3FJ5A

Crystal structure of the c-src-sh3 domain
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGRTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Intertwined dimeric structure for the SH3 domain of the c-Src tyrosine kinase induced by polyethylene glycol binding
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 6
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A02
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3fj5A01
1AWOA 2GTJA 2JM8A 3PE0A 4RUGA 1K76A 2J6KA 2RQRA 2RMOA 1W6XA 1PNJA 1T0JA 4D8KA 2EPDA 1NEGA 4CC4B 1H3HA 2CH4W 1M27C 2KT1A 1MV0B 2CSIA 2DX1A 1QKXA 1NEBA 4ZNXA 2F2VA 1AWJA 1BB9A 2CSQA 2ENMA 4OMMA 2RQVA 4F14A 3M0QA 3QWXX 1WYXA 2A08A 2ED0A 1ZX6A 4CC3A 2AKKA 1GBRA 2AKLA 3VS1A 1AWWA 1GL5A 4OMNA 2JT4A 4J9CA 3REAB 2YUPA 2HCKA 1JXMA 1H92A 2A28A 2D8JA 1AOJA 3A98A 3O5ZA 2CT3A 1SSHA 3EG2A 1PKTA 1ABOA 1QCFA 1X43A 1TUCA 4HCKA 2RNAA 4HVVA 3H0IA 4LUDA 1M3BA 1T3SA 2K79A 4RTUA 2B86A 1WA7A 1K4US 1QLYA 4OMOA 3VS5A 3NMZC 3SHWA 1H8KA 1HD3A 1ZUKA 1SHGA 1GCPA 3VS2A 1NLPC 2GQIA 2V1QA 1JEGA 3UA6A 1ABQA 3H41A 2ED1A 2CDTA 1M30A 4AG1C 2BZXA 1U06A 4Z8AA 2RQUA 2DL8A 2KRMA 4AFUC 1K0XA 2YUQA 2K2MA 4LUEA 1JO8A 1NM7A 1HSQA 1WXBA 4JJCA 1JQQA 1SRMA 1GFCA 1X6BA 2DBMA 4EIKA 5IHIA 2GTOA 5IH2A 2DRKA 4HVWA 1YP5A 4K11A 1PRLC 2EBPA 4JPBW 4AG2C 2RN8A 1TG0A 1CSKA 1VYUA 3EG3A 2K7AA 2LZ6B 2FPFA 4ORZA 1JXOA 3FJ5A 2EYXA 2CUBA 2DBKA 2I0NA 4DEYA 1U3OA 1UGVA 4RTZA 3R6NA 1MV3A 2RQTA 3I9QA 1YN8A 4Z89A 1JU5C 1YWPA 4OMQA 1UE9A 2J7IA 3M0TA 4X1VA 2LCSA 1UUEA 4J9BA 4J9EA 2DL4A 1YCSB 2RPNA 2M51A 2L3QA 4GBQA 4CC2A 3EG1A 5IHNA 1PKSA 1X27A 1PWTA 1AZGB 2F2WA 5L23A 2FG0A 1I0CA 3I5RA 3VS3A 2KROA 3NGPA 2O88A 1X2KA 1GBQA 4RTYA 1UECA 1B3QA 1IO6A 1OEBA 1SRLA 2DNUA 2YT6A 2KXCA 2GGRA 2DL7A 2ECZA 2FO0A 1GFDA 2LX7A 2K6DA 3UA7A 1N5ZA 3PVQA 3EGUA 4IIMA 4RTVA 4Y92A 2EW3A 2O9SA 2DRMA 4JJDA 5IHKA 2GBQA 3VRZA 1Z9ZA 3EHQA 2PTKA 4J9DA 5I22A 1WXUA 2DL3A 2FPDA 2L3SA 2J6FA 1M3AA 1SPKA 2H8HA 1NYGA 1ZSGA 2DLPA 2J05A 2FRYA 3M0PA 1VYVA 3I35A 1G83A 4HVUA 1UG1A 2A37A 1ZLMA 2DL5A 1WIEA 2KRNA 4M4ZA 2KXDA 3THKA 3UF4A 4RTTA 1WXTA 3ZL7C 1AEYA 3M0UA 2D1XA 1SEMA 1QKWA 3C0CA 2L2PA 1KFZA 2EQIA 2K9GA 1LCKA 1OPLA 1UJYA 1ARKA 4J9HA 1PRMC 1Y57A 2BZ8A 2C0OA 2EGAA 2JM9A 3VS4A 3EG0A 5IXBA 1UJ0A 2O2OA 2C0TA 3GBQA 1QWEA 4IIOA 1SHFA 2ABLA 3VS7A 1QWFA 1FMKA 2JS0A 2LP5A 2KR3A 4F17A 1KIKA 2FEIA 2J06A 4F16A 3TSWA 4AFQC 2V1RA 5IXFA 1I07A 2JXBA 4OMPA 3REBB 1B07A 2EVRA 1VYTA 2EYWA 2RQWA 4CC7A 1A0NB 5ECAA 4JZ4A 2KNBB 1NG2A 2CH4A 2LJ0A 1BK2A 2DF6A 1CKAA 2PZ1A 1VA7A 2VVKA 1PHTA 1WDXA 1EFNA 2O9VA 1CKBA 1T3LA 1ZUUA 3IQLA 2LQNA 1W1FA 4LE9A 4Z88A 2AK5A 2NUZA 2MOXA 4FSSA 2BTTA 2DYBA 2DILA 1M8MA 1RLQC 3EHRA 5FWBA 1AVZC 1MUZA 1RI9A 2YDLA 2OAWA 1BBZA 1Y0MA 2KT8A 2KYMA 2ROTA 4AFZC 1E7OA 4RTXA 2DJQA 2JS2A 2C0IA 1OPKA 1OV3A 1K9AA 1KJWA 1AZEA 1G2BA 2HSPA 2CUDA 1GCQA 2YUNA 3PVLA 2D8HA 4E6RA 1E6HA 2DMOA 2EYYA 1BU1A 1AD5A 3VRYA 4JZ3A 2P4RA 1S1NA 3M0SA 4D8DA 2KEAA 1NLOC 1ZUYA 4ESRA 3H0HA 2DE0X 2EYZA 4DEXA 2KGTA 1M3CA 1XOVA 1TUDA 1UHCA 1ZBJA 4AFSC 3TVTA 1OOTA 2EGCA 4WCIA 1X6GA 5HCKA 2DVJA 3QWYA 1T0HA 2SRCA 2KBTA 2OI3A 4LN2A 2KYBA 1X2QA 5FW9A 1YNZA 4J9GA 2M0YA 2LJ3A 2K3BA 1I1JA 2HDAA 1WX6A 2GNCA 2X3XD 1UFFA 2LJ1A 4OMLA 5EC7A 1GRIA 3RNJA 2AZSA 2CT4A 2JMCA 2MCNA 2FPEA 2J6OA 3M0RA 2AZVA 1YWOA 2KRSA 3LH5A 1UDLA 2LNHB 2YUOA 4JJBA 1UTIA 2O31A 2G6FX 2EGEA 2JTEA 1RUWA 2E5KA 1K1ZA 2EKHA 1HJDA 3JV3A 3I5SA 4KRTA 2W10A 2JW4A 2QDLA 2HEQA 2W0ZA 3CQTA 1W70A 5GJVB 3ULRB 3KFVA 2VWFA 1K0SA 2LQWA 2DA9A 3H0FA 2L0AA 2D0NA 2DM1A 1E6GA 2JMAA 1U5SA 1WLPB 2A36A 2ESWA 1Z9QA 2RF0A 4GLMA 3VS0A 2X3WD 1AWXA 1FYNA 2F2XA 3NPFA 2MIOA 1V1CA 1J3TA 2BZYA 2XMFA 4A63B 1KSWA 2VKNA 2KE9A 2OJ2A 2HBWA 2FRWA 3TSZA 3U23A 1GCQC 2CREA 2NWMA 2PNIA 4R0KA 1X69A 4LNPA 1WI7A 4RTWA 4J9IA 4J9FA 2L3PA 4QT7A 5GJWB 3SEMA 1UHFA 1RLPC 2ROLA 2SEMA 5I11A 1WFWA 4HXJA 3VS6A 3RBBB 2LMJA 3NHNA 3UATA 5FWCA 2YSQA 2IIMA 1NYFA
chains in the Genus database with same CATH superfamily
1MMGA 1WGSA 2LQKA 3I55Q 2KI7A 2JUFA 1G8XA 2RQRA 4PJOA 2MMPA 2RMOA 1PNJA 1YITA 2COYA 1M1FA 1WHMA 3I56Q 1YI2Q 4X9DA 5I2MA 1VQKQ 1NEBA 4ZNXA 2F2VA 2RB6A 3J7AF 5GAN3 1AWJA 2CSQA 2ENMA 3LYIA 3RESA 3RIRA 1TOVA 2QQRA 3BDLA 4JLGA 3CCMT 2EWNA 3A8MB 3UT1A 2XHCA 2P0KA 1ZX6A 3A1PA 2AKKA 1GBRA 3CCRT 1BI0A 3QYGB 3VS1A 3DLLA 2DXBA 4LDXA 2LT1A 1X75C 3FC3A 4OMNA 2JT4A 3CCJA 2OTJT 3OMGA 2HCKA 3CCSQ 2COWA 1QCNA 2A28A 1N9RA 4JUVA 3A98A 1KK7A 1TS9A 2H3JA 3CC4A 1PKTA 4R56A 1ABOA 3L2RA 1QVFA 3OYBA 1N8RC 4LUDA 3M53A 3OW2A 1ZSZA 2K79A 4RTUA 2X51A 2B86A 3M56A 4C92D 4RG8A 1K4US 4OMOA 4NL2A 3VS5A 4C0ZA 1R8OB 3NMZC 3CC7T 1GCPA 2E12A 3UA6A 3TQ7P 1ABQA 3H41A 4GY5A 1KD1R 1M30A 2KK4A 1VIEA 2BZXA 5GMKj 4E7HA 4Z8AA 2F5KA 4E7LA 3VJPA 3E9GA 3S3MA 5CK9A 4LUEA 1JO8A 1M2VB 1NM7A 1WHKA 4KGVB 3RR6A 1VUBA 1WXBA 2VUBA 1LVKA 4JJCA 1MMAA 4ELZC 4B9XA 2EJFA 3MEWA 3HSBA 4EIKA 1VQ4T 2GTOA 2AIRB 4HVWA 4LD9K 5GAOn 3E9FA 5LJ5d 4HCCA 1M1KC 2QAZA 1RACB 1Q7YC 5GAN4 1TG0A 3RKYA 1ZA1B 2XI9A 3FJ5A 3HFNA 2EYXA 4GLKA 1NE8A 3F70A 2RO0A 4BACA 5HK0A 2YRCA 1LJOA 4Z89A 4OMQA 2JZ2A 1BI3A 4C0GA 3M0TA 4PJNA 2LCSA 2DL4A 2RPNA 2X4XA 2EAYA 1VQ6Q 2P0QA 4RCBA 3CCRQ 1OYXA 3RMQA 4C8QC 5L23A 3ME9A 2XG8D 2K5FA 4FW1A 2KROA 3NGPA 4E47A 1V29B 4RTYA 4M7AB 1TSFA 2XDPA 1B3QA 1IO6A 2YT6A 1YIJA 2KXCA 4J7FA 3OBYA 4QVZA 3MPUB 1N5ZA 4IIMA 4F7UE 4RTVA 2EW3A 4EMKC 3G4SQ 4FYYB 2O9SA 1O9SA 3TCJA 2VGNA 4KGXB 5IHKA 1WHLA 3CPFA 3FDRA 1M3AA 1NYGA 4M7AF 1JJ2A 1F1BB 4PKCC 2J05A 3M0PA 1VYVA 3M54A 1UG1A 4ZTJA 5AT1B 1Q82U 4AMCA 3CCMA 3NTIA 5IAYA 2DL5A 2KRNA 2LNVA 2KXDA 6AT1B 3THKA 3UF4A 3OYFA 3L42A 3OW2S 1VQOT 4HCZA 3ZL7C 1AEYA 2D1XA 2EQIA 2YWWA 4IUVA 1ARKA 2BZ8A 2C0OA 5LJ5e 1K9MC 4EMHA 5IXBA 5KE3A 4M7DB 1UJ0A 1QWEA 1IB8A 3CC4T 4IIOA 1FWZA 2QEXA 3KUFA 2DYIA 1BCOA 2E65A 3URGA 1KD1C 2IVWA 2KQWA 4M78C 2FEIA 4BY6B 1M5Q1 3G4SA 4F16A 4AFQC 4M77F 3OYNA 5IXFA 2EQKA 2MI6A 1I07A 2K57A 3CC7Q 1D0ZA 1YI2T 5A0DA 1Y71A 4M75C 2PUOB 2BKDN 1BCMA 3META 4C5GA 3RDVA 2O4XB 3FRNA 2DF6A 4M78G 3MO8A 3LW5E 3JCMe 2VVKA 4RKUE 1IHWA 1EFNA 2LRQA 3WXMB 1W1FA 4LE9A 4XK8E 1YJ9Q 2MOXA 2X4JA 2VV5A 5GAN6 1OZ2A 2DD5A 1BYMA 