3FJ6A

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fj6A00
2VFHA 1QOPA 3BW2A 1SO6A 3KOFA 3SR7A 1SPQA 4MFEA 4U4MA 1H7WA 3NA8A 3QZEA 5HUOA 3TSDA 3HG3A 1ICPA 3W83A 1C8VA 5D2VA 2C1HA 1RD5A 2Y7GA 3KVJA 1KA9F 2A85A 2F84A 3PVFA 4JYFA 2QCDA 3DZ1A 4IPJA 1VRDA 4L4LA 3M44A 1EP3A 5F4SA 4OQVA 2OX1A 3ZR4A 3QSTA 2TPSA 4O1DA 3VE9A 1ZAJA 2Q3OA 5AHIA 4CNPA 3HG5A 4C1KA 1QR7A 1TRIA 1P4CA 3TDFA 2CFFA 2HMCA 5A5WA 4N4PA 5LSMA 3HF3A 2FTPA 5CSSA 1UASA 4UMCA 4XWUA 4BI7A 3IVSA 1QPQA 2O7QA 2Q8ZA 1Q45A 4QAIA 3MWAA 1SO4A 3KHJA 1R2RA 4KWWA 1KLYA 3PM6A 2W0UA 1OG0A 3LB0A 1GQNA 3W73A 5EMUA 1ML1A 4QM1A 3DAQA 5F1VA 1P0KA 3TH6A 2R94A 3NPUA 2X16A 3E49A 3E96A 1JCMP 3NQGA 4N4QA 3N9SA 1D3GA 2B4GA 3TUUA 3O16A 3LOTA 4JTEA 1A5CA 1AG1O 1QO5A 3E0IA 4DF1A 1DJQA 1EEPA 3LXCA 2E09A 4IMDA 3LI0A 3N14A 3DH7A 2E5CA 1AW2A 4I7WA 2FPTA 1Q3NA 4IMFA 3CIXA 2DZWA 2B0MA 2AQWA 2GQ9A 3G22A 5F4WA 4GXMA 4JIQA 2VFFA 3G18A 5EBUA 3O15A 3W1UA 2I1OA 5BOOA 2FB3A 3W7HA 4PEKA 3NL6A 1ZY9A 1FCUA 4CQAA 3NPXA 4CCCA 4LVFA 2KZHA 2F7FA 3ABOA 3DFQA 2J88A 5BW6A 1LRNA 3G3DA 1H1ZA 4JTKA 5TBOA 4WXYA 3STCA 1OK4A 1Y0EA 1Z48A 4DQWA 4Y90A 2VENA 3F4NA 3A5FA 1OFAA 3G1VA 3TC6A 3PF3A 2OT0A 1K8XA 3I6RA 5HWMA 2JK2A 4DF2A 3TMLA 4XTIA 4FIRA 2FPVA 1FXQA 1W5MA 4LOCA 4WD0A 1KTBA 4M6QA 1XUUA 3W1XA 4O4VA 2CWNA 4K7VA 3W2JA 1LOQA 3HBLA 3T44A 3PC0A 4HSNA 2NUYA 3C2VA 3I68A 5G2IA 3TX9A 2J27A 3Q2DA 2CZEA 3IVTA 3PSVA 5DBUA 3TK7A 5LGXA 4LS2A 2P10A 3W1TA 4A2RA 1GYLA 5KSWA 4CNNA 5K4XA 1IXNA 5K2ZA 4WZHA 5K9DA 5CPMA 3MP4A 4AXKA 2QCNA 2ZZ3A 4ORIA 2GJNA 3NO5A 4CNOA 1TTIA 4UTIA 3IGUA 3C2OA 3I7RA 4GUHA 2C18A 1DV7A 4M6VA 1FY6A 3RLUA 3TFCA 5LHFA 2Y7DA 5EL1A 3LLDA 5A8GA 4UTHA 1AMKA 4P61A 4QJ1A 1KFJA 3TNOA 3ABRA 5LNVA 3UD6A 4JN6A 3RMJA 1OX6A 3GNDA 4FF7A 2DJXA 1F74A 3C2FA 5KZMA 4JX6A 4JGDA 4TX9A 4HSOA 1W5QA 2ZA1A 3UZJA 1HL2A 3FS2A 3NR0A 4CCEA 3EXSA 3GX9A 3VKJA 3EKLA 3W2LA 