3FJ5A

Crystal structure of the c-src-sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Intertwined dimeric structure for the SH3 domain of the c-Src tyrosine kinase induced by polyethylene glycol binding
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 6
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A01
1E7OA 1UHFA 4JPBW 1GFCA 1NLPC 3O5ZA 3EGUA 3IQLA 1ZUYA 2GTOA 2KRSA 2O9SA 2DE0X 3I5SA 1K1ZA 2CDTA 3JV3A 1TUDA 3FJ5A 3VS7A 2X3WD 2DL8A 3H41A 2DMOA 1U06A 1MV3A 3U23A 4AFQC 1QWEA 1A0NB 1WA7A 1H3HA 2YUOA 4FSSA 1X27A 4J9DA 1SHGA 1UECA 1M3AA 5IHKA 2A37A 1PKSA 3A98A 4HXJA 4D8DA 4OMNA 3VS3A 1WXUA 4QT7A 1QCFA 2RQWA 1Y57A 1MUZA 1ARKA 1HD3A 3LH5A 2F2WA 4HVUA 3VRYA 1E6GA 1NEGA 1FMKA 2CH4W 1B07A 1OEBA 2DA9A 2LNHB 2PNIA 2RMOA 3I9QA 1K0SA 2AZVA 1YP5A 1OOTA 1VYTA 2EW3A 2JS2A 2V1QA 3M0QA 1AWJA 3QWYA 2GBQA 4RTWA 1OV3A 2HDAA 1AOJA 2KE9A 4RTTA 4F17A 1EFNA 2F2XA 2KYMA 4RTYA 4F16A 2DYBA 1UJ0A 2B86A 1RUWA 2K7AA 2HCKA 2L3SA 2CSIA 1WLPB 4GBQA 2BTTA 4J9CA 4JJBA 2AKLA 1AEYA 2DX1A 2FRYA 2LZ6B 4RUGA 3SHWA 1BU1A 1WXBA 1WI7A 2OJ2A 2RQUA 4JJCA 1GL5A 2VWFA 2L3PA 2KR3A 3SEMA 2KEAA 3TSWA 2ESWA 2GNCA 2YSQA 2EYWA 2A36A 2DILA 1PRLC 2GGRA 3PE0A 4AG1C 5GJWB 3UA6A 3EG1A 1K4US 2CT4A 2J6FA 2KGTA 3NHNA 1T0HA 2VVKA 2W10A 4E6RA 2LP5A 2O2OA 2IIMA 3M0UA 4J9BA 1M3BA 1KFZA 2SEMA 1JU5C 1UHCA 4CC2A 1K9AA 1AZEA 2K79A 2XMFA 1WX6A 1Z9ZA 4Z89A 3RBBB 1BBZA 3I35A 1FYNA 5IH2A 3H0FA 1GCQC 1H8KA 4HVVA 2G6FX 3VS4A 4WCIA 1AWWA 2YUQA 1I07A 4LE9A 1AWXA 2DRMA 1MV0B 2LJ0A 1SEMA 3ZL7C 2DBMA 2LX7A 2JMCA 1WIEA 1I1JA 1M8MA 2L0AA 4HCKA 1IO6A 2LJ3A 1QLYA 1M30A 4LUDA 3VS6A 2EYZA 2O31A 1SPKA 2KRMA 1X69A 1W1FA 5FWBA 2LQWA 1M27C 3EHQA 2EGAA 2D8JA 2BZ8A 4ORZA 1LCKA 1BB9A 4JZ4A 1NYFA 1AVZC 2ED1A 2H8HA 1X43A 3REBB 2KT1A 5IHIA 1ZUKA 3NMZC 1SRMA 1VYVA 2CT3A 2GQIA 2EYXA 2ABLA 1T3LA 2D1XA 2MOXA 5ECAA 2C0TA 2CREA 1OPKA 3VRZA 1XOVA 3UATA 2KT8A 3GBQA 2A28A 2JM9A 2JMAA 2M0YA 1UUEA 1ABOA 1X6BA 1GBRA 2EPDA 2KBTA 1NEBA 4ESRA 1HJDA 1CSKA 4LN2A 1V1CA 2DF6A 2YDLA 4OMPA 2AKKA 2W0ZA 2DL3A 5IHNA 4RTVA 2DL5A 4IIOA 1ZUUA 2OAWA 1JXOA 4M4ZA 4Z8AA 4R0KA 2D0NA 1VYUA 2NUZA 3KFVA 1UDLA 3M0SA 1YWOA 2CSQA 2CH4A 1AD5A 2J6KA 2KROA 4AFZC 2MCNA 5IXBA 2PTKA 4CC3A 4AG2C 3TSZA 3PVQA 2LCSA 2AZSA 1YCSB 2KNBB 1E6HA 5EC7A 1JQQA 2JT4A 2ROTA 4AFSC 2M51A 2JW4A 1SRLA 2BZYA 2D8HA 2CUDA 4J9EA 1T0JA 2FO0A 1NYGA 2K2MA 1ZBJA 4DEYA 1AZGB 2ENMA 1JEGA 1X2QA 2DVJA 5I22A 1QKXA 3EHRA 4ZNXA 2QDLA 1T3SA 2LMJA 1GFDA 1G2BA 2RPNA 1UE9A 1JO8A 2EBPA 2EGCA 1W70A 2RQRA 2SRCA 3EG3A 2RNAA 1K76A 4OMLA 2CUBA 4HVWA 2I0NA 1SHFA 2X3XD 1VA7A 4OMOA 5L23A 4IIMA 1WDXA 2J7IA 2C0OA 1UG1A 4X1VA 1PRMC 1WFWA 1PKTA 1UGVA 4GLMA 4JZ3A 3H0HA 1SSHA 2K6DA 1B3QA 2HSPA 1H92A 2J6OA 5I11A 2KYBA 1M3CA 1CKBA 4OMQA 1GCPA 2JTEA 2C0IA 3TVTA 1GBQA 1QWFA 2FG0A 2RN8A 1YWPA 2PZ1A 5FW9A 2EYYA 3VS1A 2L2PA 1ZSGA 1UTIA 4DEXA 2L3QA 3VS0A 1PHTA 1YNZA 2DJQA 3EG0A 4J9HA 1JXMA 5HCKA 4CC7A 1K0XA 2A08A 3CQTA 2FEIA 3R6NA 4K11A 1Y0MA 1W6XA 1ABQA 1RLQC 2FPEA 2J05A 4JJDA 1TUCA 3NGPA 3VS5A 4AFUC 2DRKA 3REAB 1RI9A 1CKAA 2LQNA 1WXTA 2AK5A 4OMMA 4J9GA 1HSQA 2BZXA 3ULRB 1ZLMA 1KSWA 5GJVB 2J06A 4EIKA 1U5SA 4RTUA 2LJ1A 4LUEA 4Y92A 2F2VA 3EG2A 2O88A 2MIOA 1N5ZA 1X6GA 4RTXA 4A63B 5IXFA 2EKHA 2O9VA 2YT6A 2NWMA 2DL7A 1RLPC 1J3TA 1KIKA 3UA7A 3C0CA 3M0TA 4F14A 3PVLA 3I5RA 1BK2A 2ROLA 1QKWA 2V1RA 2FPDA 1Z9QA 1TG0A 1YN8A 2DL4A 2E5KA 2DBKA 3THKA 1PNJA 2GTJA 1GCQA 1NM7A 3M0RA 3RNJA 3VS2A 2JM8A 1U3OA 1UJYA 2P4RA 1G83A 4Z88A 2EVRA 2RF0A 1NG2A 1PWTA 2KRNA 4J9IA 2DLPA 2EGEA 1GRIA 2JS0A 1NLOC 2HBWA 5FWCA 1ZX6A 1X2KA 1WYXA 1UFFA 2ED0A 3NPFA 2RQVA 1I0CA 2JXBA 3QWXX 4D8KA 2KXDA 4CC4B 2KXCA 1AWOA 1OPLA 2ECZA 4J9FA 2FPFA 2K3BA 1KJWA 2VKNA 2K9GA 2RQTA 3M0PA 4RTZA 2DNUA 2HEQA 3UF4A 4LNPA 2DM1A 3H0IA 1S1NA 2FRWA 2YUPA 2OI3A 2YUNA 4KRTA 2EQIA
chains in the Genus database with same CATH superfamily
1GFCA 4NL2A 4AMCA 2RHIA 3OW2A 4XU3A 2YLCA 3CCRQ 3V8LA 5KYWB 2O9SA 1Q7YR 1OYXA 1TUDA 2DL8A 2JJ9A 1VQ5A 3QSUA 1X01A 4F7UA 2BE7D 1A0NB 1Y71A 2CYZB 4QVDA 4OB1B 4LDVA 2YUOA 4J9DA 1H3HA 3KXTA 3JCMP 2CZ6B 4IUVA 5IHKA 4OMFB 3CCUT 5FU6C 3H9NA 3EFSA 2PVOB 4ME7A 3OYAA 1WXUA 3X28B 3X24B 3JCMf 1MUZA 1HD3A 1BCMA 1Q82C 2RA2A 8ATCB 3VRYA 2CH4W 2DA9A 2RMOA 1B07A 2LNHB 4OMOA 5CKBA 2K2VA 1MNEA 2JNGA 4M7AA 2LX9A 3QYHB 2V1QA 2XK0A 5GANh 3RIRA 4Z02A 1AWJA 4E2FB 1O75A 2FL7A 2CZ0B 2XHCA 1AOJA 2HSEB 3TCJA 1N9SA 2XKOC 2F2XA 2KYMA 4RTYA 2DYBA 4ELYC 1UJ0A 4FYVB 2K7AA 3LH0A 3GF5A 4M78A 5IAYA 2DZ9A 2BTTA 1RAFB 3EGXB 1WNLA 4OB2B 2OJ2A 2VWFA 2L3PA 2KR3A 3SEMA 2KEAA 2JVVA 2DILA 5CQXA 5A2QE 1PRLC 1RADB 1VQ6T 4A53A 1IGUA 1MMNA 1NPPA 3MPUB 3CC7A 4FIBA 3TU4K 4R56A 2KGTA 3BE3A 3NHNA 5J3BA 4BDYA 5LJ5e 4J9BA 1M3BA 2E6ZA 1QCOA 2NUPB 2HD0A 5LJ5j 2K79A 2DO3A 3RUXA 3H6ZA 4Z89A 2QEXT 3DB4A 4QVZA 4C0DB 3L2RA 4HVVA 2V8IA 4WCIA 2I2LA 4LE9A 4M7DC 2QG9B 1SG5A 2EAYA 1WIEA 2KQWA 1I1JA 2IG0A 1SSFA 1YITT 2P0QA 3JAME 4M7DF 1QLYA 1M30A 3HRSA 4PJOB 3E1SA 1B34A 3HP9A 5GAOm 4B6MA 3FJPA 1KQ2A 1X69A 3PNWC 5LJ3e 4M75G 3SFMA 3OYFA 2M16A 1YJWT 3MP8A 2CZ1B 3EH2A 5LJ3j 1M90U 4XTWA 1K9MU 2KAFA 5L8RE 2MF2A 3EGDB 1VQOT 3M59A 3OYGA 3CD6T 2GQIA 1UGQB 4FW2A 4J8OA 3JCMc 2MOXA 2XG8D 3PTAA 2CP6A 4FCYA 3VRZA 1IRXA 3JCMg 3UATA 1S72A 3GBQA 2JM9A 5GAOq 1VQLT 4ESRA 4P5NA 4LN2A 1KQSP 3EFOA 3HSBA 2DF6A 4RKUE 2MI6A 3I56A 5GAMh 2A3LA 2FZCB 3V7SA 1ZUUA 2OAWA 4R0KA 1YI2A 5GANf 4JLIA 4KGXB 3OYIA 2O01E 4C92B 3HKSA 3JCMQ 2KROA 4JLGA 4AG2C 1WHKA 3CXCS 3PVQA 3BDLA 4JS5A 1YCSB 3HFNA 1U1SA 4M77C 4BE0A 2JT4A 2YWWA 4JRIA 2FZGB 2JW4A 4FYYB 4M77F 1VQ8Q 1YITQ 3CCLA 4BD3A 3QO3A 3OYLA 4DEYA 4RCBA 1RAGB 1I8FA 2EQKA 5I22A 1W2BA 1ZSZB 3EHRA 3QDRB 5GMKi 1T3SA 2P0PA 1G2BA 3RDVA 2QA4A 1UE9A 1WZOA 2EBPA 3GNFB 1QP3A 4FT4A 2XDBA 2OTLQ 4HKEA 8AT1B 4HVWA 3QDFA 3JB9J 3OSVA 3ASKA 1VA7A 3GNGA 2J7IA 4F7UE 1VQOQ 1NZ9A 2C0OA 1UG1A 2CKKA 4DBHA 1WFWA 2JZ2A 3VJPA 2OX7A 2E1HA 4ATOA 5CQYA 5FU6B 3J7AF 2KYBA 2F69A 1VQLQ 3L2VA 1IHWA 4RCCA 4M75A 3OYJA 1GBQA 2FG0A 4BY6C 1YWPA 4XU1A 2PZ1A 5FW9A 3MJXA 5GAN2 5FU7C 2L2PA 5D7UA 1ZSGA 1UTIA 4OGCA 4M7AE 2L3QA 2LNVA 1Y07A 5KYUA 1C0MA 4J9HA 3G71T 4CC7A 3CQTA 2RI3A 3CC2A 1KD1R 