5CKDA 2DILA 3QSUA 3HPWA 4JJNK 1RLQC 2VXEA 5FWBA 2CS7A 2CP0A 3C95A 3HKSA 2E1HA 3HL8A 2GFAA 5M9OA 4AFZC 2JS2A 1WJRA 2C0IA 4C92A 1AZEA 2CUDA 1GCQA 2IPOB 3CCVQ 3FB9A 3PVLA 3PT9A 2D8HA 4J6WA 1M90U 1AD5A 1BI1A 1VQLA 4BUGA 1S1NA 4C5HA 1NLOC 3X24B 2GQVA 3RKXA 2RHIA 2M9UA 3H0HA 2CYZB 1XOVA 2QGGA 1ZBJA 2ZPGB 4X9CA 3GP8A 3JCMb 4M7AC 2DVJA 4RG2A 1KC8C 2E64A 3OS1A 1VQPA 2KYBA 3HFOA 1YNZA 3I55A 2LJ3A 4A53A 2QGFB 2RHYA 4A4FA 1OI1A 4A4KA 2MYSA 1NJIC 1UFFA 3MEUA 2LJ1A 1OU9A 5KYUB 1OU8A 1S72Q 3P8BB 2PVGB 4FW2A 3QHSA 2FZGB 4F7UA 4ZN3A 3I56A 3P8DA 3DB4A 3CD6Q 2JMCA 4MZPA 2CZ7B 2DK3A 3E2UA 2FPEA 3M0RA 4ATOA 4UC4A 2KRSA 3PIPA 4C8QB 1VQKT 2FZKB 4EPCA 2YUOA 4JJBA 2NUPA 1YJNT 3JCMJ 2EKHA 2CP2A 1HJDA 3DKMA 3E1SA 2A3LA 5FU7B 3TEEA 2DXUA 2JW4A 2QDLA 2Y4XA 1QQJA 3CQTA 1K0SA 2JTFA 4A4EA 2E6ZA 3J80E 1SSFA 2DM1A 1E6GA 1WLPB 1U5SA 2JMAA 2A36A 2RJCA 2EIFA 5KH6A 3CCQA 3G4ST 4FT2A 2JNGA 1FYNA 3NPFA 2MIOA 1J3TA 3OSSC 2ATCB 4A4HA 4M78B 2R5MA 2BIVA 4PLIA 2K3YA 2HZYA 2QASA 3TSZA 3M55A 2CZ0B 2FYKA 3X25B 1GCQC 5D7UA 1ZSZB 1VQ8T 1IGUA 2NWMA 4R0KA 4DA4A 3FJPA 1X01A 3J81E 2L3PA 1WZOA 4QT7A 4YTLA 1WFWA 3VS6A 3RBBB 4N0AA 3NHNA 1LNXA 1PG5B 4A54A 1QW1A 2D9TA 2JM8A 1QVFP 3PE0A 4ZTFA 1JJ2P 4C5EA 3X28B 3V8KA 1W6XA 2B8AA 2K4YA 3JB9J 3CBMA 4N0AC 1T0JA 4D8KA 2XKOC 4L6V5 2RK1A 4N4GA 3GPLA 3V7RA 3L2VA 1NEGA 2PVOB 4CC4B 3ER0A 2CH4W 1VQ5A 1M27C 5LJ3g 2KT1A 1QP2A 4E7SA 2DX1A 2RM4A 1QVPA 3CD6T 1BIBA 4M75A 5GANf 4XTWA 1BB9A 4FCYA 3BY7A 1VQ7Q 4OMMA 3M4YA 1UB4A 2CKKA 1K9MU 3M0QA 3QWXX 3CC2T 1KG1A 4M7DC 4CC3A 4FYVB 1WHJA 4QQGA 3OYIA 2GCXA 3HP9A 1GL5A 3CCSA 5GAMj 2YUPA 1EZZB 2YHTA 3VYHB 1R77A 1X43A 3OYMA 3X26B 1N8RU 4HVVA 3H0IA 1Q86C 4BDZA 3MEVA 4KH1B 1UGPB 4Y91A 2DKGA 2Y4YA 3SHWA 2DERA 4MMLA 4NL3A 1VQKA 1NLPC 2GQIA 2EJ9A 2CDTA 3EGDA 3P8HA 4P5NA 1K73C 4PJOD 3EFSA 2K2MA 1M2OA 3Q1JA 2HBPA 3EAEA 1JB0E 1HSQA 3M58A 1JQQA 2KMTA 4M7DA 4IUPA 3PTAA 4E2FB 3CCUT 4PK4A 3CCQT 2DRKA 3LLRA 4C5IA 1YJ9T 3GOXA 3G6EA 4JPBW 4AG2C 4C8QA 2E4HA 1Q81U 1VYUA 2HSEB 1W2BP 4J6YA 4OGEA 2FPFA 5GMKl 2CUBA 2DBKA 2I0NA 5GANh 2BE7D 3R6NA 4RTZA 3CCLQ 3I9QA 1UE9A 2LX9A 4J9EA 2L5QA 2LCLA 1M1KR 2WSEE 2FL7A 3SB2A 3INZA 4KH0B 4GBQA 2R58A 1PKSA 2F2WA 3VS3A 2M0OA 3OS2A 2O88A 2KVQG 1X2KA 1GBQA 2F69A 3FIFA 4PJOC 2QQSA 3GF5A 5KYUA 4LD6A 1VQ4Q 3AHUA 4C0DC 2K6DA 2ZPIB 2V8IA 4Y92A 1FXXA 1YJNA 4CI0C 2LTOA 2CP5A 4JJDA 4L59A 2GBQA 3M9QA 1VQOA 2DVEA 1K8AR 4J9DA 5I22A 2FPDA 4LDUA 1MHNA 1H641 3JCMd 4M78E 1K9MR 2A37A 4C92B 4LDYA 3CPWP 4XTXA 1IRXA 1ZLMA 2QTXA 5KCOA 4QVDA 4RTTA 4C92G 2X4YA 1M8VA 2QQAA 3M0UA 3PMIA 3GLXA 2DIQA 5GAMf 2K9GA 2EQMA 1LCKA 1PRMC 1JJ2S 1UGQB 4DBHA 4QW2A 5DLQE 1S72A 2EGAA 3VS4A 3OQ5A 4NS5A 3VUZA 5KYXB 4HCBA 1I4K1 5CKEA 5CO7A 4M75G 1SHFA 5KYYB 4F7UF 2EQJA 3VS7A 3FEOA 1VQNT 1UGSB 4C0FA 2KR3A 4C92F 3CMAT 5GMKh 2VGMA 3QYHB 8AT1B 5HKCA 1YFNA 4N4HA 1C6VX 3OYHA 2YRVA 1Y7XA 4HT9A 4OMFB 2E6NA 4NOYA 2EVRA 1Q82R 1A0NB 5J26A 5ECAA 5GAN7 4M75D 2CH4A 2IG0A 4JRIA 1BK2A 4XTZA 2EQUA 2M16A 2V26A 1D1AA 3V7SA 3X20B 2COZA 1K8AU 4KT0E 1T3LA 2BUDA 1VQ4A 1ZUUA 3LWIA 3CCVA 3OYKA 5FRNA 4BD3A 1B34B 2HD0A 3JB9F 3G6ET 1YJWQ 2BTTA 2DYBA 1WHGA 1QVFS 3ZFJA 2E3HA 1M8MA 2RJFA 1MNEA 4MZTA 5CKHA 4M7DG 3EHRA 3C12A 2M02A 2YDLA 4KGZB 2OAWA 1YJWT 3HRUA 2KT8A 2ROTA 1I5OB 1M1KU 2DJQA 4IUQA 3OYLA 3PNWC 4M78D 1OPKA 2DFUA 3CCLT 2YUNA 3O8VA 1E6HA 3V8LA 2EYYA 4RCCA 2X4WA 4PL6A 3VRYA 5LJ3j 3A8HB 1FX7A 2MWOA 2OAUA 3D7SB 4ESRA 3JCMQ 3JAME 4BI8B 4XTUA 3SWNA 2EYZA 1U8RA 1TUDA 1UHCA 2ZPHB 2HL5C 1OOTA 1VQ5Q 2P0PA 4M75F 3OS5A 2D6FA 2VXFA 1T0HA 3CC4Q 2KBTA 3EG9A 2OI3A 4LN2A 5GAMg 4J9GA 4QKUA 2KY9A 3EFOA 1PSEA 4BB7A 3V8JA 3CCJQ 2GNCA 1RL2A 2CP3A 1K73U 1C0MA 3M57A 2QI2A 1GRIA 2DJZA 2XU8A 1M90R 1TWBA 2DZCA 2QG9B 3BE3A 5EG2A 2J6OA 5GAOq 2L3RA 3LH5A 2O31A 4M77G 2EGEA 2JTEA 1RUWA 1UGRB 3I5SA 5CQYA 4JRQA 3SFMA 5GAOr 2MPXC 2W10A 3JCMf 4CRIA 1W70A 2ZZDA 3ULRB 2NUTB 2XIDA 2A0FB 5CAIA 2L0AA 4JDSA 1UEBA 2D0NA 4J8OA 5D6XA 5GANd 3OYAA 2ESWA 1KHIA 2CP7A 2QEXQ 3CMAQ 2X3WD 1HXDA 4DQ2A 3HRTA 5DM7R 2BZYA 2CZ1B 4FT4A 3A5ZB 2DTIA 1MMNA 1VQ7T 1S72T 2KE9A 2DEQA 2OJ2A 2FRWA 3PGGA 5FROA 4B9WA 3U23A 3A8GB 3CCRA 1YHQQ 3TREA 2O01E 2CREA 2PNIA 1NPRA 1RADB 1X69A 4LNPA 5GAN2 3UWNA 1WI7A 1W2BS 4O6JA 2YLCA 4J9FA 1IXDA 5LL6S 2E10A 1UHFA 1RLPC 2SEMA 1VQ5T 2RHXA 2LMJA 2YSQA 4M77E 1M2VA 3AT1B 2J6KA 1VQ9T 3JCMh 1R0BG 3CCQQ 5HK3A 1H3HA 3OW2P 1B7TA 5AYFA 3OYEA 2XD0A 3DLMA 2HAXA 5GANj 3CCVT 1Y96B 2CGHA 2RA2A 2DXTA 1VQNA 1FMWA 5KCHA 1SF9A 1QVGA 2VB6A 1KQSP 4OF1A 4F14A 2A08A 2ED0A 3HHTB 1OZ3A 2AKLA 1QMCA 4KUIA 2FHDA 1RABB 5J39A 3OB9A 4J9CA 3REAB 1VQPT 7AT1B 1I8FA 3S3OA 4M7AD 1H92A 3UPUA 4PFOA 4F04B 2D8JA 2RD1A 2K5IA 3O5ZA 1K73R 1Q95G 3OA6A 1SSHA 1XJWB 3EG2A 4ZN1A 1QCFA 5FU7C 2XDBA 1HK9A 1VQPQ 5C0MA 5CVIA 1T3SA 3JCMg 2Z0WA 4M75B 4ZGDB 1QLYA 2PUKB 1V76A 1YITT 1H8KA 1ZUKA 3PFSA 1SHGA 3G7ZA 3UDCA 2ED1A 2I2LA 2M1HA 4AG1C 2DL8A 3WVDB 1FMVA 3KBGA 5KYYA 3RMSA 3QUIA 3M59A 3CC7A 5LJ3d 1GFCA 2PVDB 1D1CA 1X6BA 2DBMA 2ZGWA 4EMGA 4M77D 1ZSZC 2ZCFB 4LDVA 1YP5A 4K11A 1D09B 1RAGB 2EBPA 3RUXA 4C8QD 3GNFB 1DJ7B 1CSKA 2EFIA 4O5VA 4ORZA 3SDZA 1YCYA 1TTHB 3FLGA 1U3OA 1UGVA 3WVEB 1VQNQ 1MV3A 1AHJB 5CIUA 1JU5C 1YWPA 2D0QB 3KXTA 3CEYA 2J7IA 4X1VA 1YIJT 1VOMA 4V2SA 2M51A 2L3QA 1N8RR 2MK5A 5IHNA 1X27A 5GMKm 1AZGB 2P84A 1ZA2B 1I0CA 3I5RA 4E7IA 3PIOA 1TH7A 4XU0A 1OEBA 2DNUA 2JTMA 2GGRA 1TU0B 2ECZA 4N4IA 3UA7A 3PVQA 2HNIA 3MP6A 3GNGA 2HQXA 3LH0A 1VQ9Q 4PJOB 4M77C 4C92C 3HRSA 2PU9B 3EHQA 1N6AA 1WXUA 2L3SA 2J6FA 3QDRB 1VQ6A 2H8HA 1ZBXA 2DLPA 3TU4K 2KDSA 3QJYA 4JRKA 1I81A 4PJOG 3CD6A 2WSCE 2K5LA 5GAMh 4HVUA 2JVVA 3L2WA 2QA4A 1WXTA 2E70A 3C0CA 4M7DF 1WNLA 1VQ9A 1OPLA 1Y57A 5GAMe 3JB9G 5J3BA 1Q7YU 5LJ3h 1JBMA 2O2OA 2C0TA 1RAHB 3GBQA 1YI2A 3G71T 1VIFA 1VQMA 2QYZA 4OP0A 4ANJA 1NBEB 2JS0A 1Y07A 3QZ9B 4DBFA 3JSCA 3TSWA 1Q81C 3QIIA 2VASA 2JXBA 4OMPA 3REBB 1B07A 3E19A 3MKDA 2KNBB 2QDYB 1D3BB 4J5YA 5GAMd 1NJIU 2LJ0A 5A2QE 2DPPB 5I2SA 1CKAA 3CCET 1VA7A 2LC4A 4ME7A 2P4TA 1CKBA 4F7UB 3G1JA 3IQLA 4HT8A 4WF2A 4Z88A 1WPYA 1YJ9A 3ASKA 1MMDA 5DLOA 4FSSA 1O75A 3VYGA 5KYNA 9ATCB 1BBZA 1Y0MA 3LX7A 3MCAB 4OB1B 3C94A 1NJIR 2C06A 1TUGB 4DOVA 