3FJ6A

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 137
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fj6A00
3NQEA 2FFCA 3TQKA 3W75A 4RR4A 4QQ3A 1TCDA 3LI1A 3TFCA 5I3IA 3KOFA 3ELFA 2ALDA 4O14A 3G24A 3A23A 2CWNA 3WK0A 3TV8A 3W22A 4D2JA 1IXPA 3EX3A 4IGHA 2O7QA 2JKEA 4PL1A 1JULA 1KTNA 4IMCA 5U4NA 3VFLA 2BX7A 3LXCA 5BW6A 3M6YA 1WBJA 2VFDA 4Z1AA 4OU1A 2ZZ2A 5HUOA 1TREA 4QM1A 3I65A 3O8AA 5CPNA 3N9SA 4U4MA 2VOMA 1GVSA 3L65A 1QR7A 4PFMA 3W84A 1IIGA 4WQ6A 1OF8A 4LC6A 1F73A 1ZAJA 1DORA 2YCEA 4LVFA 2V2CA 1JQXA 3LGEA 5AYYA 4XTIA 4O16A 5AHEA 3W1MA 2WSRA 1QDSA 3G1VA 4CCDA 4IMDA 4CQ9A 4NJIA 3NL5A 4XZ9A 5FI8A 4C1KA 2ZFAA 2O7SA 1ML1A 4BFAA 1GQNA 4BK9A 3DENA 1JRBA 1DOSA 3E96A 5HMSA 1OFBA 3C2RA 3NQCA 2CLKA 4P61A 2V2HA 2B4GA 1PHWA 5CKSA 4Z1DA 3P80A 1M7PA 5BRBA 3N2XA 1JUKA 4GNJA 2V2DA 2CZFA 5D2WA 3E9AA 5I3GA 1N7KA 4ZVJA 3LLDA 3BGJA 3L5LA 1VHCA 1XBYA 1W37A 1KLZA 4H4IA 1TTJA 1V7YA 2CLOA 3N73A 1YTDA 3TJXA 3T4CA 2V9DA 1S5VA 3EWWA 1VHNA 4GXMA 4XBKA 2FLIA 3TU9A 3E02A 1NVMA 3P7YA 4DF0A 1P0NA 3W72A 4UMCA 4IX2A 3LERA 3S8HA 4GC4A 3MP5A 1Q6RA 3GDKA 2E1DA 3TROA 1M7OA 1G7UA 2Y70A 1GPWA 4M6VA 1EP3A 5G5IA 1GOXA 3MW7A 1ICSA 4X2RA 3Q94A 1GTHA 3D0CA 2ZZ3A 2I1OA 2HS8A 4IOTA 4MLJA 3FYPA 2CLEA 4PEKA 1W31A 1EA0A 1FWNA 1K7EA 1TPVA 1VGAA 1OG0A 4Q32A 3S1UA 5AB3A 3HIJA 5K3VA 3SZ8A 1TYGA 3IIVA 4GE8A 3GDTA 4UTIA 3HGRA 1YDVA 1F5ZA 2Z0IA 3IVUA 4N6FA 5K4ZA 1WQ5A 4GUHA 3EWBX 3B0UX 3G1XA 3NQVA 1LTDA 4O13A 4HNNA 2Y7GA 1VQTA 4WY0F 3L68A 5IBXA 5G2HA 2DZPA 3IIXA 2V81A 1T8XA 2TRSA 4ONVA 1GG0A 3H55A 3R2GA 4RXGA 1M6JA 1VCFA 4WJEA 1S5TA 3GVGA 2YZRA 5TBOA 3OG3A 4E2DA 1JCXA 1TJRA 3PWAA 1IXNA 3M7WA 3TNOA 3L5AA 4NVTA 3TXZA 3L0NA 4G1KA 3U6WA 3C2FA 3NPVA 5HR6A 3HGJA 4JTIA 4HPJA 3BW4A 1KFJA 1I2RA 4AF0A 3W1UA 4DPPA 1OX4B 2TMDA 5J5RA 1FCVA 4QIUA 2X2GA 3E0IA 5H2ZA 1H63A 1G4SA 2E6AA 4KFOA 4JX4A 3VI2A 3L67A 4ORMA 3TMQA 3PR2A 4N9CA 1XXXA 1QWGA 2WNQA 1TRDA 4MYAA 1NEYA 3CWNA 4IMFA 3G1HA 1Y0EA 1P5BA 3S5ZA 3EX1A 4FXRA 3B0VC 1I2OA 4UNKA 5HJLA 2FDSA 5DXYA 2GVJA 1TPC1 2FPTA 3CEPA 1SFJA 4UR7A 1PHQA 3PG8A 1NF0A 2W6RA 3LBMA 4TU1A 1TPWA 2NX9A 4IMEA 3FA5A 3M16A 4JICA 1JJKA 2CLMA 3UY8A 3VNDA 3QEZA 3V1PA 3IIZA 5F1VA 1DJQA 1AW1A 1J5TA 4DQWA 4AH7A 4GRSA 1M5WA 2OT0A 3PG9A 1R47A 2YW4A 2FJKA 4JTEA 3MYOA 3O6YX 3KVLA 3SR7A 5KTLA 2V5BA 3I7SA 3S6DA 1L6WA 2YYUA 4UTMA 1UB3A 3FJ6A 3IVSA 4QITA 2E6DA 2Y7EA 1LROA 4UTHA 1MZHA 3JRKA 3AJXA 1KFEA 4JTFA 4Y90A 3NQ6A 2D73A 3PSVA 4JDBA 4P2VA 4UFJA 1ZY9A 2Q8LA 2NLIA 4O12A 4PCFA 3G22A 5LGZA 1ONRA 3TC7A 1XBXA 3PULA 3LTPA 5HNRA 3G0SA 2Y62A 2ZRUA 3S1VA 4N02A 4CNOA 4AMAA 2I14A 3MYPA 3WJSA 3W23A 3CIXA 2C14A 3LOTA 3ZWSA 2Z2UA 1RQEA 2PC4A 4O10A 2OCZA 2BSLA 6ALDA 1TO3A 2Y7FA 1EUAA 1XDMA 2R91A 3SSJA 1OK6A 2QAFA 4AF0B 3O63A 3UWZA 2VEMA 3RLUA 3QSRA 3C3NA 1JRCA 3BW3A 3QW4B 4EF8A 3DKJA 2V0TA 3GK0A 2ZRXA 4UTLA 4MZ8A 1MEIA 2RDUA 3KX6A 1L9WA 4MY9A 5D09A 4JD4A 2QCCA 3CC1A 2G96A 3QPYA 3P82A 3C52A 1QOQA 3GB6A 4O54A 3LV5A 3VKJA 4IXHA 4LS0A 1SO5A 2C3ZA 2WSYA 3W07A 4O4WA 2Q3OA 3HG3A 5CZJA 4K38A 3F1QA 4R34A 1GTEA 3NA8A 3QC3A 2F84A 3ZR4A 3QQ0A 3BLIA 5K9CA 3CU2A 2PE4A 3W1AA 4GUGA 5A5WA 1FY6A 4H6KA 5DBUA 1ADOA 4UFMA 3NQ7A 3YPIA 3HB9A 3E12A 3N3MA 1A5BA 3HG5A 4LVGA 3P67A 4WX2A 2CU0A 5K9DA 4J9JA 1DVJA 1KM2A 2QCDB 5L6UA 5AC8A 5HULA 2VELA 1TPH1 2GVLA 3SFKA 3DAQA 2ZZ7A 3QZEA 1TIMA 4RV8A 4CQAA 2RKXA 3IIPA 1FXPA 4LRTA 3TXVA 2PRHA 4HNVA 4EIVA 1TJPA 1W5NA 3LCFA 2CLLA 3R89A 1I2NA 4ALDA 2Z1BA 4ZQOA 1ZFJA 1BTMA 3PAJA 4JGDA 1OX5A 1LOLA 1BEUA 3R12A 2F7FA 2YW3A 1TPEA 3W7EA 3LCXA 1FBAA 3HG2A 4KKXA 4NUWA 4JDYA 3SY5A 4RKAA 4JYFA 4YCPA 3PSWA 4L4LA 2ZRYA 3W7NA 2Y63A 5D33A 3TJLA 5KZMA 5CSSA 3MWAA 1BKSA 3M41A 1G4EA 3DI0A 1PCWA 1SW0A 1YADA 1JVNA 4MYXA 4DO6A 1GYNA 5G4WA 4KFNA 3LBCA 4DELA 1HTIA 2DORA 4OT7A 4K7YA 1WBHA 2VENA 1QAPA 1SW3A 1D9EA 2YR1A 4LV9A 5A8GA 3S5YA 4ZQRA 3W7LA 1N55A 3VE7A 2WQPA 2QJGA 4K36A 4Q4KA 4BF9A 5AHNA 3EWXA 2V82A 3KHJA 2H8XA 3PUDA 1K8YA 1TTPA 3KVMA 4MZYA 3C0JA 5E0KA 4O19A 5LHFA 6TIMA 1C9DA 2FIQA 5CZTA 1G4TA 4K7VA 3T40A 4FEZA 2RHGA 4LU0A 1SQ7A 2PRMA 3P5YA 4HKPA 3TDFA 4RZ4A 4GBUA 4GJ1A 5FF3A 1YTKA 3C2VA 3IGXA 2EGZA 3EB2A 2QCLA 2H3DA 1HUVA 5AHLA 1I2QA 3P81A 3STCA 2QCNA 4UTJA 2H90A 4O53A 1D3GA 3BV4A 3H53A 5C55A 5D2YA 2JKPA 3UWQA 4CLMA 3G0UA 5EKYA 3DI1A 1OYCA 1TTIA 2QCDA 4YWIA 2DZTA 1H7XA 2CLIA 1A5CA 3CM4A 1Z44A 4WZHA 2R14A 3UPBA 4I7WA 2ZRZA 2A7PA 5CPMA 3TUUA 3HG4A 1FWWA 4R33A 4NXSA 3UQNA 2QKFA 2E6FA 3FJLA 1HO1A 3W2KA 1WOBA 3P60A 5LNVA 3U2OA 1SW7A 2B7PA 2JGQA 2A2IA 3LHTA 3W1RA 4UTKA 2CLFA 1RQHA 1I8JA 4ZQNA 3B06A 5DXXA 3BG9A 1OABA 3MI2A 4UUIA 1QFEA 1OJXA 1JCNA 1XFBA 2YFNA 1PVNA 3B4UA 3INPA 2HTMA 1FWRA 1KV5A 4HSNA 5LNWA 1FWTA 1JQVA 1U5JA 4HN4A 2G5WA 4JTLA 3W1PA 3HPSA 1MSSA 2YGYA 1QO5A 1YXDA 2FB2A 2W0UA 1DKWA 4TX9A 1KV8A 4DBDA 2JKAA 1AMKA 1KFLA 3HF3A 4XUGA 4MFEA 2NXIA 2HSAA 1LLWA 2RH9A 4UMAA 2X1RA 1I2PA 1Q6LA 4GUFA 1TQXA 1LCOA 1SZNA 1OFDA 4LVAA 2VFHA 5K7JA 3B03A 3I6RA 2QAPA 1ALDA 1WDWA 2NXHA 3FKRA 2BWGA 2WKJA 3C6CA 2DP3A 2E68A 2OZ0A 4O17A 2DZWA 4I9AA 2G95A 