2E3IA 4BI8B 3S3MA 4M78E 2DRKA 4MDWA 1KC8U 1JB0E 4DBRA 3REAB 1RI9A 2DXTA 1CKAA 4OMMA 2YRDA 1Q86R 2M02A 2EKOA 4ZTJA 3L1AA 4IUUA 4J5YA 1KSWA 5GANg 4O5VA 5GAMf 4OVAA 4C8QD 2ZCFB 1M1KR 4LUEA 3Q1JA 2K4YA 3I55A 1Q82U 3CC4A 1QW1A 3EG9B 4MZPA 1RLPC 1GXIE 1KIKA 3UA7A 2NLUA 4F14A 4L6V5 2E6NA 1BCOA 4Y28E 3C12A 3ME9A 2G3RA 1Z9QA 5I2SA 2DL4A 2DBKA 1VQPA 4C0FA 3CPFA 1PNJA 2BIVA 1GCQA 3M0RA 4XU0A 3RNJA 3VS2A 3OMGA 1U3OA 1VQ4T 2QQRA 3QJ6A 1NJIC 3M56A 2KRNA 4J9IA 5KE3A 1NLOC 1ZX6A 1X2KA 1YBYA 3CCEA 1WYXA 2XU8A 2R5MA 2JTMA 2L5QA 1WJRA 1PG5B 3G4ST 1QVPA 2R58A 2ZPGB 2KXDA 4CC4B 1OI1A 1AWOA 2K3BA 2RQTA 3NTHA 4RTZA 2HAXA 1MMDA 1Q81R 3CCST 5GAOp 2DM1A 3V7RA 5GMKh 2OI3A 3G71Q 3OW2P 1IZ6A 4PJOD 1M4ZA 3CMEA 4KRTA 4XQ3A 4C0ZA 3M55A 5KYYB 3RESA 3EGUA 1PC0A 1ZUYA 1VQNA 3G7ZA 1NE8A 3CCQT 2DKGA 1QVFS 1PCXA 3RKYA 3FJ5A 3VS7A 2XICA 2DMOA 4F7UB 5GAN5 2M1HA 1QWEA 1VQKA 1BIAA 3FB9A 1OQKA 1MGQA 1TH7A 1M3AA 1D0ZA 1VQ9T 1PKSA 3CCRT 5FRMA 1TOVA 3VS3A 4M75C 2RQWA 3T9NA 1R0BG 4BDZA 2F2WA 5I2MA 5GAMg 2PUOB 2PNIA 1OEBA 3CCJA 2YHTA 3ZEHA 1TS9A 4JRQA 1YP5A 4M7AB 2B8AA 4M77B 3M0QA 3QKJA 2CP3A 1TWBA 4KUIA 1VQ4Q 1KG1A 2HDAA 2QTVA 2KE9A 1IREB 4F17A 4C92D 2B86A 4V2SA 4N0AA 4M78B 2HCKA 3CCVA 1MMAA 2OTJT 2RHYA 2CSIA 3L2WA 1WLPB 4GBQA 4J9CA 5CO7A 1G3SA 3OS5A 1TU0B 3G4SQ 1VQ5T 2RQUA 4JJCA 1GL5A 4KGVB 2ESWA 2YSQA 4DOWA 2EYWA 3OMCA 3RMSA 4A4EA 3F70A 3PE0A 3SWNC 1K4US 3PGGA 2W10A 2LP5A 2WACA 2ZGWA 2IIMA 1JJ2S 2QI2A 1VUBA 5CKDA 2RM4A 4EMKA 2MMPA 3N5BB 3DLLA 4CC2A 2RHUA 3E19A 1AZEA 3BY7A 4FT2A 2XMFA 4MMKA 1WX6A 2F1LA 1BBZA 1FYNA 1GCQC 2LQKA 2KMTA 2O4XA 1SF9A 2RB6A 4M75E 3VS4A 1AWXA 3NFCA 2F5KA 3CCQQ 1MV0B 4BY6B 1YHQQ 3ZL7C 2JMCA 5FU7B 1M8MA 2IPOB 2Y4YA 4HCKA 5LJ3d 3P8DA 1NPRA 1ZSZC 4PJLA 5LJ5h 1G3WA 1B34B 4IUPA 3VS6A 1O9SA 5DLOA 2O31A 1VQ9Q 1VOMA 1I5OB 3OBYA 3A5ZB 2ZPEB 5FWBA 2D8JA 1M1FA 2DXUA 5A0GA 1KC8C 4IUTA 1LOJA 4JZ4A 1MHNA 3D7SB 4PK4A 1AVZC 1X43A 3NMZC 4WTOB 2RD1A 2CT3A 3NTIA 1OU9A 1X6OA 5ECAA 2C0TA 2VXFA 1OPKA 1M2VA 2MWOA 4HCBA 1X75C 1XOVA 1G8XA 2KT8A 2JMAA 1UUEA 1ABOA 1RAHB 2EPDA 4TVRA 2OTJQ 5CVIA 3V8KA 5LJ3h 3EFOB 1V1CA 3LWHA 2GCXA 1VQ5Q 2AKKA 3OS1A 3OY9A 2DL5A 4IIOA 2YRVA 1JXOA 4M4ZA 4Z8AA 4C8QG 4HT8A 1VYUA 1D09B 1VQ7A 1KK7A 2RH2A 1HK9A 2CH4A 3FRNA 1K8AR 4ZN1A 3E2UA 2DZCA 4ZTFA 4XTZA 3PMIA 3TSZA 1IXDA 2XD0A 2AZSA 4GY5A 1AT1B 2KNBB 4DA4A 2H3JA 4FYXB 3G6EA 5EC7A 3OSSC 4DBQA 2Z0WA 4AFSC 3VUBA 4XTYA 4M7DD 2BZYA 3EAEA 2CUDA 4J9EA 1T0JA 2K2MA 4LXCA 1LPLA 1W2BP 2QK0A 5DM7R 2VYTA 1WGSA 2PVGB 2HL3A 2E5QA 4LDYA 2ENMA 1JEGA 1X2QA 1K73R 3I56T 2PQWA 4ZNXA 1NJIU 1D3BA 2RPNA 4EMGA 3O8VA 5HK0A 4KH0B 1YI2T 2JN0A 1EIFA 3CCUA 2GF7A 1VQ8T 4KUDK 2E65A 3CCMT 2I0NA 3C95A 2QXFA 4O6JA 4IIMA 1WDXA 4X1VA 1PRMC 1UGVA 3X26B 4CI0C 5LJ5f 4JZ3A 3H0HA 2DIGA 4PJOG 1B3QA 2DEUA 1H92A 1QQJA 2QTXA 1MNDA 2OTLT 2LRQA 1M3CA 5CKHA 4OMQA 4LDXA 1UGPB 2JTEA 3TVTA 1WHLA 4M75B 3X20B 2LCCA 1I5LA 5LL6S 3VS1A 5DY9A 3JCMW 2EJGA 4PLLA 5KYUB 1Q7YC 3JSCA 1WHJA 2DJQA 1YNZA 3EG0A 5DLQE 5GANe 2H3EB 3A8MB 4K11A 1RAEB 1Y0MA 2AIRB 1W6XA 2QA4T 3RMQA 1TUCA 4N4HA 1VQ6A 1BIBA 4PJNA 4AFUC 5GAN8 2L89A 2CP0A 1D0XA 1W4SA 4J9GA 4IURA 1VQMA 1HSQA 5LJ3f 3CEYA 1N27A 3M4YA 4X9CA 5GJVB 4F7UF 3OS0A 4EIKA 4YTLA 1KQSS 4Y92A 4B9WA 3SB2A 4FSXA 4M77D 4C8QA 3SWNB 2QEXA 1Y96A 2F2VA 4E7LA 1X6GA 2EKHA 2O9VA 4C92G 2QQSA 3OYMA 3P8BB 3L2UA 3I56Q 2C06A 4M7AC 5I21A 1BK2A 2ROLA 4LD9K 1QKWA 1C6VX 4KULA 1TG0A 2DAQA 7AT1B 4X34A 3CPWP 3H8ZA 3JB9F 4JS4A 1LVKA 2K5IA 1YI2Q 3CMAT 4M7AF 2JM8A 1FXXA 3CCMQ 4M78C 4ANJA 1NG2A 1GRIA 1YJWA 4EDUA 4M78F 2BKDN 3CPWS 3JB9H 4JRPA 1UGSB 3QXEB 3NPFA 4EPCA 1OZ3A 3LGLA 4B9XA 2NUPA 3CD6A 3J81E 5AT1B 3MCAB 2EJ9A 2KXCA 3ER0A 1SKUB 2ECZA 4J9FA 3CC4T 2VKNA 1IHVA 3PT9A 3CCLQ 3OYDA 5LJ5g 5CK9A 2VV5A 4LNPA 1M90R 1K9MR 2YUPA 1OX8A 3DB3A 3R6OA 1IGQA 4QKUA 1EX4A 2QA4Q 4PJOA 1C1AA 1VQPT 1E7OA 1ZA2B 4JPBW 1NLPC 4XAXB 3O5ZA 3WVEB 1YJNT 2WSEE 2KRSA 2DE0X 3I5SA 3JV3A 2X3WD 3JRZA 3H41A 3RR6A 3CCET 1MV3A 4E7SA 2HQHA 3PIOA 1PD0A 2COZA 1U1TA 4QQ6A 2ZPHB 2PU9B 1ZA1B 5C6SA 1UECA 3EGDA 2A37A 3FIFA 4D8DA 2VXEA 1OZ2A 4BE1A 2X9HA 5LJ3g 3JB9I 1QCFA 5HKCA 1ARKA 4HVUA 3BDUA 1FWZA 1NEGA 1FMKA 2DD5A 4EMHA 2DYIA 5IN1A 1F1BB 2AZVA 3CMAQ 3INZA 3MKDA 3QWYA 3J80E 2GBQA 4RTWA 3CMET 3CC2Q 4RTTA 2L3RA 1EFNA 1UEBA 3URGA 1YJ9T 4F16A 2DVEA 1DJ7B 3CXCA 4C92A 2DFUA 5FLXE 4KGZB 2DX1A 2FRYA 3SHWA 4BUGA 1LNXA 1BU1A 2GFAA 1WXBA 3OYEA 4IUQA 2GNCA 5CCAA 2GGRA 4AG1C 1U8RA 3CC4Q 2CT4A 2J6FA 3MEAA 2VVKA 2EQJA 2VUBA 2O2OA 4M7DG 4BB7A 3A8GB 2VC8A 4PLIA 3LLRA 2SEMA 1UHCA 1QVGP 1K9AA 2QAZA 3G1JA 1Z9ZA 1VQPQ 3RBBB 4XTUA 4N4GA 4PFPA 3H0FA 1YJNQ 4XU2A 2O4XB 1YIJT 1AWWA 3JCMb 1I07A 2DRMA 2KK4A 1QVGS 3LW5E 5D6YA 4LDWA 2VGMA 3CCEQ 4J6YA 1I4K1 1H641 1HXDA 1TSFA 2KVQG 3GIBA 3UT1A 1I81A 1KHCA 1WJSA 4L59A 1SPKA 3S6WA 2KRMA 1FX7A 1W1FA 3HRUA 3GLXA 2EGAA 1YHQT 3OW2S 2BZ8A 2DIQA 5GAN3 1LCKA 1N8RR 4ZN3A 1BB9A 1NYFA 3A1PA 2ED1A 5GMKl 2H8HA 4OGEA 1FMVA 1RL2A 4C8QE 3CMEQ 1QCNA 1T3LA 3VYGA 5KCHA 2CREA 4OB0B 1M2VB 3ZFJA 4JRKA 2E4HA 2LCLA 1Q82R 1YJ9Q 2M0YA 1GBRA 2KBTA 3QUIA 1Q7YU 1NBEB 1KD1C 1HJDA 4J6WA 4M75F 3S3NA 2DL3A 5IHNA 4RTVA 1M1GA 1Q86C 2ATCB 2RHZA 2XDPA 2EQMA 2RK2A 4M77G 1UDLA 1YWOA 3OBWA 2CSQA 1M1KC 3GP8A 2MCNA 3TQ7P 5IXBA 2LQ8A 3CCJQ 2QQAA 3EG9A 3CCSA 2LCSA 4C5GA 2PUKB 5EG2A 3M5AA 3SDZA 1YIJQ 3OYHA 2V26A 2KDSA 4J83A 5KYXA 3AT1B 2L8DA 3OQ5A 2D8HA 2QASA 1TTHB 1NYGA 3CCVQ 3EFRA 1V76A 4M7DA 3OB9A 3CCQA 1ACMB 1AZGB 4PJOE 1LJOA 1QKXA 1D3BB 3CBMA 2LMJA 1GFDA 1OULA 4BI3A 1JO8A 2EGCA 1VQ9A 1XNIA 4RG8A 2RNAA 1K76A 2VGNA 2K3XA 3CCRA 2DPPB 1SHFA 4X9DA 4GLKA 4FM4B 2QGFB 3MHXA 3VYHB 5GAOl 3S3OA 2D6FA 2Y90A 3LGFA 4QW2A 4GLMA 1Q81C 1BKBA 1PM3A 1SSHA 1HYOA 2K6DA 3EH1A 3JCMe 5HK3A 3CC7T 4BI4A 2XDDA 3C4SA 1GCPA 2FB7A 5GANd 5CR2A 2DERA 1QVFA 5KYYA 2RN8A 3QYGB 4MMLA 2OTJA 5CKFA 2WSFE 4C5EA 2MWPA 2X4YA 1EZZB 2RI2A 1PHTA 1OU8A 2A08A 2FEIA 3R6NA 3A8OB 1N8RC 1ABQA 2JTFA 4JJDA 3LYIA 5GMKm 3NGPA 3MP6A 3OYCA 2JOYA 2DXBA 4C92E 2LQNA 2AK5A 4L5GA 3X25B 4QQGA 2BZXA 3QZ5B 4FYWB 2KI7A 2QGGA 1WHHA 4PFZA 4ZGEB 1U5SA 4RTUA 2LJ1A 4C8QB 2FZKB 4PNOA 3VU3C 1Y96B 2V8JA 4CRIA 2O88A 4M77A 1N5ZA 4A63B 