1G2BA 3M5AA 3EH2A 1XTDA 1YIJQ 4E7JA 1BU1A 2K2VA 1YBYA 2KAFA 5KYWA 1G3YA 2P4RA 4B6MA 2KEAA 1YJNQ 1ZUYA 3BW1A 4DBRA 2DE0X 3JB9I 2QTVA 5GANe 4PJJA 4DEXA 2KGTA 5GAOl 3QKJA 1MGQA 4AFSC 2NLUA 4JLIA 2HKQB 3TVTA 2DTOA 5GMKe 2EGCA 3GIBA 2XICA 4WCIA 1X6GA 3ZEHA 3V7CA 1XNIA 5DY9A 3QWYA 1OX8A 2RJEA 1PM3A 3RKWA 3QPHA 1RAEB 2SRCA 3S3NA 1PSFA 2EJGA 5LJ5g 1X2QA 5FW9A 4A4GA 2K3XA 5CKFA 4C0DB 2K3BA 1I1JA 2HDAA 2E5QA 2ZAEA 3VV0A 1WQ7A 1WX6A 2RK2A 2QXFA 2X3XD 3CXCS 1Y96A 1GXIE 5EC7A 4WTOB 3RNJA 2FZCB 2AZSA 4M75E 2CT4A 4FYXB 2X35A 2NUPB 1LOJA 5CQXA 3CCEQ 2AZVA 2RH2A 1UTIA 1IREB 2G6FX 2E5KA 4F7UG 3EH1A 5D6WA 4M7DD 3MEAA 4KRTA 1VQ6T 3OYCA 2HL3A 1D0XA 2LT4A 1VQMT 5GMKi 2W0ZA 5GJVB 5C6SA 3KFVA 5IT9E 2GF7A 3C4SA 4M78F 2LQWA 3BDUA 5HY6A 4MDWA 3CMAA 1YITQ 5GAN8 3CXCP 2DTHA 2L89A 1AWXA 4BE1A 2F2XA 2NUTA 2XMFA 4A63B 1OX9A 2HQHA 3L2QA 4C92E 5LJ5h 1X6OA 2RHUA 3L2UA 2VKNA 1KQ2A 1OQKA 2HBWA 2LVMA 4BDYA 1PD0A 5IN1A 1IHVA 3L2ZA 4PNOA 4RTWA 1K8AC 3CPWS 1YHQA 3SEMA 4II1A 2E3IA 5I11A 1KC8U 4M77B 3LWHA 5FWCA 2QQ9A 1AWOA 2GTJA 4IUUA 4RUGA 1K76A 2RHZA 2OTLQ 3G6EQ 4FL6A 4PJMA 2GFUA 2EPDA 2LDMA 3CC2A 4JS4A 1TXQA 2XK0A 4MZMA 2OTLT 5A0GA 1BKBA 4E7ZA 1MV0B 5D6YA 2CSIA 1QKXA 3CMEQ 3G71A 4HA8A 2JOYA 1D0YA 2HQEA 1VQOQ 3CBPA 2RQVA 1KQSS 1WQWA 5I21A 1WYXA 4PFZA 2RI2A 3CBOA 3OYGA 3CMET 1VQ8A 1IZ6A 4OVAA 2V8KA 2NYSA 1NPPA 2O4XA 3CCUA 4M7DE 1AWWA 5GAN5 2RI3A 2ZPBB 1SKUB 5CR2A 3JCMX 1JXMA 1M4ZA 2RI5A 1AOJA 3MHXA 2CT3A 3QJ6A 4BI4A 3OYDA 1Q86R 3DB3A 4HCKA 2DXCA 1TUCA 2RNAA 3OSVA 2QEXT 4QQDA 2DIGA 4PFPA 1M3BA 4Z02A 3CCJT 1WA7A 4HKEA 4QVCA 5FLXE 4FIBA 1G3SA 1HD3A 1M90C 3VS2A 3QXEB 4XAXB 2V1QA 1JEGA 2YXYA 3MP1A 2EKOA 8ATCB 1RAIB 1U06A 1Q7YR 2RQUA 4DOWA 1HYOA 3M4GA 2KRMA 4AFUC 1K0XA 2YUQA 1G3TA 2OX7A 4BY6C 4ELYC 3G71Q 1LPLA 1KQ1A 1SRMA 3MP8A 5IHIA 4VUBA 5FU6C 5IH2A 2DD4A 4FM4B 3JCMP 3CCUQ 2AHJB 3ZBDA 1PRLC 2FB7A 2RN8A 4QQ6A 2R57A 3EG3A 2K7AA 2LZ6B 1JXOA 4DEYA 5GAOm 1I5LA 3JCMV 2QK0A 2RQTA 1YN8A 2RJDA 1UUEA 4J9BA 1YCSB 4M7AA 1RAAB 4JRPA 5GAOp 1YHQT 2BE9B 4CC2A 3EG1A 5LJ3f 1PWTA 4RMOA 2FG0A 1G3WA 1D3BA 1EX4A 1UECA 1SRLA 2X9HA 2DL7A 2FO0A 1N27A 3VUBA 2LX7A 1GFDA 3EGUA 4AT1B 4M7AE 3H9NA 1KD1U 3LGLA 3SWNB 1BI2A 2DRMA 1R0CB 2OTLA 3VRZA 1Z9ZA 1W2BA 2OTJQ 2PTKA 2DETA 2DL3A 4ZGJB 1SPKA 1ZSGA 2FRYA 1M1GA 1RI0A 3I35A 1G83A 3QBYA 1ZHIA 3OMCA 4LDWA 2F5TX 3QG1A 4C8QF 2L8DA 2MWPA 4PJLA 2JN0A 5KYXA 5CCAA 4XQ3A 1NZ9A 2HMAA 1WIEA 2YRDA 4M4ZA 2F1LA 3EFOB 5L8RE 3RERA 1SEMA 1QKWA 2MF2A 2L2PA 1KFZA 1U1SA 4KUDK 5A0LA 1UJYA 1PD1A 4J9HA 1Q81R 4Y28E 4FYWB 4IKFA 2JM9A 1W4SA 3EG0A 3OS0A 2KSSA 4OGCA 4BE0A 3OY9A 2JJ9A 2ABLA 1QWFA 4C8QE 1FMKA 2LP5A 4MMKA 1M9SA 4F17A 5KYWB 1ACMB 3BFMA 1KIKA 3EFRA 3JCMW 1H3ZA 1RAFB 3CCEA 2J06A 4FU6A 3CMEA 2AT1B 2V1RA 2CZ6B 3MJXA 4M78A 1QVGS 4CC7A 1VYTA 2EYWA 2RQWA 3QZ5B 4XU3A 4OB0B 4JZ4A 4BI3A 2DZ9A 1NG2A 2OTJA 1XQHA 4EMKA 2PZ1A 1ZQ1A 1VQMQ 1PHTA 3JB9H 1WDXA 4OB3B 1JRIA 1D1BA 2O9VA 4XU2A 2LQNA 2AK5A 2NUZA 3CCLA 1C1AA 4KULA 4XU1A 2V8JA 1P92A 3I55T 3L1AA 1QP3A 3HTRA 1AVZC 1MUZA 1RI9A 1Q86U 3EG9B 2KYMA 3VU3C 1E7OA 2ZPEB 4KBMB 4RTXA 4D6WA 3QDFA 1OV3A 2DEUA 1K9AA 1WJQA 1KJWA 3NTKA 3A8OB 3I56T 2HSPA 2WSFE 4J83A 4E6RA 2DMOA 4L5GA 3JRZA 3SWNC 4M7AG 1VQ8Q 4JZ3A 4PLLA 3JB9D 3M0SA 4D8DA 1KC8R 2G3RA 2QQBA 5LJ3e 3CC2Q 3JCMc 4PJOF 2PQWA 3CPWA 1M3CA 2LCCA 4JS5A 3EGDB 4XTYA 2LQ8A 3N5BB 3NFCA 3CXCA 2VYTA 1VQLT 2VC8A 5HCKA 1QCOA 3OYYA 3CCST 1WJSA 4LXCA 4J7IA 2A7YA 5FRMA 2DAQA 1VQLQ 4MDXA 2E41A 2M0YA 4TVRA 4DBQA 4R55A 2CP6A 1YJWA 3PMTA 2MAMA 3EGXA 4OMLA 1EIFA 2QA4T 5LJ5j 1OULA 2ZPFB 1U1TA 2MCNA 3OBWA 1YWOA 3H6ZA 3LGFA 5FU6B 1UDLA 3H8ZA 1QVGP 1KQSA 2DO3A 2LNHB 1KHCA 4BE2A 1PC0A 5KE2A 1K1ZA 1MNDA 1AT1B 3JV3A 5CKBA 4ZGEB 5GANg 4M77A 2HEQA 2FVUA 1SG5A 2VWFA 1Q82C 2DA9A 3H0FA 3R6OA 4Q5WA 1Z9QA 2RF0A 4GLMA 2XDDA 3VS0A 4C8QG 4FSXA 2HKNA 1V1CA 2QA4Q 1WHHA 2Y90A 1BIAA 3EGXB 1KSWA 2H3EB 3VKIA 3NTHA 3SD4A 3A8LB 4J6XA 4XTVA 2YLBA 4IURA 1N9SA 4PJOE 3T9NA 1IGQA 1PCXA 4EDUA 2WACA 2EYQA 2R5AA 4OB2B 4EMKB 4J9IA 5LJ5f 3S6WA 3CCMQ 4IUTA 1VQ7A 3OYJA 5GJWB 1G5VA 2ROLA 4E7KA 4X34A 4HXJA 3QO3A 3UATA 1B34A 2IIMA 1NYFA
chains in the Genus database with same CATH topology
1AWOA 2GTJA 2JM8A 3PE0A 4RUGA 1K76A 2J6KA 2RQRA 2RMOA 1W6XA 1PNJA 1T0JA 4D8KA 2EPDA 1NEGA 4CC4B 1H3HA 2CH4W 1M27C 2KT1A 1MV0B 2CSIA 2DX1A 1QKXA 1NEBA 4ZNXA 2F2VA 1AWJA 1BB9A 2CSQA 2ENMA 4OMMA 2RQVA 4F14A 3M0QA 3QWXX 1WYXA 2A08A 2ED0A 1ZX6A 4CC3A 2AKKA 1GBRA 2AKLA 3VS1A 1AWWA 1GL5A 4OMNA 2JT4A 4J9CA 3REAB 2YUPA 2HCKA 1JXMA 1H92A 2A28A 2D8JA 1AOJA 3A98A 3O5ZA 2CT3A 1SSHA 3EG2A 1PKTA 1ABOA 1QCFA 1X43A 1TUCA 4HCKA 2RNAA 4HVVA 3H0IA 4LUDA 1M3BA 1T3SA 2K79A 4RTUA 2B86A 1WA7A 1K4US 1QLYA 4OMOA 3VS5A 3NMZC 3SHWA 1H8KA 1HD3A 1ZUKA 1SHGA 1GCPA 3VS2A 1NLPC 2GQIA 2V1QA 1JEGA 3UA6A 1ABQA 3H41A 2ED1A 2CDTA 1M30A 4AG1C 2BZXA 1U06A 4Z8AA 2RQUA 2DL8A 2KRMA 4AFUC 1K0XA 2YUQA 2K2MA 4LUEA 1JO8A 1NM7A 1HSQA 1WXBA 4JJCA 1JQQA 1SRMA 1GFCA 1X6BA 2DBMA 4EIKA 5IHIA 2GTOA 5IH2A 2DRKA 4HVWA 1YP5A 4K11A 1PRLC 2EBPA 4JPBW 4AG2C 2RN8A 1TG0A 1CSKA 1VYUA 3EG3A 2K7AA 2LZ6B 2FPFA 4ORZA 1JXOA 3FJ5A 2EYXA 2CUBA 2DBKA 2I0NA 4DEYA 1U3OA 1UGVA 4RTZA 3R6NA 1MV3A 2RQTA 3I9QA 1YN8A 4Z89A 1JU5C 1YWPA 4OMQA 1UE9A 2J7IA 3M0TA 4X1VA 2LCSA 1UUEA 4J9BA 4J9EA 2DL4A 1YCSB 2RPNA 2M51A 2L3QA 4GBQA 4CC2A 3EG1A 5IHNA 1PKSA 1X27A 1PWTA 1AZGB 2F2WA 5L23A 2FG0A 1I0CA 3I5RA 3VS3A 2KROA 3NGPA 2O88A 1X2KA 1GBQA 4RTYA 1UECA 1B3QA 1IO6A 1OEBA 1SRLA 2DNUA 2YT6A 2KXCA 2GGRA 2DL7A 2ECZA 2FO0A 1GFDA 2LX7A 2K6DA 3UA7A 1N5ZA 3PVQA 3EGUA 4IIMA 4RTVA 4Y92A 2EW3A 2O9SA 2DRMA 4JJDA 5IHKA 2GBQA 3VRZA 1Z9ZA 3EHQA 2PTKA 4J9DA 5I22A 1WXUA 2DL3A 2FPDA 2L3SA 2J6FA 1M3AA 1SPKA 2H8HA 1NYGA 1ZSGA 2DLPA 2J05A 2FRYA 3M0PA 1VYVA 3I35A 1G83A 4HVUA 1UG1A 2A37A 1ZLMA 2DL5A 1WIEA 2KRNA 4M4ZA 2KXDA 3THKA 3UF4A 4RTTA 1WXTA 3ZL7C 1AEYA 3M0UA 2D1XA 1SEMA 1QKWA 3C0CA 2L2PA 1KFZA 2EQIA 2K9GA 1LCKA 1OPLA 1UJYA 1ARKA 4J9HA 1PRMC 1Y57A 2BZ8A 2C0OA 2EGAA 2JM9A 3VS4A 3EG0A 5IXBA 1UJ0A 2O2OA 2C0TA 3GBQA 1QWEA 4IIOA 1SHFA 2ABLA 3VS7A 1QWFA 1FMKA 2JS0A 2LP5A 2KR3A 4F17A 1KIKA 2FEIA 2J06A 4F16A 3TSWA 4AFQC 2V1RA 5IXFA 1I07A 2JXBA 4OMPA 