 2DO3A 4MZTA 2K3YA 5FU6C 4C92F 4D8DA 1YJNQ 1BIBA 2KROA 1Q86R 4XU3A 2R58A 2ZPIB 1YITT 3QWXX 3D7SB 1YCSB 4PKCC 2WSCE 3M0RA 4ZTFA 1EZZB 3CEYA 4E7SA 1K8AC 1WFWA 3G6ET 2JN0A 2ROTA 2NWMA 3X25B 5CR2A 1VQ5Q 1M1KR 3V8KA 2DETA 2KAFA 2LQWA 1QQJA 1Y96B 1G3WA 2L89A 5DY9A 1UJYA 4IUQA 1YJ9T 3A8MB 2RH2A 5GAMd 5FROA 4GLKA 1HK9A 2QASA 2C0OA 4ZGJB 5KYYA 2A7YA 2B8AA 1QCFA 2IPOB 3CCQQ 1VQ6Q 4KULA 1U5SA 2NUTB 2O4XB 4FT4A 4F7UF 1KC8U 3VS4A 5AYFA 4QQDA 5AT1B 2WSFE 2ATCB 5LL6S 4MZPA 2E3IA 1H3ZA 2MPXC 3FB9A 5LJ3e 3V7RA 4P5NA 1PC0A 4PJOG 4L6V5 2AZSA 2RI2A 3CPWP 5CAIA 3QKJA 3OA6A 3G71A 1T3SA 1YWPA 1OZ3A 2J6KA 3A5ZB 1YITQ 4OB0B 3OW2A 2YLBA 4QQGA 1P92A 1K73R 2CT3A 3UA7A 1NYGA 1X6GA 3QHSA 4Y28E 3H41A 3M53A 3G6EQ 1D0ZA 3H9NA 4GY5A 5FW9A 2PQWA 1TG0A 4C0DB 4J6YA 3EG9A 3PT9A 2M1HA 2VXFA 2KRMA 4IIMA 5EG2A 2DERA 3JCMW 1VQ9T 2X9HA 4HCBA 1PSFA 2DXUA 2KXDA 1YJ9Q 3CXCS 2GQVA 1OEBA 2COYA 1WHKA 2E4HA 4K11A 2M0OA 4IUUA 3GPLA 4E7ZA 5GAOr 2A0FB 1M2OA 3VYHB 2YRDA 1OYXA 2ZGWA 2NUZA 3CCRQ 3RKXA 2DZCA 5I2SA 2QYZA 3JCMg 3CCMA 1YBYA 4HT9A 1Q86C 3N5BB 2COWA 1XOVA 3HFOA 4C5HA 5FU6B 1VOMA 2IG0A 2DRKA 2HSPA 2JNGA 2QXFA 2YHTA 2LC4A 1K76A 2RQTA 3SEMA 2M16A 1M1KC 3QDFA 3QYHB 3KFVA 4LDUA 5HY6A 1JJ2P 3CCUA 2HCKA 1SSFA 4CI0C 4N4IA 5LJ3j 5GAMe 1VQ9Q 3OS0A 4J6XA 1X2KA 1QCNA 2XMFA 4LDWA 4PFZA 3MP8A 1C0MA 1VQMA 2JTMA 2Z0WA 3EG2A 4OMPA 1EFNA 1KSWA 1WJRA 1PSEA 4OMFB 3GF5A 1M90C 2G6FX 4ELYC 5KYYB 2OAWA 3HRUA 3OYNA 2LCSA 2M9UA 3TU4K 2V8IA 2HBWA 3ZFJA 3CC7T 1X69A 4C8QD 1RLQC 2FYKA 1KD1R 4OVAA 3FC3A 1K73C 3G4ST 2CZ7B 4M75G 2QA4T 2ZPHB 5GMKm 1H8KA 5GMKl 2YRVA 1W6XA 1H92A 3F70A 4Q5WA 2ED0A 1VQ5A 4Y91A 2QI2A 4FW1A 8AT1B 4BI4A 3BDUA 5LJ5f 1IZ6A 2DTHA 1VQLT 2J6OA 3MJXA 3RESA 5KCHA 4RTYA 1UEBA 3OYHA 1MV0B 1O9SA 5IT9E 4R55A 2AKLA 3EFRA 2E3HA 1SHFA 1ZSZA 1QVPA 3G1JA 3CCQA 1ZSZC 1VQ6A 2RHYA 3V8LA 3JSCA 3CCJT 1HYOA 3CC4A 4XU0A 1RI9A 1NLPC 2CH4A 1TS9A 4WF2A 2QTVA 2QG9B 2EYWA 2ENMA 2PUKB 3CCLT 2LJ1A 2EYYA 1FMVA 4C0ZA 3CC7Q 2K3BA 1MMAA 1UE9A 1M3BA 1ABOA 1KHCA 4M7DA 2P0KA 4AMCA 5C6SA 4E6RA 3ZEHA 4JLIA 4M7DC 3C12A 4FM4B 1IHWA 3OYDA 1YITA 2FO0A 3G4SQ 1U06A 2XDBA 2X4WA 4C92G 1X6BA 2QA4Q 2QQAA 3G6EA 4M7AA 1NM7A 1N6AA 1Z9ZA 3L1AA 1YHQT 1EIFA 4IUVA 4M7AC 3J80E 1VQ7T 1X6OA 3NHNA 2KBTA 1VQLQ 1V76A 2BZ8A 2CSQA 2QEXQ 1YJ9A 2DYIA 3OYFA 1Y0MA 2D6FA 3JB9G 1HSQA 5GANg 1B34A 3S3MA 1SG5A 1I81A 1BCOA 4BY6C 3CCJQ 3PGGA 2XG8D 3MHXA 3EFSA 4PJOF 2D8HA 2YUOA 4PNOA 3CCRA 2FRWA 1Q82R 1TH7A 2XICA 2K5FA 5DLQE 2DRMA 1ZLMA 4F7UG 4ATOA 4E7IA 5LJ3g 1YWOA 1NZ9A 1Q7YR 4PFPA 5IAYA 2K79A 2DL3A 4PLLA 1QW1A 1JXMA 4RTZA 2V8KA 3JB9I 1RL2A 3PTAA 2BE9B 3JV3A 1MMNA 2BTTA 4YTLA 1LVKA 2JUFA 3TEEA 1YFNA 1UFFA 1ZHIA 1NEGA 4LNPA 2DBMA 4PFOA 1AWXA 1IO6A 2FEIA 1KQ2A 4A4GA 1YHQQ 2CZ6B 4JRPA 1PD1A 1VQ7Q 2PVOB 2CREA 3ASKA 1TWBA 4MZMA 4JUVA 5CIUA 3S6WA 3CPWA 2DXBA 3VV0A 1VQ9A 4JJCA 4PJOE 1MNDA 2FPFA 5A2QE 3HPWA 5IXBA 2JM9A 3SHWA 4E7LA 2AIRB 2V8JA 3VS2A 4Z02A 4IIOA 1GCPA 2KNBB 1ZSZB 5GJWB 2HQXA 2H3JA 2RN8A 2I2LA 1I5OB 2RK2A 3ZL7C 1CKBA 4IKFA 3VRZA 1G3TA 2EQUA 1RADB 3MEAA 3OS1A 2XD0A 5LJ5h 1K9AA 2KI7A 1RAHB 3HRSA 3QWYA 2I0NA 3HP9A 4AFZC 4LXCA 2LVMA 4M7DB 2K7AA 1U8RA 2JXBA 2ZCFB 3Q1JA 2GGRA 3I5SA 2DBKA 4IURA 4DQ2A 2CSIA 2HEQA 5FWCA 3HSBA 1V29B 2DEQA 3E9GA 1BI3A 2RJEA 4M7AB 1ZA1B 3I55Q 1QP2A 2YUPA 4M78A 1JBMA 5GAN8 5GAMg 4M7DD 1SEMA 1TUCA 1VQMT 3A8HB 2RHIA 5HK0A 1D1CA 4J9GA 3V8JA 2CP2A 1LJOA 1YN8A 5KYUA 4FU6A 2RQUA 2EGAA 3JRZA 5C0MA 1N8RR 2EAYA 2FG0A 5GMKh 4M7AD 1B34B 1Q82C 3M4YA 4JS4A 1JJ2A 2D0QB 2KGTA 1Q7YC 3JCMf 4D6WA 4CRIA 3R6NA 2EQMA 4LDVA 3CC7A 4M77F 1YJNT 1VQ4Q 3VYGA 1GFCA 2F2VA 3JCMV 4EMGA 1MGQA 3X20B 4ELZC 2KDSA 4JRQA 1VIFA 3G4SA 3EGUA 2D1XA 1H3HA 2EYXA 2QA4A 1WX6A 2CGHA 2QGFB 1YIJT 4DBHA 1RLPC 1TUDA 2QDYB 2M51A 3E2UA 4DBFA 4DBQA 3CXCP 2F2WA 1G3YA 2MWOA 4Z88A 3PIPA 1K1ZA 2ABLA 2ESWA 2M0YA 1K8AU 1VQLA 1FYNA 1PRLC 2DD4A 2KK4A 2QEXA 5HCKA 4A63B 3RMQA 1UGPB 1UG1A 4OB1B 2F5TX 2KR3A 4E7KA 4ME7A 5GAN7 2E64A 3DB3A 1I1JA 3P8BB 4KGVB 4HVWA 5DM7R 2FPDA 3CCJA 4E7JA 5KYNA 2L3RA 1YJWT 5CKEA 3PVQA 2OJ2A 4PJNA 1KC8R 3CC2T 3CCLA 1QMCA 2V1RA 1UTIA 2KY9A 1KQ1A 4IUTA 1WXTA 3LH0A 3JB9J 3OYYA 2LZ6B 1UGSB 4JRIA 3A8GB 2LQ8A 5EC7A 5FRNA 2DXTA 4JPBW 2ECZA 2VUBA 2CS7A 2MF2A 5CKDA 2H8HA 3GNFB 3PNWC 1YI2Q 1E6HA 5A0DA 1YIJQ 1SPKA 4B9XA 4JDSA 4BE0A 1YHQA 5D6XA 1VQ7A 3M0SA 1VQKT 3JB9H 3JB9F 1WDXA 3A8OB 1W1FA 2RHUA 3EG3A 3FDRA 3WXMB 1E7OA 2KMTA 1WXUA 1PRMC 3QXEB 2RPNA 4M78B 3I9QA 2AKKA 3TREA 1N8RC 2VWFA 4DOVA 2YUQA 2E1HA 4XTZA 3UT1A 1WJSA 1OU8A 3CCST 2E65A 3CCRT 4C92E 1NPPA 5KYUB 1YJWQ 4M75A 5L23A 4M75C 3L2UA 1JB0E 1I4K1 1TTHB 2PVGB 3E1SA 4AFQC 3CC2Q 4OMMA 3QPHA 4M78D 4OB3B 3ZBDA 2RJCA 4RG2A 2HZYA 4NS5A