4OB3B 2GFUA 4NOYA 2NWMA 4Y91A 3CBPA 1J3TA 3C0CA 1BI3A 1XQHA 2X4WA 3VV0A 4BE2A 3I5RA 2V1RA 2FPDA 1XTDA 3C94A 4ZGJB 1YN8A 2CP2A 1R8OB 2GTJA 1S72T 1VQ7Q 2CZ7B 1D1BA 4OP0A 1UJYA 2DD4A 2E70A 4N0AC 3P8HA 1JJ2A 2RF0A 4QQDA 2HKNA 2DLPA 2JS0A 4HCCA 4IKFA 2FHDA 2HBWA 3MP1A 3LWIA 3OYBA 5FWCA 4KBMB 1VQMT 3E9FA 2HQXA 2ED0A 2QQBA 2PVDB 5CKEA 1Q95G 2RQVA 1G3TA 4A4HA 3G6EQ 1W2BS 3CC7Q 4PJMA 1I0CA 2JXBA 5IT9E 3QWXX 2F5TX 2MYSA 1OPLA 1WPYA 2NUTA 5FRNA 1KJWA 4EMKC 3UDCA 2K9GA 5D6XA 5KCOA 2YXYA 1D1AA 3H0IA 2ZPBB 1RACB 1S1NA 2FRWA 2YRCA 5A0DA 2YUNA 2E3HA 1YFNA 1G5VA 2QQ9A 4KT0E 1UHFA 1RAAB 5GAMd 5J39A 1WHGA 3E9GA 2DTIA 1RAIB 3CCUQ 3IQLA 2DJZA 2DTHA 1M2OA 3CCLT 2GTOA 6AT1B 1RABB 5KYWA 5CAIA 4XTVA 3ZBDA 3KUFA 5KE2A 1G3YA 1K1ZA 2CDTA 2KY9A 1U06A 2K3YA 3QZ9B 3U23A 4AFQC 3UPUA 1WA7A 2RI5A 1QP2A 2AT1B 2COWA 3MO8A 1X27A 4FSSA 1SHGA 5GANj 3RKXA 3QPHA 2CGHA 3A98A 4Q5WA 4HXJA 2E12A 2M9UA 3WVDB 3QJYA 4LDUA 3GOXA 4OMNA 4QT7A 1Y57A 3M54A 3LH5A 2RO0A 2V8KA 1E6GA 4BACA 3RKWA 3I9QA 3JB9D 1K0SA 4M7AD 3QG1A 2X4XA 1OOTA 1VYTA 2EW3A 2JS2A 1S72Q 2RK1A 1KD1U 1OV3A 3OYNA 3CXCP 2BE9B 2LT1A 1WHMA 3M57A 4UC4A 3LX7A 1VQ6Q 4M78D 4M7DE 1RUWA 2VASA 1VQ8A 1YITA 2L3SA 3CCMA 1Q86U 1JRIA 4E7KA 1VQMQ 2ZPIB 2DXCA 3QBYA 2P4TA 4JJBA 3FEOA 2AKLA 3EGXA 1AEYA 2LZ6B 4RUGA 1K8AC 3HHTB 2DK3A 2DEQA 1XJWB 1MMGA 2HMAA 1WI7A 1M1KU 2E41A 3CC2T 2HL5C 3TSWA 1NJIR 3BW1A 4C0GA 1P92A 2A36A 2QEXQ 5M9OA 1D1CA 2OTLA 2BUDA 5GJWB 5HY6A 3UA6A 2CS7A 3EG1A 2HNIA 3PMTA 2DTOA 1T0HA 4E6RA 4NL3A 4DQ2A 1PD1A 3M0UA 4OF1A 4HCZA 2QYZA 4N4IA 1KFZA 3PFSA 1JU5C 1VQOA 2AHJB 3HTRA 2ZZDA 3JCMX 4DBFA 2VB6A 3I55T 3I35A 1K73C 5IH2A 3QIIA 1UB4A 1H8KA 4F04B 4D6WA 1VQLA 2MPXC 1BI1A 2G6FX 2IVWA 2YUQA 4JDSA 4FU6A 2LJ0A 1IB8A 1SEMA 2DBMA 2LX7A 2EWNA 1YJWQ 3RERA 2L0AA 4PL6A 3V8JA 1IO6A 2MAMA 2LJ3A 2A7YA 2QDYB 4LUDA 2D0QB 1UGRB 3V7CA 2EYZA 4E7IA 2Y4XA 3CD6Q 2R5AA 3HL8A 3HFOA 2P0KA 2LQWA 1M27C 3EHQA 4ORZA 3FLGA 5GAMe 3CBOA 5GAOr 1Q81U 3L2QA 3REBB 2KT1A 5IHIA 1ZUKA 5GAMj 1SRMA 1R77A 1VYVA 2EYXA 2ABLA 2D1XA 4M77E 4RMOA 3CMAA 2A28A 1KHIA 2JUFA 1X6BA 1Y7XA 1NEBA 2FVUA 2R57A 2MK5A 1CSKA 1D0YA 2X51A 4RG2A 9ATCB 5D6WA 2YDLA 4OMPA 1N8RU 1PSFA 2W0ZA 2WSCE 5A0LA 3A8LB 1BI0A 4NS5A 1KQSA 4A4KA 2P84A 2D0NA 2NUZA 4C5HA 4DOVA 2K57A 3KFVA 3M0SA 3M9QA 1B7TA 1VQNT 3TEEA 3L42A 1AD5A 2J6KA 4J7FA 4HA8A 3SWNA 4AFZC 2PTKA 4CC3A 3BFMA 1VQKT 1BI2A 2LT4A 3DKMA 3I55Q 2NYSA 4C8QC 1E6HA 3DLMA 5J26A 4J7IA 4II1A 1JQQA 2ROTA 3L2ZA 5KH6A 2M51A 5KYXB 4C8QF 2EFIA 1SRLA 4EMKB 2K5LA 3VUZA 3UWNA 1YJNA 2FO0A 4FW1A 3CCJT 1ZBJA 4M7DB 2OAUA 3CPWA 4AT1B 1KQ1A 3OS2A 4JJNK 2DVJA 1H3ZA 4PFOA 3G71A 1R0CB 4XK8E 1ZSZA 2XIDA 2QDLA 3FC3A 3JCMJ 3HPWA 3PIPA 1W70A 2RQRA 2SRCA 3EG3A 1TXQA 2LVMA 4OMLA 3FDRA 3CCVT 2CUBA 3A8HB 5GAOn 4A54A 3JCMd 3AHUA 2X3XD 3MEVA 5L23A 1JBMA 2LTOA 2YLBA 4C5IA 4A4GA 2COYA 1PKTA 3QHSA 3MEWA 4LD6A 3M58A 4HT9A 5GAN4 3NTKA 1N9RA 3TREA 1M90C 1QVFP 2ZAEA 2HSPA 3KBGA 2J6OA 1K9MC 5I11A 1RI0A 1WJQA 1CKBA 4M75D 1KC8R 4C0DC 2C0IA 2M0OA 1VIEA 4R55A 1QWFA 4A4FA 3MEUA 5GAN7 1YJ9A 2EYYA 4QVCA 4F7UG 4DEXA 2EIFA 4PKCC 4E7HA 4PJOC 3VS0A 1VIFA 1K0XA 5HCKA 1JXMA 2A0FB 1WQWA 1VQNQ 2FPEA 1RLQC 1BYMA 1VQ4A 2J05A 4PJOF 3VS5A 3JCMh 2EJFA 4E7ZA 2K5FA 1AHJB 4WF2A 4XTXA 4FL6A 5KYNA 5GAN6 1ZBXA 1WXTA 1VQKQ 3ULRB 2HZYA 3JB9G 4M7AG 1ZLMA 2HQEA 5C0MA 3G4SA 2CP5A 1TUGB 2J06A 1ZQ1A 5AYFA 2RHXA 2D9TA 2ZPFB 3EG2A 1PSEA 2MIOA 4JUVA 4RTXA 5IXFA 4PJJA 1FMWA 1YIJA 2YT6A 4M78G 3OA6A 2DL7A 2X4JA 3JCMV 3M0TA 4ZGDB 3HRTA 3OYYA 1YCYA 3GPLA 1M5Q1 3PVLA 4E47A 2RJCA 2E5KA 2LDMA 4E7JA 3THKA 3VKIA 1JJ2P 3M53A 3M4GA 1NM7A 2HKQB 2FYKA 5CIUA 4J6XA 4MZMA 5LJ5d 2DETA 2P4RA 1G83A 2RJFA 4Z88A 2EVRA 2E10A 1K8AU 2RJDA 4C92C 1QMCA 1PWTA 1YHQA 2EGEA 1M8VA 5GMKe 2XI9A 4VUBA 3OYKA 3META 1OX9A 2EQUA 1UFFA 2X35A 1M9SA 3CCSQ 4C92F 1WQ7A 2KSSA 5GMKj 1VQ7T 2RJEA 4KH1B 2CP7A 2LC4A 2GQVA 4D8KA 5FROA 1QVGA 2NUTB 2FPFA 4ELZC 3SD4A 3M0PA 2DNUA 2HEQA 3UF4A 1K73U 2E64A 3WXMB 3G6ET 1N6AA 1V29B 1ZHIA 4MDXA 4MZTA 2HBPA 2EQIA 2EYQA
chains in the Genus database with same CATH topology
1E7OA 1UHFA 4JPBW 1GFCA 1NLPC 3O5ZA 3EGUA 3IQLA 1ZUYA 2GTOA 2KRSA 2O9SA 2DE0X 3I5SA 1K1ZA 2CDTA 3JV3A 1TUDA 3FJ5A 3VS7A 2X3WD 2DL8A 3H41A 2DMOA 1U06A 1MV3A 3U23A 4AFQC 1QWEA 1A0NB 1WA7A 1H3HA 2YUOA 4FSSA 1X27A 4J9DA 1SHGA 1UECA 1M3AA 5IHKA 2A37A 1PKSA 3A98A 4HXJA 4D8DA 4OMNA 3VS3A 1WXUA 4QT7A 1QCFA 2RQWA 1Y57A 1MUZA 1ARKA 1HD3A 3LH5A 2F2WA 4HVUA 3VRYA 1E6GA 1NEGA 1FMKA 2CH4W 1B07A 1OEBA 2DA9A 2LNHB 2PNIA 2RMOA 3I9QA 1K0SA 2AZVA 1YP5A 1OOTA 1VYTA 2EW3A 2JS2A 2V1QA 3M0QA 1AWJA 3QWYA 2GBQA 4RTWA 1OV3A 2HDAA 1AOJA 2KE9A 4RTTA 4F17A 1EFNA 2F2XA 2KYMA 4RTYA 4F16A 2DYBA 1UJ0A 2B86A 1RUWA 2K7AA 2HCKA 2L3SA 2CSIA 1WLPB 4GBQA 2BTTA 4J9CA 4JJBA 2AKLA 1AEYA 2DX1A 2FRYA 2LZ6B 4RUGA 3SHWA 1BU1A 1WXBA 1WI7A 2OJ2A 2RQUA 4JJCA 1GL5A 2VWFA 2L3PA 2KR3A 3SEMA 2KEAA 3TSWA 2ESWA 2GNCA 2YSQA 2EYWA 2A36A 2DILA 1PRLC 2GGRA 3PE0A 4AG1C 5GJWB 3UA6A 3EG1A 1K4US 2CT4A 2J6FA 2KGTA 3NHNA 1T0HA 2VVKA 2W10A 4E6RA 2LP5A 2O2OA 2IIMA 3M0UA 4J9BA 1M3BA 1KFZA 2SEMA 1JU5C 1UHCA 4CC2A 1K9AA 1AZEA 2K79A 2XMFA 1WX6A 1Z9ZA 4Z89A 3RBBB 1BBZA 3I35A 1FYNA 5IH2A 3H0FA 1GCQC 1H8KA 4HVVA 2G6FX 3VS4A 4WCIA 1AWWA 2YUQA 1I07A 4LE9A 1AWXA 2DRMA 1MV0B 2LJ0A 1SEMA 3ZL7C 2DBMA 2LX7A 2JMCA 1WIEA 1I1JA 1M8MA 2L0AA 4HCKA 1IO6A 2LJ3A 1QLYA 1M30A 4LUDA 3VS6A 2EYZA 2O31A 1SPKA 2KRMA 1X69A 1W1FA 5FWBA 2LQWA 1M27C 3EHQA 2EGAA 2D8JA 2BZ8A 4ORZA 1LCKA 1BB9A 4JZ4A 1NYFA 1AVZC 2ED1A 2H8HA 1X43A 3REBB 2KT1A 5IHIA 1ZUKA 3NMZC 1SRMA 1VYVA 2CT3A 2GQIA 2EYXA 2ABLA 1T3LA 2D1XA 2MOXA 5ECAA 2C0TA 2CREA 1OPKA 3VRZA 1XOVA 3UATA 2KT8A 3GBQA 2A28A 2JM9A 2JMAA 2M0YA 1UUEA 1ABOA 1X6BA 1GBRA 2EPDA 2KBTA 1NEBA 4ESRA 1HJDA 1CSKA 4LN2A 1V1CA 2DF6A 2YDLA 4OMPA 2AKKA 2W0ZA 2DL3A 5IHNA 4RTVA 2DL5A 4IIOA 1ZUUA 2OAWA 1JXOA 4M4ZA 4Z8AA 4R0KA 2D0NA 1VYUA 2NUZA 3KFVA 1UDLA 3M0SA 1YWOA 2CSQA 2CH4A 1AD5A 2J6KA 2KROA 4AFZC 2MCNA 5IXBA 2PTKA 4CC3A 4AG2C 3TSZA 3PVQA 2LCSA 2AZSA 1YCSB 2KNBB 1E6HA 5EC7A 1JQQA 2JT4A 2ROTA 4AFSC 2M51A 2JW4A 1SRLA 2BZYA 2D8HA 2CUDA 4J9EA 1T0JA 2FO0A 1NYGA 2K2MA 1ZBJA 4DEYA 1AZGB 2ENMA 