3REBB 1B07A 2EVRA 1VYTA 2EYWA 2RQWA 4CC7A 1A0NB 5ECAA 4JZ4A 2KNBB 1NG2A 2CH4A 2LJ0A 1BK2A 2DF6A 1CKAA 2PZ1A 1VA7A 2VVKA 1PHTA 1WDXA 1EFNA 2O9VA 1CKBA 1T3LA 1ZUUA 3IQLA 2LQNA 1W1FA 4LE9A 4Z88A 2AK5A 2NUZA 2MOXA 4FSSA 2BTTA 2DYBA 2DILA 1M8MA 1RLQC 3EHRA 5FWBA 1AVZC 1MUZA 1RI9A 2YDLA 2OAWA 1BBZA 1Y0MA 2KT8A 2KYMA 2ROTA 4AFZC 1E7OA 4RTXA 2DJQA 2JS2A 2C0IA 1OPKA 1OV3A 1K9AA 1KJWA 1AZEA 1G2BA 2HSPA 2CUDA 1GCQA 2YUNA 3PVLA 2D8HA 4E6RA 1E6HA 2DMOA 2EYYA 1BU1A 1AD5A 3VRYA 4JZ3A 2P4RA 1S1NA 3M0SA 4D8DA 2KEAA 1NLOC 1ZUYA 4ESRA 3H0HA 2DE0X 2EYZA 4DEXA 2KGTA 1M3CA 1XOVA 1TUDA 1UHCA 1ZBJA 4AFSC 3TVTA 1OOTA 2EGCA 4WCIA 1X6GA 5HCKA 2DVJA 3QWYA 1T0HA 2SRCA 2KBTA 2OI3A 4LN2A 2KYBA 1X2QA 5FW9A 1YNZA 4J9GA 2M0YA 2LJ3A 2K3BA 1I1JA 2HDAA 1WX6A 2GNCA 2X3XD 1UFFA 2LJ1A 4OMLA 5EC7A 1GRIA 3RNJA 2AZSA 2CT4A 2JMCA 2MCNA 2FPEA 2J6OA 3M0RA 2AZVA 1YWOA 2KRSA 3LH5A 1UDLA 2LNHB 2YUOA 4JJBA 1UTIA 2O31A 2G6FX 2EGEA 2JTEA 1RUWA 2E5KA 1K1ZA 2EKHA 1HJDA 3JV3A 3I5SA 4KRTA 2W10A 2JW4A 2QDLA 2HEQA 2W0ZA 3CQTA 1W70A 5GJVB 3ULRB 3KFVA 2VWFA 1K0SA 2LQWA 2DA9A 3H0FA 2L0AA 2D0NA 2DM1A 1E6GA 2JMAA 1U5SA 1WLPB 2A36A 2ESWA 1Z9QA 2RF0A 4GLMA 3VS0A 2X3WD 1AWXA 1FYNA 2F2XA 3NPFA 2MIOA 1V1CA 1J3TA 2BZYA 2XMFA 4A63B 1KSWA 2VKNA 2KE9A 2OJ2A 2HBWA 2FRWA 3TSZA 3U23A 1GCQC 2CREA 2NWMA 2PNIA 4R0KA 1X69A 4LNPA 1WI7A 4RTWA 4J9IA 4J9FA 2L3PA 4QT7A 5GJWB 3SEMA 1UHFA 1RLPC 2ROLA 2SEMA 5I11A 1WFWA 4HXJA 3VS6A 3RBBB 2LMJA 3NHNA 3UATA 5FWCA 2YSQA 2IIMA 1NYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWO A;  2GTJ A;  2JM8 A;  3PE0 A;  4RUG A;  1K76 A;  2J6K A;  2RQR A;  2RMO A;  1W6X A;  1PNJ A;  1T0J A;  4D8K A;  2EPD A;  1NEG A;  4CC4 B;  1H3H A;  2CH4 W;  1M27 C;  2KT1 A;  1MV0 B;  2CSI A;  2DX1 A;  1QKX A;  1NEB A;  4ZNX A;  2F2V A;  1AWJ A;  1BB9 A;  2CSQ A;  2ENM A;  4OMM A;  2RQV A;  4F14 A;  3M0Q A;  3QWX X;  1WYX A;  2A08 A;  2ED0 A;  1ZX6 A;  4CC3 A;  2AKK A;  1GBR A;  2AKL A;  3VS1 A;  1AWW A;  1GL5 A;  4OMN A;  2JT4 A;  4J9C A;  3REA B;  2YUP A;  2HCK A;  1JXM A;  1H92 A;  2A28 A;  2D8J A;  1AOJ A;  3A98 A;  3O5Z A;  2CT3 A;  1SSH A;  3EG2 A;  1PKT A;  1ABO A;  1QCF A;  1X43 A;  1TUC A;  4HCK A;  2RNA A;  4HVV A;  3H0I A;  4LUD A;  1M3B A;  1T3S A;  2K79 A;  4RTU A;  2B86 A;  1WA7 A;  1K4U S;  1QLY A;  4OMO A;  3VS5 A;  3NMZ C;  3SHW A;  1H8K A;  1HD3 A;  1ZUK A;  1SHG A;  1GCP A;  3VS2 A;  1NLP C;  2GQI A;  2V1Q A;  1JEG A;  3UA6 A;  1ABQ A;  3H41 A;  2ED1 A;  2CDT A;  1M30 A;  4AG1 C;  2BZX A;  1U06 A;  4Z8A A;  2RQU A;  2DL8 A;  2KRM A;  4AFU C;  1K0X A;  2YUQ A;  2K2M A;  4LUE A;  1JO8 A;  1NM7 A;  1HSQ A;  1WXB A;  4JJC A;  1JQQ A;  1SRM A;  1GFC A;  1X6B A;  2DBM A;  4EIK A;  5IHI A;  2GTO A;  5IH2 A;  2DRK A;  4HVW A;  1YP5 A;  4K11 A;  1PRL C;  2EBP A;  4JPB W;  4AG2 C;  2RN8 A;  1TG0 A;  1CSK A;  1VYU A;  3EG3 A;  2K7A A;  2LZ6 B;  2FPF A;  4ORZ A;  1JXO A;  3FJ5 A;  2EYX A;  2CUB A;  2DBK A;  2I0N A;  4DEY A;  1U3O A;  1UGV A;  4RTZ A;  3R6N A;  1MV3 A;  2RQT A;  3I9Q A;  1YN8 A;  4Z89 A;  1JU5 C;  1YWP A;  4OMQ A;  1UE9 A;  2J7I A;  3M0T A;  4X1V A;  2LCS A;  1UUE A;  4J9B A;  4J9E A;  2DL4 A;  1YCS B;  2RPN A;  2M51 A;  2L3Q A;  4GBQ A;  4CC2 A;  3EG1 A;  5IHN A;  1PKS A;  1X27 A;  1PWT A;  1AZG B;  2F2W A;  5L23 A;  2FG0 A;  1I0C A;  3I5R A;  3VS3 A;  2KRO A;  3NGP A;  2O88 A;  1X2K A;  1GBQ A;  4RTY A;  1UEC A;  1B3Q A;  1IO6 A;  1OEB A;  1SRL A;  2DNU A;  2YT6 A;  2KXC A;  2GGR A;  2DL7 A;  2ECZ A;  2FO0 A;  1GFD A;  2LX7 A;  2K6D A;  3UA7 A;  1N5Z A;  3PVQ A;  3EGU A;  4IIM A;  4RTV A;  4Y92 A;  2EW3 A;  2O9S A;  2DRM A;  4JJD A;  5IHK A;  2GBQ A;  3VRZ A;  1Z9Z A;  3EHQ A;  2PTK A;  4J9D A;  5I22 A;  1WXU A;  2DL3 A;  2FPD A;  2L3S A;  2J6F A;  1M3A A;  1SPK A;  2H8H A;  1NYG A;  1ZSG A;  2DLP A;  2J05 A;  2FRY A;  3M0P A;  1VYV A;  3I35 A;  1G83 A;  4HVU A;  1UG1 A;  2A37 A;  1ZLM A;  2DL5 A;  1WIE A;  2KRN A;  4M4Z A;  2KXD A;  3THK A;  3UF4 A;  4RTT A;  1WXT A;  3ZL7 C;  1AEY A;  3M0U A;  2D1X A;  1SEM A;  1QKW A;  3C0C A;  2L2P A;  1KFZ A;  2EQI A;  2K9G A;  1LCK A;  1OPL A;  1UJY A;  1ARK A;  4J9H A;  1PRM C;  1Y57 A;  2BZ8 A;  2C0O A;  2EGA A;  2JM9 A;  3VS4 A;  3EG0 A;  5IXB A;  1UJ0 A;  2O2O A;  2C0T A;  3GBQ A;  1QWE A;  4IIO A;  1SHF A;  2ABL A;  3VS7 A;  1QWF A;  1FMK A;  2JS0 A;  2LP5 A;  2KR3 A;  4F17 A;  1KIK A;  2FEI A;  2J06 A;  4F16 A;  3TSW A;  4AFQ C;  2V1R A;  5IXF A;  1I07 A;  2JXB A;  4OMP A;  3REB B;  1B07 A;  2EVR A;  1VYT A;  2EYW A;  2RQW A;  4CC7 A;  1A0N B;  5ECA A;  4JZ4 A;  2KNB B;  1NG2 A;  2CH4 A;  2LJ0 A;  1BK2 A;  2DF6 A;  1CKA A;  2PZ1 A;  1VA7 A;  2VVK A;  1PHT A;  1WDX A;  1EFN A;  2O9V A;  1CKB A;  1T3L A;  1ZUU A;  3IQL A;  2LQN A;  1W1F A;  4LE9 A;  4Z88 A;  2AK5 A;  2NUZ A;  2MOX A;  4FSS A;  2BTT A;  2DYB A;  2DIL A;  1M8M A;  1RLQ C;  3EHR A;  5FWB A;  1AVZ C;  1MUZ A;  1RI9 A;  2YDL A;  2OAW A;  1BBZ A;  1Y0M A;  2KT8 A;  2KYM A;  2ROT A;  4AFZ C;  1E7O A;  4RTX A;  2DJQ A;  2JS2 A;  2C0I A;  1OPK A;  1OV3 A;  1K9A A;  1KJW A;  1AZE A;  1G2B A;  2HSP A;  2CUD A;  1GCQ A;  2YUN A;  3PVL A;  2D8H A;  4E6R A;  1E6H A;  2DMO A;  2EYY A;  1BU1 A;  1AD5 A;  3VRY A;  4JZ3 A;  2P4R A;  1S1N A;  3M0S A;  4D8D A;  2KEA A;  1NLO C;  1ZUY A;  4ESR A;  3H0H A;  2DE0 X;  2EYZ A;  4DEX A;  2KGT A;  1M3C A;  1XOV A;  1TUD A;  1UHC A;  1ZBJ A;  4AFS C;  3TVT A;  1OOT A;  2EGC A;  4WCI A;  1X6G A;  5HCK A;  2DVJ A;  3QWY A;  1T0H A;  2SRC A;  2KBT A;  2OI3 A;  4LN2 A;  2KYB A;  1X2Q A;  5FW9 A;  1YNZ A;  4J9G A;  2M0Y A;  2LJ3 A;  2K3B A;  1I1J A;  2HDA A;  1WX6 A;  2GNC A;  2X3X D;  1UFF A;  2LJ1 A;  4OML A;  5EC7 A;  1GRI A;  3RNJ A;  2AZS A;  2CT4 A;  2JMC A;  2MCN A;  2FPE A;  2J6O A;  3M0R A;  2AZV A;  1YWO A;  2KRS A;  3LH5 A;  1UDL A;  2LNH B;  2YUO A;  4JJB A;  1UTI A;  2O31 A;  2G6F X;  2EGE A;  2JTE A;  1RUW A;  2E5K A;  1K1Z A;  2EKH A;  1HJD A;  3JV3 A;  3I5S A;  4KRT A;  2W10 A;  2JW4 A;  2QDL A;  2HEQ A;  2W0Z A;  3CQT A;  1W70 A;  5GJV B;  3ULR B;  3KFV A;  2VWF A;  1K0S A;  2LQW A;  2DA9 A;  3H0F A;  2L0A A;  2D0N A;  2DM1 A;  1E6G A;  2JMA A;  1U5S A;  1WLP B;  2A36 A;  2ESW A;  1Z9Q A;  2RF0 A;  4GLM A;  3VS0 A;  2X3W D;  1AWX A;  1FYN A;  2F2X A;  3NPF A;  2MIO A;  1V1C A;  1J3T A;  2BZY A;  2XMF A;  4A63 B;  1KSW A;  2VKN A;  2KE9 A;  2OJ2 A;  2HBW A;  2FRW A;  3TSZ A;  3U23 A;  1GCQ C;  2CRE A;  2NWM A;  2PNI A;  4R0K A;  1X69 A;  4LNP A;  1WI7 A;  4RTW A;  4J9I A;  4J9F A;  2L3P A;  4QT7 A;  5GJW B;  3SEM A;  1UHF A;  1RLP C;  2ROL A;  2SEM A;  5I11 A;  1WFW A;  4HXJ A;  3VS6 A;  3RBB B;  2LMJ A;  3NHN A;  3UAT A;  5FWC A;  2YSQ A;  2IIM A;  1NYF A; 