2X30A 2C0AA 1SU5A 4OBTA 3GR8A 3QSTA 3CWOX 2DZVA 3UYCA 2ATMA 3SIZA 3TFXA 5AOUA 4M6QA 4M6PA 4JTHA 3BG5A 1A53A 4JTKA 3NGJA 4C1LA 2V8ZA 3LCIA 3MMTA 4FX7A 3G3DA 3S0CA 3DGRA 3LCLA 3C56A 4N2YA 1TV7A 3TW7A 5FEWA 2WSQA 2DZXA 3NDOA 4O1DA 3EX4A 3JS3A 4N9EA 1FX6A 3NQ8A 3U8GA 3R8RA 1LRQA 1LOSA 5TQLA 3GR7A 2BZNA 3LX9A 1DJNA 3RLVA 1GWJA 5HWJA 1KFCA 2XN1A 3HPXA 3OA3A 5AN7A 3TC6A 4XBSA 3IV3A 5LHEA 2PCQA 2TYSA 3RNDA 3OVQA 1EB3A 1LLZA 4WY0B 3M1ZA 1XKYA 3OIXA 2NUXA 2X1SA 3GNDA 1SFLA 1K3UA 5KZEA 3TAKA 5I3HA 2JK2A 3W7JA 4UXDA 2ISSA 4X22A 2CFFA 1OX4A 4Z0JA 1UJPA 1LBMA 2ZZ1A 2R8WA 4O57A 1NFBA 3DFTA 4AXKA 5EBUA 2ZZ5A 2VEPA 1TMHA 1N8FA 4NXKA 4N6EA 3O15A 3TH6A 4ZMGA 2QUUA 4IX0A 3ABOA 5F4XA 1TPB1 4ZZ9A 1QPNA 2QJHA 2XN2A 2QCEA 5G1TA 3K30A 2NWRA 2QDHA 4O52A 3M5ZA 3TK7A 1QNVA 1KM0A 4O8RA 4LS1A 3THAA 3DFNA 5LGXA 1KBJA 1H5YA 1EP2A 2EF9A 4JR5A 3W7QA 1HO4A 5C6MA 1T96A 1KFBA 1ZHAA 1JCYA 5FESA 2ZZ6A 4QNWA 1CI1A 4BWLC 1X8FA 1GVRA 1W0MA 3GIYA 4RXFA 4XKYA 1W3TA 4O50A 1VCVA 1YDNA 2V30A 4A3UA 3W1LA 1YLVA 5F2GA 4NJKA 4IJBA 2Y7DA 3N19B 1GVQA 1YPFA 2VFGA 4UCGA 4ML9A 1LBLA 1VPXA 1VLIA 3P61A 3JR2A 1F7BA 2ISVA 3PF3A 4QNEA 2C15A 1J2WA 2ZA1A 4LS2A 1YYAA 1O4UA 1W1ZA 2QCFA 1J4EA 5D30A 1AW5A 3LHVA 2DJLA 3C8FA 3LRKA 3UY7A 3V75A 1TTQA 5GVJA 1VYSX 1PE1A 4MIMA 4AEOA 2QCHA 4ICNA 3TMLA 3M44A 5D2VA 3OEXA 2E6YA 2EPHA 2DZSA 3HOJA 3NPXA 4NZJA 3N14A 3EXTA 4AWUA 1MO0A 3F4WA 3PBUA 3STGA 3EWZA 5D2XA 5KITA 4JTJA 3BVJA 1NF7A 4GUJA 3THQA 5AYZA 1WX0A 3MUXA 2J9ZA 4JTGA 3NO5A 1WA3A 2OMAA 3KVJA 2A7RA 1EEPA 4JX6A 1OFAA 1H7NA 3WK1A 3RK8A 3RMJA 3W7RA 3KRSA 1HL2A 4TO8A 3L21A 4BWLA 1QCWA 4BI6A 4R7JA 3NVTA 3LCGA 4FNPA 4UTTC 4JEQA 3G8RA 4A21A 1OFOA 3NYZA 1KM5A 2YFOA 1R30A 1RR2A 1RVGA 4A29A 5I3KA 3G3MA 5F2IA 2XN0A 3LHUA 2W79A 3PUOA 5G4EA 3W1XA 2RDTA 1ZJIA 2J9XA 1XI3A 1VLWA 4JIQA 1LM1A 4TR9A 3PC0A 2VFIA 3CHVA 3LLFA 4M7SA 4UFIA 5J5DA 1FCQA 3NQGA 1ICPA 4FNQA 3NPWA 1PS9A 1UUOA 3LB0A 2PURA 4QISA 1HG3A 4R53A 3DKLA 4K6AA 1H51A 4HPXA 4IPJA 2CZ5A 4O0KA 1QPQA 3IEBA 4NT0A 1FDJA 1XBVA 5F2MA 1BWLA 1Z48A 1EIXA 3KXQA 3CB8A 3CLMA 1R2TA 3ABSA 4K8HA 4LOCA 2BTMA 1ZCOA 3W7PA 2YYTA 5CZ0A 3IIOA 4LTSA 5EPDA 4WOQA 3A21A 5CPLA 4JS3A 4JN6A 3L0GA 1AK5A 1WXJA 1RZMA 3EXRA 3LXBA 4AAJA 4Y96A 2YSWA 2X1UA 4QSHA 1OK4A 3W76A 4DO5A 1AW2A 1CW2A 5KSWA 1Z41A 4X9SA 4FB7A 3PUEA 4RLIA 3FLUA 3UXDA 2ISWA 2NV1A 5DCDA 1B9BA 4UR8A 2VFFA 4UFLA 4JTSA 4KFPA 4CQ8A 1AL8A 2VKZG 4NX0A 1KTBA 5D03A 2ZTJA 4A22A 3HBLA 1JCMP 4EOUA 1RD5A 1QPRA 2ATSA 2FPYA 3O07A 2E77A 3NNTA 4ZQCA 4WUIA 3P84A 3QM3A 4LUIA 4NNAA 2B7OA 3OBKA 4NU7A 4NX5A 2GUUA 4M5PA 3S9YA 4BI5A 4AVFA 3BW2A 2JGYA 3BPWA 3I68A 3BLFA 1RPXA 2A6NA 3RU6A 2A4AA 5FEZA 3NM1A 1LZOA 5DY3A 5EMUA 1V5XA 2E5DA 3B04A 3HO8A 4MZ1A 4Y9AA 5AHIA 3W86A 4FHAA 2NXGA 1THFD 3MJYA 2WNZA 1RQBA 5G1YA 3M5VA 3MP3A 2WNNA 4Z1CA 1MEHA 1G69A 4DEFA 2GJNA 4KWVA 1SZFA 2YXGA 3C2OA 4O15A 3TX9A 3MHGA 3ZS4A 3TKFA 1FDYA 2ZRVA 3G1YA 1H61A 2I9EA 4O1AA 4DXVA 1TSIA 2G97A 2Q3RA 3DXIA 4FNTA 4LUJA 5K2ZA 2E09A 2QR6A 3GZ3A 3P74A 4LW7A 1WV2A 3DZ1A 5G2IA 3C4UA 1JCLA 3W7GA 2GQAA 5AHFA 4FX8A 2V5LA 5AYXA 4WXZA 1DHPA 3Q37A 3DU0A 3S5NA 2GVGA 1A50A 1OYAA 1EP1A 2ZBTA 4XKYB 1LYXA 3NAVA 3DFSA 3NPUA 5DCBA 1DQXA 1EX5A 4RJEA 4S2CA 1OHLA 2QCMA 1VR6A 5KINA 1TB3A 3FYOA 3Q58A 1C8VA 3W83A 1Q6QA 3M5YA 3KRZA 4OWGA 2HS6A 1VZWA 2H6RA 3LV6A 4MUZA 2Y89A 2NX1A 5AC7A 2GPTA 3O05A 3QF0A 3GDLA 4IMGA 4Z1BA 1H7OA 4BR1A 5DBTA 4O4VA 4O1BA 5D32A 1C29A 4EF9A 2QUTA 3DHFA 5LNRA 4DF1A 2YX0A 3MBDA 1K7XA 4UMBA 4WD0A 4AWTA 1EUNA 1SO6A 5F2LA 2ZA2A 3NR0A 1X7FA 1F6KA 5FF0A 3EKZA 3P8IA 4E2BA 3T7VA 3BG3A 3UD6A 1ME9A 5BNKA 1Q45A 4JIPA 1Q6OA 3W7OA 4EVZA 3GXNA 1SPQA 4S1FA 1W5QA 4OQVA 3RF9A 4WXYA 3B0PA 1YTEA 1H1ZA 3O6CA 4N4PA 2VEIA 2A7NA 1JCJA 1SO4A 1TQJA 3CT7A 2QDGA 3GYEA 3PB0A 5C2XA 2Q8ZA 3M5XA 3QW3A 3L0KA 5AC6A 4O0ZA 3GAYA 3GLCA 3DFQA 5BMXA 1FDZA 1IIHA 3BO9A 3FFSA 3LTYA 4ZL1A 4DPQA 3G1DA 4FNRA 3EXSA 1S5WA 4A2SA 5K4XA 2A0NA 4ZQMA 4UNLA 4GUIA 3QH2A 3W71A 3O6DA 5DELA 4NZFA 3F03K 1VYRA 2P1FA 3KFTA 3PS7A 3W2NA 3NZ1A 3PVFA 5LNUA 1XUZA 3A9IA 1W56A 4JY8A 3FOKA 1KM4A 1G7VA 4DBEA 4AHPA 5HUPA 1IXQA 5ABTA 4O28A 1ZENA 5D2TA 5IM51 3EEGA 2C19A 4N4QA 3VE9A 3W1QA 4HNUA 1H62A 3GKFA 3NG3A 2WPBA 2Y61A 4CCEA 2ZRWA 1I45A 5D04C 4UTWA 1PV8A 5LNSA 3T78A 4JXCA 4UC5A 5MHBA 2TPSA 3NQDA 4Y8FA 3TQVA 1F76A 3GDMA 3M47A 3MHUA 3F4NA 3CEUA 3G8EA 3LHZA 3NEVA 2C18A 2AAMA 2Z6JA 1VRDA 3W9ZA 4NQ1A 3O1NA 3LTSA 2ZDRA 3STFA 4NJHA 2BXVA 5EA9A 2FPVA 5HWMA 4LT9A 3MP4A 3VCRA 3M9YA 1ZALA 1A5AA 3S42A 5LZLA 2ZQ0A 4ORIA 4TMBA 1SSDA 1WOAA 1YXYA 1Z42A 3NQFA 4PL2A 1FCUA 5CPOA 1MEWA 3TR2A 1G6CA 3EWYA 1P1XA 3IGSA 2QJIA 1EWDA 1TPUA 3W7MA 2ZYFA 3STEA 2CZEA 1R46A 1AL7A 4ADTA 1LBFA 5TIMA 3PBWA 3MBFA 3W3OA 5BMWA 2XFWA 3W2JA 3WJZA 4E0CA 1K03A 1G67A 3NL2A 3TQ0A 4M7TA 1VS1A 2VEKA 3B8DA 1OVDA 3W73A 3N34A 4AWSA 2NWSA 4PH6A 1K7FA 3LCHA 3N9RA 5C5YA 4XQ6A 1OFQA 2A85A 3G1SA 2H8ZA 4PODA 3FKKA 4L4MA 4OGZA 1RV8A 3C61A 1GEQA 1ZAHA 4MOZA 4FNUA 3R13A 4OV9A 5H91A 1L6SA 4MKNA 4GWEA 2NZLA 4UTWC 7TIMA 2BLEA 4M19A 1VH7A 3TCEA 1QO2A 5U7SA 