1JEGA 1X2QA 2DVJA 5I22A 1QKXA 3EHRA 4ZNXA 2QDLA 1T3SA 2LMJA 1GFDA 1G2BA 2RPNA 1UE9A 1JO8A 2EBPA 2EGCA 1W70A 2RQRA 2SRCA 3EG3A 2RNAA 1K76A 4OMLA 2CUBA 4HVWA 2I0NA 1SHFA 2X3XD 1VA7A 4OMOA 5L23A 4IIMA 1WDXA 2J7IA 2C0OA 1UG1A 4X1VA 1PRMC 1WFWA 1PKTA 1UGVA 4GLMA 4JZ3A 3H0HA 1SSHA 2K6DA 1B3QA 2HSPA 1H92A 2J6OA 5I11A 2KYBA 1M3CA 1CKBA 4OMQA 1GCPA 2JTEA 2C0IA 3TVTA 1GBQA 1QWFA 2FG0A 2RN8A 1YWPA 2PZ1A 5FW9A 2EYYA 3VS1A 2L2PA 1ZSGA 1UTIA 4DEXA 2L3QA 3VS0A 1PHTA 1YNZA 2DJQA 3EG0A 4J9HA 1JXMA 5HCKA 4CC7A 1K0XA 2A08A 3CQTA 2FEIA 3R6NA 4K11A 1Y0MA 1W6XA 1ABQA 1RLQC 2FPEA 2J05A 4JJDA 1TUCA 3NGPA 3VS5A 4AFUC 2DRKA 3REAB 1RI9A 1CKAA 2LQNA 1WXTA 2AK5A 4OMMA 4J9GA 1HSQA 2BZXA 3ULRB 1ZLMA 1KSWA 5GJVB 2J06A 4EIKA 1U5SA 4RTUA 2LJ1A 4LUEA 4Y92A 2F2VA 3EG2A 2O88A 2MIOA 1N5ZA 1X6GA 4RTXA 4A63B 5IXFA 2EKHA 2O9VA 2YT6A 2NWMA 2DL7A 1RLPC 1J3TA 1KIKA 3UA7A 3C0CA 3M0TA 4F14A 3PVLA 3I5RA 1BK2A 2ROLA 1QKWA 2V1RA 2FPDA 1Z9QA 1TG0A 1YN8A 2DL4A 2E5KA 2DBKA 3THKA 1PNJA 2GTJA 1GCQA 1NM7A 3M0RA 3RNJA 3VS2A 2JM8A 1U3OA 1UJYA 2P4RA 1G83A 4Z88A 2EVRA 2RF0A 1NG2A 1PWTA 2KRNA 4J9IA 2DLPA 2EGEA 1GRIA 2JS0A 1NLOC 2HBWA 5FWCA 1ZX6A 1X2KA 1WYXA 1UFFA 2ED0A 3NPFA 2RQVA 1I0CA 2JXBA 3QWXX 4D8KA 2KXDA 4CC4B 2KXCA 1AWOA 1OPLA 2ECZA 4J9FA 2FPFA 2K3BA 1KJWA 2VKNA 2K9GA 2RQTA 3M0PA 4RTZA 2DNUA 2HEQA 3UF4A 4LNPA 2DM1A 3H0IA 1S1NA 2FRWA 2YUPA 2OI3A 2YUNA 4KRTA 2EQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7O A;  1UHF A;  4JPB W;  1GFC A;  1NLP C;  3O5Z A;  3EGU A;  3IQL A;  1ZUY A;  2GTO A;  2KRS A;  2O9S A;  2DE0 X;  3I5S A;  1K1Z A;  2CDT A;  3JV3 A;  1TUD A;  3FJ5 A;  3VS7 A;  2X3W D;  2DL8 A;  3H41 A;  2DMO A;  1U06 A;  1MV3 A;  3U23 A;  4AFQ C;  1QWE A;  1A0N B;  1WA7 A;  1H3H A;  2YUO A;  4FSS A;  1X27 A;  4J9D A;  1SHG A;  1UEC A;  1M3A A;  5IHK A;  2A37 A;  1PKS A;  3A98 A;  4HXJ A;  4D8D A;  4OMN A;  3VS3 A;  1WXU A;  4QT7 A;  1QCF A;  2RQW A;  1Y57 A;  1MUZ A;  1ARK A;  1HD3 A;  3LH5 A;  2F2W A;  4HVU A;  3VRY A;  1E6G A;  1NEG A;  1FMK A;  2CH4 W;  1B07 A;  1OEB A;  2DA9 A;  2LNH B;  2PNI A;  2RMO A;  3I9Q A;  1K0S A;  2AZV A;  1YP5 A;  1OOT A;  1VYT A;  2EW3 A;  2JS2 A;  2V1Q A;  3M0Q A;  1AWJ A;  3QWY A;  2GBQ A;  4RTW A;  1OV3 A;  2HDA A;  1AOJ A;  2KE9 A;  4RTT A;  4F17 A;  1EFN A;  2F2X A;  2KYM A;  4RTY A;  4F16 A;  2DYB A;  1UJ0 A;  2B86 A;  1RUW A;  2K7A A;  2HCK A;  2L3S A;  2CSI A;  1WLP B;  4GBQ A;  2BTT A;  4J9C A;  4JJB A;  2AKL A;  1AEY A;  2DX1 A;  2FRY A;  2LZ6 B;  4RUG A;  3SHW A;  1BU1 A;  1WXB A;  1WI7 A;  2OJ2 A;  2RQU A;  4JJC A;  1GL5 A;  2VWF A;  2L3P A;  2KR3 A;  3SEM A;  2KEA A;  3TSW A;  2ESW A;  2GNC A;  2YSQ A;  2EYW A;  2A36 A;  2DIL A;  1PRL C;  2GGR A;  3PE0 A;  4AG1 C;  5GJW B;  3UA6 A;  3EG1 A;  1K4U S;  2CT4 A;  2J6F A;  2KGT A;  3NHN A;  1T0H A;  2VVK A;  2W10 A;  4E6R A;  2LP5 A;  2O2O A;  2IIM A;  3M0U A;  4J9B A;  1M3B A;  1KFZ A;  2SEM A;  1JU5 C;  1UHC A;  4CC2 A;  1K9A A;  1AZE A;  2K79 A;  2XMF A;  1WX6 A;  1Z9Z A;  4Z89 A;  3RBB B;  1BBZ A;  3I35 A;  1FYN A;  5IH2 A;  3H0F A;  1GCQ C;  1H8K A;  4HVV A;  2G6F X;  3VS4 A;  4WCI A;  1AWW A;  2YUQ A;  1I07 A;  4LE9 A;  1AWX A;  2DRM A;  1MV0 B;  2LJ0 A;  1SEM A;  3ZL7 C;  2DBM A;  2LX7 A;  2JMC A;  1WIE A;  1I1J A;  1M8M A;  2L0A A;  4HCK A;  1IO6 A;  2LJ3 A;  1QLY A;  1M30 A;  4LUD A;  3VS6 A;  2EYZ A;  2O31 A;  1SPK A;  2KRM A;  1X69 A;  1W1F A;  5FWB A;  2LQW A;  1M27 C;  3EHQ A;  2EGA A;  2D8J A;  2BZ8 A;  4ORZ A;  1LCK A;  1BB9 A;  4JZ4 A;  1NYF A;  1AVZ C;  2ED1 A;  2H8H A;  1X43 A;  3REB B;  2KT1 A;  5IHI A;  1ZUK A;  3NMZ C;  1SRM A;  1VYV A;  2CT3 A;  2GQI A;  2EYX A;  2ABL A;  1T3L A;  2D1X A;  2MOX A;  5ECA A;  2C0T A;  2CRE A;  1OPK A;  3VRZ A;  1XOV A;  3UAT A;  2KT8 A;  3GBQ A;  2A28 A;  2JM9 A;  2JMA A;  2M0Y A;  1UUE A;  1ABO A;  1X6B A;  1GBR A;  2EPD A;  2KBT A;  1NEB A;  4ESR A;  1HJD A;  1CSK A;  4LN2 A;  1V1C A;  2DF6 A;  2YDL A;  4OMP A;  2AKK A;  2W0Z A;  2DL3 A;  5IHN A;  4RTV A;  2DL5 A;  4IIO A;  1ZUU A;  2OAW A;  1JXO A;  4M4Z A;  4Z8A A;  4R0K A;  2D0N A;  1VYU A;  2NUZ A;  3KFV A;  1UDL A;  3M0S A;  1YWO A;  2CSQ A;  2CH4 A;  1AD5 A;  2J6K A;  2KRO A;  4AFZ C;  2MCN A;  5IXB A;  2PTK A;  4CC3 A;  4AG2 C;  3TSZ A;  3PVQ A;  2LCS A;  2AZS A;  1YCS B;  2KNB B;  1E6H A;  5EC7 A;  1JQQ A;  2JT4 A;  2ROT A;  4AFS C;  2M51 A;  2JW4 A;  1SRL A;  2BZY A;  2D8H A;  2CUD A;  4J9E A;  1T0J A;  2FO0 A;  1NYG A;  2K2M A;  1ZBJ A;  4DEY A;  1AZG B;  2ENM A;  1JEG A;  1X2Q A;  2DVJ A;  5I22 A;  1QKX A;  3EHR A;  4ZNX A;  2QDL A;  1T3S A;  2LMJ A;  1GFD A;  1G2B A;  2RPN A;  1UE9 A;  1JO8 A;  2EBP A;  2EGC A;  1W70 A;  2RQR A;  2SRC A;  3EG3 A;  2RNA A;  1K76 A;  4OML A;  2CUB A;  4HVW A;  2I0N A;  1SHF A;  2X3X D;  1VA7 A;  4OMO A;  5L23 A;  4IIM A;  1WDX A;  2J7I A;  2C0O A;  1UG1 A;  4X1V A;  1PRM C;  1WFW A;  1PKT A;  1UGV A;  4GLM A;  4JZ3 A;  3H0H A;  1SSH A;  2K6D A;  1B3Q A;  2HSP A;  1H92 A;  2J6O A;  5I11 A;  2KYB A;  1M3C A;  1CKB A;  4OMQ A;  1GCP A;  2JTE A;  2C0I A;  3TVT A;  1GBQ A;  1QWF A;  2FG0 A;  2RN8 A;  1YWP A;  2PZ1 A;  5FW9 A;  2EYY A;  3VS1 A;  2L2P A;  1ZSG A;  1UTI A;  4DEX A;  2L3Q A;  3VS0 A;  1PHT A;  1YNZ A;  2DJQ A;  3EG0 A;  4J9H A;  1JXM A;  5HCK A;  4CC7 A;  1K0X A;  2A08 A;  3CQT A;  2FEI A;  3R6N A;  4K11 A;  1Y0M A;  1W6X A;  1ABQ A;  1RLQ C;  2FPE A;  2J05 A;  4JJD A;  1TUC A;  3NGP A;  3VS5 A;  4AFU C;  2DRK A;  3REA B;  1RI9 A;  1CKA A;  2LQN A;  1WXT A;  2AK5 A;  4OMM A;  4J9G A;  1HSQ A;  2BZX A;  3ULR B;  1ZLM A;  1KSW A;  5GJV B;  2J06 A;  4EIK A;  1U5S A;  4RTU A;  2LJ1 A;  4LUE A;  4Y92 A;  2F2V A;  3EG2 A;  2O88 A;  2MIO A;  1N5Z A;  1X6G A;  4RTX A;  4A63 B;  5IXF A;  2EKH A;  2O9V A;  2YT6 A;  2NWM A;  2DL7 A;  1RLP C;  1J3T A;  1KIK A;  3UA7 A;  3C0C A;  3M0T A;  4F14 A;  3PVL A;  3I5R A;  1BK2 A;  2ROL A;  1QKW A;  2V1R A;  2FPD A;  1Z9Q A;  1TG0 A;  1YN8 A;  2DL4 A;  2E5K A;  2DBK A;  3THK A;  1PNJ A;  2GTJ A;  1GCQ A;  1NM7 A;  3M0R A;  3RNJ A;  3VS2 A;  2JM8 A;  1U3O A;  1UJY A;  2P4R A;  1G83 A;  4Z88 A;  2EVR A;  2RF0 A;  1NG2 A;  1PWT A;  2KRN A;  4J9I A;  2DLP A;  2EGE A;  1GRI A;  2JS0 A;  1NLO C;  2HBW A;  5FWC A;  1ZX6 A;  1X2K A;  1WYX A;  1UFF A;  2ED0 A;  3NPF A;  2RQV A;  1I0C A;  2JXB A;  3QWX X;  4D8K A;  2KXD A;  4CC4 B;  2KXC A;  1AWO A;  1OPL A;  2ECZ A;  4J9F A;  2FPF A;  2K3B A;  1KJW A;  2VKN A;  2K9G A;  2RQT A;  3M0P A;  4RTZ A;  2DNU A;  2HEQ A;  3UF4 A;  4LNP A;  2DM1 A;  3H0I A;  1S1N A;  2FRW A;  2YUP A;  2OI3 A;  2YUN A;  4KRT A;  2EQI A; 