chains in the Genus database with same CATH topology
1V1CA 1WXBA 2X3XD 2A36A 2DA9A 2CUBA 2DL5A 2CUDA 2PNIA 2DMOA 2O9VA 5IXFA 2FRYA 1S1NA 4JZ4A 3EG0A 1M8MA 4RTVA 2K2MA 1H8KA 2DX1A 4JJBA 2KE9A 2LP5A 1OPLA 1W6XA 1H92A 2ED0A 3VS6A 1ZUKA 2EPDA 2KYBA 2GTOA 2RQVA 2JM8A 1NLOC 2J6OA 1WYXA 4RTYA 2J06A 4Z8AA 2KXCA 2LJ0A 4HXJA 1FMKA 1JO8A 1MV0B 2AKLA 4RTTA 3EHQA 2AZVA 1SHFA 3M0PA 2LJ3A 1KIKA 2EGEA 3A98A 3GBQA 2O31A 1GRIA 1RI9A 1NLPC 2CH4A 4J9IA 3TVTA 2EYWA 2ENMA 2JMCA 1UHFA 3RNJA 2LJ1A 2O9SA 2EYYA 3H0FA 1BK2A 3O5ZA 2O88A 1ABQA 1PKSA 4R0KA 2VVKA 2SRCA 1M3CA 1B07A 2K3BA 2AK5A 5I11A 1UE9A 1M3BA 1X27A 1ABOA 4FSSA 1JEGA 1QWFA 4LN2A 4E6RA 1GBRA 2DJQA 1PHTA 1ZX6A 2FO0A 4F17A 1U06A 2YUNA 3H0HA 1X6BA 1BBZA 1LCKA 1MV3A 1M30A 2GQIA 3IQLA 3THKA 1WA7A 4Z89A 1PKTA 1VYUA 1NM7A 1Z9ZA 5GJVB 4X1VA 3REBB 2DL8A 2CDTA 3NHNA 2KBTA 3NGPA 1K4US 2FPEA 2KRNA 2GTJA 1J3TA 1ARKA 1NYFA 1UGVA 1ZUUA 1GL5A 4DEXA 4AFSC 2BZ8A 2CSQA 3I35A 4ZNXA 3U23A 3UF4A 2VKNA 1Y0MA 1HSQA 4JJDA 2KT8A 1YNZA 4AFUC 4F16A 2J6FA 1HD3A 2JMAA 4RTUA 2D8HA 2PZ1A 2YUOA 2DF6A 2FRWA 3M0TA 4EIKA 3H0IA 2DRMA 1ZLMA 2DNUA 1HJDA 4M4ZA 1M3AA 1PNJA 1YWOA 3I5RA 4OMNA 4J9FA 2KEAA 4OMQA 5IHIA 4HVUA 4ORZA 2K79A 2DL3A 3PVLA 4RUGA 1A0NB 1JXMA 3UATA 4RTZA 1Z9QA 2QDLA 4Y92A 2E5KA 3JV3A 2HDAA 1VYVA 2YT6A 2BTTA 4J9DA 2JT4A 1VYTA 1WI7A 3PE0A 1UFFA 4CC4B 1AD5A 1NEGA 1T0JA 2DBMA 2LMJA 4LNPA 3TSWA 1I0CA 1AWXA 1IO6A 2LNHB 4WCIA 1QKWA 1UECA 2A08A 2FEIA 2C0IA 4QT7A 3VRYA 2L0AA 2CREA 4J9EA 2EYZA 3UA6A 1QKXA 4GLMA 2EGCA 1VA7A 2BZYA 1SSHA 2OI3A 1K0XA 3TSZA 2JTEA 3VS5A 2JW4A 1SRMA 4JJCA 2LQNA 4AG1C 3REAB 2FPFA 5FWBA 5IXBA 2JM9A 2C0TA 2B86A 2DE0X 4ESRA 4OMOA 2SEMA 2D8JA 3SHWA 5ECAA 4D8KA 1T3LA 3VS2A 1Y57A 1ZBJA 4IIOA 1GCQA 1GCPA 2KNBB 1AWJA 1GCQC 1T0HA 4LE9A 5GJWB 1ZSGA 2PTKA 1M27C 2RN8A 2J7IA 1JXOA 3ZL7C 1CKBA 1NG2A 2DYBA 2YDLA 2X3WD 1N5ZA 1ZUYA 3VRZA 2LX7A 2DILA 4CC2A 2DM1A 4OMLA 2ED1A 1K9AA 2RQWA 3M0UA 4J9HA 1AWWA 1RUWA 4D8DA 3QWYA 2KROA 2I0NA 4AFZC 2KYMA 2GNCA 3QWXX 1YCSB 2K7AA 2JXBA 3M0RA 2GGRA 3I5SA 4J9CA 2DBKA 1JU5C 4RTXA 1WFWA 2BZXA 2ROTA 4KRTA 2CSIA 4CC3A 2HEQA 2NWMA 5FWCA 4GBQA 4LUEA 2IIMA 1AOJA 3VS3A 2DLPA 2LQWA 2L3QA 2YUPA 2MCNA 2J05A 1UJYA 1CSKA 1SEMA 1TUCA 2ROLA 4HVVA 4J9GA 1KFZA 2C0OA 1W70A 1YN8A 2EQIA 1QWEA 2RQUA 2EGAA 2F2XA 1QCFA 1UJ0A 1CKAA 1U5SA 2FG0A 3NMZC 4F14A 3VS1A 2W0ZA 3VS4A 1PWTA 1I07A 3FJ5A 2MIOA 2KGTA 1UHCA 2K9GA 2A37A 3R6NA 1JQQA 1OOTA 1GFCA 2F2VA 1B3QA 1AEYA 1KJWA 2AZSA 2DL7A 1T3SA 3M0QA 3EGUA 1YWPA 2D1XA 3EHRA 1H3HA 2EBPA 2J6KA 3VS7A 2EYXA 4CC7A 2MOXA 4HCKA 3LH5A 1WX6A 2CT4A 2CT3A 3UA7A 1NYGA 1X6GA 1RLPC 2EVRA 1GBQA 1TUDA 2M51A 1AZEA 1WLPB 3H41A 4RTWA 2L2PA 2F2WA 4Z88A 5FW9A 3RBBB 2CH4W 3VS0A 4JZ3A 1TG0A 1K1ZA 2ABLA 2ESWA 2EW3A 2M0YA 1FYNA 1PRLC 1UDLA 2KRMA 4LUDA 1OV3A 4IIMA 5HCKA 4A63B 1BB9A 1UG1A 2JS2A 2KT1A 2KXDA 2KR3A 1I1JA 1OEBA 1UUEA 4HVWA 2V1QA 4K11A 2FPDA 1K0SA 2W10A 1X43A 3PVQA 2OJ2A 1AZGB 1YP5A 3CQTA 2NUZA 2V1RA 1UTIA 2RQRA 1GFDA 2EKHA 1WXTA 2LZ6B 5EC7A 1SHGA 2JS0A 1MUZA 1XOVA 2O2OA 3NPFA 4JPBW 2ECZA 4DEYA 2P4RA 2H8HA 2DRKA 2HSPA 1E6HA 2DL4A 2YSQA 1SPKA 3ULRB 1E6GA 1K76A 2RQTA 5IH2A 3SEMA 1AVZC 3KFVA 3M0SA 4J9BA 3C0CA 2RF0A 2GBQA 1WDXA 1NEBA 1G83A 2HCKA 2DVJA 1W1FA 3EG3A 1E7OA 1SRLA 1G2BA 1WXUA 2K6DA 1BU1A 1PRMC 2RPNA 3I9QA 1X2KA 2AKKA 2XMFA 2L3SA 1OPKA 5I22A 4AG2C 2VWFA 3EG1A 2YUQA 3EG2A 4OMPA 2RNAA 1EFNA 2RMOA 1KSWA 2A28A 5IHKA 1U3OA 2G6FX 1AWOA 2OAWA 5L23A 1X2QA 1QLYA 2LCSA 4AFQC 2D0NA 4OMMA 2KRSA 5IHNA 1WIEA 2HBWA 1X69A 2L3PA 1RLQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V1C A;  1WXB A;  2X3X D;  2A36 A;  2DA9 A;  2CUB A;  2DL5 A;  2CUD A;  2PNI A;  2DMO A;  2O9V A;  5IXF A;  2FRY A;  1S1N A;  4JZ4 A;  3EG0 A;  1M8M A;  4RTV A;  2K2M A;  1H8K A;  2DX1 A;  4JJB A;  2KE9 A;  2LP5 A;  1OPL A;  1W6X A;  1H92 A;  2ED0 A;  3VS6 A;  1ZUK A;  2EPD A;  2KYB A;  2GTO A;  2RQV A;  2JM8 A;  1NLO C;  2J6O A;  1WYX A;  4RTY A;  2J06 A;  4Z8A A;  2KXC A;  2LJ0 A;  4HXJ A;  1FMK A;  1JO8 A;  1MV0 B;  2AKL A;  4RTT A;  3EHQ A;  2AZV A;  1SHF A;  3M0P A;  2LJ3 A;  1KIK A;  2EGE A;  3A98 A;  3GBQ A;  2O31 A;  1GRI A;  1RI9 A;  1NLP C;  2CH4 A;  4J9I A;  3TVT A;  2EYW A;  2ENM A;  2JMC A;  1UHF A;  3RNJ A;  2LJ1 A;  2O9S A;  2EYY A;  3H0F A;  1BK2 A;  3O5Z A;  2O88 A;  1ABQ A;  1PKS A;  4R0K A;  2VVK A;  2SRC A;  1M3C A;  1B07 A;  2K3B A;  2AK5 A;  5I11 A;  1UE9 A;  1M3B A;  1X27 A;  1ABO A;  4FSS A;  1JEG A;  1QWF A;  4LN2 A;  4E6R A;  1GBR A;  2DJQ A;  1PHT A;  1ZX6 A;  2FO0 A;  4F17 A;  1U06 A;  2YUN A;  3H0H A;  1X6B A;  1BBZ A;  1LCK A;  1MV3 A;  1M30 A;  2GQI A;  3IQL A;  3THK A;  1WA7 A;  4Z89 A;  1PKT