4FIQA 2P0OA 2GJLA 2AGKA 1FWSA 5G2WA 3OVPA 4S2BA 3PM6A 3W6YA 1QMLA 2FTPA 3WJYA 3TA6A 3QMSA 3DH7A 4MJZA 3UZ5A 2B7QA 3NM3A 3QMRA 5F4WA 3W7HA 3UWWA 2WJZA 2CLHA 2C6QA 1E51A 1X1OA 3ZWTA 5HINA 5DY2A 1L2UA 3QRHA 3L9CA 2ZZ4A 3LXAA 5DCEA 4I7UA 4PC8A 4NJGA 3PY2A 1OX6A 4PA8A 3C2EA 4FIRA 3G0XA 2VFEA 2GQ8A 1F2JA 4MLRA 2FQIA 4NJJA 3GDRA 3HJZA 3A5VA 1FUYA 1HFBA 1LRTA 1T0OA 3UPWA 2QF7A 4NNCA 4Y6GA 3MI3A 4Z0SA 2WO5A 1TV5A 3KVKA 3MI6A 3QJAA 3UWYA 5EY5A 3WK3A 1WYIA 1AG1O 3LCWA 4AHQA 3CPRA 3KRUA 2IQTA 3AO0A 3NQAA 2C1HA 3M43A 3R5EA 3A22A 3IVTA 1GZGA 5CG7A 1IGSA 4RZ6A 1H60A 1SZEA 3PBVA 1PIIA 1XC4A 1TPFA 4TIMA 5LSMA 3UWUA 4WY0A 1SUXA 1O94A 3GAKA 1R2SA 1SZGA 5FEPA 1W5PA 2CZDA 5EYWA 3HGSA 1L6YA 4RCXA 4K37A 3W88A 1KM3A 3A24A 1F74A 1FXQA 4JNMA 1DL3A 1H50A 1O60A 2GQ9A 3RFAA 2FB3A 4JYDA 3W7CA 1JUEA 4OV4A 3WFAA 1KBIA 4LWWA 5AFDA 3IGUA 3ABQA 3DBPA 4IUOA 2J88A 5CSRA 4E38A 3SW6A 1IXOA 3LI0A 4OHQA 5D37A 4O1CA 1W5MA 1UBSA 1KTCA 2YDAA 5D05A 4ADUA 4TMCA 1QOPA 3FEMA 1CX9A 1XDLA 2WV8A 4KWWA 3LM7A 5F4SA 2NUYA 3NL6A 2A6LA 3G18A 3TE9A 1ZNNA 3L66A 4MY8A 3CIWA 5CZSA 1VCGA 2DJXA 4O18A 3I7QA 3NQMA 4FO4A 4LY8A 1XBZA 1UCWA 2LLEA 4BI7A 1FCBA 1H7WA 3SGZA 3W7IA 5T26A 3Q2DA 2DZUA 1B4EA 1NAL1 2P10A 2GOUA 1BWKA 4XTDA 3HQ1A 4YXGA 3QFEA 3W70A 4JTUA 1XUUA 1R2RA 1SSGA 3SECA 3USBA 4QAIA 1H7PA 2EHHA 3UZJA 4X3ZA 1OFPA 2RDWA 1XL9A 4GFSA 1W8SA 1XM3A 4OE7A 3LHWA 2NX3A 3B05A 3A5FA 3CTLA 2OX1A 5C54A 3O16A 1EPXA 4MY1A 3MO7A 1KFKA 1YXCA 3ZFHA 4W9TA 5I3JA 4ADSA 3L2IA 3BLEA 2JBMA 2J9YA 3QMTA 3OVRA 3UNDA 1SO3A 1ICQA 3NOEA 5IBXC 3ATYA 2DU2A 5FEXA 1TV8A 2R94A 2A5HA 3SI9A 3L5MA 4LNYA 3H54A 5D02A 3T55A 3ATZA 3UXAA 4H3DA 1GYLA 2ABAA 3W1NA 1QPOA 1UASA 1B57A 3BK0A 4HSOA 4IPIA 3HPZA 4JY9A 2EAWA 5KZDA 2J24A 4N9DA 3P5ZA 3NQ2A 4RZ5A 3SJ3A 1GJPA 4CCCA 1TPDA 3W85A 5BOOA 5AHMA 3NL3A 2E5CA 1X1ZA 3NXFA 3T44A 3LRLA 3EX6A 2TSYA 3ANYA 4CNPA 1A5SA 4NNBA 1WAUA 1P0KA 3EX2A 1O95A 5LKYA 3M0ZA 1OFRA 5SWUA 1F6PA 2X1TA 2ZCGA 5K9XA 3TIMA 2VC6A 3DFOA 3ABRA 3HGOA 4N9BA 4I7VA 2PRLA 1LDCA 4POCA 3G1FA 5E93A 4ZQPA 3CQ0A 4Q33A 3FIGA 2AQWA 4LVBA 3TSBA 5HWNA 1P4CA 2Z6IA 2A21A 1U83A 3LRMA 3W1TA 3OHIA 4Z08A 1W3NA 1I4NA 3GNNA 2QUVA 1G4PA 4YL2A 2C13A 1O5KA 4FF7A 1K02A 3S5OA 1B3OA 1DBTA 1VC4A 3W2LA 3UWVA 4HIBA 2VXNA 3PBYA 2WOQA 2X16A 3EKLA 2Y88A 1T99A 3PB2A 4MVAA 2NUWA 2EKCA 1EWEA 4IQLA 1W5OA 5FF4A 1YDOA 3GXPA 3P8JA 3FS2A 3GXTA 2ZA3A 1IF2A 4K8EA 3MHFA 5DN1A 1VJIA 1H1YA 3N2MA 3W2MA 4MJMA 3TW6A 3BGGA 3S1WA 3GKAA 5HR7A 1LP6A 3W2UA 3DFPA 4HNTA 4JYEA 3G1AA 4LRSA 4CNNA 1NSJA 5I3FA 4QJ1A 3W74A 5HQEA 4IWWA 2Y85A 1MXSA 4B5NA 2CW6A 1FQ0A 2B0MA 4IXXA 4UFHA 4HHPA 1JR1A 4UTTA 1PL9A 1H7RA 1KW1A 4RK8A 3I7RA 5KMYA 1KLYA 1GVFA 1W3IA 1LORA 1LOQA 5L9FA 2ZTKA 4YCOA 3DHDA 2UV8G 4LVDA 1OF6A 4WOZA 3WJWA 1GG1A 3QQ1A 3GX9A 1UUMA 3LHYA 3EWUA 4YLWA 1K8ZA 4O11A 2RFGA 3WJXA 4A2RA 3BARA 1YPIA 2A1YA 5FF7A 1K8XA 2B7NA 5CGQA 3HMJG 4LV4A 1O5XA 3IRDA 3S1XA 1D3HA 4FX6M 2J6XA 1GVOA 3KAOA 3O06A 2Y6ZA 2ABBA 4AHOA 1TRIA 2QCGA 2NV2A 4U28A 1X6UA 3W7DA 2OT1A 3QPZA 4YMZA 4FXSA 5DLCA 3SGUA 3TSDA 5EL1A 1ZAIA 2J27A 4JTTA 3TSMA 1ME7A 2E5BA 1S3HA 1KM1A 3E49A 4JX5A 2YPIA 4UTUA 1DV7A 1OYBA 1SR9A 1OFEA 2HMCA 4AB4A 8TIMA 1Q3NA 2KZHA 2OJPA 3NZRA 1F05A 1GT8A 2H3BA 1KM6A 5FF2A 4EWND 4DF2A 3W7KA 1ME8A 4UIOA 1B4KA 4MFDA 1KA9F 4HT3A 4RX0A 3TAOA 3W87A 1LRNA 1DQWA 3LDVA 1VYPX 2C16A 4PTNA 4K39A 4UFKA 2QEZA 3P62A 4MPQA 1JUBA 1PCKA 1XCFA 5E1QA 3QYQA 1W54A 4FNSA 3WK2A 4DO4A 4LC8A 4XWUA 5D38A 5F1UA
chains in the Genus database with same CATH superfamily
3EB4A 3NQEA 3HQNA 4RR4A 3ID7A 1TCDA 1IEIA 3KOFA 2ALDA 1RLDA 4O14A 2VJXA 3SFWA 1ZJAA 3WK0A 3TV8A 1IXPA 1PX3A 4REQB 3S2MA 3BMWA 3LS9A 1KTNA 4IMCA 2BX7A 3CUFA 3CXOA 1UROA 1J0IA 2ZZ2A 3SURA 1TREA 4XD5A 1FRBA 3L4TA 4QS5A 1HKWA 3B9AA 1OT2A 3B9EA 3VVGA 1R87A 4OBRA 4W87A 4EXAA 1ZCCA 1OF8A 4FOJA 1DORA 3RM9A 3TEVA 1XLAA 5AHEA 1WXYA 3NXLA 4CCDA 1KKOA 1YW1A 3EOSA 4NJIA 1J0YA 2RUSA 1GQNA 3BC9A 1WO2A 4KCUA 3A9BA 3OLGA 3E96A 5HMSA 3AALA 4IIHA 2WMIB 3K1GA 4P61A 3JUGA 4AVOA 2B4GA 1PHWA 4ZO6A 1RY0A 4F2TA 1S39A 1WXZA 4H6RA 1H1NA 4MWAB 4L1XA 3N2XA 4PB4A 4QQUA 2V2DA 3PWIA 1KD0A 1N7KA 3NZGA 4GVIA 5JIPA 1XBYA 1PXGA 4IIFA 3BCFA 4LCQA 3LPGA 1TTJA 3KP1A 3KRBA 3GU9A 1S5VA 4XBKA 2FLIA 3GG1A 1E9ZB 1NVMA 3BLOA 3UZZA 4EAMA 1ZJHA 3N11A 5M17A 1EF2A 2OOFA 4GC4A 1Q6RA 4MTVA 3LGGA 3OODA 2QHAA 2Y70A 1XH1A 4JL1A 1O66A 4TUFA 1GOXA 4BQ2A 4HOWA 1BVNP 1BRLA 5BRQA 1GTHA 1NFPA 1KNWA 2HS8A 4KBXA 2OYLA 3LA4A 4PEKA 1CB7B 1EA0A 1FWNA 4GH3A 1EOMA 1JD9A 3Q65A 5A6BA 3LQLA 5K3VA 1CGVA 3SZ8A 3IIVA 4CNUA 1YDVA 3O2LA 2Z0IA 5LXEA 4H8HA 4YTUA 2C91A 1EF3A 1FA2A 1VBGA 1IHIA 4S3KA 1K9DA 3PJUA 3MDUA 1LTDA 3KWSA 3SADA 1GQJA 3MY9A 4HNNA 2Y7GA 3EAUA 5IBXA 4FF5A 2V81A 4R27A 4RXGA 1DTUA 1VCFA 1Q7QA 4WJEA 1XRTA 3AIUA 1JCXA 1TJRA 3M7WA 4NVTA 3TXZA 2Z1XA 1NDYA 1ZS2A 3U6WA 4FLOA 4K8GA 2A3BA 5CXPA 3N9KA 4MKSA 2FYMA 1XFCA 4LX4A 3LBOA 2TMDA 1WZLA 3WCZA 4DN1A 1XDJA 5H2ZA 3WLJA 3UJFA 1V0MA 3TMQA 3C5QA 4QSFA 3IANA 5H1WA 1TRDA 3LYEA 3IRSA 3CWNA 1XLBA 1P5BA 3S5ZA 3EX1A 4FXRA 3B0VC 