#chains in the Genus database with same CATH topology
 1MMG A;  1WGS A;  2LQK A;  3I55 Q;  2KI7 A;  2JUF A;  1G8X A;  2RQR A;  4PJO A;  2MMP A;  2RMO A;  1PNJ A;  1YIT A;  2COY A;  1M1F A;  1WHM A;  3I56 Q;  1YI2 Q;  4X9D A;  5I2M A;  1VQK Q;  1NEB A;  4ZNX A;  2F2V A;  2RB6 A;  3J7A F;  5GAN 3;  1AWJ A;  2CSQ A;  2ENM A;  3LYI A;  3RES A;  3RIR A;  1TOV A;  2QQR A;  3BDL A;  4JLG A;  3CCM T;  2EWN A;  3A8M B;  3UT1 A;  2XHC A;  2P0K A;  1ZX6 A;  3A1P A;  2AKK A;  1GBR A;  3CCR T;  1BI0 A;  3QYG B;  3VS1 A;  3DLL A;  2DXB A;  4LDX A;  2LT1 A;  1X75 C;  3FC3 A;  4OMN A;  2JT4 A;  3CCJ A;  2OTJ T;  3OMG A;  2HCK A;  3CCS Q;  2COW A;  1QCN A;  2A28 A;  1N9R A;  4JUV A;  3A98 A;  1KK7 A;  1TS9 A;  2H3J A;  3CC4 A;  1PKT A;  4R56 A;  1ABO A;  3L2R A;  1QVF A;  3OYB A;  1N8R C;  4LUD A;  3M53 A;  3OW2 A;  1ZSZ A;  2K79 A;  4RTU A;  2X51 A;  2B86 A;  3M56 A;  4C92 D;  4RG8 A;  1K4U S;  4OMO A;  4NL2 A;  3VS5 A;  4C0Z A;  1R8O B;  3NMZ C;  3CC7 T;  1GCP A;  2E12 A;  3UA6 A;  3TQ7 P;  1ABQ A;  3H41 A;  4GY5 A;  1KD1 R;  1M30 A;  2KK4 A;  1VIE A;  2BZX A;  5GMK j;  4E7H A;  4Z8A A;  2F5K A;  4E7L A;  3VJP A;  3E9G A;  3S3M A;  5CK9 A;  4LUE A;  1JO8 A;  1M2V B;  1NM7 A;  1WHK A;  4KGV B;  3RR6 A;  1VUB A;  1WXB A;  2VUB A;  1LVK A;  4JJC A;  1MMA A;  4ELZ C;  4B9X A;  2EJF A;  3MEW A;  3HSB A;  4EIK A;  1VQ4 T;  2GTO A;  2AIR B;  4HVW A;  4LD9 K;  5GAO n;  3E9F A;  5LJ5 d;  4HCC A;  1M1K C;  2QAZ A;  1RAC B;  1Q7Y C;  5GAN 4;  1TG0 A;  3RKY A;  1ZA1 B;  2XI9 A;  3FJ5 A;  3HFN A;  2EYX A;  4GLK A;  1NE8 A;  3F70 A;  2RO0 A;  4BAC A;  5HK0 A;  2YRC A;  1LJO A;  4Z89 A;  4OMQ A;  2JZ2 A;  1BI3 A;  4C0G A;  3M0T A;  4PJN A;  2LCS A;  2DL4 A;  2RPN A;  2X4X A;  2EAY A;  1VQ6 Q;  2P0Q A;  4RCB A;  3CCR Q;  1OYX A;  3RMQ A;  4C8Q C;  5L23 A;  3ME9 A;  2XG8 D;  2K5F A;  4FW1 A;  2KRO A;  3NGP A;  4E47 A;  1V29 B;  4RTY A;  4M7A B;  1TSF A;  2XDP A;  1B3Q A;  1IO6 A;  2YT6 A;  1YIJ A;  2KXC A;  4J7F A;  3OBY A;  4QVZ A;  3MPU B;  1N5Z A;  4IIM A;  4F7U E;  4RTV A;  2EW3 A;  4EMK C;  3G4S Q;  4FYY B;  2O9S A;  1O9S A;  3TCJ A;  2VGN A;  4KGX B;  5IHK A;  1WHL A;  3CPF A;  3FDR A;  1M3A A;  1NYG A;  4M7A F;  1JJ2 A;  1F1B B;  4PKC C;  2J05 A;  3M0P A;  1VYV A;  3M54 A;  1UG1 A;  4ZTJ A;  5AT1 B;  1Q82 U;  4AMC A;  3CCM A;  3NTI A;  5IAY A;  2DL5 A;  2KRN A;  2LNV A;  2KXD A;  6AT1 B;  3THK A;  3UF4 A;  3OYF A;  3L42 A;  3OW2 S;  1VQO T;  4HCZ A;  3ZL7 C;  1AEY A;  2D1X A;  2EQI A;  2YWW A;  4IUV A;  1ARK A;  2BZ8 A;  2C0O A;  5LJ5 e;  1K9M C;  4EMH A;  5IXB A;  5KE3 A;  4M7D B;  1UJ0 A;  1QWE A;  1IB8 A;  3CC4 T;  4IIO A;  1FWZ A;  2QEX A;  3KUF A;  2DYI A;  1BCO A;  2E65 A;  3URG A;  1KD1 C;  2IVW A;  2KQW A;  4M78 C;  2FEI A;  4BY6 B;  1M5Q 1;  3G4S A;  4F16 A;  4AFQ C;  4M77 F;  3OYN A;  5IXF A;  2EQK A;  2MI6 A;  1I07 A;  2K57 A;  3CC7 Q;  1D0Z A;  1YI2 T;  5A0D A;  1Y71 A;  4M75 C;  2PUO B;  2BKD N;  1BCM A;  3MET A;  4C5G A;  3RDV A;  2O4X B;  3FRN A;  2DF6 A;  4M78 G;  3MO8 A;  3LW5 E;  3JCM e;  2VVK A;  4RKU E;  1IHW A;  1EFN A;  2LRQ A;  3WXM B;  1W1F A;  4LE9 A;  4XK8 E;  1YJ9 Q;  2MOX A;  2X4J A;  2VV5 A;  5GAN 6;  1OZ2 A;  2DD5 A;  1BYM A;  5CKD A;  2DIL A;  3QSU A;  3HPW A;  4JJN K;  1RLQ C;  2VXE A;  5FWB A;  2CS7 A;  2CP0 A;  3C95 A;  3HKS A;  2E1H A;  3HL8 A;  2GFA A;  5M9O A;  4AFZ C;  2JS2 A;  1WJR A;  2C0I A;  4C92 A;  1AZE A;  2CUD A;  1GCQ A;  2IPO B;  3CCV Q;  3FB9 A;  3PVL A;  3PT9 A;  2D8H A;  4J6W A;  1M90 U;  1AD5 A;  1BI1 A;  1VQL A;  4BUG A;  1S1N A;  4C5H A;  1NLO C;  3X24 B;  2GQV A;  3RKX A;  2RHI A;  2M9U A;  3H0H A;  2CYZ B;  1XOV A;  2QGG A;  1ZBJ A;  2ZPG B;  4X9C A;  3GP8 A;  3JCM b;  4M7A C;  2DVJ A;  4RG2 A;  1KC8 C;  2E64 A;  3OS1 A;  1VQP A;  2KYB A;  3HFO A;  1YNZ A;  3I55 A;  2LJ3 A;  4A53 A;  2QGF B;  2RHY A;  4A4F A;  1OI1 A;  4A4K A;  2MYS A;  1NJI C;  1UFF A;  3MEU A;  2LJ1 A;  1OU9 A;  5KYU B;  1OU8 A;  1S72 Q;  3P8B B;  2PVG B;  4FW2 A;  3QHS A;  2FZG B;  4F7U A;  4ZN3 A;  3I56 A;  3P8D A;  3DB4 A;  3CD6 Q;  2JMC A;  4MZP A;  2CZ7 B;  2DK3 A;  3E2U A;  2FPE A;  3M0R A;  4ATO A;  4UC4 A;  2KRS A;  3PIP A;  4C8Q B;  1VQK T;  2FZK B;  4EPC A;  2YUO A;  4JJB A;  2NUP A;  1YJN T;  3JCM J;  2EKH A;  2CP2 A;  1HJD A;  3DKM A;  3E1S A;  2A3L A;  5FU7 B;  3TEE A;  2DXU A;  2JW4 A;  2QDL A;  2Y4X A;  1QQJ A;  3CQT A;  1K0S A;  2JTF A;  4A4E A;  2E6Z A;  3J80 E;  1SSF A;  2DM1 A;  1E6G A;  1WLP B;  1U5S A;  2JMA A;  2A36 A;  2RJC A;  2EIF A;  5KH6 A;  3CCQ A;  3G4S T;  4FT2 A;  2JNG A;  1FYN A;  3NPF A;  2MIO A;  1J3T A;  3OSS C;  2ATC B;  4A4H A;  4M78 B;  2R5M A;  2BIV A;  4PLI A;  2K3Y A;  2HZY A;  2QAS A;  3TSZ A;  3M55 A;  2CZ0 B;  2FYK A;  3X25 B;  1GCQ C;  5D7U A;  1ZSZ B;  1VQ8 T;  1IGU A;  2NWM A;  4R0K A;  4DA4 A;  3FJP A;  1X01 A;  3J81 E;  2L3P A;  1WZO A;  4QT7 A;  4YTL A;  1WFW A;  3VS6 A;  3RBB B;  4N0A A;  3NHN A;  1LNX A;  1PG5 B;  4A54 A;  1QW1 A;  2D9T A;  2JM8 A;  1QVF P;  3PE0 A;  4ZTF A;  1JJ2 P;  4C5E A;  3X28 B;  3V8K A;  1W6X A;  2B8A A;  2K4Y A;  3JB9 J;  3CBM A;  4N0A C;  1T0J A;  4D8K A;  2XKO C;  4L6V 5;  2RK1 A;  4N4G A;  3GPL A;  3V7R A;  3L2V A;  1NEG A;  2PVO B;  4CC4 B;  3ER0 A;  2CH4 W;  1VQ5 A;  1M27 C;  5LJ3 g;  2KT1 A;  1QP2 A;  4E7S A;  2DX1 A;  2RM4 A;  1QVP A;  3CD6 T;  1BIB A;  4M75 A;  5GAN f;  4XTW A;  1BB9 A;  4FCY A;  3BY7 A;  1VQ7 Q;  4OMM A;  3M4Y A;  1UB4 A;  2CKK A;  