A;  1VYU A;  1NM7 A;  1Z9Z A;  5GJV B;  4X1V A;  3REB B;  2DL8 A;  2CDT A;  3NHN A;  2KBT A;  3NGP A;  1K4U S;  2FPE A;  2KRN A;  2GTJ A;  1J3T A;  1ARK A;  1NYF A;  1UGV A;  1ZUU A;  1GL5 A;  4DEX A;  4AFS C;  2BZ8 A;  2CSQ A;  3I35 A;  4ZNX A;  3U23 A;  3UF4 A;  2VKN A;  1Y0M A;  1HSQ A;  4JJD A;  2KT8 A;  1YNZ A;  4AFU C;  4F16 A;  2J6F A;  1HD3 A;  2JMA A;  4RTU A;  2D8H A;  2PZ1 A;  2YUO A;  2DF6 A;  2FRW A;  3M0T A;  4EIK A;  3H0I A;  2DRM A;  1ZLM A;  2DNU A;  1HJD A;  4M4Z A;  1M3A A;  1PNJ A;  1YWO A;  3I5R A;  4OMN A;  4J9F A;  2KEA A;  4OMQ A;  5IHI A;  4HVU A;  4ORZ A;  2K79 A;  2DL3 A;  3PVL A;  4RUG A;  1A0N B;  1JXM A;  3UAT A;  4RTZ A;  1Z9Q A;  2QDL A;  4Y92 A;  2E5K A;  3JV3 A;  2HDA A;  1VYV A;  2YT6 A;  2BTT A;  4J9D A;  2JT4 A;  1VYT A;  1WI7 A;  3PE0 A;  1UFF A;  4CC4 B;  1AD5 A;  1NEG A;  1T0J A;  2DBM A;  2LMJ A;  4LNP A;  3TSW A;  1I0C A;  1AWX A;  1IO6 A;  2LNH B;  4WCI A;  1QKW A;  1UEC A;  2A08 A;  2FEI A;  2C0I A;  4QT7 A;  3VRY A;  2L0A A;  2CRE A;  4J9E A;  2EYZ A;  3UA6 A;  1QKX A;  4GLM A;  2EGC A;  1VA7 A;  2BZY A;  1SSH A;  2OI3 A;  1K0X A;  3TSZ A;  2JTE A;  3VS5 A;  2JW4 A;  1SRM A;  4JJC A;  2LQN A;  4AG1 C;  3REA B;  2FPF A;  5FWB A;  5IXB A;  2JM9 A;  2C0T A;  2B86 A;  2DE0 X;  4ESR A;  4OMO A;  2SEM A;  2D8J A;  3SHW A;  5ECA A;  4D8K A;  1T3L A;  3VS2 A;  1Y57 A;  1ZBJ A;  4IIO A;  1GCQ A;  1GCP A;  2KNB B;  1AWJ A;  1GCQ C;  1T0H A;  4LE9 A;  5GJW B;  1ZSG A;  2PTK A;  1M27 C;  2RN8 A;  2J7I A;  1JXO A;  3ZL7 C;  1CKB A;  1NG2 A;  2DYB A;  2YDL A;  2X3W D;  1N5Z A;  1ZUY A;  3VRZ A;  2LX7 A;  2DIL A;  4CC2 A;  2DM1 A;  4OML A;  2ED1 A;  1K9A A;  2RQW A;  3M0U A;  4J9H A;  1AWW A;  1RUW A;  4D8D A;  3QWY A;  2KRO A;  2I0N A;  4AFZ C;  2KYM A;  2GNC A;  3QWX X;  1YCS B;  2K7A A;  2JXB A;  3M0R A;  2GGR A;  3I5S A;  4J9C A;  2DBK A;  1JU5 C;  4RTX A;  1WFW A;  2BZX A;  2ROT A;  4KRT A;  2CSI A;  4CC3 A;  2HEQ A;  2NWM A;  5FWC A;  4GBQ A;  4LUE A;  2IIM A;  1AOJ A;  3VS3 A;  2DLP A;  2LQW A;  2L3Q A;  2YUP A;  2MCN A;  2J05 A;  1UJY A;  1CSK A;  1SEM A;  1TUC A;  2ROL A;  4HVV A;  4J9G A;  1KFZ A;  2C0O A;  1W70 A;  1YN8 A;  2EQI A;  1QWE A;  2RQU A;  2EGA A;  2F2X A;  1QCF A;  1UJ0 A;  1CKA A;  1U5S A;  2FG0 A;  3NMZ C;  4F14 A;  3VS1 A;  2W0Z A;  3VS4 A;  1PWT A;  1I07 A;  3FJ5 A;  2MIO A;  2KGT A;  1UHC A;  2K9G A;  2A37 A;  3R6N A;  1JQQ A;  1OOT A;  1GFC A;  2F2V A;  1B3Q A;  1AEY A;  1KJW A;  2AZS A;  2DL7 A;  1T3S A;  3M0Q A;  3EGU A;  1YWP A;  2D1X A;  3EHR A;  1H3H A;  2EBP A;  2J6K A;  3VS7 A;  2EYX A;  4CC7 A;  2MOX A;  4HCK A;  3LH5 A;  1WX6 A;  2CT4 A;  2CT3 A;  3UA7 A;  1NYG A;  1X6G A;  1RLP C;  2EVR A;  1GBQ A;  1TUD A;  2M51 A;  1AZE A;  1WLP B;  3H41 A;  4RTW A;  2L2P A;  2F2W A;  4Z88 A;  5FW9 A;  3RBB B;  2CH4 W;  3VS0 A;  4JZ3 A;  1TG0 A;  1K1Z A;  2ABL A;  2ESW A;  2EW3 A;  2M0Y A;  1FYN A;  1PRL C;  1UDL A;  2KRM A;  4LUD A;  1OV3 A;  4IIM A;  5HCK A;  4A63 B;  1BB9 A;  1UG1 A;  2JS2 A;  2KT1 A;  2KXD A;  2KR3 A;  1I1J A;  1OEB A;  1UUE A;  4HVW A;  2V1Q A;  4K11 A;  2FPD A;  1K0S A;  2W10 A;  1X43 A;  3PVQ A;  2OJ2 A;  1AZG B;  1YP5 A;  3CQT A;  2NUZ A;  2V1R A;  1UTI A;  2RQR A;  1GFD A;  2EKH A;  1WXT A;  2LZ6 B;  5EC7 A;  1SHG A;  2JS0 A;  1MUZ A;  1XOV A;  2O2O A;  3NPF A;  4JPB W;  2ECZ A;  4DEY A;  2P4R A;  2H8H A;  2DRK A;  2HSP A;  1E6H A;  2DL4 A;  2YSQ A;  1SPK A;  3ULR B;  1E6G A;  1K76 A;  2RQT A;  5IH2 A;  3SEM A;  1AVZ C;  3KFV A;  3M0S A;  4J9B A;  3C0C A;  2RF0 A;  2GBQ A;  1WDX A;  1NEB A;  1G83 A;  2HCK A;  2DVJ A;  1W1F A;  3EG3 A;  1E7O A;  1SRL A;  1G2B A;  1WXU A;  2K6D A;  1BU1 A;  1PRM C;  2RPN A;  3I9Q A;  1X2K A;  2AKK A;  2XMF A;  2L3S A;  1OPK A;  5I22 A;  4AG2 C;  2VWF A;  3EG1 A;  2YUQ A;  3EG2 A;  4OMP A;  2RNA A;  1EFN A;  2RMO A;  1KSW A;  2A28 A;  5IHK A;  1U3O A;  2G6F X;  1AWO A;  2OAW A;  5L23 A;  1X2Q A;  1QLY A;  2LCS A;  4AFQ C;  2D0N A;  4OMM A;  2KRS A;  5IHN A;  1WIE A;  2HBW A;  1X69 A;  2L3P A;  1RLQ C; 
#chains in the Genus database with same CATH topology