1CB2A 3UZXA 4WCJA 1SFJA 2RJHA 2YXOA 4GI9A 2ZX6A 4W4QA 1NF0A 2VRJA 3QY8A 2W6RA 4AD2A 3WL0A 4TTUA 1MUCA 2EPOA 1EJ7L 1UH3A 3NSMA 4ZB5A 3PZNA 5LIKX 5IHRA 1D7KA 1J5TA 3QY7A 1M5WA 4CN4A 3PG9A 4Q4OA 1FHDA 4JTEA 6A3HA 1YKWA 3D47A 2OU4A 1XINA 1A0EA 4LSBA 5LYRA 3LLXA 1UB3A 3GC2A 4GVHA 4UTHA 2PDMA 3UA3A 3KTSA 3AJXA 4D8AA 3H22A 4WRHA 3CV6A 4CCZA 4P2VA 1ZY9A 2JE8A 5E6YA 2NLIA 2OLAA 1AD4A 4PCFA 4S3DA 4DUXA 5LGZA 2XGZA 3TC7A 1XBXA 1UWQA 1VFOA 5A6BD 2Y62A 4N02A 3DIPA 2I14A 3W23A 3LOTA 2Z2UA 4XBJA 4LYRA 3VAVA 1TO3A 2Y7FA 3T42A 5C7VA 2ZC1A 3O63A 4P7OA 3VGHA 3ZJKA 1YBQA 2VEMA 3GXMA 1W1A1 1FHUA 4DYJA 1JRCA 3BW3A 4CUCA 1TA3A 2YDRA 3EOEA 1JZ7A 4EF8A 4S3GA 2V0TA 3WDRA 4JEJA 2RDUA 2Z7KA 1L9WA 4JD4A 3BJTA 2G96A 3QPYA 4CEXC 4O54A 4GYJA 3RRAA 4IXHA 5D8WA 5CLWA 4LS0A 1SO5A 2J77A 2BXZA 5MKGA 2R82A 2V6AA 1OADA 2JFEX 4K38A 5CGTA 1TX2A 4U2ZA 1EO7A 3W1AA 4NI8A 4P7NA 4F4RA 3NQ7A 3YPIA 3HB9A 3E12A 3K5XA 3N3MA 3T0BA 1IWPA 2CU0A 4O1EA 3PJTA 5L6UA 3N2CA 3MMUA 5TNVA 4REQA 4GI4A 1FOBA 3WUFA 3DAQA 1EC9A 1UR8A 1NQ6A 1F9CA 3PPCA 3SRHA 5A8OA 4YWSA 4LRTA 2WC7A 3R94A 4HNVA 4FOUA 2INFA 2CESA 1W5NA 3MO4A 1L0PA 3QV9A 4ALDA 2UBPC 3GBDA 1UKSA 2DIJA 1BTMA 2PLKA 5H6HA 6PTDA 1W9VA 3R12A 2WHLA 1QPKA 1TPEA 2BGSA 4J3TA 3U2ZA 3ARRA 3S3GA 4K1GA 1QBAA 3M0MA 3SY5A 1P6BA 4EPEC 3GHSA 1A5OC 5CSSA 1R3QA 1V08A 3BSMA 4AY1A 4Y7EA 1BKSA 5JBFA 3N4EA 3N6HA 4HB7A 4GQQA 1FH7A 1O5RA 4MYXA 3MSYA 2Z24A 2DORA 3NDZA 4K7YA 1NH6A 4ERIA 1SW3A 1Q13A 2DQXA 3CGTA 3HFTA 3W7LA 3H2MA 2QJGA 2XH2A 1S3TC 4HA4A 4PZVA 4BF9A 2INZA 3EWXA 9CGTA 4KEVA 2F2HA 3HJEA 1Z8AA 1K8YA 1XRSA 1G01A 4NF7A 4WKFA 2HISA 4S3FA 4O19A 2PWUA 3BL3A 4GZJA 2BOFX 2GDQA 3TDFA 4F0HA 1C90A 3SQSA 4DBWA 3T0DA 1VEMA 3M07A 1H0IA 2QCLA 2H3DA 1UR3M 2VUYA 5DT7A 2H90A 1D3GA 3BV4A 5C55A 4E4UA 4GISA 5EGRA 2JKPA 2WCSA 1OYCA 3CB3A 3NEHA 2QCDA 4ERAA 2CLIA 1A5CA 3AXMA 2YLLA 3CZLA 4I7WA 3DEQA 2XZ7A 5A6AA 4AUBA 1HP5A 2A7PA 5CPMA 1V3KA 5GNXA 1T5AA 2J7FA 2ESCA 1OD0A 4RE0A 2OYMA 3V35A 3W2KA 2VURA 4WKHA 1SW7A 2F6XA 1M3UA 5D4YA 2X0YA 2AMXA 4PUDA 2E8YA 1Y5XA 1I9CB 1JZ8A 4GX9A 3VD4A 3MI2A 4F66A 1QFEA 3B8WA 2PDXA 1XFBA 1XLIA 3INPA 1PVNA 3B4UA 3LNPA 1FWTA 1JQVA 3RMEA 2VCBA 4JTLA 3MKKA 3N6QA 1YXDA 4ZCWA 3W26A 5CJMA 4DAIA 4DBDA 2JKAA 1KFLA 3HF3A 4XUGA 4GHRA 1B54A 4X0VA 2HSAA 2RH9A 4UMAA 1IZKA 2ACRA 1Q6LA 3U5UA 4AXNA 4GUFA 2HJPA 4FR6A 2OQLA 2OELA 1LCOA 1OFDA 2P0IA 4LVAA 1WDWA 3FKRA 2JF7A 2BWGA 2DP3A 3RRXA 4IZGA 4JIHA 3KBVA 2DZVA 3UYCA 3SQMA 2ATMA 3CQIA 4HP5A 2MUCA 2Z1SA 1ZP4A 3WUEA 1J93A 1ZUAX 2FZBA 1OEPA 1CZ1A 1XYMA 2D23A 1M04A 3S0CA 3DGRA 3ZSTA 2OPJA 3PTMA 4E2OA 1QHZA 4FK9A 4O1DA 4GX8A 1KBBA 4GBDA 2HVNA 2J74A 3OG2A 3VX0A 4FXFA 1MI3A 1LOSA 1J10A 5D9PA 1DJNA 5HWJA 3OA3A 5AN7A 1UR0A 4XBSA 2Z4GA 4IQEA 2WANA 2TYSA 2ZC8A 3ITVA 2DSWA 3VTRA 4M24A 3THUA 3VNJA 3OIXA 2X1SA 3RM8A 2HVMA 3TAKA 5I3HA 1G5AA 1EJTC 2D0HA 4A3RA 2AKZA 1L8NA 5A95A 4GK8A 3OB8A 3AC0A 4JHZA 1OX4A 3T0AA 1UJPA 4CQCA 3VIHA 4DVOA 1E1CA 1SVDA 5EBUA 1J0ZA 1VFUA 2ZZ5A 4BCEA 3O15A 4AD3A 4AD5A 4IX0A 5F4XA 1NU5A 1F3XA 2WKLA 1RBLA 3K30A 4IGSA 4O52A 1P7TB 1QNVA 3GDBA 1U33A 2VOTA 3DFNA 1KBJA 3EYPA 3U7BA 4WDTA 3TYAA 2QUMA 4OJYA 2Q71A 1CI1A 5C7HA 3OYXA 1W0MA 4RXFA 3TA9A 3GXFA 5MKGB 4OFCA 5FJJA 4A8NA 1YDNA 3VO0A 3A64A 1A5MC 4EKJA 1OQFA 3VZZA 1YPFA 1KCLA 2QW5A 2VFGA 2Z7GA 1ENUA 2GDVA 1DJYA 3VIJA 2ISVA 1FWJC 4QNEA 2ZA1A 2ZDSA 1NIUA 1O4UA 1WCGA 4US5A 4H8VA 3C8FA 4C6IA 1C8XA 2FZ8A 3W02A 4MIMA 3RPDA 1Q2RA 3M44A 5BU6A 3CO8A 1GW9A 3UWEA 7XIMA 4C6JA 3HOJA 4MWAC 4H6QA 4CN6A 3N14A 3L4VA 1FP9A 3T81A 3PBUA 3C0QA 1DJIA 4ZOAA 3OZMA 1HKJA 3BVJA 3F5LA 1NF7A 5HK4A 4H7ZA 4RDWA 4GUJA 3CS2A 3MUXA 2PBGA 4S3JA 4MUPA 5A69A 3VXGA 2OMAA 4L56A 4C6NA 4BF7A 3KHDA 1OFAA 3NQBA 1K8CA 1Z69A 3ZLHA 1BGGA 3VNKA 2QZRA 1HL2A 3T2OA 1TWDA 3RX2A 3LCGA 3UZYA 1RA5A 4YN5A 4J28A 4A29A 3G3MA 3M0YA 1B0IA 3VOHA 1I75A 1ZJIA 1VLWA 4I5RA 3FGCA 4UFIA 3PC0A 1D2KA 2VFIA 4DJFA 4DJDA 1P0BA 3SO7A 4FA3A 1DJWA 4AX6A 4B3LA 2PWHA 1E56A 1HG3A 3NZQA 1TVPA 1CIUA 3V4BA 1E3XA 3DKLA 3FA4A 4UCFA 1HX0A 3SBFA 2CZ5A 4IPJA 5A2BA 2BY2A 4Z2JA 5A8QA 1QPQA 2OEKA 1BWLA 1EIXA 3CLMA 5HXMA 1ZCOA 3V0TA 3W7PA 2OB3A 1E5JA 4H8UA 1V03A 1XD0A 5EPDA 4W8LA 4JN6A 2VDGA 1H2JA 1ONWA 1TE6A 4D72A 3KEHA 3EXRA 4NYUA 2YSWA 1JD7A 2EBNA 2WYSA 4QSHA 1AW2A 4E2VA 3FLUA 5HA7A 1LL7A 4JTSA 5A6JA 4CQ8A 3ORWA 1GJUA 4BZYA 2GFTA 3HBLA 3GFZA 3MUAA 1RJPA 2FPYA 2VO5A 3VDAA 1FKXA 3U4AA 3U7VA 3NNTA 3HURA 4DI8A 4AIBA 4KCWA 3CQJA 4GCAA 4LUIA 1TWWA 3OBKA 4F8XA 4DXXA 1I0BA 2JGYA 1O5QA 5A8NA 3H7RA 3RU6A 1NOWA 3UESA 5FEZA 3H8AA 3DOPA 3QFWA 4DNHA 3SCPA 3WLRA 1V5XA 4TVCA 3B04A 1DXFA 3P0XA 3GFYA 2CKRA 4XAZA 3UJ2A 7TAAA 3WIJA 1RQBA 5G1YA 3LK6A 3M5VA 3PZTA 1PKLA 1LT7A 4DEFA 4PMJA 3WNKA 3ZS4A 1R3TA 1FDYA 5HNNA 3S1GA 4LUJA 2C7FA 2XIIA 5K2ZA 2E09A 2QR6A 1WV2A 3OVGA 3W7GA 1JCLA 1XRVA 2GQAA 3VIGA 2G3JA 4ECLA 3DG6A 5AYXA 1DHPA 3DU0A 3B9NA 3PZUA 1MW1A 1ZLPA 4HNLA 4XKYB 4ZSTA 5REQA 3NPUA 5DCBA 1XP3A 4S2CA 1OHLA 1VR6A 3AJ7A 1OGSA 1Q6QA 3M5YA 4PTVA 4MUZA 2AGTA 5A6SA 1E0VA 2GPTA 2VWTA 3QF0A 4KWSA 4Z1BA 4HQVA 