#chains in the Genus database with same CATH topology
 1GFC A;  4NL2 A;  4AMC A;  2RHI A;  3OW2 A;  4XU3 A;  2YLC A;  3CCR Q;  3V8L A;  5KYW B;  2O9S A;  1Q7Y R;  1OYX A;  1TUD A;  2DL8 A;  2JJ9 A;  1VQ5 A;  3QSU A;  1X01 A;  4F7U A;  2BE7 D;  1A0N B;  1Y71 A;  2CYZ B;  4QVD A;  4OB1 B;  4LDV A;  2YUO A;  4J9D A;  1H3H A;  3KXT A;  3JCM P;  2CZ6 B;  4IUV A;  5IHK A;  4OMF B;  3CCU T;  5FU6 C;  3H9N A;  3EFS A;  2PVO B;  4ME7 A;  3OYA A;  1WXU A;  3X28 B;  3X24 B;  3JCM f;  1MUZ A;  1HD3 A;  1BCM A;  1Q82 C;  2RA2 A;  8ATC B;  3VRY A;  2CH4 W;  2DA9 A;  2RMO A;  1B07 A;  2LNH B;  4OMO A;  5CKB A;  2K2V A;  1MNE A;  2JNG A;  4M7A A;  2LX9 A;  3QYH B;  2V1Q A;  2XK0 A;  5GAN h;  3RIR A;  4Z02 A;  1AWJ A;  4E2F B;  1O75 A;  2FL7 A;  2CZ0 B;  2XHC A;  1AOJ A;  2HSE B;  3TCJ A;  1N9S A;  2XKO C;  2F2X A;  2KYM A;  4RTY A;  2DYB A;  4ELY C;  1UJ0 A;  4FYV B;  2K7A A;  3LH0 A;  3GF5 A;  4M78 A;  5IAY A;  2DZ9 A;  2BTT A;  1RAF B;  3EGX B;  1WNL A;  4OB2 B;  2OJ2 A;  2VWF A;  2L3P A;  2KR3 A;  3SEM A;  2KEA A;  2JVV A;  2DIL A;  5CQX A;  5A2Q E;  1PRL C;  1RAD B;  1VQ6 T;  4A53 A;  1IGU A;  1MMN A;  1NPP A;  3MPU B;  3CC7 A;  4FIB A;  3TU4 K;  4R56 A;  2KGT A;  3BE3 A;  3NHN A;  5J3B A;  4BDY A;  5LJ5 e;  4J9B A;  1M3B A;  2E6Z A;  1QCO A;  2NUP B;  2HD0 A;  5LJ5 j;  2K79 A;  2DO3 A;  3RUX A;  3H6Z A;  4Z89 A;  2QEX T;  3DB4 A;  4QVZ A;  4C0D B;  3L2R A;  4HVV A;  2V8I A;  4WCI A;  2I2L A;  4LE9 A;  4M7D C;  2QG9 B;  1SG5 A;  2EAY A;  1WIE A;  2KQW A;  1I1J A;  2IG0 A;  1SSF A;  1YIT T;  2P0Q A;  3JAM E;  4M7D F;  1QLY A;  1M30 A;  3HRS A;  4PJO B;  3E1S A;  1B34 A;  3HP9 A;  5GAO m;  4B6M A;  3FJP A;  1KQ2 A;  1X69 A;  3PNW C;  5LJ3 e;  4M75 G;  3SFM A;  3OYF A;  2M16 A;  1YJW T;  3MP8 A;  2CZ1 B;  3EH2 A;  5LJ3 j;  1M90 U;  4XTW A;  1K9M U;  2KAF A;  5L8R E;  2MF2 A;  3EGD B;  1VQO T;  3M59 A;  3OYG A;  3CD6 T;  2GQI A;  1UGQ B;  4FW2 A;  4J8O A;  3JCM c;  2MOX A;  2XG8 D;  3PTA A;  2CP6 A;  4FCY A;  3VRZ A;  1IRX A;  3JCM g;  3UAT A;  1S72 A;  3GBQ A;  2JM9 A;  5GAO q;  1VQL T;  4ESR A;  4P5N A;  4LN2 A;  1KQS P;  3EFO A;  3HSB A;  2DF6 A;  4RKU E;  2MI6 A;  3I56 A;  5GAM h;  2A3L A;  2FZC B;  3V7S A;  1ZUU A;  2OAW A;  4R0K A;  1YI2 A;  5GAN f;  4JLI A;  4KGX B;  3OYI A;  2O01 E;  4C92 B;  3HKS A;  3JCM Q;  2KRO A;  4JLG A;  4AG2 C;  1WHK A;  3CXC S;  3PVQ A;  3BDL A;  4JS5 A;  1YCS B;  3HFN A;  1U1S A;  4M77 C;  4BE0 A;  2JT4 A;  2YWW A;  4JRI A;  2FZG B;  2JW4 A;  4FYY B;  4M77 F;  1VQ8 Q;  1YIT Q;  3CCL A;  4BD3 A;  3QO3 A;  3OYL A;  4DEY A;  4RCB A;  1RAG B;  1I8F A;  2EQK A;  5I22 A;  1W2B A;  1ZSZ B;  3EHR A;  3QDR B;  5GMK i;  1T3S A;  2P0P A;  1G2B A;  3RDV A;  2QA4 A;  1UE9 A;  1WZO A;  2EBP A;  3GNF B;  1QP3 A;  4FT4 A;  2XDB A;  2OTL Q;  4HKE A;  8AT1 B;  4HVW A;  3QDF A;  3JB9 J;  3OSV A;  3ASK A;  1VA7 A;  3GNG A;  2J7I A;  4F7U E;  1VQO Q;  1NZ9 A;  2C0O A;  1UG1 A;  2CKK A;  4DBH A;  1WFW A;  2JZ2 A;  3VJP A;  2OX7 A;  2E1H A;  4ATO A;  5CQY A;  5FU6 B;  3J7A F;  2KYB A;  2F69 A;  1VQL Q;  3L2V A;  1IHW A;  4RCC A;  4M75 A;  3OYJ A;  1GBQ A;  2FG0 A;  4BY6 C;  1YWP A;  4XU1 A;  2PZ1 A;  5FW9 A;  3MJX A;  5GAN 2;  5FU7 C;  2L2P A;  5D7U A;  1ZSG A;  1UTI A;  4OGC A;  4M7A E;  2L3Q A;  2LNV A;  1Y07 A;  5KYU A;  1C0M A;  4J9H A;  3G71 T;  4CC7 A;  3CQT A;  2RI3 A;  3CC2 A;  1KD1 R;  2E3I A;  4BI8 B;  3S3M A;  4M78 E;  2DRK A;  4MDW A;  1KC8 U;  1JB0 E;  4DBR A;  3REA B;  1RI9 A;  2DXT A;  1CKA A;  4OMM A;  2YRD A;  1Q86 R;  2M02 A;  2EKO A;  4ZTJ A;  3L1A A;  4IUU A;  4J5Y A;  1KSW A;  5GAN g;  4O5V A;  5GAM f;  4OVA A;  4C8Q D;  2ZCF B;  1M1K R;  4LUE A;  3Q1J A;  2K4Y A;  3I55 A;  1Q82 U;  3CC4 A;  1QW1 A;  3EG9 B;  4MZP A;  1RLP C;  1GXI E;  1KIK A;  3UA7 A;  2NLU A;  4F14 A;  4L6V 5;  2E6N A;  1BCO A;  4Y28 E;  3C12 A;  3ME9 A;  2G3R A;  1Z9Q A;  5I2S A;  2DL4 A;  2DBK A;  1VQP A;  4C0F A;  3CPF A;  1PNJ A;  2BIV A;  1GCQ A;  3M0R A;  4XU0 A;  3RNJ A;  3VS2 A;  3OMG A;  1U3O A;  1VQ4 T;  2QQR A;  3QJ6 A;  1NJI C;  3M56 A;  2KRN A;  4J9I A;  5KE3 A;  1NLO C;  1ZX6 A;  1X2K A;  1YBY A;  3CCE A;  1WYX A;  2XU8 A;  2R5M A;  2JTM A;  2L5Q A;  1WJR A;  1PG5 B;  3G4S T;  1QVP A;  2R58 A;  2ZPG B;  2KXD A;  4CC4 B;  1OI1 A;  1AWO A;  2K3B A;  2RQT A;  3NTH A;  4RTZ A;  2HAX A;  1MMD A;  1Q81 R;  3CCS T;  5GAO p;  2DM1 A;  3V7R A;  5GMK h;  2OI3 A;  3G71 Q;  3OW2 P;  1IZ6 A;  4PJO D;  1M4Z A;  3CME A;  4KRT A;  4XQ3 A;  4C0Z A;  3M55 A;  5KYY B;  3RES A;  3EGU A;  1PC0 A;  1ZUY A;  1VQN A;  3G7Z A;  1NE8 A;  3CCQ T;  2DKG A;  1QVF S;  1PCX A;  3RKY A;  3FJ5 A;  3VS7 A;  2XIC A;  2DMO A;  4F7U B;  5GAN 5;  2M1H A;  1QWE A;  1VQK A;  1BIA A;  3FB9 A;  1OQK A;  1MGQ A;  1TH7 A;  1M3A A;  1D0Z A;  1VQ9 T;  1PKS A;  3CCR T;  5FRM A;  1TOV A;  3VS3 A;  4M75 C;  2RQW A;  3T9N A;  1R0B G;  4BDZ A;  2F2W A;  5I2M A;  5GAM g;  2PUO B;  2PNI A;  1OEB A;  3CCJ A;  2YHT A;  3ZEH A;  1TS9 A;  4JRQ A;  1YP5 A;  4M7A B;  2B8A A;  4M77 B;  3M0Q A;  3QKJ A;  2CP3 A;  1TWB A;  4KUI A;  1VQ4 Q;  1KG1 A;  2HDA A;  2QTV A;  2KE9 A;  1IRE B;  4F17 A;  4C92 D;  2B86 A;  4V2S A;  4N0A A;  4M78 B;  2HCK A;  3CCV A;  1MMA A;  2OTJ T;  2RHY A;  2CSI A;  3L2W A;  1WLP B;  4GBQ A;  4J9C A;  5CO7 A;  1G3S A;  3OS5 A;  1TU0 B;  3G4S Q;  1VQ5 T;  2RQU A;  4JJC A;  1GL5 A;  4KGV B;  2ESW A;  2YSQ A;  4DOW A;  2EYW A;  3OMC A;  3RMS A;  4A4E A;  3F70 A;  3PE0 A;  3SWN C;  1K4U S;  3PGG A;  2W10 A;  2LP5 A;  2WAC