3M1ZA 3LCWA 3S42A 3ABSA 4UTLA 4RZ6A 1C29A 1DQWA 2JKPA 2CLEA 5DXYA 4N6FA 1I2OA 5D32A 3UWQA 1XM3A 1FBAA 2H90A 2CW6A 1QAPA 3PG9A 5K9CA 4WXZA 5FF2A 4I9AA 5DCEA 2GPTA 3S5OA 5J5RA 4O17A 1ICSA 3HGRA 4FO4A 2WNNA 5TQLA 1OYBA 2DZXA 3PR2A 3G3MA 3QQ0A 1I4NA 3LRKA 1GYNA 1SZGA 3UWYA 3M41A 1OX4A 5FEZA 1EWEA 2PC4A 3GLCA 1GZGA 4Z1AA 1NEYA 2HTMA 3R2GA 3B05A 3AO0A 3UYCA 1H7OA 2QUTA 4ONVA 4JR5A 3KFTA 1KM5A 2BTMA 1XC4A 1Q6LA 1R2SA 3K30A 3LCLA 5L6UA 4YLWA 4TMBA 3M6YA 1K7FA 5D02A 3H53A 1JUKA 1FCVA 1QPNA 4NX5A 1GPWA 4IXHA 1WQ5A 1FQ0A 1T0OA 1WDWA 5CZ0A 4M5PA 2Z0IA 2FLIA 2QCFA 3W23A 4KFPA 1SR9A 3HQ1A 3QYQA 4K6AA 2BX7A 3N2XA 2BXVA 2A21A 4JTFA 2UV8G 4NZFA 1FWSA 5E1QA 1VGAA 1ICQA 2X1TA 2A1YA 4RKAA 1KV8A 3W1PA 1GVOA 3IEBA 4TU1A 1BKSA 2B7OA 1G7VA 2G96A 3OBKA 1AL7A 1GVQA 4AAJA 1CW2A 3IV3A 2CLFA 3FJ6A 2C14A 4G1KA 1W1ZA 2QCCA 2DZSA 3NGJA 3STGA 2EAWA 4H3DA 2JBMA 3R13A 2RDUA 4ZQPA 4GRSA 3USBA 4O57A 3W85A 3UY7A 4AEOA 4IUOA 1A5AA 4X9SA 2VELA 1S5VA 4HKPA 2V2HA 1J5TA 3VE7A 1THFD 3AJXA 4FXRA 1R2TA 4JTGA 1OHLA 1H1YA 4UNLA 1VR6A 1KV5A 4KFNA 3G1XA 3WJSA 3W07A 2V0TA 3L68A 4YWIA 4MVAA 1TPH1 3SGZA 4EF9A 1I2RA 2QUUA 3W84A 2QDGA 2TYSA 2LLEA 3G1DA 5HUPA 4QITA 3LBMA 3NQAA 4N9CA 3P62A 1WXJA 1FWTA 1TIMA 4O14A 2QR6A 4EVZA 1EP2A 1F2JA 4O11A 5D2YA 5AC6A 2H6RA 4YCPA 4GNJA 4NXKA 3OEXA 5DCDA 2FIQA 5G1TA 4NX0A 4HNNA 4O1CA 3CWNA 1PHWA 4RLIA 3UWUA 4S1FA 1IIGA 2RDWA 5AYXA 3NQMA 5CGQA 3DGRA 3C2RA 1W0MA 3GAKA 2JKAA 3QPZA 3G1AA 3OVQA 1K7XA 1B4KA 5F2LA 3QPYA 2V82A 3G1YA 5AB3A 1JQXA 2ZA2A 3W7IA 1GJPA 3TQVA 5FF7A 3KRUA 4OV4A 5HNRA 3VFLA 4AHOA 4XKYA 3S8HA 1DKWA 2W79A 4UCGA 1VCVA 1K02A 1M7OA 3GXNA 2TSYA 3A9IA 3HJZA 5HMSA 1O5XA 1PV8A 3W7NA 1P1XA 3C2EA 3S5ZA 2ZRZA 3ZFHA 1QPRA 4GJ1A 3W2MA 4IMCA 4FNSA 1SUXA 3G1SA 3PUOA 3V75A 4FB7A 2Y89A 1CI1A 3EXTA 2YSWA 4NJKA 4UIOA 2Y70A 4O12A 1ZENA 1O5KA 2H8XA 1LTDA 4AF0B 2RKXA 3E12A 3CLMA 