1R3YA 4O1BA 1QU4A 2GK1B 3K46A 2ZX8A 4EF9A 3DHFA 3KE0A 4UMBA 4WD0A 4LANA 1SO6A 4YTTA 1F6KA 5FF0A 3GH4A 3UD6A 3I6EA 3N04A 4NG3A 1VBUA 4QE1A 3QZAA 3B0PA 2E7FA 4N4PA 4LH8A 4JFVA 4C90A 1JCJA 1TQJA 4NL1A 3CT7A 2VC7A 3GYEA 3VOJA 2P3EA 4C6FA 3M5XA 4O0ZA 3U57A 4HPHA 2HK0A 3DFQA 3GC4A 7CGTA 3R0KA 1AODA 4HGXA 4ZL1A 4DPQA 5D9OA 4FNRA 3T07A 4DJDC 3OW1A 5K4XA 3L23A 2A0NA 2PD9A 4HOZA 4H04A 3T2PA 1DP0A 4NZFA 3SDOA 1VEPA 1JPIA 3WDPP 2PAJA 3PS7A 2CETA 2AOSA 1XUZA 3GC5A 4ICMA 1B3ZA 1MXDA 3KUMA 1U22A 3WQDA 1G7VA 3N4AA 3GFXA 1F3TA 5ABTA 4O28A 1ZENA 1G1YA 5D2TA 2DEPA 5IM51 1WDSA 3VE9A 1VEOA 2AQVA 3ZVIA 4HNUA 1L2QA 3GKFA 2DUAA 2WPBA 2Y61A 3ITLA 1I45A 1B2YA 4J4KA 2ON3A 4OECA 5LNSA 2GJXB 3UR8A 2ZX7A 4B16A 4DRSA 2E9MA 2CC0A 4Y8FA 3FK4A 1NJJA 3M47A 1K9TA 3F4NA 3NFUA 3G8EA 2IW0A 2E9BA 3ES7A 1VRDA 2VGFA 3W9ZA 4NQ1A 3SCOA 1F3WA 1RP8A 2HPMA 3ZR5A 2O9OA 1D8CA 3GSMA 3HTWA 1XSIA 2WLYA 3WH6A 1AZ2A 4D6EA 3NQFA 4OUIA 5CPOA 4DM2A 1MEWA 3MB9A 3BUVA 3LMYA 1G6CA 3EWYA 1P1XA 2DY3A 3ES8A 5I00A 3IGSA 1EWDA 4PUKA 1BXCA 1M03A 1PX8A 3PBWA 1E40A 3W3OA 5HQMA 2XFWA 3KL3A 1MYRA 3VKCA 1HP4A 1PIGA 3LU2A 1GOOA 4E4PA 3NL2A 4M7TA 4GD0A 2Z1WA 3MUZ1 3L4YA 1J5SA 3NTYA 4PH6A 1HJSA 1K7FA 1W8GA 4KW2A 3G1SA 4PODA 3C86A 1GEQA 1XCWA 2O4MA 1MDLA 1US3A 4GJIA 2ZUTA 1NP0A 4GWEA 4LY4A 4BQ4A 4IG2B 3MKCA 4Q7BA 4FIQA 2R6OA 4ASTA 3CV2A 3A3HA 4DZHA 2Y1HA 5IXEA 4NAEA 4JN8A 1FWSA 2IQ0A 3OVPA 3MDWA 3PM6A 3W6LA 3W6YA 3WJYA 4MJZA 1CDGA 2OG9A 4F79A 3NM3A 1Q5MA 1E4NA 1PWLA 2E3ZA 1E51A 4PUWA 5DY2A 3VUPA 1IR2A 4AC7C 2ZZ4A 5I24A 4I7UA 4PC8A 2F2KA 1ZTVA 3GUWA 2REQB 3VKDA 3FXGA 3G0XA 4X0NA 4MDPA 3B9OA 1LWHA 3A5VA 3UPWA 1LRTA 1GK8A 2BXYA 2QF7A 1Q85A 4A3YA 1B9ZA 3KVKA 3JZEA 2WJEA 4JKMA 3G77A 4C65A 3A4WA 4AHQA 3KRUA 3AO0A 1J6PA 2C1HA 4PTDA 5AVNA 4PCPA 5CG7A 3SUSA 1PIIA 1TPFA 1PO9A 2WSPA 3HA1A 4WY0A 3GAKA 5J8LA 1R2SA 4RNJA 4XAYA 5FEPA 3A4XA 2CZDA 2PWFA 3HGSA 1QW9A 3C0LA 3GO2A 3KBMA 2DFAA 4JNMA 1O60A 3RFAA 1DIKA 2GJPA 3Q67A 3N2OA 3FJ4A 3TYCA 1KBIA 5AFDA 3IGUA 3IJ9A 3DBPA 3N17A 5CSRA 1OD8A 2PGWA 1M53A 4HMDA 4QDMA 3SW6A 1E72M 1R0MA 4OHQA 3VD5A 5C8BB 2XIMA 1V0KA 3EDEA 2WBKA 3CQKA 4ADUA 3O9NA 4TMCA 3FEMA 1PKMA 2PU0A 2WV8A 4KWWA 1KXQA 2V5DA 2NUYA 4L65A 2A6LA 3G18A 4CNSA 1ZNNA 4JNYA 4H1ZA 3L66A 5CZSA 5DF0A 3A13A 1UCWA 4U5IA 3D3FA 1H7WA 2PDWA 3PHAA 3SGZA 3W7IA 4XZIA 3WLSA 1B4EA 2ZX5A 3HQ1A 2C79A 3SECA 2EHHA 4HHHA 1E15A 1RP9A 3RO8A 1UQYA 1H5VA 4XX6A 4OE7A 4EANA 3A5FA 4U3CA 2Y5JA 1GKQA 1EPXA 3MO7A 3PBMA 2VD9A 3ZFHA 4MB3A 3SB0A 2PWDA 3EPOA 2WW5A 2OR2A 3ONBA 2XG9A 1EC8A 3UNDA 3VDBA 1SO3A 3NOEA 5IBXC 3OIHA 3JZUA 1CXKA 4S3CA 5DEZA 3WLLA 1TV8A 1XLLA 1C7SA 4U3AA 2O9RA 3CMJA 3SN0A 2VM8A 5AKQA 3CL6A 1ZSXA 3ATZA 3QOKA 1QPOA 1UIOA 1UASA 2FH6A 3BK0A 4H9MA 1KC7A 1QOXA 1UD3A 3NQ2A 4RZ5A 5BWAA 3M0HA 4ZSUA 5BOOA 3KOYA 5AYBA 1X1ZA 3JW7A 3T44A 1RJQA 2DV0A 2IPFA 2Y4SA 4ZB0A 1P0KA 5I79A 1OC5A 1O95A 3M0ZA 4KESA 4D71A 2YCLA 1G0CA 2ZCGA 2BP1A 3RX3A 1XRFA 3DFOA 3ABRA 3HGOA 2IXVA 1V6TA 2GVYA 4IM4A 6REQA 1BSLA 4P8XA 3OZOA 1P4CA 1XLKA 3VMOA 3W4RA 3CUHA 3H21A 1XIIA 5MF5A 3W1TA 2P8CA 4Z08A 1CLXA 1E1EA 4YL2A 3O3RA 2C13A 1M7XA 1B3OA 1DBTA 1M01A 2IKJA 3NYDA 2D0FA 2XIQA 2DZBA 1DYSA 2ZE3A 3UA4A 1EJVC 1T99A 1ZP3A 3EDDA 4J7RA 4GI8A 3TLLA 5B7YA 4GXPA 5AC4A 1B3XA 1W5OA 4E6MA 1YDYA 3VDGA 1GHRA 4P8VA 3S4TA 5IOBA 2WMJA 4OBSA 3N2MA 4PRTA 3PANA 5HJYA 2VQUA 4L9XA 3W2UA 3DFPA 3WF3A 1QW8A 3MC5A 2WLZA 4ZE4A 4A6GA 2WBGA 3PPHA 2EG8A 5I3FA 3LPPA 3ICJA 4YYCA 5HQEA 4B5NA 5E0FA 2GGGA 1IEVA 3FXYA 3BTNA 3QGKC 1V3IA 1X1NA 1NARA 3H4WA 3U0HA 1Z89A 1QI5A 1QNSA 3IK2A 8XIAA 1JDAA 1J2BA 4JIRA 1CGUA 4TVUA 1TIWA 4K3ZA 2XSXA 1UUMA 3EWUA 2BFGA 1JPKA 3PTKA 3WJXA 4A2RA 3BARA 4KEZA 1YPIA 2A1YA 4HZ8A 3AMKA 4JFWA 1UWSA 3AHZA 1O5XA 2DSKA 5IFTA 2J6XA 1WZKA 1GVOA 3KAOA 2Y6ZA 2ABBA 2NT1A 2QCGA 3WBXA 5AC5A 4H7CA 4P8UA 1OWQA 1MVYA 3BQ5A 3CZ8A 4WF7A 4JTCA 1SJAA 1ZAIA 3WNPA 3RR4A 1FWAC 2GSHA 3WQ6A 2E5BA 2PC8A 4FXJA 4ZB2A 2YPIA 1OYBA 2QJMA 1XYLA 2HMCA 4JAWA 1IWBA 1Q3NA 2FGBA 2KZHA 3NZRA 3EDFA 4C5YA 2H3BA 1KM6A 4WVXA 4DF2A 2FVMA 1GNXA 4LFYA 5ABEA 5E9XA 3TAOA 2D0GA 2Y8UA 4UFKA 4AZHA 3W6MA 1PCKA 3QYQA 2PDNA 4HMNA 2V3EA 5XIMA 3LSBA 4XWUA 4FR1A 1BRLB 2Q6ZA 1D7FA 4Q8PA 4MAVA 4QQ3A 4G5DA 7ODCA 3TFCA 2MANA 7A3HA 1LT8A 2FTWA 2R1PA 2X2YA 1Q4NX 3QV7A 3W22A 3EX3A 1J79A 3UERA 1HKKA 3K2GA 1WKYA 4DXKA 5U4NA 4HU3A 3LXCA 2FHCA 4AD4A 3M6YA 1WBJA 2VFDA 4Z1AA 1C9WA 5HUOA 4LBRA 1RJRA 4X9YA 3LEPA 3O8AA 2I5QA 3N9SA 3FHAA 3B0XA 1QR7A 3AXXA 4AYSA 3W84A 2EPLX 4LC6A 1TV3A 2YCEA 1JQXA 3LGEA 1LQ0A 2Y5SA 4O16A 1LWJA 1QDSA 1S38A 1UR4A 1QVBA 4IMDA 4UBPC 1YE4A 1O1HA 4GYPC 3RIKA 3BAYA 2PGRA 2HCVA 2JEQA 9XIAA 1H0GA 4BFAA 2WNWA 4BK9A 1Q7MA 1JRBA 2WVUA 4IFKB 3NQCA 2CLKA 2V2HA 1Y65A 3RXZA 4Z1DA 3F5JA 4F9DA 3V5OA 3VNMA 1JUKA 4DJDD 3VCCA 1PTGA 4GNJA 1PPIA 5I3GA 4WSKA 3LLDA 3L2MA 3L5LA 2X42A 3REQA 5IDZA 1W37A 1KLZA 4H4IA 3SCVA 1BF2A 3ALFA 4N0RA 1V7YA 4OOUA 3TJXA 1YTDA 3VGEA 1JI2A 4J2PA 1VHNA 4GXMA 1BVWA 4JCMA 3MA8A 4IT1A 1MW2A 1CBGA 2W92A 5JBEA 3ECQA 4LEFA 3VUSA 3VC5A 4DWSD 3UYIA 1F4AA 4M6VA 