A;  2ZGW A;  2IIM A;  1JJ2 S;  2QI2 A;  1VUB A;  5CKD A;  2RM4 A;  4EMK A;  2MMP A;  3N5B B;  3DLL A;  4CC2 A;  2RHU A;  3E19 A;  1AZE A;  3BY7 A;  4FT2 A;  2XMF A;  4MMK A;  1WX6 A;  2F1L A;  1BBZ A;  1FYN A;  1GCQ C;  2LQK A;  2KMT A;  2O4X A;  1SF9 A;  2RB6 A;  4M75 E;  3VS4 A;  1AWX A;  3NFC A;  2F5K A;  3CCQ Q;  1MV0 B;  4BY6 B;  1YHQ Q;  3ZL7 C;  2JMC A;  5FU7 B;  1M8M A;  2IPO B;  2Y4Y A;  4HCK A;  5LJ3 d;  3P8D A;  1NPR A;  1ZSZ C;  4PJL A;  5LJ5 h;  1G3W A;  1B34 B;  4IUP A;  3VS6 A;  1O9S A;  5DLO A;  2O31 A;  1VQ9 Q;  1VOM A;  1I5O B;  3OBY A;  3A5Z B;  2ZPE B;  5FWB A;  2D8J A;  1M1F A;  2DXU A;  5A0G A;  1KC8 C;  4IUT A;  1LOJ A;  4JZ4 A;  1MHN A;  3D7S B;  4PK4 A;  1AVZ C;  1X43 A;  3NMZ C;  4WTO B;  2RD1 A;  2CT3 A;  3NTI A;  1OU9 A;  1X6O A;  5ECA A;  2C0T A;  2VXF A;  1OPK A;  1M2V A;  2MWO A;  4HCB A;  1X75 C;  1XOV A;  1G8X A;  2KT8 A;  2JMA A;  1UUE A;  1ABO A;  1RAH B;  2EPD A;  4TVR A;  2OTJ Q;  5CVI A;  3V8K A;  5LJ3 h;  3EFO B;  1V1C A;  3LWH A;  2GCX A;  1VQ5 Q;  2AKK A;  3OS1 A;  3OY9 A;  2DL5 A;  4IIO A;  2YRV A;  1JXO A;  4M4Z A;  4Z8A A;  4C8Q G;  4HT8 A;  1VYU A;  1D09 B;  1VQ7 A;  1KK7 A;  2RH2 A;  1HK9 A;  2CH4 A;  3FRN A;  1K8A R;  4ZN1 A;  3E2U A;  2DZC A;  4ZTF A;  4XTZ A;  3PMI A;  3TSZ A;  1IXD A;  2XD0 A;  2AZS A;  4GY5 A;  1AT1 B;  2KNB B;  4DA4 A;  2H3J A;  4FYX B;  3G6E A;  5EC7 A;  3OSS C;  4DBQ A;  2Z0W A;  4AFS C;  3VUB A;  4XTY A;  4M7D D;  2BZY A;  3EAE A;  2CUD A;  4J9E A;  1T0J A;  2K2M A;  4LXC A;  1LPL A;  1W2B P;  2QK0 A;  5DM7 R;  2VYT A;  1WGS A;  2PVG B;  2HL3 A;  2E5Q A;  4LDY A;  2ENM A;  1JEG A;  1X2Q A;  1K73 R;  3I56 T;  2PQW A;  4ZNX A;  1NJI U;  1D3B A;  2RPN A;  4EMG A;  3O8V A;  5HK0 A;  4KH0 B;  1YI2 T;  2JN0 A;  1EIF A;  3CCU A;  2GF7 A;  1VQ8 T;  4KUD K;  2E65 A;  3CCM T;  2I0N A;  3C95 A;  2QXF A;  4O6J A;  4IIM A;  1WDX A;  4X1V A;  1PRM C;  1UGV A;  3X26 B;  4CI0 C;  5LJ5 f;  4JZ3 A;  3H0H A;  2DIG A;  4PJO G;  1B3Q A;  2DEU A;  1H92 A;  1QQJ A;  2QTX A;  1MND A;  2OTL T;  2LRQ A;  1M3C A;  5CKH A;  4OMQ A;  4LDX A;  1UGP B;  2JTE A;  3TVT A;  1WHL A;  4M75 B;  3X20 B;  2LCC A;  1I5L A;  5LL6 S;  3VS1 A;  5DY9 A;  3JCM W;  2EJG A;  4PLL A;  5KYU B;  1Q7Y C;  3JSC A;  1WHJ A;  2DJQ A;  1YNZ A;  3EG0 A;  5DLQ E;  5GAN e;  2H3E B;  3A8M B;  4K11 A;  1RAE B;  1Y0M A;  2AIR B;  1W6X A;  2QA4 T;  3RMQ A;  1TUC A;  4N4H A;  1VQ6 A;  1BIB A;  4PJN A;  4AFU C;  5GAN 8;  2L89 A;  2CP0 A;  1D0X A;  1W4S A;  4J9G A;  4IUR A;  1VQM A;  1HSQ A;  5LJ3 f;  3CEY A;  1N27 A;  3M4Y A;  4X9C A;  5GJV B;  4F7U F;  3OS0 A;  4EIK A;  4YTL A;  1KQS S;  4Y92 A;  4B9W A;  3SB2 A;  4FSX A;  4M77 D;  4C8Q A;  3SWN B;  2QEX A;  1Y96 A;  2F2V A;  4E7L A;  1X6G A;  2EKH A;  2O9V A;  4C92 G;  2QQS A;  3OYM A;  3P8B B;  3L2U A;  3I56 Q;  2C06 A;  4M7A C;  5I21 A;  1BK2 A;  2ROL A;  4LD9 K;  1QKW A;  1C6V X;  4KUL A;  1TG0 A;  2DAQ A;  7AT1 B;  4X34 A;  3CPW P;  3H8Z A;  3JB9 F;  4JS4 A;  1LVK A;  2K5I A;  1YI2 Q;  3CMA T;  4M7A F;  2JM8 A;  1FXX A;  3CCM Q;  4M78 C;  4ANJ A;  1NG2 A;  1GRI A;  1YJW A;  4EDU A;  4M78 F;  2BKD N;  3CPW S;  3JB9 H;  4JRP A;  1UGS B;  3QXE B;  3NPF A;  4EPC A;  1OZ3 A;  3LGL A;  4B9X A;  2NUP A;  3CD6 A;  3J81 E;  5AT1 B;  3MCA B;  2EJ9 A;  2KXC A;  3ER0 A;  1SKU B;  2ECZ A;  4J9F A;  3CC4 T;  2VKN A;  1IHV A;  3PT9 A;  3CCL Q;  3OYD A;  5LJ5 g;  5CK9 A;  2VV5 A;  4LNP A;  1M90 R;  1K9M R;  2YUP A;  1OX8 A;  3DB3 A;  3R6O A;  1IGQ A;  4QKU A;  1EX4 A;  2QA4 Q;  4PJO A;  1C1A A;  1VQP T;  1E7O A;  1ZA2 B;  4JPB W;  1NLP C;  4XAX B;  3O5Z A;  3WVE B;  1YJN T;  2WSE E;  2KRS A;  2DE0 X;  3I5S A;  3JV3 A;  2X3W D;  3JRZ A;  3H41 A;  3RR6 A;  3CCE T;  1MV3 A;  4E7S A;  2HQH A;  3PIO A;  1PD0 A;  2COZ A;  1U1T A;  4QQ6 A;  2ZPH B;  2PU9 B;  1ZA1 B;  5C6S A;  1UEC A;  3EGD A;  2A37 A;  3FIF A;  4D8D A;  2VXE A;  1OZ2 A;  4BE1 A;  2X9H A;  5LJ3 g;  3JB9 I;  1QCF A;  5HKC A;  1ARK A;  4HVU A;  3BDU A;  1FWZ A;  1NEG A;  1FMK A;  2DD5 A;  4EMH A;  2DYI A;  5IN1 A;  1F1B B;  2AZV A;  3CMA Q;  3INZ A;  3MKD A;  3QWY A;  3J80 E;  2GBQ A;  4RTW A;  3CME T;  3CC2 Q;  4RTT A;  2L3R A;  1EFN A;  1UEB A;  3URG A;  1YJ9 T;  4F16 A;  2DVE A;  1DJ7 B;  3CXC A;  4C92 A;  2DFU A;  5FLX E;  4KGZ B;  2DX1 A;  2FRY A;  3SHW A;  4BUG A;  1LNX A;  1BU1 A;  2GFA A;  1WXB A;  3OYE A;  4IUQ A;  2GNC A;  5CCA A;  2GGR A;  4AG1 C;  1U8R A;  3CC4 Q;  2CT4 A;  2J6F A;  3MEA A;  2VVK A;  2EQJ A;  2VUB A;  2O2O A;  4M7D G;  4BB7 A;  3A8G B;  2VC8 A;  4PLI A;  3LLR A;  2SEM A;  1UHC A;  1QVG P;  1K9A A;  2QAZ A;  3G1J A;  1Z9Z A;  1VQP Q;  3RBB B;  4XTU A;  4N4G A;  4PFP A;  3H0F A;  1YJN Q;  4XU2 A;  2O4X B;  1YIJ T;  1AWW A;  3JCM b;  1I07 A;  2DRM A;  2KK4 A;  1QVG S;  3LW5 E;  5D6Y A;  4LDW A;  2VGM A;  3CCE Q;  4J6Y A;  1I4K 1;  1H64 1;  1HXD A;  1TSF A;  2KVQ G;  3GIB A;  3UT1 A;  1I81 A;  1KHC A;  1WJS A;  4L59 A;  1SPK A;  3S6W A;  2KRM A;  1FX7 A;  1W1F A;  3HRU A;  3GLX A;  2EGA A;  1YHQ T;  3OW2 S;  2BZ8 A;  2DIQ A;  5GAN 3;  1LCK A;  1N8R R;  4ZN3 A;  1BB9 A;  1NYF A;  3A1P A;  2ED1 A;  5GMK l;  2H8H A;  4OGE A;  1FMV A;  1RL2 A;  4C8Q E;  3CME Q;  1QCN A;  1T3L A;  3VYG A;  5KCH A;  2CRE A;  4OB0 B;  1M2V B;  3ZFJ A;  4JRK A;  2E4H A;  2LCL A;  1Q82 R;  1YJ9 Q;  2M0Y A;  1GBR A;  2KBT A;  3QUI A;  1Q7Y U;  1NBE B;  1KD1 C;  1HJD A;  4J6W A;  4M75 F;  3S3N A;  2DL3 A;  5IHN A;  4RTV A;  1M1G A;  1Q86 C;  2ATC B;  2RHZ A;  2XDP A;  2EQM A;  2RK2 A;  4M77 G;  1UDL A;  1YWO A;  3OBW A;  2CSQ A;  1M1K C;  3GP8 A;  2MCN A;  3TQ7 P;  5IXB A;  2LQ8 A;  3CCJ Q;  2QQA A;  3EG9 A;  3CCS A;  2LCS A;  4C5G A;  2PUK B;  5EG2 A;  3M5A A;  3SDZ A;  1YIJ Q;  3OYH A;  2V26 A;  2KDS A;  4J83 A;  5KYX A;  3AT1 B;  2L8D A;  3OQ5 A;  2D8H A;  2QAS A;  1TTH B;  1NYG A;  3CCV Q;  3EFR A;  1V76 A;  4M7D A;  3OB9 A;  3CCQ A;  1ACM B;  1AZG B;  4PJO E;  1LJO A;  1QKX A;  1D3B B;  3CBM A;  2LMJ A;  1GFD A;  1OUL A;  4BI3 A;  1JO8 A;  2EGC A;  1VQ9 A;  1XNI A;  4RG8 