3C3NA 3BW3A 5AHEA 4EIVA 4YMZA 1LYXA 2WNQA 4M7SA 4UTTC 2DORA 1TPVA 1H51A 1ZAHA 2CU0A 3LERA 3IIOA 4WOZA 4WY0A 2X2GA 4NJJA 2FFCA 5AN7A 1OF8A 3NQ7A 2QJGA 1EWDA 2NXHA 2WSYA 4PCFA 3SW6A 3UQNA 3T40A 4UFKA 5CKSA 3DFSA 4PTNA 5I3KA 1PCKA 3FJLA 3TCEA 4EF8A 4O1BA 4NJGA 1TJRA 3WJXA 4FNUA 4E0CA 4FHAA 1XBYA 3OIXA 3L5LA 3M0ZA 1LOSA 4UFLA 5C55A 3DHFA 3PBVA 2YFOA 4UR7A 1EB3A 3HOJA 5DELA 1H5YA 4ICNA 3O6CA 5K3VA 3P82A 1N8FA 2ZTJA 2OMAA 4EWND 1OVDA 2RFGA 3G0UA 3S5YA 1KBJA 3BW4A 3QQ1A 1J4EA 3KVMA 3NM1A 1LZOA 3P60A 3GR8A 1OFPA 1FCBA 4K37A 1FDJA 1TMHA 5LGZA 2ZRWA 1NF7A 2XN2A 3TKFA 3IIVA 5FF4A 3LHTA 2ZYFA 3I65A 2IQTA 3PBUA 3TMQA 2QCMA 1XKYA 3TSBA 3LXBA 4XBKA 1I2QA 1KFLA 3T7VA 3ELFA 1WYIA 1FUYA 1L6YA 1QFEA 2V30A 3QC3A 1G69A 1JR1A 1TPUA 1FDYA 1TPDA 3S9YA 1KW1A 2WPBA 3PUDA 5TIMA 1GWJA 4MLJA 1FDZA 3BG9A 1YLVA 8TIMA 3A23A 1A5SA 1SU5A 3W2KA 1VZWA 4DO5A 1DOSA 1H62A 4UTMA 4FX7A 3LHVA 4GUIA 3WJZA 2ZZ6A 4MPQA 3RFAA 2ABAA 1GOXA 5G2WA 2DZUA 3W1MA 1QCWA 3RLVA 1G4SA 1YXCA 2QUVA 1LORA 1SO3A 2VEPA 4MFDA 4NJIA 1H7NA 3L5AA 3FOKA 1S5WA 1XBXA 1ZNNA 5FEXA 2WO5A 4LVDA 4IX2A 3CPRA 2OZ0A 3WFAA 4NZJA 3LCHA 3W7CA 3W7MA 2C3ZA 2PRMA 3EWYA 2VFGA 2RHGA 1KM3A 3NVTA 2V81A 3GZ3A 1VLIA 3NNTA 2C0AA 2YXGA 1QO2A 3N3MA 4JYEA 1TV8A 4LS0A 2BZNA 1OFEA 3W70A 4YL2A 3TJXA 1JRCA 3P7YA 3S6DA 3OVRA 4S2BA 1VH7A 1FWWA 3R5EA 3U6WA 5E93A 4QNEA 1JCLA 3NQ8A 5SWUA 5HQEA 4X22A 4Y8FA 4RCXA 4K38A 4LV9A 3STEA 1K3UA 4HIBA 4D2JA 4AWTA 2QEZA 5D2XA 1YPFA 1DJNA 1PS9A 2VFDA 4NU7A 4UTKA 3ZS4A 2DZPA 2VKZG 4LUIA 3CWOX 5F2GA 2FPYA 1VCFA 2WNZA 4TMCA 3FFSA 4POCA 3C56A 1M7PA 1U5JA 2NLIA 5J5DA 5K4ZA 3W7JA 3WK3A 2Y7EA 5KMYA 2WV8A 2Z1BA 1VLWA 4BWLC 3EX3A 4JS3A 3OA3A 3PG8A 1DORA 3OVPA 1Z41A 3GKFA 3LHYA 3B4UA 3JS3A 2E6YA 3N19B 3LXAA 3SGUA 3EXRA 4CLMA 3T78A 1AW5A 1N7KA 3WK0A 1YADA 1BWKA 1SQ7A 4PA8A 2E68A 1TPEA 4PODA 2CZ5A 4LVAA 5AC8A 3GAYA 4QQ3A 4IQLA 4X2RA 