 2CP7 A;  1S72 T;  1WHL A;  1WXB A;  2X3X D;  5GAO m;  1R0B G;  2VGN A;  2HMA A;  1QP3 A;  2DK3 A;  2FRY A;  3BFM A;  4J6W A;  3C95 A;  3QBY A;  1Q86 U;  2DTI A;  2MAM A;  2KE9 A;  2RO0 A;  2EJG A;  5GAO n;  1AHJ B;  2D9T A;  3VS6 A;  2X35 A;  3I55 A;  3S3N A;  3R6O A;  4KGZ B;  2KYB A;  3SWN A;  2GTO A;  3OQ5 A;  3SWN C;  1VQK Q;  2NYS A;  4F7U E;  2E10 A;  3JCM h;  2KSS A;  3MP1 A;  3L42 A;  1VQ8 T;  3CCV T;  1RAE B;  4MDW A;  1JO8 A;  1SF9 A;  4RTT A;  3VJP A;  3EHQ A;  2EKO A;  2RM4 A;  5GAN f;  2E6Z A;  3M0P A;  5I2M A;  4XAX B;  3GBQ A;  3CCS Q;  1KC8 C;  2O31 A;  4C92 A;  1KQS A;  3GOX A;  4C92 C;  1NJI U;  3OYE A;  1QVF A;  1OX9 A;  5LJ3 f;  3BW1 A;  1M4Z A;  3H0F A;  1IRX A;  3O5Z A;  2O88 A;  1ABQ A;  2G3R A;  1M90 U;  1VQ4 A;  2SRC A;  3PMI A;  3MO8 A;  4NL2 A;  1U1S A;  4KUI A;  4JRK A;  3RIR A;  2IVW A;  1X27 A;  1PG5 B;  4FSS A;  1QWF A;  1S72 Q;  2OTJ T;  2CZ0 B;  2PUO B;  1PHT A;  1ZX6 A;  1VQO T;  5A0G A;  2EQJ A;  2FHD A;  4FYW B;  5GAN 4;  3PMT A;  3H0H A;  5GAN 6;  1M30 A;  2GQI A;  2CP3 A;  3OS2 A;  3IQL A;  4BUG A;  4BDY A;  1VYU A;  5GJV B;  4X1V A;  3REB B;  2RHX A;  2MYS A;  3MEW A;  4DOW A;  4C0G A;  3HL8 A;  1NYF A;  1WHJ A;  1ZUU A;  4BI3 A;  1M1F A;  4F7U A;  4AFS C;  1VQ8 Q;  4ZNX A;  5LJ5 e;  3CCV Q;  3UF4 A;  2Y90 A;  5KCO A;  3CMA T;  5IN1 A;  4XQ3 A;  2Y4X A;  4JJD A;  1YNZ A;  4OB2 B;  1K9M U;  4AFU C;  2ZPF B;  2FZC B;  1HD3 A;  2JMA A;  3P8D A;  1UGQ B;  1LPL A;  5KH6 A;  2CP0 A;  2DF6 A;  3BDL A;  4WTO B;  2K4Y A;  3M0T A;  4J7I A;  4EIK A;  3H0I A;  5D6Y A;  4M75 B;  1HJD A;  2HSE B;  1KG1 A;  4M4Z A;  1M3A A;  1YJN A;  4OMQ A;  4A54 A;  4C8Q G;  3O8V A;  3PVL A;  4XTU A;  2MWP A;  2FZG B;  4M77 G;  1Z9Q A;  3DLM A;  2OTJ Q;  1D1A A;  3QSU A;  2K57 A;  2HKN A;  1VQO Q;  1RAB B;  2JT4 A;  1YI2 A;  1YIJ A;  3PE0 A;  4CC4 B;  2LMJ A;  4M75 D;  1I0C A;  2LNH B;  2HQE A;  1QKW A;  1QVG P;  2YWW A;  5CKH A;  1WPY A;  2E5Q A;  2L0A A;  4FYV B;  2QEX T;  2MK5 A;  3CCE Q;  3DB4 A;  5GAO p;  1QKX A;  4GLM A;  4QVZ A;  5GAM f;  2OI3 A;  4KH1 B;  3SWN B;  3TSZ A;  4XTY A;  3JCM P;  5CQX A;  2JW4 A;  3MP6 A;  2QTX A;  2XDP A;  2LQN A;  4N4H A;  4AG1 C;  1M9S A;  2NUP A;  3L2Q A;  3C4S A;  2B86 A;  4J8O A;  5ECA A;  3CMA Q;  1TSF A;  1U1T A;  2JVV A;  2ZZD A;  1T3L A;  3QYG B;  1YJW A;  1AWJ A;  3CXC A;  2PTK A;  3UDC A;  1M27 C;  2J7I A;  3M5A A;  1Q95 G;  3CC2 A;  5I21 A;  2X3W D;  3AT1 B;  2HL3 A;  1BI0 A;  4C92 B;  1ZUY A;  2LX7 A;  1RAG B;  4RCB A;  4CC2 A;  4E7H A;  1M8V A;  3QII A;  3M0U A;  4J9H A;  1AWW A;  3M59 A;  4JS5 A;  4MMK A;  4C0F A;  1C1A A;  2KYM A;  2LRQ A;  5LJ5 j;  3NTK A;  3GNG A;  4BE2 A;  2EWN A;  5GAN h;  4J9C A;  1JU5 C;  3OBY A;  4C92 D;  4KRT A;  4CC3 A;  2LT1 A;  1IXD A;  4GBQ A;  1AOJ A;  1VQK A;  3VS3 A;  2DLP A;  1MNE A;  4LD6 A;  5KE2 A;  2GCX A;  2MCN A;  4MDX A;  5LJ3 h;  3PIO A;  4JLG A;  2EYQ A;  1X75 C;  2OX7 A;  1R0C B;  4F7U B;  3NTH A;  2L8D A;  2EQI A;  1OX8 A;  3CCS A;  2P84 A;  2BE7 D;  2F5K A;  4F14 A;  3VS1 A;  1KD1 C;  1I07 A;  2DXC A;  3EAE A;  3OW2 P;  1O75 A;  3FRN A;  2X4X A;  3FJ5 A;  5J3B A;  5GMK j;  2K9G A;  3P8H A;  2A37 A;  5CCA A;  2RK1 A;  4BAC A;  1B3Q A;  1S72 A;  4BD3 A;  4XTX A;  1B7T A;  3CPF A;  2EBP A;  3VS7 A;  3MET A;  2Y4Y A;  2MOX A;  4HCK A;  3H8Z A;  2CT4 A;  1ACM B;  2EVR A;  1GBQ A;  3I55 T;  2PU9 B;  1AZE A;  4RTW A;  6AT1 B;  4OGC A;  2QGG A;  2CH4 W;  4JZ3 A;  3RER A;  1DJ7 B;  2EW3 A;  4XU1 A;  3C94 A;  1QVG S;  1UDL A;  3FLG A;  3QG1 A;  4LUD A;  1OV3 A;  3CD6 T;  1VQ8 A;  3CCV A;  2KT1 A;  1EX4 A;  2QAZ A;  1M2V A;  5D7U A;  3JCM J;  1UUE A;  3L2V A;  2NUP B;  2V1Q A;  2W10 A;  1X43 A;  4B6M A;  1AZG B;  4C5G A;  4LDY A;  3H6Z A;  1VQ4 T;  3OYK A;  2RQR A;  1I8F A;  2DJZ A;  4EPC A;  2OTJ A;  1SHG A;  3M9Q A;  2JS0 A;  1VUB A;  2O2O A;  4C5E A;  3DLL A;  5GAM h;  1VQO A;  4XU2 A;  5FU7 C;  4DEY A;  4IUP A;  2OTL Q;  2P4R A;  2DVE A;  2GF7 A;  2E6N A;  4KGX B;  2DIQ A;  1E6G A;  4A4K A;  5IH2 A;  1AVZ C;  4RG8 A;  2RI3 A;  3CCE A;  4J9B A;  3C0C A;  1WJQ A;  3VUZ A;  1RAC B;  1K8A R;  1D3B A;  1RAA B;  2DVJ A;  2EQK A;  1IGQ A;  4PJO A;  3CD6 Q;  4M7D G;  3CBO A;  1SRL A;  4PJO C;  2K6D A;  1BU1 A;  1X01 A;  5FRM A;  1Q81 U;  3CMA A;  4AG2 C;  1PCX A;  3V7C A;  2RNA A;  4BY6 B;  3QUI A;  2RHZ A;  4MML A;  2C06 A;  3HHT B;  2A28 A;  4M7A G;  3VUB A;  4EMK A;  1AWO A;  4FW2 A;  1LNX A;  4J83 A;  4C8Q F;  1R77 A;  1G3S A;  4EMK C;  3UWN A;  8ATC B;  3OYC A;  3M4G A;  3MEV A;  4EMH A;  2L3P A;  2LCL A;  2RA2 A;  3OW2 S;  2P0P A;  1V1C A;  3RMS A;  2DFU A;  1YI2 T;  2CUB A;  2DL5 A;  3BY7 A;  1BI2 A;  2DMO A;  5IXF A;  2F1L A;  1S1N A;  1BCM A;  3EG0 A;  1M8M A;  2LT4 A;  4JJB A;  5GAO q;  3RR6 A;  1OUL A;  2XHC A;  3X28 B;  3UPU A;  1ZUK A;  2MMP A;  1MMD A;  2NLU A;  4N0A A;  2RQV A;  4DA4 A;  4N0A C;  5HK3 A;  1WYX A;  3QJ6 A;  3L2R A;  4A4F A;  2KXC A;  4HXJ A;  4C8Q E;  1IRE B;  3HRT A;  2E41 A;  4M77 E;  1OU9 A;  2PVD B;  2LJ3 A;  4JJN K;  5CVI A;  3LX7 A;  1QVG A;  1M2V B;  3JCM b;  1VIE A;  1GRI A;  1Y71 A;  