A;  2RNA A;  1K76 A;  2VGN A;  2K3X A;  3CCR A;  2DPP B;  1SHF A;  4X9D A;  4GLK A;  4FM4 B;  2QGF B;  3MHX A;  3VYH B;  5GAO l;  3S3O A;  2D6F A;  2Y90 A;  3LGF A;  4QW2 A;  4GLM A;  1Q81 C;  1BKB A;  1PM3 A;  1SSH A;  1HYO A;  2K6D A;  3EH1 A;  3JCM e;  5HK3 A;  3CC7 T;  4BI4 A;  2XDD A;  3C4S A;  1GCP A;  2FB7 A;  5GAN d;  5CR2 A;  2DER A;  1QVF A;  5KYY A;  2RN8 A;  3QYG B;  4MML A;  2OTJ A;  5CKF A;  2WSF E;  4C5E A;  2MWP A;  2X4Y A;  1EZZ B;  2RI2 A;  1PHT A;  1OU8 A;  2A08 A;  2FEI A;  3R6N A;  3A8O B;  1N8R C;  1ABQ A;  2JTF A;  4JJD A;  3LYI A;  5GMK m;  3NGP A;  3MP6 A;  3OYC A;  2JOY A;  2DXB A;  4C92 E;  2LQN A;  2AK5 A;  4L5G A;  3X25 B;  4QQG A;  2BZX A;  3QZ5 B;  4FYW B;  2KI7 A;  2QGG A;  1WHH A;  4PFZ A;  4ZGE B;  1U5S A;  4RTU A;  2LJ1 A;  4C8Q B;  2FZK B;  4PNO A;  3VU3 C;  1Y96 B;  2V8J A;  4CRI A;  2O88 A;  4M77 A;  1N5Z A;  4A63 B;  4OB3 B;  2GFU A;  4NOY A;  2NWM A;  4Y91 A;  3CBP A;  1J3T A;  3C0C A;  1BI3 A;  1XQH A;  2X4W A;  3VV0 A;  4BE2 A;  3I5R A;  2V1R A;  2FPD A;  1XTD A;  3C94 A;  4ZGJ B;  1YN8 A;  2CP2 A;  1R8O B;  2GTJ A;  1S72 T;  1VQ7 Q;  2CZ7 B;  1D1B A;  4OP0 A;  1UJY A;  2DD4 A;  2E70 A;  4N0A C;  3P8H A;  1JJ2 A;  2RF0 A;  4QQD A;  2HKN A;  2DLP A;  2JS0 A;  4HCC A;  4IKF A;  2FHD A;  2HBW A;  3MP1 A;  3LWI A;  3OYB A;  5FWC A;  4KBM B;  1VQM T;  3E9F A;  2HQX A;  2ED0 A;  2QQB A;  2PVD B;  5CKE A;  1Q95 G;  2RQV A;  1G3T A;  4A4H A;  3G6E Q;  1W2B S;  3CC7 Q;  4PJM A;  1I0C A;  2JXB A;  5IT9 E;  3QWX X;  2F5T X;  2MYS A;  1OPL A;  1WPY A;  2NUT A;  5FRN A;  1KJW A;  4EMK C;  3UDC A;  2K9G A;  5D6X A;  5KCO A;  2YXY A;  1D1A A;  3H0I A;  2ZPB B;  1RAC B;  1S1N A;  2FRW A;  2YRC A;  5A0D A;  2YUN A;  2E3H A;  1YFN A;  1G5V A;  2QQ9 A;  4KT0 E;  1UHF A;  1RAA B;  5GAM d;  5J39 A;  1WHG A;  3E9G A;  2DTI A;  1RAI B;  3CCU Q;  3IQL A;  2DJZ A;  2DTH A;  1M2O A;  3CCL T;  2GTO A;  6AT1 B;  1RAB B;  5KYW A;  5CAI A;  4XTV A;  3ZBD A;  3KUF A;  5KE2 A;  1G3Y A;  1K1Z A;  2CDT A;  2KY9 A;  1U06 A;  2K3Y A;  3QZ9 B;  3U23 A;  4AFQ C;  3UPU A;  1WA7 A;  2RI5 A;  1QP2 A;  2AT1 B;  2COW A;  3MO8 A;  1X27 A;  4FSS A;  1SHG A;  5GAN j;  3RKX A;  3QPH A;  2CGH A;  3A98 A;  4Q5W A;  4HXJ A;  2E12 A;  2M9U A;  3WVD B;  3QJY A;  4LDU A;  3GOX A;  4OMN A;  4QT7 A;  1Y57 A;  3M54 A;  3LH5 A;  2RO0 A;  2V8K A;  1E6G A;  4BAC A;  3RKW A;  3I9Q A;  3JB9 D;  1K0S A;  4M7A D;  3QG1 A;  2X4X A;  1OOT A;  1VYT A;  2EW3 A;  2JS2 A;  1S72 Q;  2RK1 A;  1KD1 U;  1OV3 A;  3OYN A;  3CXC P;  2BE9 B;  2LT1 A;  1WHM A;  3M57 A;  4UC4 A;  3LX7 A;  1VQ6 Q;  4M78 D;  4M7D E;  1RUW A;  2VAS A;  1VQ8 A;  1YIT A;  2L3S A;  3CCM A;  1Q86 U;  1JRI A;  4E7K A;  1VQM Q;  2ZPI B;  2DXC A;  3QBY A;  2P4T A;  4JJB A;  3FEO A;  2AKL A;  3EGX A;  1AEY A;  2LZ6 B;  4RUG A;  1K8A C;  3HHT B;  2DK3 A;  2DEQ A;  1XJW B;  1MMG A;  2HMA A;  1WI7 A;  1M1K U;  2E41 A;  3CC2 T;  2HL5 C;  3TSW A;  1NJI R;  3BW1 A;  4C0G A;  1P92 A;  2A36 A;  2QEX Q;  5M9O A;  1D1C A;  2OTL A;  2BUD A;  5GJW B;  5HY6 A;  3UA6 A;  2CS7 A;  3EG1 A;  2HNI A;  3PMT A;  2DTO A;  1T0H A;  4E6R A;  4NL3 A;  4DQ2 A;  1PD1 A;  3M0U A;  4OF1 A;  4HCZ A;  2QYZ A;  4N4I A;  1KFZ A;  3PFS A;  1JU5 C;  1VQO A;  2AHJ B;  3HTR A;  2ZZD A;  3JCM X;  4DBF A;  2VB6 A;  3I55 T;  3I35 A;  1K73 C;  5IH2 A;  3QII A;  1UB4 A;  1H8K A;  4F04 B;  4D6W A;  1VQL A;  2MPX C;  1BI1 A;  2G6F X;  2IVW A;  2YUQ A;  4JDS A;  4FU6 A;  2LJ0 A;  1IB8 A;  1SEM A;  2DBM A;  2LX7 A;  2EWN A;  1YJW Q;  3RER A;  2L0A A;  4PL6 A;  3V8J A;  1IO6 A;  2MAM A;  2LJ3 A;  2A7Y A;  2QDY B;  4LUD A;  2D0Q B;  1UGR B;  3V7C A;  2EYZ A;  4E7I A;  2Y4X A;  3CD6 Q;  2R5A A;  3HL8 A;  3HFO A;  2P0K A;  2LQW A;  1M27 C;  3EHQ A;  4ORZ A;  3FLG A;  5GAM e;  3CBO A;  5GAO r;  1Q81 U;  3L2Q A;  3REB B;  2KT1 A;  5IHI A;  1ZUK A;  5GAM j;  1SRM A;  1R77 A;  1VYV A;  2EYX A;  2ABL A;  2D1X A;  4M77 E;  4RMO A;  3CMA A;  2A28 A;  1KHI A;  2JUF A;  1X6B A;  1Y7X A;  1NEB A;  2FVU A;  2R57 A;  2MK5 A;  1CSK A;  1D0Y A;  2X51 A;  4RG2 A;  9ATC B;  5D6W A;  2YDL A;  4OMP A;  1N8R U;  1PSF A;  2W0Z A;  2WSC E;  5A0L A;  3A8L B;  1BI0 A;  4NS5 A;  1KQS A;  4A4K A;  2P84 A;  2D0N A;  2NUZ A;  4C5H A;  4DOV A;  2K57 A;  3KFV A;  3M0S A;  3M9Q A;  1B7T A;  1VQN T;  3TEE A;  3L42 A;  1AD5 A;  2J6K A;  4J7F A;  4HA8 A;  3SWN A;  4AFZ C;  2PTK A;  4CC3 A;  3BFM A;  1VQK T;  1BI2 A;  2LT4 A;  3DKM A;  3I55 Q;  2NYS A;  4C8Q C;  1E6H A;  3DLM A;  5J26 A;  4J7I A;  4II1 A;  1JQQ A;  2ROT A;  3L2Z A;  5KH6 A;  2M51 A;  5KYX B;  4C8Q F;  2EFI A;  1SRL A;  4EMK B;  2K5L A;  3VUZ A;  3UWN A;  1YJN A;  2FO0 A;  4FW1 A;  3CCJ T;  1ZBJ A;  4M7D B;  2OAU A;  3CPW A;  4AT1 B;  1KQ1 A;  3OS2 A;  4JJN K;  2DVJ A;  1H3Z A;  4PFO A;  3G71 A;  1R0C B;  4XK8 E;  1ZSZ A;  2XID A;  2QDL A;  3FC3 A;  3JCM J;  3HPW A;  3PIP A;  1W70 A;  2RQR A;  2SRC A;  3EG3 A;  1TXQ A;  2LVM A;  4OML A;  3FDR A;  3CCV T;  2CUB A;  3A8H B;  5GAO n;  4A54 A;  3JCM d;  3AHU A;  2X3X D;  3MEV A;  5L23 A;  1JBM A;  2LTO A;  2YLB A;  4C5I A;  4A4G A;  2COY A;  1PKT A;  3QHS A;  3MEW A;  4LD6 A;  3M58 A;  4HT9 A;  5GAN 4;  3NTK A;  1N9R A;  3TRE A;  1M90 C;  1QVF P;  2ZAE A;  2HSP A;  3KBG A;  2J6O A;  1K9M C;  5I11 A;  1RI0 A;  1WJQ A;  1CKB A;  4M75 D;  1KC8 R;  4C0D C;  2C0I A;  2M0O A;  1VIE A;  4R55 A;  1QWF A;  4A4F A;  3MEU A;  5GAN 7;  1YJ9 A;  2EYY A;  4QVC A;  4F7U G;  4DEX A;  2EIF A;  4PKC C;  4E7H A;  4PJO C;  3VS0 A;  1VIF A;  1K0X A;  5HCK A;  1JXM A;  2A0F B;  1WQW A;  1VQN Q;  2FPE A;  1RLQ C;  1BYM A;  1VQ4 A;  2J05 A;  4PJO F;  3VS5 A;  3JCM h;  2EJF A;  4E7Z A;  2K5F A;  1AHJ B;  4WF2 A;  4XTX A;  4FL6 A;  5KYN A;  5GAN 6;  1ZBX A;  1WXT A;  1VQK Q;  3ULR B;  2HZY A;  3JB9 G;  4M7A G;  1ZLM A;  2HQE A;  5C0M A;  3G4S A;  2CP5 A;  1TUG B;  2J06 A;  1ZQ1 A;  5AYF A;  2RHX A;  2D9T A;  2ZPF B;  3EG2 A;  1PSE A;  2MIO A;  4JUV A;  4RTX A;  5IXF A;  4PJJ A;  1FMW A;  1YIJ A;  2YT6 A;  4M78 G;  3OA6 A;  2DL7 A;  2X4J A;  3JCM V;  3M0T A;  4ZGD B;  3HRT A;  3OYY A;  1YCY A;  3GPL A;  1M5Q 1;  3PVL A;  4E47 A;  2RJC A;  2E5K A;  2LDM A;  4E7J A;  3THK A;  3VKI A;  1JJ2 P;  3M53 A;  3M4G A;  1NM7 A;  2HKQ B;  2FYK A;  5CIU A;  4J6X A;  4MZM A;  5LJ5 d;  2DET A;  2P4R A;  1G83 A;  2RJF A;  4Z88 A;  2EVR A;  2E10 A;  1K8A U;  2RJD A;  4C92 C;  1QMC A;  1PWT A;  1YHQ A;  2EGE A;  1M8V A;  5GMK e;  2XI9 A;  4VUB A;  3OYK A;  3MET A;  1OX9 A;  2EQU A;  1UFF A;  2X35 A;  1M9S A;  3CCS Q;  4C92 F;  1WQ7 A;  2KSS A;  5GMK j;  1VQ7 T;  2RJE A;  4KH1 B;  2CP7 A;  2LC4 A;  2GQV A;  4D8K A;  5FRO A;  1QVG A;  2NUT B;  2FPF A;  4ELZ C;  3SD4 A;  3M0P A;  2DNU A;  2HEQ A;  3UF4 A;  1K73 U;  2E64 A;  3WXM B;  3G6E T;  1N6A A;  1V29 B;  1ZHI A;  4MDX A;  4MZT A;  2HBP A;  2EQI A;  2EYQ A; 