5F1UA 2Z6JA 1LOLA 4GWEA 3M5VA 1K8ZA 3THAA 2P1FA 1ZAIA 2PRLA 1P0NA 1OFDA 1F5ZA 3U8GA 4HPJA 1W3NA 4H4IA 1TV7A 3TSMA 2WSRA 4NNBA 4NUWA 2OJPA 4LY8A 1O95A 3W7GA 1OF6A 1OYAA 1YTDA 2X30A 2R14A 4UR8A 2QDHA 1VC4A 4ZQRA 3W2UA 3TAKA 4XBSA 3BK0A 4MZ1A 5KZDA 4IOTA 5IBXC 1F73A 2E6AA 1HUVA 5AYZA 4MKNA 3W1RA 4MYAA 1FXPA 1RR2A 2Q3RA 2QCDB 3CQ0A 4Y96A 3QH2A 2WJZA 5FI8A 3UNDA 2ISWA 2GOUA 3S1UA 4BI5A 2TRSA 4NNCA 4PH6A 1XXXA 1X6UA 2GVGA 3HIJA 2VOMA 2HS8A 2ZZ1A 3TJLA 3H55A 5HJLA 2V5LA 5AYYA 3HPSA 1SFJA 4FIQA 3RU6A 3SI9A 4LUJA 1MXSA 1SZEA 2CLMA 3OG3A 4AHPA 3NQ2A 2NXIA 3BLEA 3ATYA 5CSRA 1H7PA 1SSGA 2HSAA 3LHWA 3R8RA 3MJYA 3N9RA 3MP5A 3MHFA 4DBDA 1UB3A 1J2WA 3G8RA 2A5HA 1O60A 4KFOA 2NV1A 3FYOA 3NM3A 1JUEA 5G5IA 5DN1A 3EX1A 3B04A 3W1NA 4UTJA 6TIMA 4ZQOA 4UFIA 4H6KA 2QJHA 5DY3A 4QIUA 3EWUA 3TE9A 4A3UA 4GUFA 4NXSA 1OYCA 4UXDA 3GDMA 4E2BA 4MY8A 1KBIA 4O1AA 3MYOA 2ZA3A 4O19A 5DXXA 2GQ8A 1WBHA 4JDBA 4ADUA 3IGSA 1MEHA 2CZDA 5D04C 1ZJIA 3CEUA 3GXPA 3HB9A 4DELA 3TW6A 3HG2A 1EA0A 5KTLA 3NPWA 3ABQA 3WK2A 1FWNA 2VFIA 3YPIA 3O07A 3KAOA 3U2OA 3IVUA 2YCEA 5D05A 1Q6RA 1YXYA 4XQ6A 3QMRA 2ZZ7A 3M5ZA 1DBTA 1K8YA 5DLCA 1SFLA 2G95A 5HULA 5F4XA 1A5BA 3W74A 1L6WA 2DU2A 3W1AA 1R47A 2QCEA 3LCIA 3P84A 2W6RA 4WOQA 1YDVA 2Z6IA 1YPIA 2CZFA 3B03A 1QDSA 3GDRA 3BLIA 4BFAA 4JTTA 4AWSA 1I45A 3GKAA 1EPXA 3GB6A 1XUZA 1GG1A 3DFOA 1VQTA 3QSRA 3UXDA 1XDLA 3ZWTA 4AMAA 3L9CA 2B7QA 1BEUA 3UWZA 3CC1A 3GIYA 1RPXA 2J24A 5I3JA 1NFBA 2JGQA 3QMTA 3R89A 5T26A 1H63A 1GTEA 2WKJA 1G4TA 3C61A 2NV2A 1EP1A 3D0CA 2EF9A 4HN4A 3NQEA 2A7RA 2B7PA 2PE4A 1OFRA 2NX9A 2X1SA 3PBYA 3FLUA 1WAUA 3B0PA 3B0UX 1B57A 2VEIA 1QMLA 4A22A 4A29A 3PB2A 1PE1A 2QKFA 3M7WA 5HR6A 1TQJA 1X8FA 3L67A 1ZHAA 2GQAA 2CLKA 2QCGA 4BI6A 3W1LA 3L0NA 5CZSA 3THQA 4Q4KA 5AHLA 1O4UA 3PSWA 5HWNA 3EEGA 5LKYA 3GDLA 5EPDA 5FEPA 3NAVA 4HT3A 1JJKA 3C4UA 2R8WA 3PWAA 4JY8A 3LDVA 3LX9A 