1OM0A 4GZ7A 3GHTA 2PMQA 2VCAA 1BF6A 3Q94A 2PWGA 2I1OA 3E2QA 1V3HA 3MQTA 2BY0A 4IOTA 3FYPA 3PZIA 1T40A 2CLEA 2CEQA 3ARVA 3AROA 1R3VA 1TPVA 1VGAA 1HXJA 5AB3A 3HIJA 1D3CA 4ZOEA 1TYGA 4UTIA 3GDTA 2BY3A 3W24A 3HGRA 1F5ZA 2D2JA 5K4ZA 1JYVA 3QXBA 1XGEA 2RGMA 1LL4A 4S3EA 4RNFA 1HGWA 5PTDA 1AQ0A 3EA3A 2V69A 5C9UA 5G2HA 4PMUA 3QV8A 2ZVRA 2NV9A 4C60A 2X7WA 4E2DA 3VILA 4UOZA 4UQAA 4DHGA 3PWAA 3WMSA 1IXNA 1JEZA 2A3EA 5ENLA 3L0NA 4G1KA 3C2FA 1QK2A 1EKOA 5CGMA 4HPJA 4MJ2A 1J6OA 3FCPA 4YHEA 3W1UA 2WPGA 4MNKA 4C6PA 1ZQ5A 3QHMA 4D1JA 2IQDA 3OLIA 4XK2A 1OINA 2TAAA 3D3AA 3L67A 4ORMA 4MADA 2WZEA 4GXWA 2TODA 4HCLA 3WQFA 1QWGA 1ESWA 2WNQA 3G1RA 2QPSA 2F6KA 4AEFA 1NEYA 1Y0EA 1DXEA 4US6A 1UWTA 2C8NA 1POJA 1KR1A 4AZCB 4QP0A 4ATDA 4DY1A 4UNKA 3OTRA 3KCOA 2GVJA 1UHVA 1FFQA 3AIBA 1P7TA 4UR7A 4IPLA 1YQ2A 2D1ZA 2I5IA 4QEHA 3D5HA 3AIWA 3F4DA 1OT1A 4FZIA 4JICA 3AOFA 4UNIA 3QEZA 3QLDA 1K4GA 2QUNA 4MB4A 1EXPA 3SUTA 3IAQA 1AD1A 1E4LA 4BEQA 2WJDA 4DQWA 4GRSA 4NI3A 3WEMA 1W2VA 2YW4A 1J01A 3MYOA 3O6YX 1W1YA 5KTLA 3PPGA 1PB0A 2EKGA 6ENLA 1L6WA 2V3DA 5KEZA 4UTMA 3FJ6A 3CUGA 2BOEX 1LG2A 3WQ4A 3TN5A 3T9PA 4JTFA 4Y90A 5BXPA 4P8WA 1JF5A 3EKGA 1PX4A 4O12A 1K77A 4DYKA 1ZRQA 5FJUA 3QZ6A 2Z1KA 3LTPA 3BH4A 4ZFCA 4PMNA 2WSKA 5DMMA 1TV4A 1GOIA 3VIFA 3MYPA 3TQPA 3J7HA 3CIXA 2C14A 4CEUC 1RQEA 4GO8A 2OCZA 4MJ4A 3TR9A 1XDMA 3S47A 2R91A 4NSBA 4G1NA 1J0JA 2QAFA 3UWZA 5DO8A 3OA5A 3QSRA 4K2SA 2WQDA 1HN1A 3B97A 5A6LA 1UZDA 2ZRXA 1UMLA 5KZ6A 2PF8A 1BHGA 3CC1A 5LIYX 3C52A 3GB6A 4GQGA 4UQEA 3IJLA 3LV5A 3TYZA 3VKJA 1X6LA 4G2DA 2X8RA 1B3VA 4PRWA 2Q3OA 5CZJA 1QBBA 4PBFA 3F1QA 4C1NB 3IJDA 3NA8A 2F84A 4PRRA 3QQ0A 3BLIA 3I4EA 5K9CA 3CU2A 3MMWA 3ZJ8A 4INFA 2PE4A 5H8UA 2HRWA 2OSXA 4NKCA 4ROPA 4GUGA 3AZRA 4LVGA 1E6QM 1TX0A 5K9DA 4J9JA 4Q8VA 2SFPA 3UR7A 5HULA 1TPH1 5CPSA 3QZEA 1L6GA 1KKRA 1TIMA 3R43A 1XQLA 4Q8TA 2DUXA 2ACSA 2CLLA 3QR1A 4DUWA 4R7WA 1C3FA 3B40A 1R85A 3CL7A 5FKYA 2F7FA 2YW3A 2VZOA 3HQOA 4C6MA 3HG2A 4YCPA 3PSWA 1YMYA 2QNEA 4RDZA 4L4LA 5D33A 2WXDM 3GVWA 1SW0A 4Y9MA 1YADA 1Y7VA 1GYNA 4GCXA 4DELA 1HTIA 4OT7A 4J3XA 2XVPA 2PDUA 2VENA 5F7UA 1VFFA 2YR1A 4HK5A 2I56A 5RUBA 3S5YA 1VBJA 4ZQRA 1ISYA 4K36A 1UPMB 4Q4KA 1EJWC 1BYAA 1IQ8A 5LA2A 3VU2A 1V6UA 4P7QA 3PUDA 5BOFA 3LM3A 4MZYA 2WB5A 5E0KA 4GI6A 2WHMA 3S6TA 5TAOA 1G4TA 4GQBA 4ENLA 6CGTA 2RHGA 3GRIA 2PTWA 4WR3A 4CU7A 5E09A 3PNUA 5FF3A 2GJXA 4IJCA 2V5CA 2G3MA 3EA1A 2QCNA 4UTJA 3WMBA 5D2YA 2W67A 1MQPA 3HFYA 3I3DA 5EKYA 4AQLA 4UQDA 1TTIA 4NY2A 4YWIA 4TTGA 1WUEA 1Z44A 3KOZA 2R14A 2R1NA 3SQLA 1XLHA 4CD4A 3TUUA 3HG4A 1WB0A 3FJLA 2E6FA 3MUY1 1WOBA 3UXIA 2HZGA 3C2YA 2B7PA 3KTCA 4DUOA 1BPLB 4FMVA 4B3ZA 5FACA 4HHMA 2YKKA 5BWFA 2CLFA 4ZQNA 3B06A 3WG6A 2BHZA 3TJ4A 5DXXA 2JIWA 1CWYA 4UUIA 4MWAA 1OCQA 2ODOA 1JCNA 3E6EA 2HTMA 2EPMX 2F8QA 1KV5A 3Q45A 2PDFA 4GIRA 4HSNA 1UA3A 4B90A 1MDRA 4O1FA 1K6AA 5GPRA 4D6DA 1XH0A 2FB2A 2XU2A 1KBLA 3WSUA 3VDHA 1DJXA 3OOQA 3CK5A 2CWXA 4MFEA 3UG3A 3CMGA 2X1RA 1I2PA 4AZBA 3BSGA 4Q8NA 1SZNA 2PU1A 3GBEA 3BAKA 3UETA 4R7OA 1XR2A 2OZ0A 4EP8C 4I9AA 2G95A 2X30A 3DYPA 1SU5A 4OBTA 3BMVA 3IUIA 1K9EA 1YRRA 3URAA 1EH9A 3TFXA 1DWGM 5FSEC 4M6QA 1MQQA 4L4PA 4JTKA 2G4JA 3I3BA 1XIBA 3KCLA 3MMTA 4IICA 4FX7A 3G3DA 1ZB5A 3C56A 3TW7A 4PEEA 5FEWA 4N9EA 3IACA 1S46A 1LRQA 2BVTA 2BZNA 3BSHA 3APYA 1SMAA 2XN1A 3HPXA 3RHGA 3IV3A 3RNDA 5FOOA 2CBVA 3OVQA 3BJFA 4WY0B 2WMIA 5HQLA 1SFTA 4X22A 2CFFA 4TV6A 4Z0JA 3CUXA 4AISA 3I3EA 2E28A 2R8WA 4O57A 1NFBA 3DFTA 4AXKA 3UCDA 4N6EA 1J8VA 5DMYA 1VBRA 3TH6A 4GIAA 4JNZA 3ABOA 3HZ3A 2YL8A 3VIOA 5JXQA 3E2SA 1S2AA 1P0EA 1AH4A 3FGCB 2XN2A 3AYTA 3I10A 4JOMA 2QCEA 3IS4A 4LF1A 2BB0A 2QDHA 3M5ZA 1NOFA 2PB1A 4LS1A 4P5UA 1H5YA 3VOCA 4JR5A 2NVDA 1HO4A 2YDSA 1N8WA 1ZHAA 1JCYA 5FESA 1GOWA 3T1GA 1ITQA 2WMGA 3GVQA 3GIYA 4C6EA 4GY1A 2GGHA 4O50A 4WJXA 1XH2A 1XGDA 3W1LA 2VEGA 2DQWA 2Y7DA 3N19B 4GJJA 4UCGA 1LBLA 2IS7A 4DJEC 4M3PA 4L6OA 9XIMA 1J2WA 1F3EA 4LS2A 1XX1A 3H2CA 1XIMA 3LHVA 1DXIA 3UY7A 3V75A 2UY3A 2HE8A 1PE1A 3CT2A 3TLQA 3WBYA 4ICNA 5D2VA 4QBXA 3OEXA 2WHJA 5HATA 1RXOB 4NZJA 1DWHM 3KLLA 2PDHA 3PPFA 1MO0A 3R1ZA 3STGA 5D2XA 5KITA 4YS1A 2VX5A 5BCAA 3QBUA 3CTTA 5AYZA 1KXVA 2I7GA 8A3HA 1WA3A 3KVJA 3ZJ7A 5AYIA 1EEPA 3ANVA 4IISA 3W7RA 4P7LA 4RNIA 1YBQB 3L21A 4PSRA 4BWLA 3S9IA 1QCWA 3F7JA 6XIMA 2NW0A 4R7JA 5I7GA 4A21A 1NDWA 1EYWA 3NYZA 1UZ1A 3FDKA 1KM5A 1FP8A 1R30A 2YFOA 5CLTA 1E43A 4B5UA 2VDIA 4RDVA 1Q4WA 3SCNA 3CAWA 4D9PA 2XN0A 3PUOA 2W79A 4JIIX 3W1XA 3H26A 3AIEA 2BVDA 1LM1A 3QHOA 3LB0A 4QISA 3ARYA 4RE2A 4R53A 1FKWA 4Y9NA 3RU8X 2QYGA 1KRBC 3PJXA 3WLNA 2WC4A 5FJTA 1E6XM 3IEBA 1FDJA 5F2MA 3CZKA 3HMCA 3CB8A 4K8HA 1R2TA 3ABSA 3M4HA 4OOZA 2BTMA 2C1IA 1PBGA 2NVCA 3F2CA 1C8YA 1LUCB 3TYBA 4D6CA 3BAWA 4EPDC 1RZMA 3QR3A 2QVHA 4Y96A 3W76A 1CW2A 2PBOA 4JHOA 4M51A 4X9SA 3WLMA 4UR8A 2GOKA 4NIRA 2VKZG 5E5CA 4A22A 1JCMP 3GU2A 4HMCA 2QULA 2PD5A 3ONCA 3GWQA 3QM3A 3FW6A 2B7OA 2EG7A 2GUUA 4NX5A 1HL9A 4BI5A 4AVFA 3BW2A 4ZO9A 3WLQA 2A6NA 2J66A 4L6DA 3B8IA 2A4AA 1KXHA 3S6OA 4WKAA 3CYVA 2OTDA 5AHIA 4NASA 1VD6A 