1K9M U;  3M0Q A;  3QWX X;  3CC2 T;  1KG1 A;  4M7D C;  4CC3 A;  4FYV B;  1WHJ A;  4QQG A;  3OYI A;  2GCX A;  3HP9 A;  1GL5 A;  3CCS A;  5GAM j;  2YUP A;  1EZZ B;  2YHT A;  3VYH B;  1R77 A;  1X43 A;  3OYM A;  3X26 B;  1N8R U;  4HVV A;  3H0I A;  1Q86 C;  4BDZ A;  3MEV A;  4KH1 B;  1UGP B;  4Y91 A;  2DKG A;  2Y4Y A;  3SHW A;  2DER A;  4MML A;  4NL3 A;  1VQK A;  1NLP C;  2GQI A;  2EJ9 A;  2CDT A;  3EGD A;  3P8H A;  4P5N A;  1K73 C;  4PJO D;  3EFS A;  2K2M A;  1M2O A;  3Q1J A;  2HBP A;  3EAE A;  1JB0 E;  1HSQ A;  3M58 A;  1JQQ A;  2KMT A;  4M7D A;  4IUP A;  3PTA A;  4E2F B;  3CCU T;  4PK4 A;  3CCQ T;  2DRK A;  3LLR A;  4C5I A;  1YJ9 T;  3GOX A;  3G6E A;  4JPB W;  4AG2 C;  4C8Q A;  2E4H A;  1Q81 U;  1VYU A;  2HSE B;  1W2B P;  4J6Y A;  4OGE A;  2FPF A;  5GMK l;  2CUB A;  2DBK A;  2I0N A;  5GAN h;  2BE7 D;  3R6N A;  4RTZ A;  3CCL Q;  3I9Q A;  1UE9 A;  2LX9 A;  4J9E A;  2L5Q A;  2LCL A;  1M1K R;  2WSE E;  2FL7 A;  3SB2 A;  3INZ A;  4KH0 B;  4GBQ A;  2R58 A;  1PKS A;  2F2W A;  3VS3 A;  2M0O A;  3OS2 A;  2O88 A;  2KVQ G;  1X2K A;  1GBQ A;  2F69 A;  3FIF A;  4PJO C;  2QQS A;  3GF5 A;  5KYU A;  4LD6 A;  1VQ4 Q;  3AHU A;  4C0D C;  2K6D A;  2ZPI B;  2V8I A;  4Y92 A;  1FXX A;  1YJN A;  4CI0 C;  2LTO A;  2CP5 A;  4JJD A;  4L59 A;  2GBQ A;  3M9Q A;  1VQO A;  2DVE A;  1K8A R;  4J9D A;  5I22 A;  2FPD A;  4LDU A;  1MHN A;  1H64 1;  3JCM d;  4M78 E;  1K9M R;  2A37 A;  4C92 B;  4LDY A;  3CPW P;  4XTX A;  1IRX A;  1ZLM A;  2QTX A;  5KCO A;  4QVD A;  4RTT A;  4C92 G;  2X4Y A;  1M8V A;  2QQA A;  3M0U A;  3PMI A;  3GLX A;  2DIQ A;  5GAM f;  2K9G A;  2EQM A;  1LCK A;  1PRM C;  1JJ2 S;  1UGQ B;  4DBH A;  4QW2 A;  5DLQ E;  1S72 A;  2EGA A;  3VS4 A;  3OQ5 A;  4NS5 A;  3VUZ A;  5KYX B;  4HCB A;  1I4K 1;  5CKE A;  5CO7 A;  4M75 G;  1SHF A;  5KYY B;  4F7U F;  2EQJ A;  3VS7 A;  3FEO A;  1VQN T;  1UGS B;  4C0F A;  2KR3 A;  4C92 F;  3CMA T;  5GMK h;  2VGM A;  3QYH B;  8AT1 B;  5HKC A;  1YFN A;  4N4H A;  1C6V X;  3OYH A;  2YRV A;  1Y7X A;  4HT9 A;  4OMF B;  2E6N A;  4NOY A;  2EVR A;  1Q82 R;  1A0N B;  5J26 A;  5ECA A;  5GAN 7;  4M75 D;  2CH4 A;  2IG0 A;  4JRI A;  1BK2 A;  4XTZ A;  2EQU A;  2M16 A;  2V26 A;  1D1A A;  3V7S A;  3X20 B;  2COZ A;  1K8A U;  4KT0 E;  1T3L A;  2BUD A;  1VQ4 A;  1ZUU A;  3LWI A;  3CCV A;  3OYK A;  5FRN A;  4BD3 A;  1B34 B;  2HD0 A;  3JB9 F;  3G6E T;  1YJW Q;  2BTT A;  2DYB A;  1WHG A;  1QVF S;  3ZFJ A;  2E3H A;  1M8M A;  2RJF A;  1MNE A;  4MZT A;  5CKH A;  4M7D G;  3EHR A;  3C12 A;  2M02 A;  2YDL A;  4KGZ B;  2OAW A;  1YJW T;  3HRU A;  2KT8 A;  2ROT A;  1I5O B;  1M1K U;  2DJQ A;  4IUQ A;  3OYL A;  3PNW C;  4M78 D;  1OPK A;  2DFU A;  3CCL T;  2YUN A;  3O8V A;  1E6H A;  3V8L A;  2EYY A;  4RCC A;  2X4W A;  4PL6 A;  3VRY A;  5LJ3 j;  3A8H B;  1FX7 A;  2MWO A;  2OAU A;  3D7S B;  4ESR A;  3JCM Q;  3JAM E;  4BI8 B;  4XTU A;  3SWN A;  2EYZ A;  1U8R A;  1TUD A;  1UHC A;  2ZPH B;  2HL5 C;  1OOT A;  1VQ5 Q;  2P0P A;  4M75 F;  3OS5 A;  2D6F A;  2VXF A;  1T0H A;  3CC4 Q;  2KBT A;  3EG9 A;  2OI3 A;  4LN2 A;  5GAM g;  4J9G A;  4QKU A;  2KY9 A;  3EFO A;  1PSE A;  4BB7 A;  3V8J A;  3CCJ Q;  2GNC A;  1RL2 A;  2CP3 A;  1K73 U;  1C0M A;  3M57 A;  2QI2 A;  1GRI A;  2DJZ A;  2XU8 A;  1M90 R;  1TWB A;  2DZC A;  2QG9 B;  3BE3 A;  5EG2 A;  2J6O A;  5GAO q;  2L3R A;  3LH5 A;  2O31 A;  4M77 G;  2EGE A;  2JTE A;  1RUW A;  1UGR B;  3I5S A;  5CQY A;  4JRQ A;  3SFM A;  5GAO r;  2MPX C;  2W10 A;  3JCM f;  4CRI A;  1W70 A;  2ZZD A;  3ULR B;  2NUT B;  2XID A;  2A0F B;  5CAI A;  2L0A A;  4JDS A;  1UEB A;  2D0N A;  4J8O A;  5D6X A;  5GAN d;  3OYA A;  2ESW A;  1KHI A;  2CP7 A;  2QEX Q;  3CMA Q;  2X3W D;  1HXD A;  4DQ2 A;  3HRT A;  5DM7 R;  2BZY A;  2CZ1 B;  4FT4 A;  3A5Z B;  2DTI A;  1MMN A;  1VQ7 T;  1S72 T;  2KE9 A;  2DEQ A;  2OJ2 A;  2FRW A;  3PGG A;  5FRO A;  4B9W A;  3U23 A;  3A8G B;  3CCR A;  1YHQ Q;  3TRE A;  2O01 E;  2CRE A;  2PNI A;  1NPR A;  1RAD B;  1X69 A;  4LNP A;  5GAN 2;  3UWN A;  1WI7 A;  1W2B S;  4O6J A;  2YLC A;  4J9F A;  1IXD A;  5LL6 S;  2E10 A;  1UHF A;  1RLP C;  2SEM A;  1VQ5 T;  2RHX A;  2LMJ A;  2YSQ A;  4M77 E;  1M2V A;  3AT1 B;  2J6K A;  1VQ9 T;  3JCM h;  1R0B G;  3CCQ Q;  5HK3 A;  1H3H A;  3OW2 P;  1B7T A;  5AYF A;  3OYE A;  2XD0 A;  3DLM A;  2HAX A;  5GAN j;  3CCV T;  1Y96 B;  2CGH A;  2RA2 A;  2DXT A;  1VQN A;  1FMW A;  5KCH A;  1SF9 A;  1QVG A;  2VB6 A;  1KQS P;  4OF1 A;  4F14 A;  2A08 A;  2ED0 A;  3HHT B;  1OZ3 A;  2AKL A;  1QMC A;  4KUI A;  2FHD A;  1RAB B;  5J39 A;  3OB9 A;  4J9C A;  3REA B;  1VQP T;  7AT1 B;  1I8F A;  3S3O A;  4M7A D;  1H92 A;  3UPU A;  4PFO A;  4F04 B;  2D8J A;  2RD1 A;  2K5I A;  3O5Z A;  1K73 R;  1Q95 G;  3OA6 A;  1SSH A;  1XJW B;  3EG2 A;  4ZN1 A;  1QCF A;  5FU7 C;  2XDB A;  1HK9 A;  1VQP Q;  5C0M A;  5CVI A;  1T3S A;  3JCM g;  2Z0W A;  4M75 B;  4ZGD B;  1QLY A;  2PUK B;  1V76 A;  1YIT T;  1H8K A;  1ZUK A;  3PFS A;  1SHG A;  3G7Z A;  3UDC A;  2ED1 A;  2I2L A;  2M1H A;  4AG1 C;  2DL8 A;  3WVD B;  1FMV A;  3KBG A;  5KYY A;  3RMS A;  3QUI A;  3M59 A;  3CC7 A;  5LJ3 d;  1GFC A;  2PVD B;  1D1C A;  1X6B A;  2DBM A;  2ZGW A;  4EMG A;  4M77 D;  1ZSZ C;  2ZCF B;  4LDV A;  1YP5 A;  4K11 A;  1D09 B;  1RAG B;  2EBP A;  3RUX A;  4C8Q D;  3GNF B;  1DJ7 B;  1CSK A;  2EFI A;  4O5V A;  4ORZ A;  3SDZ A;  1YCY A;  1TTH B;  3FLG A;  1U3O A;  1UGV A;  3WVE B;  1VQN Q;  1MV3 A;  1AHJ B;  5CIU A;  1JU5 C;  1YWP A;  2D0Q B;  3KXT A;  3CEY A;  2J7I A;  4X1V A;  1YIJ T;  1VOM A;  4V2S A;  2M51 A;  2L3Q A;  1N8R R;  2MK5 A;  5IHN A;  1X27 A;  5GMK m;  1AZG B;  2P84 A;  1ZA2 B;  1I0C A;  3I5R A;  4E7I A;  3PIO A;  1TH7 A;  4XU0 A;  1OEB A;  2DNU A;  2JTM A;  2GGR A;  1TU0 B;  2ECZ A;  4N4I A;  3UA7 A;  3PVQ A;  2HNI A;  3MP6 A;  3GNG A;  2HQX A;  3LH0 A;  1VQ9 Q;  4PJO B;  4M77 C;  4C92 C;  3HRS A;  2PU9 B;  3EHQ A;  1N6A A;  1WXU A;  2L3S A;  2J6F A;  3QDR B;  1VQ6 A;  2H8H A;  1ZBX A;  2DLP A;  3TU4 K;  2KDS A;  3QJY A;  4JRK A;  1I81 A;  4PJO G;  3CD6 A;  2WSC E;  2K5L A;  5GAM h;  4HVU A;  2JVV A;  3L2W A;  2QA4 A;  