1M1G A;  3TVT A;  4F04 B;  3RKW A;  4ZGE B;  2O01 E;  1UHF A;  2JZ2 A;  1KHI A;  3RKY A;  1PKS A;  3J7A F;  2RD1 A;  2GFU A;  2VVK A;  3EH1 A;  1M3C A;  3OY9 A;  1LOJ A;  2AK5 A;  3SFM A;  5I11 A;  1JEG A;  4LN2 A;  2QQS A;  2DJQ A;  4BDZ A;  1N27 A;  4F17 A;  3HFN A;  3OMC A;  3E19 A;  5FU7 B;  1BBZ A;  1XNI A;  2HBP A;  4Z89 A;  3ER0 A;  4UC4 A;  2K3X A;  2X4J A;  2DL8 A;  3J81 E;  1BIA A;  1IGU A;  3OYB A;  1W2B P;  1K4U S;  2FPE A;  2FB7 A;  2MI6 A;  1ARK A;  2CP6 A;  1UGV A;  2VV5 A;  5LJ5 d;  7AT1 B;  1GL5 A;  4DEX A;  1MHN A;  3M54 A;  4FIB A;  5GMK i;  3I35 A;  1D3B B;  2KQW A;  2COZ A;  3KUF A;  1OI1 A;  4PJO B;  4C8Q A;  3OYI A;  4C8Q C;  2R5A A;  4M77 A;  1XTD A;  4M77 C;  5CKB A;  3LGL A;  5GAN e;  4TVR A;  2J6F A;  4RTU A;  4R56 A;  2X4Y A;  4ZN3 A;  2PZ1 A;  2VAS A;  1NJI R;  2DEU A;  4EMK B;  3CC4 Q;  3GIB A;  3LWH A;  4M78 G;  1M90 R;  3I5R A;  4J9F A;  5IHI A;  4HKE A;  4PJO D;  4J7F A;  4ORZ A;  2BIV A;  5GAO l;  2EIF A;  2M02 A;  4RUG A;  3DKM A;  3UAT A;  4BI8 B;  2OTL A;  2YT6 A;  4HCC A;  1WI7 A;  2ZAE A;  2K5I A;  3TSW A;  2P4T A;  5KYW A;  3OYG A;  2A08 A;  5DLO A;  3OYJ A;  4QT7 A;  1NBE B;  1FWZ A;  1WZO A;  1M1K U;  3M55 A;  4J9E A;  2HNI A;  1RI0 A;  2YXY A;  3UA6 A;  5FLX E;  3CD6 A;  2BZY A;  2LCC A;  2JTE A;  3MCA B;  1SRM A;  1WGS A;  1WNL A;  3REA B;  5FWB A;  2LNV A;  2DE0 X;  2P0Q A;  3OYA A;  2D8J A;  4D8K A;  2XID A;  2ZPG B;  2HD0 A;  1K9M R;  4LE9 A;  1ZSG A;  1H64 1;  1N9S A;  4A4E A;  1JXO A;  4XK8 E;  1D09 B;  5CQY A;  2DYB A;  1N5Z A;  1Y07 A;  1WHH A;  2R5M A;  2DIL A;  3CME T;  2WSE E;  3A8L B;  2RI5 A;  2R57 A;  2ED1 A;  2X51 A;  2RQW A;  3CBM A;  2XDD A;  1RUW A;  3VU3 C;  3OSV A;  2QQ9 A;  2GNC A;  1K73 U;  2VGM A;  1WQ7 A;  4L59 A;  3OBW A;  5KE3 A;  1GXI E;  3FEO A;  2DKG A;  2HAX A;  4PJJ A;  4RTX A;  2BZX A;  5CO7 A;  3CCE T;  1WHM A;  3EGD A;  4M7D F;  3QZ5 B;  5GAN j;  4LUE A;  2IIM A;  1RAI B;  1TXQ A;  3NTI A;  4NOY A;  4L5G A;  3OB9 A;  4FT2 A;  5KYX A;  2L3Q A;  1VQN T;  1ZBX A;  2RB6 A;  2J05 A;  9ATC B;  1CSK A;  2LDM A;  4M7A F;  2ROL A;  4HVV A;  3VKI A;  1W2B S;  2XKO C;  1KFZ A;  1W70 A;  2DD5 A;  1QWE A;  1OZ2 A;  2VB6 A;  2E70 A;  2F2X A;  2EJF A;  1UJ0 A;  2RJD A;  1CKA A;  4C8Q B;  3NMZ C;  1NJI C;  2LTO A;  4M77 B;  2W0Z A;  1PWT A;  1FXX A;  2MIO A;  3I56 T;  1UHC A;  1TU0 B;  2RJF A;  1JQQ A;  1OOT A;  2DPP B;  2JTF A;  3CME Q;  4RCC A;  1AEY A;  3LGF A;  1KJW A;  2DZ9 A;  2DL7 A;  4M7D E;  3M0Q A;  3EHR A;  4CC7 A;  4M77 D;  3LH5 A;  5GMK e;  4FSX A;  2EFI A;  3NFC A;  1WLP B;  3CPW S;  2L2P A;  3E9F A;  4M7A E;  2AHJ B;  3M57 A;  4ZGD B;  3RBB B;  4ZTJ A;  1KK7 A;  3VS0 A;  5KYW B;  3GLX A;  1AT1 B;  4PJL A;  1XJW B;  3L2Z A;  1QCO A;  1VQN Q;  1YCY A;  3QO3 A;  1BB9 A;  2JS2 A;  3ME9 A;  5J39 A;  4PK4 A;  1PD0 A;  1K9M C;  3EG9 B;  4ZN1 A;  4PJM A;  4FCY A;  3EFO A;  1K0S A;  4DBR A;  1YP5 A;  4FL6 A;  3CQT A;  1HXD A;  3MKD A;  3I56 Q;  1VQP T;  1GFD A;  5L8R E;  2EKH A;  1D0X A;  3JCM d;  2K5L A;  1KD1 U;  2JJ9 A;  1IHV A;  4LD9 K;  3M58 A;  3JCM c;  1MUZ A;  3NPF A;  1JRI A;  2YRC A;  2E12 A;  5GAN 3;  2EJ9 A;  1Y7X A;  3TQ7 P;  2FZK B;  4VUB A;  4A4H A;  5CKF A;  2YSQ A;  2DL4 A;  3EH2 A;  3ULR B;  5GAM j;  3M56 A;  2LX9 A;  1ZA2 B;  4NL3 A;  1SKU B;  2RF0 A;  3EGD B;  3SDZ A;  2GBQ A;  3EGX A;  1D0Y A;  1NEB A;  3SD4 A;  4C5I A;  1G83 A;  1M5Q 1;  1FMW A;  5GAN 2;  1G2B A;  4HCZ A;  3OS5 A;  5KYX B;  3L2W A;  3QJY A;  3X24 B;  2L3S A;  1OPK A;  5I22 A;  5HKC A;  3JB9 D;  3EG1 A;  1JJ2 S;  2RMO A;  5M9O A;  4M78 F;  5IHK A;  1U3O A;  1MMG A;  4HT8 A;  1X2Q A;  1QLY A;  1W2B A;  1R8O B;  2HL5 C;  3JCM Q;  2D0N A;  2KRS A;  5IHN A;  2GFA A;  5GAN 5;  1WIE A;  4V2S A;  1VQP Q;  2A3L A;  4OGE A;  3CCL Q;  4B9W A;  2OTL T;  2A36 A;  2DA9 A;  2JOY A;  2F69 A;  3MPU B;  3G71 T;  2CUD A;  2K2V A;  2PNI A;  3TCJ A;  2O9V A;  2YLC A;  4JZ4 A;  4RTV A;  2K2M A;  4KBM B;  2DX1 A;  2LP5 A;  3JCM X;  1OPL A;  2WAC A;  1G5V A;  3LLR A;  3AHU A;  4II1 A;  2EPD A;  2JM8 A;  1NPR A;  2CYZ B;  4QW2 A;  1NLO C;  4N4G A;  3LWI A;  1KQS P;  1WQW A;  4M78 E;  3OYL A;  2J06 A;  3BE3 A;  4Z8A A;  2LJ0 A;  1QVF P;  1FMK A;  4FYX B;  1F1B B;  2KVQ G;  2ZPE B;  1Q81 R;  2AZV A;  2QQR A;  2DTO A;  3X26 B;  1KIK A;  2EGE A;  1XQH A;  5J26 A;  3A98 A;  3INZ A;  4QVD A;  1W4S A;  1OQK A;  2XK0 A;  4J9I A;  3EFO B;  1Q82 U;  2JMC A;  4X9D A;  3RNJ A;  3HTR A;  2XU8 A;  1UB4 A;  2O9S A;  2CZ1 B;  3G7Z A;  1BK2 A;  3LYI A;  4OF1 A;  4R0K A;  3JCM e;  1Q7Y U;  3CME A;  3CCM T;  3QZ9 B;  1B07 A;  1WHG