#chains in the Genus database with same CATH homology
 1E7O A;  1UHF A;  4JPB W;  1GFC A;  1NLP C;  3O5Z A;  3EGU A;  3IQL A;  1ZUY A;  2GTO A;  2KRS A;  2O9S A;  2DE0 X;  3I5S A;  1K1Z A;  2CDT A;  3JV3 A;  1TUD A;  3FJ5 A;  3VS7 A;  2X3W D;  2DL8 A;  3H41 A;  2DMO A;  1U06 A;  1MV3 A;  3U23 A;  4AFQ C;  1QWE A;  1A0N B;  1WA7 A;  1H3H A;  2YUO A;  4FSS A;  1X27 A;  4J9D A;  1SHG A;  1UEC A;  1M3A A;  5IHK A;  2A37 A;  1PKS A;  3A98 A;  4HXJ A;  4D8D A;  4OMN A;  3VS3 A;  1WXU A;  4QT7 A;  1QCF A;  2RQW A;  1Y57 A;  1MUZ A;  1ARK A;  1HD3 A;  3LH5 A;  2F2W A;  4HVU A;  3VRY A;  1E6G A;  1NEG A;  1FMK A;  2CH4 W;  1B07 A;  1OEB A;  2DA9 A;  2LNH B;  2PNI A;  2RMO A;  3I9Q A;  1K0S A;  2AZV A;  1YP5 A;  1OOT A;  1VYT A;  2EW3 A;  2JS2 A;  2V1Q A;  3M0Q A;  1AWJ A;  3QWY A;  2GBQ A;  4RTW A;  1OV3 A;  2HDA A;  1AOJ A;  2KE9 A;  4RTT A;  4F17 A;  1EFN A;  2F2X A;  2KYM A;  4RTY A;  4F16 A;  2DYB A;  1UJ0 A;  2B86 A;  1RUW A;  2K7A A;  2HCK A;  2L3S A;  2CSI A;  1WLP B;  4GBQ A;  2BTT A;  4J9C A;  4JJB A;  2AKL A;  1AEY A;  2DX1 A;  2FRY A;  2LZ6 B;  4RUG A;  3SHW A;  1BU1 A;  1WXB A;  1WI7 A;  2OJ2 A;  2RQU A;  4JJC A;  1GL5 A;  2VWF A;  2L3P A;  2KR3 A;  3SEM A;  2KEA A;  3TSW A;  2ESW A;  2GNC A;  2YSQ A;  2EYW A;  2A36 A;  2DIL A;  1PRL C;  2GGR A;  3PE0 A;  4AG1 C;  5GJW B;  3UA6 A;  3EG1 A;  1K4U S;  2CT4 A;  2J6F A;  2KGT A;  3NHN A;  1T0H A;  2VVK A;  2W10 A;  4E6R A;  2LP5 A;  2O2O A;  2IIM A;  3M0U A;  4J9B A;  1M3B A;  1KFZ A;  2SEM A;  1JU5 C;  1UHC A;  4CC2 A;  1K9A A;  1AZE A;  2K79 A;  2XMF A;  1WX6 A;  1Z9Z A;  4Z89 A;  3RBB B;  1BBZ A;  3I35 A;  1FYN A;  5IH2 A;  3H0F A;  1GCQ C;  1H8K A;  4HVV A;  2G6F X;  3VS4 A;  4WCI A;  1AWW A;  2YUQ A;  1I07 A;  4LE9 A;  1AWX A;  2DRM A;  1MV0 B;  2LJ0 A;  1SEM A;  3ZL7 C;  2DBM A;  2LX7 A;  2JMC A;  1WIE A;  1I1J A;  1M8M A;  2L0A A;  4HCK A;  1IO6 A;  2LJ3 A;  1QLY A;  1M30 A;  4LUD A;  3VS6 A;  2EYZ A;  2O31 A;  1SPK A;  2KRM A;  1X69 A;  1W1F A;  5FWB A;  2LQW A;  1M27 C;  3EHQ A;  2EGA A;  2D8J A;  2BZ8 A;  4ORZ A;  1LCK A;  1BB9 A;  4JZ4 A;  1NYF A;  1AVZ C;  2ED1 A;  2H8H A;  1X43 A;  3REB B;  2KT1 A;  5IHI A;  1ZUK A;  3NMZ C;  1SRM A;  1VYV A;  2CT3 A;  2GQI A;  2EYX A;  2ABL A;  1T3L A;  2D1X A;  2MOX A;  5ECA A;  2C0T A;  2CRE A;  1OPK A;  3VRZ A;  1XOV A;  3UAT A;  2KT8 A;  3GBQ A;  2A28 A;  2JM9 A;  2JMA A;  2M0Y A;  1UUE A;  1ABO A;  1X6B A;  1GBR A;  2EPD A;  2KBT A;  1NEB A;  4ESR A;  1HJD A;  1CSK A;  4LN2 A;  1V1C A;  2DF6 A;  2YDL A;  4OMP A;  2AKK A;  2W0Z A;  2DL3 A;  5IHN A;  4RTV A;  2DL5 A;  4IIO A;  1ZUU A;  2OAW A;  1JXO A;  4M4Z A;  4Z8A A;  4R0K A;  2D0N A;  1VYU A;  2NUZ A;  3KFV A;  1UDL A;  3M0S A;  1YWO A;  2CSQ A;  2CH4 A;  1AD5 A;  2J6K A;  2KRO A;  4AFZ C;  2MCN A;  5IXB A;  2PTK A;  4CC3 A;  4AG2 C;  3TSZ A;  3PVQ A;  2LCS A;  2AZS A;  1YCS B;  2KNB B;  1E6H A;  5EC7 A;  1JQQ A;  2JT4 A;  2ROT A;  4AFS C;  2M51 A;  2JW4 A;  1SRL A;  2BZY A;  2D8H A;  2CUD A;  4J9E A;  1T0J A;  2FO0 A;  1NYG A;  2K2M A;  1ZBJ A;  4DEY A;  1AZG B;  2ENM A;  1JEG A;  1X2Q A;  2DVJ A;  5I22 A;  1QKX A;  3EHR A;  4ZNX A;  2QDL A;  1T3S A;  2LMJ A;  1GFD A;  1G2B A;  2RPN A;  1UE9 A;  1JO8 A;  2EBP A;  2EGC A;  1W70 A;  2RQR A;  2SRC A;  3EG3 A;  2RNA A;  1K76 A;  4OML A;  2CUB A;  4HVW A;  2I0N A;  1SHF A;  2X3X D;  1VA7 A;  4OMO A;  5L23 A;  4IIM A;  1WDX A;  2J7I A;  2C0O A;  1UG1 A;  4X1V A;  1PRM C;  1WFW A;  1PKT A;  1UGV A;  4GLM A;  4JZ3 A;  3H0H A;  1SSH A;  2K6D A;  1B3Q A;  2HSP A;  1H92 A;  2J6O A;  5I11 A;  2KYB A;  1M3C A;  1CKB A;  4OMQ A;  1GCP A;  2JTE A;  2C0I A;  3TVT A;  1GBQ A;  1QWF A;  2FG0 A;  2RN8 A;  1YWP A;  2PZ1 A;  5FW9 A;  2EYY A;  3VS1 A;  2L2P A;  1ZSG A;  1UTI A;  4DEX A;  2L3Q A;  3VS0 A;  1PHT A;  1YNZ A;  2DJQ A;  3EG0 A;  4J9H A;  1JXM A;  5HCK A;  4CC7 A;  1K0X A;  2A08 A;  3CQT A;  2FEI A;  3R6N A;  4K11 A;  1Y0M A;  1W6X A;  1ABQ A;  1RLQ C;  2FPE A;  2J05 A;  4JJD A;  1TUC A;  3NGP A;  3VS5 A;  4AFU C;  2DRK A;  3REA B;  1RI9 A;  1CKA A;  2LQN A;  1WXT A;  2AK5 A;  4OMM A;  4J9G A;  1HSQ A;  2BZX A;  3ULR B;  1ZLM A;  1KSW A;  5GJV B;  2J06 A;  4EIK A;  1U5S A;  4RTU A;  2LJ1 A;  4LUE A;  4Y92 A;  2F2V A;  3EG2 A;  2O88 A;  2MIO A;  1N5Z A;  1X6G A;  4RTX A;  4A63 B;  5IXF A;  2EKH A;  2O9V A;  2YT6 A;  2NWM A;  2DL7 A;  1RLP C;  1J3T A;  1KIK A;  3UA7 A;  3C0C A;  3M0T A;  4F14 A;  3PVL A;  3I5R A;  1BK2 A;  2ROL A;  1QKW A;  2V1R A;  2FPD A;  1Z9Q A;  1TG0 A;  1YN8 A;  2DL4 A;  2E5K A;  2DBK A;  3THK A;  1PNJ A;  2GTJ A;  1GCQ A;  1NM7 A;  3M0R A;  3RNJ A;  3VS2 A;  2JM8 A;  1U3O A;  1UJY A;  2P4R A;  1G83 A;  4Z88 A;  2EVR A;  2RF0 A;  1NG2 A;  1PWT A;  2KRN A;  4J9I A;  2DLP A;  2EGE A;  1GRI A;  2JS0 A;  1NLO C;  2HBW A;  5FWC A;  1ZX6 A;  1X2K A;  1WYX A;  1UFF A;  2ED0 A;  3NPF A;  2RQV A;  1I0C A;  2JXB A;  3QWX X;  4D8K A;  2KXD A;  4CC4 B;  2KXC A;  1AWO A;  1OPL A;  2ECZ A;  4J9F A;  2FPF A;  2K3B A;  1KJW A;  2VKN A;  2K9G A;  2RQT A;  3M0P A;  4RTZ A;  2DNU A;  2HEQ A;  3UF4 A;  4LNP A;  2DM1 A;  3H0I A;  1S1N A;  2FRW A;  2YUP A;  2OI3 A;  2YUN A;  4KRT A;  2EQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...