3M5YA 3CHVA 5D09A 2V5BA 1SO5A 1HTIA 2Z2UA 4UNKA 5HINA 4FX6M 3PBWA 1DHPA 3MBDA 2VEKA 2G97A 3EWZA 1LDCA 4Q32A 5C6MA 3CTLA 1L6SA 3GXTA 4IPIA 4IJBA 1Z44A 3TQ0A 3PY2A 2J9XA 3MMTA 5I3FA 4GE8A 3VNDA 1MO0A 3GDKA 2HS6A 3LBCA 1PCWA 3QM3A 1RV8A 1FWRA 3DI0A 4MIMA 1FCQA 1X7FA 1FX6A 2ZRXA 1SW7A 1Q6OA 3M16A 5BMWA 1A53A 1I2PA 1V7YA 3CU2A 3QJAA 5EY5A 3W2NA 3FA5A 3M43A 3WJWA 1EX5A 2QAPA 1X1ZA 3NQ6A 1PHQA 3GVGA 3P8IA 3IGXA 3LCXA 1T99A 2E77A 2YW4A 2XN0A 4JX4A 1XCFA 1BWLA 3P81A 3P80A 2V9DA 3DHDA 4ZZ9A 1NF0A 1WOBA 5LZLA 2PURA 1UJPA 1CX9A 4IMGA 3L2IA 1OX5A 5CPNA 4L4MA 4JTIA 5HR7A 3TIMA 1DQXA 3Q94A 1B4EA 1V5XA 3P67A 3KVKA 4FNPA 4N9EA 4W9TA 4I7VA 4Z1DA 5AOUA 3SECA 4I7UA 1F7BA 3MYPA 1ZFJA 2CLOA 3I7SA 4R53A 3ANYA 4RV8A 3INPA 2C16A 4UTTA 4QISA 1D3HA 3EKZA 4O4WA 3HPXA 1TQXA 4AH7A 5D33A 3DFTA 3G0SA 4R33A 3W7PA 3UPWA 2J9YA 1ME8A 4UTWC 1C9DA 4R34A 2GVLA 4OU1A 1VYSX 4Z0SA 1EUNA 4O16A 1TV5A 3W1QA 5G1YA 3UZ5A 1OFQA 4DXVA 1RQEA 4HNVA 2VXNA 3MP3A 4O50A 4S2CA 4UUIA 3CEPA 3UWVA 1JCNA 3LI1A 5H2ZA 1VHNA 2I9EA 3EX2A 4UFHA 3HGSA 1W37A 2VFEA 3NL3A 4TIMA 2OT1A 3MW7A 1W3IA 5L9FA 3QEZA 3O05A 1TTJA 1F6PA 4C1LA 3GDTA 4ADSA 3NL5A 2YDAA 4OV9A 3B0VC 5EYWA 1LBLA 4WY0F 1T8XA 5EA9A 3SY5A 4O52A 1D9EA 3W6YA 3EWBX 3ATZA 1VHCA 2ISSA 4P2VA 3C6CA 2AAMA 4PL2A 1QOQA 1NSJA 4WX2A 3CT7A 5CG7A 4AWUA 1LRTA 4JTSA 4JTJA 1Q6QA 3GYEA 4LS1A 4WJEA 1KFBA 2JKEA 1O94A 3DU0A 4UTUA 3TR2A 5BMXA 3KRZA 3NQDA 6ALDA 1G67A 3TA6A 2VEMA 2V8ZA 2A7NA 1AL8A 1TYGA 4PC8A 1KM6A 5LNRA 1ZCOA 1I2NA 3O1NA 4DO6A 3L21A 1JVNA 3PULA 2OCZA 3FKKA 5D2WA 1UBSA 4KWVA 3W7QA 3NZRA 3EX6A 2ZZ5A 4RR4A 4LC8A 4N2YA 3BARA 4XKYB 5LHEA 3S1VA 1VPXA 3CM4A 2YPIA 5CPLA 5C5YA 5C2XA 1LCOA 3A22A 2AGKA 1WBJA 2QAFA 3F4WA 3MI2A 3N2MA 4K39A 3GR7A 4JX5A 4FNTA 1JQVA 3IIXA 5FF3A 2CLHA 3G8EA 3LRLA 5EKYA 2EHHA 3LRMA 1T96A 3W72A 3RF9A 3T55A 4LC6A 4BR1A 4ZL1A 3NPVA 3LHUA 3I7QA 2CLLA 3O6DA 