1WXT A;  2E70 A;  3C0C A;  4M7D F;  1WNL A;  1VQ9 A;  1OPL A;  1Y57 A;  5GAM e;  3JB9 G;  5J3B A;  1Q7Y U;  5LJ3 h;  1JBM A;  2O2O A;  2C0T A;  1RAH B;  3GBQ A;  1YI2 A;  3G71 T;  1VIF A;  1VQM A;  2QYZ A;  4OP0 A;  4ANJ A;  1NBE B;  2JS0 A;  1Y07 A;  3QZ9 B;  4DBF A;  3JSC A;  3TSW A;  1Q81 C;  3QII A;  2VAS A;  2JXB A;  4OMP A;  3REB B;  1B07 A;  3E19 A;  3MKD A;  2KNB B;  2QDY B;  1D3B B;  4J5Y A;  5GAM d;  1NJI U;  2LJ0 A;  5A2Q E;  2DPP B;  5I2S A;  1CKA A;  3CCE T;  1VA7 A;  2LC4 A;  4ME7 A;  2P4T A;  1CKB A;  4F7U B;  3G1J A;  3IQL A;  4HT8 A;  4WF2 A;  4Z88 A;  1WPY A;  1YJ9 A;  3ASK A;  1MMD A;  5DLO A;  4FSS A;  1O75 A;  3VYG A;  5KYN A;  9ATC B;  1BBZ A;  1Y0M A;  3LX7 A;  3MCA B;  4OB1 B;  3C94 A;  1NJI R;  2C06 A;  1TUG B;  4DOV A;  1G2B A;  3M5A A;  3EH2 A;  1XTD A;  1YIJ Q;  4E7J A;  1BU1 A;  2K2V A;  1YBY A;  2KAF A;  5KYW A;  1G3Y A;  2P4R A;  4B6M A;  2KEA A;  1YJN Q;  1ZUY A;  3BW1 A;  4DBR A;  2DE0 X;  3JB9 I;  2QTV A;  5GAN e;  4PJJ A;  4DEX A;  2KGT A;  5GAO l;  3QKJ A;  1MGQ A;  4AFS C;  2NLU A;  4JLI A;  2HKQ B;  3TVT A;  2DTO A;  5GMK e;  2EGC A;  3GIB A;  2XIC A;  4WCI A;  1X6G A;  3ZEH A;  3V7C A;  1XNI A;  5DY9 A;  3QWY A;  1OX8 A;  2RJE A;  1PM3 A;  3RKW A;  3QPH A;  1RAE B;  2SRC A;  3S3N A;  1PSF A;  2EJG A;  5LJ5 g;  1X2Q A;  5FW9 A;  4A4G A;  2K3X A;  5CKF A;  4C0D B;  2K3B A;  1I1J A;  2HDA A;  2E5Q A;  2ZAE A;  3VV0 A;  1WQ7 A;  1WX6 A;  2RK2 A;  2QXF A;  2X3X D;  3CXC S;  1Y96 A;  1GXI E;  5EC7 A;  4WTO B;  3RNJ A;  2FZC B;  2AZS A;  4M75 E;  2CT4 A;  4FYX B;  2X35 A;  2NUP B;  1LOJ A;  5CQX A;  3CCE Q;  2AZV A;  2RH2 A;  1UTI A;  1IRE B;  2G6F X;  2E5K A;  4F7U G;  3EH1 A;  5D6W A;  4M7D D;  3MEA A;  4KRT A;  1VQ6 T;  3OYC A;  2HL3 A;  1D0X A;  2LT4 A;  1VQM T;  5GMK i;  2W0Z A;  5GJV B;  5C6S A;  3KFV A;  5IT9 E;  2GF7 A;  3C4S A;  4M78 F;  2LQW A;  3BDU A;  5HY6 A;  4MDW A;  3CMA A;  1YIT Q;  5GAN 8;  3CXC P;  2DTH A;  2L89 A;  1AWX A;  4BE1 A;  2F2X A;  2NUT A;  2XMF A;  4A63 B;  1OX9 A;  2HQH A;  3L2Q A;  4C92 E;  5LJ5 h;  1X6O A;  2RHU A;  3L2U A;  2VKN A;  1KQ2 A;  1OQK A;  2HBW A;  2LVM A;  4BDY A;  1PD0 A;  5IN1 A;  1IHV A;  3L2Z A;  4PNO A;  4RTW A;  1K8A C;  3CPW S;  1YHQ A;  3SEM A;  4II1 A;  2E3I A;  5I11 A;  1KC8 U;  4M77 B;  3LWH A;  5FWC A;  2QQ9 A;  1AWO A;  2GTJ A;  4IUU A;  4RUG A;  1K76 A;  2RHZ A;  2OTL Q;  3G6E Q;  4FL6 A;  4PJM A;  2GFU A;  2EPD A;  2LDM A;  3CC2 A;  4JS4 A;  1TXQ A;  2XK0 A;  4MZM A;  2OTL T;  5A0G A;  1BKB A;  4E7Z A;  1MV0 B;  5D6Y A;  2CSI A;  1QKX A;  3CME Q;  3G71 A;  4HA8 A;  2JOY A;  1D0Y A;  2HQE A;  1VQO Q;  3CBP A;  2RQV A;  1KQS S;  1WQW A;  5I21 A;  1WYX A;  4PFZ A;  2RI2 A;  3CBO A;  3OYG A;  3CME T;  1VQ8 A;  1IZ6 A;  4OVA A;  2V8K A;  2NYS A;  1NPP A;  2O4X A;  3CCU A;  4M7D E;  1AWW A;  5GAN 5;  2RI3 A;  2ZPB B;  1SKU B;  5CR2 A;  3JCM X;  1JXM A;  1M4Z A;  2RI5 A;  1AOJ A;  3MHX A;  2CT3 A;  3QJ6 A;  4BI4 A;  3OYD A;  1Q86 R;  3DB3 A;  4HCK A;  2DXC A;  1TUC A;  2RNA A;  3OSV A;  2QEX T;  4QQD A;  2DIG A;  4PFP A;  1M3B A;  4Z02 A;  3CCJ T;  1WA7 A;  4HKE A;  4QVC A;  5FLX E;  4FIB A;  1G3S A;  1HD3 A;  1M90 C;  3VS2 A;  3QXE B;  4XAX B;  2V1Q A;  1JEG A;  2YXY A;  3MP1 A;  2EKO A;  8ATC B;  1RAI B;  1U06 A;  1Q7Y R;  2RQU A;  4DOW A;  1HYO A;  3M4G A;  2KRM A;  4AFU C;  1K0X A;  2YUQ A;  1G3T A;  2OX7 A;  4BY6 C;  4ELY C;  3G71 Q;  1LPL A;  1KQ1 A;  1SRM A;  3MP8 A;  5IHI A;  4VUB A;  5FU6 C;  5IH2 A;  2DD4 A;  4FM4 B;  3JCM P;  3CCU Q;  2AHJ B;  3ZBD A;  1PRL C;  2FB7 A;  2RN8 A;  4QQ6 A;  2R57 A;  3EG3 A;  2K7A A;  2LZ6 B;  1JXO A;  4DEY A;  5GAO m;  1I5L A;  3JCM V;  2QK0 A;  2RQT A;  1YN8 A;  2RJD A;  1UUE A;  4J9B A;  1YCS B;  4M7A A;  1RAA B;  4JRP A;  5GAO p;  1YHQ T;  2BE9 B;  4CC2 A;  3EG1 A;  5LJ3 f;  1PWT A;  4RMO A;  2FG0 A;  1G3W A;  1D3B A;  1EX4 A;  1UEC A;  1SRL A;  2X9H A;  2DL7 A;  2FO0 A;  1N27 A;  3VUB A;  2LX7 A;  1GFD A;  3EGU A;  4AT1 B;  4M7A E;  3H9N A;  1KD1 U;  3LGL A;  3SWN B;  1BI2 A;  2DRM A;  1R0C B;  2OTL A;  3VRZ A;  1Z9Z A;  1W2B A;  2OTJ Q;  2PTK A;  2DET A;  2DL3 A;  4ZGJ B;  1SPK A;  1ZSG A;  2FRY A;  1M1G A;  1RI0 A;  3I35 A;  1G83 A;  3QBY A;  1ZHI A;  3OMC A;  4LDW A;  2F5T X;  3QG1 A;  4C8Q F;  2L8D A;  2MWP A;  4PJL A;  2JN0 A;  5KYX A;  5CCA A;  4XQ3 A;  1NZ9 A;  2HMA A;  1WIE A;  2YRD A;  4M4Z A;  2F1L A;  3EFO B;  5L8R E;  3RER A;  1SEM A;  1QKW A;  2MF2 A;  2L2P A;  1KFZ A;  1U1S A;  4KUD K;  5A0L A;  1UJY A;  1PD1 A;  4J9H A;  1Q81 R;  4Y28 E;  4FYW B;  4IKF A;  2JM9 A;  1W4S A;  3EG0 A;  3OS0 A;  2KSS A;  4OGC A;  4BE0 A;  3OY9 A;  2JJ9 A;  2ABL A;  1QWF A;  4C8Q E;  1FMK A;  2LP5 A;  4MMK A;  1M9S A;  4F17 A;  5KYW B;  1ACM B;  3BFM A;  1KIK A;  3EFR A;  3JCM W;  1H3Z A;  1RAF B;  3CCE A;  2J06 A;  4FU6 A;  3CME A;  2AT1 B;  2V1R A;  2CZ6 B;  3MJX A;  4M78 A;  1QVG S;  4CC7 A;  1VYT A;  2EYW A;  2RQW A;  3QZ5 B;  4XU3 A;  4OB0 B;  4JZ4 A;  4BI3 A;  2DZ9 A;  1NG2 A;  2OTJ A;  1XQH A;  4EMK A;  2PZ1 A;  1ZQ1 A;  1VQM Q;  1PHT A;  3JB9 H;  1WDX A;  4OB3 B;  1JRI A;  1D1B A;  2O9V A;  4XU2 A;  2LQN A;  2AK5 A;  2NUZ A;  3CCL A;  1C1A A;  4KUL A;  4XU1 A;  2V8J A;  1P92 A;  3I55 T;  3L1A A;  1QP3 A;  3HTR A;  1AVZ C;  1MUZ A;  1RI9 A;  1Q86 U;  3EG9 B;  2KYM A;  3VU3 C;  1E7O A;  2ZPE B;  4KBM B;  4RTX A;  4D6W A;  3QDF A;  1OV3 A;  2DEU A;  1K9A A;  1WJQ A;  1KJW A;  3NTK A;  3A8O B;  3I56 T;  2HSP A;  2WSF E;  4J83 A;  4E6R A;  2DMO A;  4L5G A;  3JRZ A;  3SWN C;  4M7A G;  1VQ8 Q;  4JZ3 A;  4PLL A;  3JB9 D;  3M0S A;  4D8D A;  1KC8 R;  2G3R A;  2QQB A;  5LJ3 e;  3CC2 Q;  3JCM c;  4PJO F;  2PQW A;  3CPW A;  1M3C A;  2LCC A;  4JS5 A;  3EGD B;  4XTY A;  2LQ8 A;  3N5B B;  3NFC A;  3CXC A;  2VYT A;  1VQL T;  2VC8 A;  5HCK A;  1QCO A;  3OYY A;  3CCS T;  1WJS A;  4LXC A;  4J7I A;  2A7Y A;  5FRM A;  2DAQ A;  1VQL Q;  4MDX A;  2E41 A;  2M0Y A;  4TVR A;  4DBQ A;  4R55 A;  2CP6 A;  1YJW A;  3PMT A;  2MAM A;  3EGX A;  4OML A;  1EIF A;  2QA4 T;  5LJ5 j;  1OUL A;  2ZPF B;  1U1T A;  2MCN A;  3OBW A;  1YWO A;  3H6Z A;  3LGF A;  5FU6 B;  1UDL A;  3H8Z A;  1QVG P;  1KQS A;  2DO3 A;  2LNH B;  1KHC A;  4BE2 A;  1PC0 A;  5KE2 A;  1K1Z A;  1MND A;  1AT1 B;  3JV3 A;  5CKB A;  4ZGE B;  5GAN g;  4M77 A;  2HEQ A;  2FVU A;  1SG5 A;  2VWF A;  1Q82 C;  2DA9 A;  3H0F A;  3R6O A;  4Q5W A;  1Z9Q A;  2RF0 A;  4GLM A;  2XDD A;  3VS0 A;  4C8Q G;  4FSX A;  2HKN A;  1V1C A;  2QA4 Q;  1WHH A;  2Y90 A;  1BIA A;  3EGX B;  1KSW A;  2H3E B;  3VKI A;  3NTH A;  3SD4 A;  3A8L B;  4J6X A;  4XTV A;  2YLB A;  4IUR A;  1N9S A;  4PJO E;  3T9N A;  1IGQ A;  1PCX A;  4EDU A;  2WAC A;  2EYQ A;  2R5A A;  4OB2 B;  4EMK B;  4J9I A;  5LJ5 f;  3S6W A;  3CCM Q;  4IUT A;  1VQ7 A;  3OYJ A;  5GJW B;  1G5V A;  2ROL A;  4E7K A;  4X34 A;  4HXJ A;  3QO3 A;  3UAT A;  1B34 A;  2IIM A;  1NYF A; 