A;  4J5Y A;  1GBR A;  3FJP A;  3RDV A;  4AT1 B;  2AT1 B;  2VYT A;  3G71 Q;  1BKB A;  3WVD B;  2YUN A;  1G8X A;  1TOV A;  1LCK A;  1MV3 A;  3THK A;  1WA7 A;  4FYY B;  1PKT A;  3LW5 E;  3PFS A;  2V26 A;  3V7S A;  4QKU A;  1Y96 A;  2DIG A;  1I5L A;  2CDT A;  2FL7 A;  3A1P A;  3NGP A;  3SB2 A;  2KRN A;  5LJ5 g;  2GTJ A;  1VQN A;  3CCU T;  1J3T A;  3GP8 A;  3QDR B;  3EGX B;  2OAU A;  3U23 A;  2VKN A;  4BE1 A;  4M78 C;  2NUT A;  2O4X A;  4XTW A;  2KT8 A;  2QQB A;  4RKU E;  3MEU A;  5GAN d;  2ZPB B;  3T9N A;  4KH0 B;  2HKQ B;  4E2F B;  4F16 A;  1D1B A;  5D6W A;  3WVE B;  4QVC A;  3I56 A;  2DNU A;  3OSS C;  3URG A;  1PNJ A;  1BI1 A;  4OMN A;  2KEA A;  4XTV A;  1NE8 A;  5LJ3 d;  4HVU A;  3CCM Q;  4BB7 A;  1A0N B;  3KXT A;  2BUD A;  4M75 F;  4ANJ A;  2QDL A;  4Y92 A;  2E5K A;  1IB8 A;  2L5Q A;  2HDA A;  1VYV A;  2H3E B;  1RAF B;  4X9C A;  4J9D A;  1VYT A;  4KUD K;  3CBP A;  3JAM E;  1AD5 A;  4PL6 A;  1T0J A;  1C6V X;  2HQH A;  4O5V A;  2FVU A;  4WCI A;  2CKK A;  3RUX A;  1UEC A;  2LQK A;  4PLI A;  2C0I A;  4C0D C;  3VRY A;  1VQ5 T;  3KBG A;  2EYZ A;  3OYM A;  4QQ6 A;  2EGC A;  1VA7 A;  3CCU Q;  4EDU A;  1SSH A;  1K0X A;  3HKS A;  1FX7 A;  3OMG A;  3VS5 A;  2VC8 A;  1Q81 C;  4E47 A;  2CP5 A;  1UGR B;  1BYM A;  1PM3 A;  2C0T A;  4ESR A;  4OMO A;  2SEM A;  4LDX A;  4X34 A;  1KQS S;  1VQM Q;  1Y57 A;  3CCQ T;  2DAQ A;  1ZBJ A;  1N8R U;  1GCQ A;  1VQ6 T;  1QVF S;  2XI9 A;  4HA8 A;  1GCQ C;  1T0H A;  4OP0 A;  1N9R A;  3FIF A;  3CC4 T;  4KT0 E;  4RMO A;  4M75 E;  4A53 A;  1NG2 A;  1ZQ1 A;  2YDL A;  5A0L A;  1VQP A;  1TUG B;  4O6J A;  5CK9 A;  2QK0 A;  3S3O A;  2VXE A;  2BKD N;  2DM1 A;  4OML A;  2DO3 A;  4MZT A;  2K3Y A;  5FU6 C;  4C92 F;  4D8D A;  1YJN Q;  1BIB A;  2KRO A;  1Q86 R;  4XU3 A;  2R58 A;  2ZPI B;  1YIT T;  3QWX X;  3D7S B;  1YCS B;  4PKC C;  2WSC E;  3M0R A;  4ZTF A;  1EZZ B;  3CEY A;  4E7S A;  1K8A C;  1WFW A;  3G6E T;  2JN0 A;  2ROT A;  2NWM A;  3X25 B;  5CR2 A;  1VQ5 Q;  1M1K R;  3V8K A;  2DET A;  2KAF A;  2LQW A;  1QQJ A;  1Y96 B;  1G3W A;  2L89 A;  5DY9 A;  1UJY A;  4IUQ A;  1YJ9 T;  3A8M B;  2RH2 A;  5GAM d;  5FRO A;  4GLK A;  1HK9 A;  2QAS A;  2C0O A;  4ZGJ B;  5KYY A;  2A7Y A;  2B8A A;  1QCF A;  2IPO B;  3CCQ Q;  1VQ6 Q;  4KUL A;  1U5S A;  2NUT B;  2O4X B;  4FT4 A;  4F7U F;  1KC8 U;  3VS4 A;  5AYF A;  4QQD A;  5AT1 B;  2WSF E;  2ATC B;  5LL6 S;  4MZP A;  2E3I A;  1H3Z A;  2MPX C;  3FB9 A;  5LJ3 e;  3V7R A;  4P5N A;  1PC0 A;  4PJO G;  4L6V 5;  2AZS A;  2RI2 A;  3CPW P;  5CAI A;  3QKJ A;  3OA6 A;  3G71 A;  1T3S A;  1YWP A;  1OZ3 A;  2J6K A;  3A5Z B;  1YIT Q;  4OB0 B;  3OW2 A;  2YLB A;  4QQG A;  1P92 A;  1K73 R;  2CT3 A;  3UA7 A;  1NYG A;  1X6G A;  3QHS A;  4Y28 E;  3H41 A;  3M53 A;  3G6E Q;  1D0Z A;  3H9N A;  4GY5 A;  5FW9 A;  2PQW A;  1TG0 A;  4C0D B;  4J6Y A;  3EG9 A;  3PT9 A;  2M1H A;  2VXF A;  2KRM A;  4IIM A;  5EG2 A;  2DER A;  3JCM W;  1VQ9 T;  2X9H A;  4HCB A;  1PSF A;  2DXU A;  2KXD A;  1YJ9 Q;  3CXC S;  2GQV A;  1OEB A;  2COY A;  1WHK A;  2E4H A;  4K11 A;  2M0O A;  4IUU A;  3GPL A;  4E7Z A;  5GAO r;  2A0F B;  1M2O A;  3VYH B;  2YRD A;  1OYX A;  2ZGW A;  2NUZ A;  3CCR Q;  3RKX A;  2DZC A;  5I2S A;  2QYZ A;  3JCM g;  3CCM A;  1YBY A;  4HT9 A;  1Q86 C;  3N5B B;  2COW A;  1XOV A;  3HFO A;  4C5H A;  5FU6 B;  1VOM A;  2IG0 A;  2DRK A;  2HSP A;  2JNG A;  2QXF A;  2YHT A;  2LC4 A;  1K76 A;  2RQT A;  3SEM A;  2M16 A;  1M1K C;  3QDF A;  3QYH B;  3KFV A;  4LDU A;  5HY6 A;  1JJ2 P;  3CCU A;  2HCK A;  1SSF A;  4CI0 C;  4N4I A;  5LJ3 j;  5GAM e;  1VQ9 Q;  3OS0 A;  4J6X A;  1X2K A;  1QCN A;  2XMF A;  4LDW A;  4PFZ A;  3MP8 A;  1C0M A;  1VQM A;  2JTM A;  2Z0W A;  3EG2 A;  4OMP A;  1EFN A;  1KSW A;  1WJR A;  1PSE A;  4OMF B;  3GF5 A;  1M90 C;  2G6F X;  4ELY C;  5KYY B;  2OAW A;  3HRU A;  3OYN A;  2LCS A;  2M9U A;  3TU4 K;  2V8I A;  2HBW A;  3ZFJ A;  3CC7 T;  1X69 A;  4C8Q D;  1RLQ C;  2FYK A;  1KD1 R;  4OVA A;  3FC3 A;  1K73 C;  3G4S T;  2CZ7 B;  4M75 G;  2QA4 T;  2ZPH B;  5GMK m;  1H8K A;  5GMK l;  2YRV A;  1W6X A;  1H92 A;  3F70 A;  4Q5W A;  2ED0 A;  1VQ5 A;  4Y91 A;  2QI2 A;  4FW1 A;  8AT1 B;  4BI4 A;  3BDU A;  5LJ5 f;  1IZ6 A;  2DTH A;  1VQL T;  2J6O A;  3MJX A;  3RES A;  5KCH A;  4RTY A;  1UEB A;  3OYH A;  1MV0 B;  1O9S A;  5IT9 E;  4R55 A;  2AKL A;  3EFR A;  2E3H A;  1SHF A;  1ZSZ A;  1QVP A;  3G1J A;  3CCQ A;  1ZSZ C;  1VQ6 A;  2RHY A;  3V8L A;  3JSC A;  3CCJ T;  1HYO A;  3CC4 A;  4XU0 A;  1RI9 A;  1NLP C;  2CH4 A;  1TS9 A;  4WF2 A;  2QTV A;  2QG9 B;  2EYW A;  2ENM A;  2PUK B;  3CCL T;  2LJ1 A;  2EYY A;  1FMV A;  4C0Z A;  3CC7 Q;  2K3B A;  