3MJYA 2WNZA 3P2VA 1W32A 2WNNA 4Z1CA 5CC3A 2GJNA 1SZFA 2YXGA 1QATA 4O15A 3TX9A 3MHGA 4DLMA 1GJWA 2HV5A 1TSIA 4FNTA 3LMZA 3P74A 4LW7A 3DZ1A 4I8DA 4FX8A 3WLPA 3FHQA 1OCBA 2J7GA 1MRAA 1V6YA 4R3UA 3S5NA 1A50A 4KF1A 2ZUVA 4RW5A 3NAVA 1EX5A 2QCMA 1QNQA 5KINA 1VFHA 2WVVA 1E4IA 3Q58A 3W83A 3KRZA 3VINA 2C1GA 3DERA 1VZWA 2H6RA 3LV6A 2E67A 4HYRA 4IL2A 4Q7NA 3ZT6A 5AC7A 2FZMA 3O05A 2O56A 2HE5A 4IPPA 4IMGA 1W1TA 1H7OA 4BR1A 5DBTA 5D32A 3K4AA 2X7VA 2QUTA 2J8TA 1GQLA 3VKAA 2X05A 1PIFA 4KIEA 1EUNA 2FMOA 1X7FA 4M56A 3WQ8A 3WQCA 3EKZA 3T7VA 1UIPA 1B30A 1YEYA 1ME9A 3K4WA 4PUUA 1Q45A 3W7OA 1O68A 1SPQA 4S1FA 4IFRA 3EMCA 3VYLA 4HA1A 4R9OA 3WFLA 1PAMA 1ISZA 3DG3A 4WDXA 4MHBA 4GA8A 3WH8A 3PB0A 3QQWA 4QG6A 3B0YA 2WK2A 3L0KA 5AC6A 4NZ1A 3GAYA 1JDCA 1FDZA 3FFSA 3LPOA 2PDQA 5JH2A 5BZAA 3LTYA 3SCUA 3EXSA 4A2SA 3F4VA 4PCSA 3LQGA 1BYCA 4GUIA 3E0WA 4Z17A 3CPGA 1VYRA 2JEPA 3MCOA 5M2FX 1PKYA 3E5PA 5LNUA 4JY8A 2OEMA 3GE7A 4LYQA 1PZ0A 5HUPA 1BSIA 3MSGA 4PUNA 4C6QA 4CVWA 4WIWA 2AL2B 3O6AA 4QE4A 5IDIA 1H62A 1R9XA 3N12A 3AHTA 1QXLA 3AQUA 3D46A 1HVQA 1PV8A 4PB5A 4UC5A 1J0KA 3PZMA 4ZR8A 1PZ1A 5MHBA 2CHOA 1XIHA 3TQVA 1F76A 3MHUA 3LSCA 2W91A 3O1NA 3TN3A 4TOQA 2ZDRA 4YNGA 3STFA 2FPVA 3CO4A 3T4WA 1RA0A 1IT8A 4LT9A 3VCRA 2GK1A 3BQ6A 1GKRA 3CH9A 4YVVA 1Z3NA 1HIZA 5M1TA 4PUMA 5LZLA 3KOWA 4TMBA 1CENA 1FCUA 2GGIA 2OZ8A 1R9YA 3W7MA 3N4FA 1AVAA 1A5KC 2BS9A 2J75A 1AL7A 1TG7A 2XFYA 1YHTA 4IQDA 3BMXA 4K68A 3WEOA 4DAFA 3WJZA 4DJEA 1TV2A 2A3HA 2HXTA 1WDRA 3GZAA 1JAEA 4AFYA 3ARPA 2XIJA 1EIBA 4W88A 3N34A 4AWSA 7REQB 4QG9A 1VPYA 2JF6A 1NOUA 1RAKA 2PGFA 5BROA 3VGFA 1OFQA 2A85A 2H8ZA 2XVGA 1F07A 1RV8A 4I3GA 5IRPA 1ZAHA 3R13A 5H91A 3CBWA 3MJMA 4XVDA 4KEMA 2BLEA 4M19A 1CECA 5FD0A 1UQZA 3DYMA 4KIRA 5G2WA 1A0DA 1V3JA 1QMLA 2WKGA 4YTSA 1VJZA 2CLHA 7PTDA 3ZWTA 4H83A 1TJ2A 1TJ0A 5HINA 4Q3MA 2V63A 2XFRA 3SY1A 3BLDA 5DCEA 1MRQA 3CHCA 1GVYA 5I78A 3QHNA 3GXDA 3IK4A 3ZMRA 1CXIA 4QLLA 4G6CA 1K4HA 1IEWA 3CUIA 3IJ8A 4MLRA 3GDRA 5AZ1A 1J0HA 1QASA 3NO1A 3MI3A 1E3ZA 1UP0A 7ENLA 1F8MA 1HW6A 4E8GA 3T08A 3WK3A 3LCWA 1W2PA 3CPRA 4PBGA 1ITXA 4N7QA 3IVTA 2O92A 4D8LA 1H60A 1CXHA 1GHSA 1VIWA 1XW8A 1H11A 4ACZB 3ITCA 1W3HA 1XYCA 4W85A 2CERA 3GTFA 1L6YA 3AWOA 4BQ5A 1KO0A 1KM3A 1X38A 4UOQA 1SM9A 1FXQA 3WLTA 2QPUA 3W25A 1GZ1A 4GABA 4OV4A 2HNEA 4C6OA 2WMKA 4IUOA 3LI0A 1LQ2A 5D37A 2G3IA 3CIVA 4WDUA 1UBSA 1KTCA 4G8TA 5D05A 1QOPA 3WDHA 4JTQA 4V1XA 2A79A 3VC6A 3KLKA 3IJQA 4IG2A 4MY8A 2DJXA 3FX4A 3GNXA 4O18A 2CZVA 2OVLA 4FO4A 1ZPTA 4LY8A 4YYFA 3AYRA 4D1IA 2Z2BA 1CCWB 4BI7A 4W5ZA 5CAHA 3BLKA 5T26A 5A6KA 4H00A 3FA3A 1NAL1 1TZ9A 3AU6A 3KBNA 3QFEA 2EJAA 3W70A 4JTUA 4QAIA 4C5ZA 1V79A 1XD1A 5LIUX 2ZXDA 3AZSA 2RDWA 1XL9A 4DZAA 3USZA 1KQZA 3ARZA 3LHWA 2NX3A 2VX7A 1BD0A 3CHDA 3TC3A 4LUSB 5CBBA 2PUZA 3WNMA 4GOAA 5C54A 3SCQA 1KFKA 4RZBA 1YXCA 4LGXA 4TQTA 3VABA 2J9YA 1AMYA 3BE7A 1X6NA 1ICQA 3UG4A 2DU2A 1FTXA 5FEXA 1UOKA 3L5MA 3OZYA 3URQA 4JKLA 3AYSA 2ABAA 3W1NA 3Q4DA 1MW0A 3BAJA 4IPIA 1LWIA 2EAWA 1UC4A 2R1LA 4QJ3B 4ZTXA 8RUCA 1OB0A 1TPDA 4Q8QA 1ZJBA 1WDQA 2UY5A 3NL3A 1RY8A 3NXFA 3LRLA 1US2A 4LCSA 3ANYA 5EFDA 5ABFA 1NWRA 2FKPA 4BEUA 3WQ5A 3TIMA 3I6TA 1XIFA 4JQ2A 1U1JA 1JPHA 3EGJA 4N9BA 2G3FA 4I7VA 2PRLA 1MW3A 1T8QA 3CQ0A 4Q33A 1SMDA 4B5XA 4MDOA 3RAOA 5HWNA 2F38A 2A21A 3LRMA 3OHIA 1W3NA 2QUVA 4PFHA 1O5KA 2X09A 1N82A 2R24A 5GNZA 3B9DA 3W2LA 3UWVA 5M03A 4HU8A 3PBYA 2PDIA 1GONA 2Y88A 2MNRA 2NUWA 3FNDA 1EX1A 3EDKA 5BU9A 2W61A 5FF4A 3FS2A 3F2DA 4JTRA 1XICA 2I9UA 3MHFA 3VOIA 5DN1A 1H1YA 2ADAA 3AMDA 2QMJA 3GKAA 3EOUA 2P3ZA 5HR7A 1LP6A 2XVKA 4HNTA 1GZJA 4LRSA 5I2UA 1EYEA 3UNTA 1KCXA 3DCPA 1JZ3A 3BWWA 1NSJA 3ZIZA 4F0SA 5A6TC 4QDPA 5CZKA 3UP8A 4AD1A 3WQOA 1GCYA 2BVYA 3V5FA 5FL0A 4W84A 4HHPA 1PL9A 2YZ5A 5EMYA 1H7RA 3I7RA 4CVUA 5KMYA 1KLYA 3POCA 1GVFA 5L9FA 3V0SA 1TVNA 4HU0A 2OO6A 3WX7A 3WJWA 3KCJA 1S2CA 3GX9A 4PMRA 5AY7A 4YLWA 1K8ZA 2WHKA 4IH3A 3R79A 5CGQA 1MNSA 3NWRA 2PDJA 2GQ3A 4JQ3A 4FX6M 2DVXA 3GUGA 5DT5A 2DDXA 4AHOA 5JQ9A 2J7BA 1HT6A 2OT1A 3QPZA 4DYEA 4YMZA 4FXSA 3ERPA 5DLCA 4KERA 1CT5A 2J27A 2FJUB 4BY3A 4FOKA 3VA8A 1US0A 3FJNA 1DV7A 1B1YA 8TIMA 1JG9A 2XYLA 3M0LA 3W7KA 4QLKA 3TN6A 1ME8A 2H9AA 2A3AA 1B4KA 1FH9A 1KA9F 4RX0A 2DZAA 1DQWA 1S1RA 3RILA 4GMEA 4CD5A 3WLOA 3P62A 3QKZA 2OEJA 1XCFA 4NHVA 5E1QA 4XZBA 3RM4A 3LNMA 4JL2A 2FVKA 5D38A 1AZ1A 1G94A 2FFCA 3W75A 2DIKA 3LI1A 5I3IA 2WMHA 4X63A 3VIIA 3ELFA 1O1ZA 1U5HA 1MQRA 3MV11 3A23A 1SR0A 2XSAA 4AIEA 4D2JA 2O7QA 3VZYA 2JKEA 2Y0FA 3BCJA 1M9HA 1T41A 5M3WA 3VFLA 3NVDA 3EOOA 3OGSA 4E4FA 1TELA 1VFMA 2D22A 3L4ZA 2WVTA 3NSNA 4QM1A 3BAIA 4U4MA 1EJSC 3L65A 3WQGA 4PFMA 4WQ6A 1EZWA 2QT3A 1IE7C 1K70A 1F73A 1ZAJA 2EO7A 2BGQA 2V2CA 3QPEA 2WSRA 2HROA 4CQ9A 3NL5A 4XZ9A 4C1KA 2ZFAA 4RNHA 5H8PA 1ML1A 1REQA 4Z2GA 2O0TA 2UZ9A 3DENA 3IUHA 3P0WA 5EU9A 3GIQA 3GW0A 1OFBA 5DQPA 4A8LA 5CKSA 1ODUA 3P80A 1M7PA 2OODA 4QRNA 5BRBA 4L9YA 2E9LA 3CNYA 2P76A 5D2WA 3E9AA 4ZVJA 1GGOA 1V7AA 3BGJA 2BHYA 3RLHA 2PTZA 1U1UA 2ZXQA 3N73A 3T4CA 2V9DA 3EWWA 3VIKA 1GQIA 2VUNA 1V3MA 2IPJA 3REQB 3P7YA 