#chains in the Genus database with same CATH homology
 1AWO A;  2GTJ A;  2JM8 A;  3PE0 A;  4RUG A;  1K76 A;  2J6K A;  2RQR A;  2RMO A;  1W6X A;  1PNJ A;  1T0J A;  4D8K A;  2EPD A;  1NEG A;  4CC4 B;  1H3H A;  2CH4 W;  1M27 C;  2KT1 A;  1MV0 B;  2CSI A;  2DX1 A;  1QKX A;  1NEB A;  4ZNX A;  2F2V A;  1AWJ A;  1BB9 A;  2CSQ A;  2ENM A;  4OMM A;  2RQV A;  4F14 A;  3M0Q A;  3QWX X;  1WYX A;  2A08 A;  2ED0 A;  1ZX6 A;  4CC3 A;  2AKK A;  1GBR A;  2AKL A;  3VS1 A;  1AWW A;  1GL5 A;  4OMN A;  2JT4 A;  4J9C A;  3REA B;  2YUP A;  2HCK A;  1JXM A;  1H92 A;  2A28 A;  2D8J A;  1AOJ A;  3A98 A;  3O5Z A;  2CT3 A;  1SSH A;  3EG2 A;  1PKT A;  1ABO A;  1QCF A;  1X43 A;  1TUC A;  4HCK A;  2RNA A;  4HVV A;  3H0I A;  4LUD A;  1M3B A;  1T3S A;  2K79 A;  4RTU A;  2B86 A;  1WA7 A;  1K4U S;  1QLY A;  4OMO A;  3VS5 A;  3NMZ C;  3SHW A;  1H8K A;  1HD3 A;  1ZUK A;  1SHG A;  1GCP A;  3VS2 A;  1NLP C;  2GQI A;  2V1Q A;  1JEG A;  3UA6 A;  1ABQ A;  3H41 A;  2ED1 A;  2CDT A;  1M30 A;  4AG1 C;  2BZX A;  1U06 A;  4Z8A A;  2RQU A;  2DL8 A;  2KRM A;  4AFU C;  1K0X A;  2YUQ A;  2K2M A;  4LUE A;  1JO8 A;  1NM7 A;  1HSQ A;  1WXB A;  4JJC A;  1JQQ A;  1SRM A;  1GFC A;  1X6B A;  2DBM A;  4EIK A;  5IHI A;  2GTO A;  5IH2 A;  2DRK A;  4HVW A;  1YP5 A;  4K11 A;  1PRL C;  2EBP A;  4JPB W;  4AG2 C;  2RN8 A;  1TG0 A;  1CSK A;  1VYU A;  3EG3 A;  2K7A A;  2LZ6 B;  2FPF A;  4ORZ A;  1JXO A;  3FJ5 A;  2EYX A;  2CUB A;  2DBK A;  2I0N A;  4DEY A;  1U3O A;  1UGV A;  4RTZ A;  3R6N A;  1MV3 A;  2RQT A;  3I9Q A;  1YN8 A;  4Z89 A;  1JU5 C;  1YWP A;  4OMQ A;  1UE9 A;  2J7I A;  3M0T A;  4X1V A;  2LCS A;  1UUE A;  4J9B A;  4J9E A;  2DL4 A;  1YCS B;  2RPN A;  2M51 A;  2L3Q A;  4GBQ A;  4CC2 A;  3EG1 A;  5IHN A;  1PKS A;  1X27 A;  1PWT A;  1AZG B;  2F2W A;  5L23 A;  2FG0 A;  1I0C A;  3I5R A;  3VS3 A;  2KRO A;  3NGP A;  2O88 A;  1X2K A;  1GBQ A;  4RTY A;  1UEC A;  1B3Q A;  1IO6 A;  1OEB A;  1SRL A;  2DNU A;  2YT6 A;  2KXC A;  2GGR A;  2DL7 A;  2ECZ A;  2FO0 A;  1GFD A;  2LX7 A;  2K6D A;  3UA7 A;  1N5Z A;  3PVQ A;  3EGU A;  4IIM A;  4RTV A;  4Y92 A;  2EW3 A;  2O9S A;  2DRM A;  4JJD A;  5IHK A;  2GBQ A;  3VRZ A;  1Z9Z A;  3EHQ A;  2PTK A;  4J9D A;  5I22 A;  1WXU A;  2DL3 A;  2FPD A;  2L3S A;  2J6F A;  1M3A A;  1SPK A;  2H8H A;  1NYG A;  1ZSG A;  2DLP A;  2J05 A;  2FRY A;  3M0P A;  1VYV A;  3I35 A;  1G83 A;  4HVU A;  1UG1 A;  2A37 A;  1ZLM A;  2DL5 A;  1WIE A;  2KRN A;  4M4Z A;  2KXD A;  3THK A;  3UF4 A;  4RTT A;  1WXT A;  3ZL7 C;  1AEY A;  3M0U A;  2D1X A;  1SEM A;  1QKW A;  3C0C A;  2L2P A;  1KFZ A;  2EQI A;  2K9G A;  1LCK A;  1OPL A;  1UJY A;  1ARK A;  4J9H A;  1PRM C;  1Y57 A;  2BZ8 A;  2C0O A;  2EGA A;  2JM9 A;  3VS4 A;  3EG0 A;  5IXB A;  1UJ0 A;  2O2O A;  2C0T A;  3GBQ A;  1QWE A;  4IIO A;  1SHF A;  2ABL A;  3VS7 A;  1QWF A;  1FMK A;  2JS0 A;  2LP5 A;  2KR3 A;  4F17 A;  1KIK A;  2FEI A;  2J06 A;  4F16 A;  3TSW A;  4AFQ C;  2V1R A;  5IXF A;  1I07 A;  2JXB A;  4OMP A;  3REB B;  1B07 A;  2EVR A;  1VYT A;  2EYW A;  2RQW A;  4CC7 A;  1A0N B;  5ECA A;  4JZ4 A;  2KNB B;  1NG2 A;  2CH4 A;  2LJ0 A;  1BK2 A;  2DF6 A;  1CKA A;  2PZ1 A;  1VA7 A;  2VVK A;  1PHT A;  1WDX A;  1EFN A;  2O9V A;  1CKB A;  1T3L A;  1ZUU A;  3IQL A;  2LQN A;  1W1F A;  4LE9 A;  4Z88 A;  2AK5 A;  2NUZ A;  2MOX A;  4FSS A;  2BTT A;  2DYB A;  2DIL A;  1M8M A;  1RLQ C;  3EHR A;  5FWB A;  1AVZ C;  1MUZ A;  1RI9 A;  2YDL A;  2OAW A;  1BBZ A;  1Y0M A;  2KT8 A;  2KYM A;  2ROT A;  4AFZ C;  1E7O A;  4RTX A;  2DJQ A;  2JS2 A;  2C0I A;  1OPK A;  1OV3 A;  1K9A A;  1KJW A;  1AZE A;  1G2B A;  2HSP A;  2CUD A;  1GCQ A;  2YUN A;  3PVL A;  2D8H A;  4E6R A;  1E6H A;  2DMO A;  2EYY A;  1BU1 A;  1AD5 A;  3VRY A;  4JZ3 A;  2P4R A;  1S1N A;  3M0S A;  4D8D A;  2KEA A;  1NLO C;  1ZUY A;  4ESR A;  3H0H A;  2DE0 X;  2EYZ A;  4DEX A;  2KGT A;  1M3C A;  1XOV A;  1TUD A;  1UHC A;  1ZBJ A;  4AFS C;  3TVT A;  1OOT A;  2EGC A;  4WCI A;  1X6G A;  5HCK A;  2DVJ A;  3QWY A;  1T0H A;  2SRC A;  2KBT A;  2OI3 A;  4LN2 A;  2KYB A;  1X2Q A;  5FW9 A;  1YNZ A;  4J9G A;  2M0Y A;  2LJ3 A;  2K3B A;  1I1J A;  2HDA A;  1WX6 A;  2GNC A;  2X3X D;  1UFF A;  2LJ1 A;  4OML A;  5EC7 A;  1GRI A;  3RNJ A;  2AZS A;  2CT4 A;  2JMC A;  2MCN A;  2FPE A;  2J6O A;  3M0R A;  2AZV A;  1YWO A;  2KRS A;  3LH5 A;  1UDL A;  2LNH B;  2YUO A;  4JJB A;  1UTI A;  2O31 A;  2G6F X;  2EGE A;  2JTE A;  1RUW A;  2E5K A;  1K1Z A;  2EKH A;  1HJD A;  3JV3 A;  3I5S A;  4KRT A;  2W10 A;  2JW4 A;  2QDL A;  2HEQ A;  2W0Z A;  3CQT A;  1W70 A;  5GJV B;  3ULR B;  3KFV A;  2VWF A;  1K0S A;  2LQW A;  2DA9 A;  3H0F A;  2L0A A;  2D0N A;  2DM1 A;  1E6G A;  2JMA A;  1U5S A;  1WLP B;  2A36 A;  2ESW A;  1Z9Q A;  2RF0 A;  4GLM A;  3VS0 A;  2X3W D;  1AWX A;  1FYN A;  2F2X A;  3NPF A;  2MIO A;  1V1C A;  1J3T A;  2BZY A;  2XMF A;  4A63 B;  1KSW A;  2VKN A;  2KE9 A;  2OJ2 A;  2HBW A;  2FRW A;  3TSZ A;  3U23 A;  1GCQ C;  2CRE A;  2NWM A;  2PNI A;  4R0K A;  1X69 A;  4LNP A;  1WI7 A;  4RTW A;  4J9I A;  4J9F A;  2L3P A;  4QT7 A;  5GJW B;  3SEM A;  1UHF A;  1RLP C;  2ROL A;  2SEM A;  5I11 A;  1WFW A;  4HXJ A;  3VS6 A;  3RBB B;  2LMJ A;  3NHN A;  3UAT A;  5FWC A;  2YSQ A;  2IIM A;  1NYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...