1MMA A;  1UE9 A;  1M3B A;  1ABO A;  1KHC A;  4M7D A;  2P0K A;  4AMC A;  5C6S A;  4E6R A;  3ZEH A;  4JLI A;  4M7D C;  3C12 A;  4FM4 B;  1IHW A;  3OYD A;  1YIT A;  2FO0 A;  3G4S Q;  1U06 A;  2XDB A;  2X4W A;  4C92 G;  1X6B A;  2QA4 Q;  2QQA A;  3G6E A;  4M7A A;  1NM7 A;  1N6A A;  1Z9Z A;  3L1A A;  1YHQ T;  1EIF A;  4IUV A;  4M7A C;  3J80 E;  1VQ7 T;  1X6O A;  3NHN A;  2KBT A;  1VQL Q;  1V76 A;  2BZ8 A;  2CSQ A;  2QEX Q;  1YJ9 A;  2DYI A;  3OYF A;  1Y0M A;  2D6F A;  3JB9 G;  1HSQ A;  5GAN g;  1B34 A;  3S3M A;  1SG5 A;  1I81 A;  1BCO A;  4BY6 C;  3CCJ Q;  3PGG A;  2XG8 D;  3MHX A;  3EFS A;  4PJO F;  2D8H A;  2YUO A;  4PNO A;  3CCR A;  2FRW A;  1Q82 R;  1TH7 A;  2XIC A;  2K5F A;  5DLQ E;  2DRM A;  1ZLM A;  4F7U G;  4ATO A;  4E7I A;  5LJ3 g;  1YWO A;  1NZ9 A;  1Q7Y R;  4PFP A;  5IAY A;  2K79 A;  2DL3 A;  4PLL A;  1QW1 A;  1JXM A;  4RTZ A;  2V8K A;  3JB9 I;  1RL2 A;  3PTA A;  2BE9 B;  3JV3 A;  1MMN A;  2BTT A;  4YTL A;  1LVK A;  2JUF A;  3TEE A;  1YFN A;  1UFF A;  1ZHI A;  1NEG A;  4LNP A;  2DBM A;  4PFO A;  1AWX A;  1IO6 A;  2FEI A;  1KQ2 A;  4A4G A;  1YHQ Q;  2CZ6 B;  4JRP A;  1PD1 A;  1VQ7 Q;  2PVO B;  2CRE A;  3ASK A;  1TWB A;  4MZM A;  4JUV A;  5CIU A;  3S6W A;  3CPW A;  2DXB A;  3VV0 A;  1VQ9 A;  4JJC A;  4PJO E;  1MND A;  2FPF A;  5A2Q E;  3HPW A;  5IXB A;  2JM9 A;  3SHW A;  4E7L A;  2AIR B;  2V8J A;  3VS2 A;  4Z02 A;  4IIO A;  1GCP A;  2KNB B;  1ZSZ B;  5GJW B;  2HQX A;  2H3J A;  2RN8 A;  2I2L A;  1I5O B;  2RK2 A;  3ZL7 C;  1CKB A;  4IKF A;  3VRZ A;  1G3T A;  2EQU A;  1RAD B;  3MEA A;  3OS1 A;  2XD0 A;  5LJ5 h;  1K9A A;  2KI7 A;  1RAH B;  3HRS A;  3QWY A;  2I0N A;  3HP9 A;  4AFZ C;  4LXC A;  2LVM A;  4M7D B;  2K7A A;  1U8R A;  2JXB A;  2ZCF B;  3Q1J A;  2GGR A;  3I5S A;  2DBK A;  4IUR A;  4DQ2 A;  2CSI A;  2HEQ A;  5FWC A;  3HSB A;  1V29 B;  2DEQ A;  3E9G A;  1BI3 A;  2RJE A;  4M7A B;  1ZA1 B;  3I55 Q;  1QP2 A;  2YUP A;  4M78 A;  1JBM A;  5GAN 8;  5GAM g;  4M7D D;  1SEM A;  1TUC A;  1VQM T;  3A8H B;  2RHI A;  5HK0 A;  1D1C A;  4J9G A;  3V8J A;  2CP2 A;  1LJO A;  1YN8 A;  5KYU A;  4FU6 A;  2RQU A;  2EGA A;  3JRZ A;  5C0M A;  1N8R R;  2EAY A;  2FG0 A;  5GMK h;  4M7A D;  1B34 B;  1Q82 C;  3M4Y A;  4JS4 A;  1JJ2 A;  2D0Q B;  2KGT A;  1Q7Y C;  3JCM f;  4D6W A;  4CRI A;  3R6N A;  2EQM A;  4LDV A;  3CC7 A;  4M77 F;  1YJN T;  1VQ4 Q;  3VYG A;  1GFC A;  2F2V A;  3JCM V;  4EMG A;  1MGQ A;  3X20 B;  4ELZ C;  2KDS A;  4JRQ A;  1VIF A;  3G4S A;  3EGU A;  2D1X A;  1H3H A;  2EYX A;  2QA4 A;  1WX6 A;  2CGH A;  2QGF B;  1YIJ T;  4DBH A;  1RLP C;  1TUD A;  2QDY B;  2M51 A;  3E2U A;  4DBF A;  4DBQ A;  3CXC P;  2F2W A;  1G3Y A;  2MWO A;  4Z88 A;  3PIP A;  1K1Z A;  2ABL A;  2ESW A;  2M0Y A;  1K8A U;  1VQL A;  1FYN A;  1PRL C;  2DD4 A;  2KK4 A;  2QEX A;  5HCK A;  4A63 B;  3RMQ A;  1UGP B;  1UG1 A;  4OB1 B;  2F5T X;  2KR3 A;  4E7K A;  4ME7 A;  5GAN 7;  2E64 A;  3DB3 A;  1I1J A;  3P8B B;  4KGV B;  4HVW A;  5DM7 R;  2FPD A;  3CCJ A;  4E7J A;  5KYN A;  2L3R A;  1YJW T;  5CKE A;  3PVQ A;  2OJ2 A;  4PJN A;  1KC8 R;  3CC2 T;  3CCL A;  1QMC A;  2V1R A;  1UTI A;  2KY9 A;  1KQ1 A;  4IUT A;  1WXT A;  3LH0 A;  3JB9 J;  3OYY A;  2LZ6 B;  1UGS B;  4JRI A;  3A8G B;  2LQ8 A;  5EC7 A;  5FRN A;  2DXT A;  4JPB W;  2ECZ A;  2VUB A;  2CS7 A;  2MF2 A;  5CKD A;  2H8H A;  3GNF B;  3PNW C;  1YI2 Q;  1E6H A;  5A0D A;  1YIJ Q;  1SPK A;  4B9X A;  4JDS A;  4BE0 A;  1YHQ A;  5D6X A;  1VQ7 A;  3M0S A;  1VQK T;  3JB9 H;  3JB9 F;  1WDX A;  3A8O B;  1W1F A;  2RHU A;  3EG3 A;  3FDR A;  3WXM B;  1E7O A;  2KMT A;  1WXU A;  1PRM C;  3QXE B;  2RPN A;  4M78 B;  3I9Q A;  2AKK A;  3TRE A;  1N8R C;  2VWF A;  4DOV A;  2YUQ A;  2E1H A;  4XTZ A;  3UT1 A;  1WJS A;  1OU8 A;  3CCS T;  2E65 A;  3CCR T;  4C92 E;  1NPP A;  5KYU B;  1YJW Q;  4M75 A;  5L23 A;  4M75 C;  3L2U A;  1JB0 E;  1I4K 1;  1TTH B;  2PVG B;  3E1S A;  4AFQ C;  3CC2 Q;  4OMM A;  3QPH A;  4M78 D;  4OB3 B;  3ZBD A;  2RJC A;  4RG2 A;  2HZY A;  4NS5 A; 
#chains in the Genus database with same CATH homology