4DF0A 4LB4A 2V68A 1P0NA 1HZYA 1BYDA 1M68A 4UMCA 1KCKA 4IX2A 4ZGYA 2Y5EA 3S8HA 3MP5A 3RUBL 2E1DA 1M7OA 1JNEA 2QJNA 3WF1A 5CBIA 1Q6FA 1QI0A 5G5IA 1ICSA 4X2RA 3D0CA 2ZZ3A 2HBVA 2P50A 3SM0A 1I0DA 4JKKA 2Z2AA 2CBJA 1KQYA 2GWNA 1K7EA 4LUTA 2GSJA 2OLHA 4Q32A 1R3SA 4XZLX 2ICSA 3FV9A 4GE8A 3AS1A 1W1IE 4J2MA 4YPJA 2Q8XA 4H01A 3RGTA 1E70M 4GINA 1Z32X 2O55A 4GUHA 3EWBX 3B0UX 3W01A 2Q02A 1UYQA 3G1XA 4DBSA 3N29A 4O13A 4PR4A 1JZ2A 1XV8A 2DZPA 3IIXA 1JZ6A 1EBGA 4ONVA 3VNLA 4G56A 3AAMA 4H7VA 3GVGA 2YZRA 4AZGA 2ZUMA 1Q63A 3ZJ6A 1NP2A 3TNOA 4J3ZA 2BMBA 3NPVA 3PZQA 5HR6A 3HGJA 4JTIA 3BW4A 1I2RA 3ARQA 2CITA 4DPPA 2ALRA 4XSMA 1UR1A 2G0WA 3E0IA 4ZFMA 2E6AA 3O0FA 3EEZA 4JX4A 4QEEA 3FN9A 3VI2A 3PR2A 1DJZA 4N9CA 3VIMA 1EFZA 1QRQA 1TCMA 2O9TA 1WZMA 4JHMA 1DTNA 3G1HA 1EDTA 1I2OA 6TAAA 5DXYA 3ZO9A 1TPC1 2ZWYA 3CEPA 3UT0A 2VX6A 4LPCA 3NOYA 4I9TA 3ZSSA 4TU1A 5FAJA 2ZXAA 1TPWA 2NX9A 2PP0A 1VKFA 1GUVA 3M16A 1JJKA 3UY8A 3VNDA 3V1PA 2VX4A 5F1VA 5HAOA 1DJQA 4Q8OA 1AW1A 2PPGA 1E5NA 1E0XA 4Y2WA 4AH7A 2D2GA 2OT0A 5C0QA 1R47A 4QX4A 2FJKA 2VTFA 4L64A 4O0QA 2ZUNA 3KVLA 2OZTA 2J78A 2OOGA 2X40A 1IWAA 3VKBA 2Y24A 2YA0A 3VNZA 2YYUA 1Q6EA 3IVSA 1XYAA 1A4MA 2E6DA 1MZHA 5FJRA 1R9ZA 4L7ZA 1KFEA 1DJHA 4A3HA 4A05A 2D73A 1NTHA 1UD4A 4JDBA 4QFUA 1JZ4A 3WH9A 2F6UA 4UFJA 4Q4PA 3W38A 3GQYA 2J8FA 3W00A 3G22A 1E1CB 3GVVA 1ONRA 1E4MM 2YCKX 4B4HA 3HQPA 1KRCC 5HNRA 1JYXA 3G0SA 2ZRUA 3S1VA 2YB4A 3R8GA 4AMAA 1ONXA 1MMFA 2JQXA 4AC1X 3ZWSA 2I17A 4ZBCA 3EMZA 4O10A 2ZUWA 2BSLA 3HU7A 1J9YA 1EUAA 1WKFA 1FH8A 1HKMA 4UQCA 3NURA 2IKIA 1GPFA 4B92A 2R1KA 4AF0B 3KS6A 4RL3A 3RLUA 1RCOB 3AU2A 3QW4B 3DKJA 4FPSA 3VK5A 3GK0A 4UTLA 4JQ1A 3OJGA 3V7PA 4MY9A 3P82A 4XISA 2Y8VA 1O6IA 2C3ZA 3W07A 4C6DA 3UPMA 1EBHA 5JBDA 3BICA 5CSUA 4BA0A 1A0CA 3ZR4A 1HQTA 3KW3A 3MTWA 4HJWA 4I6VA 5A5WA 4R88A 1HNYA 1ADOA 1E6ZA 1H49A 1A5BA 1ITCA 3HG5A 4G7EB 5M5DA 1HJXA 4WX2A 3T0TA 1DHKA 3MZNA 3PFMA 1KM2A 3TTOA 2YXXA 1LG1A 5AC8A 3GHRA 3VOFA 3S2NA 2ZZ7A 1OC7A 3PUGA 3AMGA 4RV8A 2PDLA 1IT7A 2RKXA 3IIPA 1BAGA 1Z6KA 2PRHA 1TJPA 4S23A 2FHBA 1I2NA 3IJ6A 2QV5A 3AHXA 3D6NA 2Z1BA 4ZQOA 4HZMA 2G8ZA 1ZFJA 2PDCA 1OX5A 1LOLA 2VDHA 1BEUA 4CGTA 3LCXA 1FBAA 1XLDA 4KKXA 4NUWA 2J13A 3KZPA 3BZGA 4JYFA 2ZRYA 3IGHX 5TF0A 4QGCA 3TJLA 2XWEA 3OBAA 5XINA 2WZHA 3U5YA 3M41A 1PCWA 1JVNA 2PFHA 3U2EA 5CG0A 3LBCA 3ZLFA 4PTXA 2OSWA 1WBHA 4Q4QA 4ACYA 4GVGA 3V18A 1UD2A 4LV9A 5A8GA 3AS2A 3L7RA 2OX4A 3LZ3A 3VE7A 5HJXA 2WQPA 1KWKA 2HQAA 3RCNA 3W28A 4A35A 1HKVA 4AIUA 3KHJA 5H8MA 4R5EA 3S5SA 1TTPA 3KVMA 4ZE5A 1CGYA 3PZGA 2VGIA 1H41A 5LHFA 6TIMA 3G2GA 1C9DA 5HANA 2R1MA 1PZ2A 4H9VA 3V1HA 3NGFA 4FEZA 3LZ5A 4TX8A 4HKPA 5B80A 1KRMA 3UG5A 4GBUA 3OQEA 4GZEA 1YTKA 3C2VA 1PDYA 2EGZA 2PDPA 3EB2A 4CNTA 4QJ5B 3G6MA 3QKEA 1HUVA 5AHLA 1UA7A 3OQ8A 1I2QA 2VVNA 1UMYA 3UCQA 1A47A 4O53A 3H53A 1TR9A 2FZDA 3DI1A 2J8GA 3QV6A 4QXIA 3BAXA 3UBPC 1EJRC 4RE3A 3S46A 3VD3A 4AZIA 2EPNA 4ILSA 3U4FA 4WZHA 8XIMA 3APTA 4IIGA 2VI0A 2AL1A 1FWWA 4R33A 4NXSA 5LIWX 3UQNA 1EEXA 1HO1A 2PP3A 4UB9A 4PTMA 4XD6A 2E8ZA 2JGQA 2A2IA 3M6DA 3W1RA 4M8UA 1RQHA 1I8JA 3R4IA 1QI2A 2OWCA 1OABA 1UKOA 3ITXA 4XAGA 4IMAA 4X61A 2YFNA 5FAGA 3WD1A 1FHLA 2NQ9A 1X7IA 4HN4A 1DWIM 2G5WA 4KGJA 3W1PA 3HPSA 3RO6A 2YGYA 5AECA 4DWSB 4NZ5A 4TX9A 2DGAA 4GY7A 3GTIA 4Q7IA 1EOKA 1AMKA 3WNOA 1EHAA 4FLQA 1VPQA 2NXIA 3LN3A 2PI6A 3WH5A 2DSVA 2OFJA 2BBFA 1TQXA 2FDMA 2V3FA 5K7JA 1MFVA 3N3TA 1OG6A 2QAPA 1ALDA 2YBUA 2WKJA 3C6CA 1RH9A 3IAPA 4O17A 3DYOA 2C0AA 3GR8A 3CWOX 3LGDA 2VR5A 3VD9A 5I5RA 1NDVA 4QR6A 3WMLA 2GGJA 1QW7A 3ENLA 4M6PA 3BG5A 1A53A 3GG7A 3NGJA 2BGNE 2V8ZA 3LCIA 3OZPA 3H4XA 4PMZA 1PWMA 1XLEA 2DH3A 3QLLA 1JDDA 1QI4A 3GS6A 3ME3A 3LCLA 3LG3A 2WAGA 4N2YA 4LB3A 2DZXA 3NDOA 1WE5A 1UH2A 4W7VA 2Z25A 5T9CE 2BNJA 1E0WA 3NQ8A 2J25A 3U8GA 3IARA 5TQLA 3GR7A 3KBSA 3LX9A 4QLJA 1GWJA 1KFCA 2ISDA 5CAKA 3SUVA 2OQYA 5LHEA 1C7TA 4AG0A 2XWDA 1XGZA 3URBA 3KL0A 2NUXA 2CLPA 3GNDA 1EGVA 3MANA 3RCMA 3AHYA 1K3UA 5KZEA 3W7JA 4Q4SA 2ISSA 5E9AA 1LBMA 1GOKA 3GIPA 3AXIA 1H09A 3ISIX 1QUMA 4EACA 5BYWA 2VEPA 1R7OA 1XISA 1UW9A 3T0CA 1N8FA 2PA6A 4NXKA 3W27A 5I02A 4ZMGA 1MZRA 1DIOA 1PSCA 1XPYA 1XYFA 4H8NA 5FJIA 1Y5WA 3UW6A 2WWCA 3K8KA 4W7WA 2QJHA 4QAWA 4ZO7A 3CL8A 4LCRA 1PJ9A 5I6SA 2FZNA 2NWRA 2A3LA 3FYYA 2IMRA 4O8RA 4CN1A 1NELA 4PULA 3THAA 2F61A 2EF9A 1V6XA 3W7QA 1L6FA 1UUQA 2PODA 4B3KA 1T96A 1KFBA 2ZZ6A 4QNWA 2VR2A 1BVZA 4BWLC 1CXFA 1X8FA 1GVRA 4QE5A 1RCXB 1QT1A 4XKYA 4B15A 4FP1A 2V30A 4GNVA 4A3UA 5F2GA 4L1WA 3WY1A 4ML9A 1VPXA 1VLIA 2P88A 3P61A 3JR2A 3PF3A 4MNMA 5D9MA 2C15A 1DE6A 4V33A 1XYZA 1YYAA 1W1ZA 3GD6A 4XD3A 2DJLA 3FEQA 3GR4A 3O0KA 3LRKA 3WQEA 4GQRA 3KM8A 1TTQA 5HBFA 4MB1A 1VYSX 4D6GA 3ITTA 2IPWA 1X8CA 1D8WA 2EPHA 4LBSA 3OHMB 3F4WA 3PAOA 4JTJA 4NAFB 5A2CA 1IYXA 4OTKA 3N15A 1DWFM 3THQA 2J9ZA 4JTGA 3F4CA 1J18A 3NO5A 3L4UA 2A7RA 4JX6A 1A4LA 4DWSA 2XIBA 3WK1A 3SGGA 3RK8A 3RMJA 4YVPA 3VGDA 4CD8A 1BLIA 5HOSA 4FNPA 4UTTC 3KL5A 4JEQA 3JU2A 3RJYA 4YTQA 1NQKA 1RR2A 5I3KA 2WZTA 4LAZA 4IIBA 3LHUA 1ADDA 5DFAA 2J9XA 4JIQA 1JGMA 4M7SA