 1V1C A;  1WXB A;  2X3X D;  2A36 A;  2DA9 A;  2CUB A;  2DL5 A;  2CUD A;  2PNI A;  2DMO A;  2O9V A;  5IXF A;  2FRY A;  1S1N A;  4JZ4 A;  3EG0 A;  1M8M A;  4RTV A;  2K2M A;  1H8K A;  2DX1 A;  4JJB A;  2KE9 A;  2LP5 A;  1OPL A;  1W6X A;  1H92 A;  2ED0 A;  3VS6 A;  1ZUK A;  2EPD A;  2KYB A;  2GTO A;  2RQV A;  2JM8 A;  1NLO C;  2J6O A;  1WYX A;  4RTY A;  2J06 A;  4Z8A A;  2KXC A;  2LJ0 A;  4HXJ A;  1FMK A;  1JO8 A;  1MV0 B;  2AKL A;  4RTT A;  3EHQ A;  2AZV A;  1SHF A;  3M0P A;  2LJ3 A;  1KIK A;  2EGE A;  3A98 A;  3GBQ A;  2O31 A;  1GRI A;  1RI9 A;  1NLP C;  2CH4 A;  4J9I A;  3TVT A;  2EYW A;  2ENM A;  2JMC A;  1UHF A;  3RNJ A;  2LJ1 A;  2O9S A;  2EYY A;  3H0F A;  1BK2 A;  3O5Z A;  2O88 A;  1ABQ A;  1PKS A;  4R0K A;  2VVK A;  2SRC A;  1M3C A;  1B07 A;  2K3B A;  2AK5 A;  5I11 A;  1UE9 A;  1M3B A;  1X27 A;  1ABO A;  4FSS A;  1JEG A;  1QWF A;  4LN2 A;  4E6R A;  1GBR A;  2DJQ A;  1PHT A;  1ZX6 A;  2FO0 A;  4F17 A;  1U06 A;  2YUN A;  3H0H A;  1X6B A;  1BBZ A;  1LCK A;  1MV3 A;  1M30 A;  2GQI A;  3IQL A;  3THK A;  1WA7 A;  4Z89 A;  1PKT A;  1VYU A;  1NM7 A;  1Z9Z A;  5GJV B;  4X1V A;  3REB B;  2DL8 A;  2CDT A;  3NHN A;  2KBT A;  3NGP A;  1K4U S;  2FPE A;  2KRN A;  2GTJ A;  1J3T A;  1ARK A;  1NYF A;  1UGV A;  1ZUU A;  1GL5 A;  4DEX A;  4AFS C;  2BZ8 A;  2CSQ A;  3I35 A;  4ZNX A;  3U23 A;  3UF4 A;  2VKN A;  1Y0M A;  1HSQ A;  4JJD A;  2KT8 A;  1YNZ A;  4AFU C;  4F16 A;  2J6F A;  1HD3 A;  2JMA A;  4RTU A;  2D8H A;  2PZ1 A;  2YUO A;  2DF6 A;  2FRW A;  3M0T A;  4EIK A;  3H0I A;  2DRM A;  1ZLM A;  2DNU A;  1HJD A;  4M4Z A;  1M3A A;  1PNJ A;  1YWO A;  3I5R A;  4OMN A;  4J9F A;  2KEA A;  4OMQ A;  5IHI A;  4HVU A;  4ORZ A;  2K79 A;  2DL3 A;  3PVL A;  4RUG A;  1A0N B;  1JXM A;  3UAT A;  4RTZ A;  1Z9Q A;  2QDL A;  4Y92 A;  2E5K A;  3JV3 A;  2HDA A;  1VYV A;  2YT6 A;  2BTT A;  4J9D A;  2JT4 A;  1VYT A;  1WI7 A;  3PE0 A;  1UFF A;  4CC4 B;  1AD5 A;  1NEG A;  1T0J A;  2DBM A;  2LMJ A;  4LNP A;  3TSW A;  1I0C A;  1AWX A;  1IO6 A;  2LNH B;  4WCI A;  1QKW A;  1UEC A;  2A08 A;  2FEI A;  2C0I A;  4QT7 A;  3VRY A;  2L0A A;  2CRE A;  4J9E A;  2EYZ A;  3UA6 A;  1QKX A;  4GLM A;  2EGC A;  1VA7 A;  2BZY A;  1SSH A;  2OI3 A;  1K0X A;  3TSZ A;  2JTE A;  3VS5 A;  2JW4 A;  1SRM A;  4JJC A;  2LQN A;  4AG1 C;  3REA B;  2FPF A;  5FWB A;  5IXB A;  2JM9 A;  2C0T A;  2B86 A;  2DE0 X;  4ESR A;  4OMO A;  2SEM A;  2D8J A;  3SHW A;  5ECA A;  4D8K A;  1T3L A;  3VS2 A;  1Y57 A;  1ZBJ A;  4IIO A;  1GCQ A;  1GCP A;  2KNB B;  1AWJ A;  1GCQ C;  1T0H A;  4LE9 A;  5GJW B;  1ZSG A;  2PTK A;  1M27 C;  2RN8 A;  2J7I A;  1JXO A;  3ZL7 C;  1CKB A;  1NG2 A;  2DYB A;  2YDL A;  2X3W D;  1N5Z A;  1ZUY A;  3VRZ A;  2LX7 A;  2DIL A;  4CC2 A;  2DM1 A;  4OML A;  2ED1 A;  1K9A A;  2RQW A;  3M0U A;  4J9H A;  1AWW A;  1RUW A;  4D8D A;  3QWY A;  2KRO A;  2I0N A;  4AFZ C;  2KYM A;  2GNC A;  3QWX X;  1YCS B;  2K7A A;  2JXB A;  3M0R A;  2GGR A;  3I5S A;  4J9C A;  2DBK A;  1JU5 C;  4RTX A;  1WFW A;  2BZX A;  2ROT A;  4KRT A;  2CSI A;  4CC3 A;  2HEQ A;  2NWM A;  5FWC A;  4GBQ A;  4LUE A;  2IIM A;  1AOJ A;  3VS3 A;  2DLP A;  2LQW A;  2L3Q A;  2YUP A;  2MCN A;  2J05 A;  1UJY A;  1CSK A;  1SEM A;  1TUC A;  2ROL A;  4HVV A;  4J9G A;  1KFZ A;  2C0O A;  1W70 A;  1YN8 A;  2EQI A;  1QWE A;  2RQU A;  2EGA A;  2F2X A;  1QCF A;  1UJ0 A;  1CKA A;  1U5S A;  2FG0 A;  3NMZ C;  4F14 A;  3VS1 A;  2W0Z A;  3VS4 A;  1PWT A;  1I07 A;  3FJ5 A;  2MIO A;  2KGT A;  1UHC A;  2K9G A;  2A37 A;  3R6N A;  1JQQ A;  1OOT A;  1GFC A;  2F2V A;  1B3Q A;  1AEY A;  1KJW A;  2AZS A;  2DL7 A;  1T3S A;  3M0Q A;  3EGU A;  1YWP A;  2D1X A;  3EHR A;  1H3H A;  2EBP A;  2J6K A;  3VS7 A;  2EYX A;  4CC7 A;  2MOX A;  4HCK A;  3LH5 A;  1WX6 A;  2CT4 A;  2CT3 A;  3UA7 A;  1NYG A;  1X6G A;  1RLP C;  2EVR A;  1GBQ A;  1TUD A;  2M51 A;  1AZE A;  1WLP B;  3H41 A;  4RTW A;  2L2P A;  2F2W A;  4Z88 A;  5FW9 A;  3RBB B;  2CH4 W;  3VS0 A;  4JZ3 A;  1TG0 A;  1K1Z A;  2ABL A;  2ESW A;  2EW3 A;  2M0Y A;  1FYN A;  1PRL C;  1UDL A;  2KRM A;  4LUD A;  1OV3 A;  4IIM A;  5HCK A;  4A63 B;  1BB9 A;  1UG1 A;  2JS2 A;  2KT1 A;  2KXD A;  2KR3 A;  1I1J A;  1OEB A;  1UUE A;  4HVW A;  2V1Q A;  4K11 A;  2FPD A;  1K0S A;  2W10 A;  1X43 A;  3PVQ A;  2OJ2 A;  1AZG B;  1YP5 A;  3CQT A;  2NUZ A;  2V1R A;  1UTI A;  2RQR A;  1GFD A;  2EKH A;  1WXT A;  2LZ6 B;  5EC7 A;  1SHG A;  2JS0 A;  1MUZ A;  1XOV A;  2O2O A;  3NPF A;  4JPB W;  2ECZ A;  4DEY A;  2P4R A;  2H8H A;  2DRK A;  2HSP A;  1E6H A;  2DL4 A;  2YSQ A;  1SPK A;  3ULR B;  1E6G A;  1K76 A;  2RQT A;  5IH2 A;  3SEM A;  1AVZ C;  3KFV A;  3M0S A;  4J9B A;  3C0C A;  2RF0 A;  2GBQ A;  1WDX A;  1NEB A;  1G83 A;  2HCK A;  2DVJ A;  1W1F A;  3EG3 A;  1E7O A;  1SRL A;  1G2B A;  1WXU A;  2K6D A;  1BU1 A;  1PRM C;  2RPN A;  3I9Q A;  1X2K A;  2AKK A;  2XMF A;  2L3S A;  1OPK A;  5I22 A;  4AG2 C;  2VWF A;  3EG1 A;  2YUQ A;  3EG2 A;  4OMP A;  2RNA A;  1EFN A;  2RMO A;  1KSW A;  2A28 A;  5IHK A;  1U3O A;  2G6F X;  1AWO A;  2OAW A;  5L23 A;  1X2Q A;  1QLY A;  2LCS A;  4AFQ C;  2D0N A;  4OMM A;  2KRS A;  5IHN A;  1WIE A;  2HBW A;  1X69 A;  2L3P A;  1RLQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...