3DFPA 3L66A 1TPC1 2XFWA 3DKJA 2QCLA 4JDYA 4FNQA 3LTYA 5KINA 1W5OA 2NUXA 5AHNA 4XZ9A 1B3OA 1E51A 2V2CA 3BVJA 5F2MA 3NDOA 3BLFA 3FEMA 1H7RA 4U28A 5FF0A 4LT9A 4Z08A 4WY0B 1K03A 3MHGA 2GJLA 3PS7A 3W22A 4IMEA 4RJEA 2A7PA 3UPBA 3A5VA 3W75A 2FQIA 3JRKA 3NL2A 5CZTA 3TAOA 3FIGA 2NXGA 4OE7A 2PCQA 3LGEA 1TB3A 3LTSA 3W7OA 2H3DA 3G0XA 1B9BA 2CLIA 3QF0A 1TO3A 4GFSA 2Y61A 3O8AA 4BWLA 4MJZA 1LROA 1YYAA 2P0OA 3TFXA 1PL9A 4JXCA 2ZRUA 2ABBA 1M5WA 3NXFA 5LNWA 2WQPA 2ZZ2A 3WK1A 2E5BA 3NEVA 4OHQA 4O53A 3O06A 2X1UA 1NAL1 1AK5A 4LRTA 4YCOA 2E1DA 2YX0A 2A4AA 2YYTA 3TXVA 1MSSA 1JUBA 4DPQA 2A6NA 4HPXA 3HGJA 4K8EA 3G1FA 1EUAA 3KRSA 2D73A 3TU9A 3E9AA 3L5MA 4JY9A 2A2IA 2JGYA 3O63A 3F1QA 3QW4B 3BGGA 3DXIA 1PVNA 3B8DA 3QFEA 4CCDA 4NQ1A 4GC4A 4JICA 2ZZ4A 1M6JA 1WX0A 2ZCGA 5D03A 4MOZA 4CQ9A 1HO1A 2RDTA 3LTPA 1RVGA 3EWWA 3NG3A 3TROA 4LVGA 4E2DA 4MLRA 3V1PA 3C52A 1NVMA 1IIHA 1G4EA 4JTLA 1KTNA 2QF7A 2O7SA 1KM0A 2E6DA 1G7UA 2X1RA 1GEQA 1S5TA 1OABA 5IBXA 1UCWA 3M9YA 2TMDA 5D2TA 1VS1A 5DY2A 2FDSA 2YR1A 2Y88A 2DZVA 2ATMA 3F03K 5G4WA 4MZYA 4O54A 2ZDRA 3SSJA 4O28A 4BK9A 4IWWA 3N34A 4O15A 1GG0A 3W7KA 5I3GA 4M6PA 1LBFA 1VJIA 1MEIA 3TQKA 4R7JA 4MZ8A 7TIMA 4GUGA 2EPHA 2NX3A 4MUZA 1JULA 4MY1A 1XFBA 2C13A 4FEZA 3LLFA 3T4CA 5LNUA 1ZALA 1DL3A 4ORMA 5CZJA 2ALDA 4PL1A 2ATSA 2B7NA 3W7DA 3LCFA 4HNTA 3Q58A 4KKXA 5BRBA 4A21A 1ME9A 3P61A 1GVRA 2Y63A 4Y9AA 3B06A 2C15A 3L0KA 5I3IA 4RX0A 3HGOA 2DP3A 4RZ4A 4ZQCA 1XL9A 5U4NA 4LU0A 1R46A 3TC7A 4AVFA 5F2IA 2WSQA 3DENA 2NWRA 5DBTA 5AC7A 2EKCA 1IGSA 3NQVA 3VCRA 4UMBA 4ZQMA 3NQCA 4Q33A 1LM1A 4NVTA 3FKRA 1WA3A 4UC5A 1JCXA 1K7EA 1TSIA 3NQFA 3MI3A 4UFMA 2V2DA 3EX4A 2Y7FA 1TCDA 3W7LA 4E38A 1SW0A 4K8HA 1ME7A 1ADOA 4Z1CA 3PUEA 4LWWA 4LVBA 4FNRA 3LCGA 1W56A 2Y85A 1VYRA 4UFJA 3W88A 3P8JA 1TRDA 4O8RA 2YFNA 4ADTA 3HO8A 3BO9A 1U83A 1W3TA 1MEWA 3BG5A 4FXSA 2YGYA 1JCJA 1QNVA 3E02A 1JCYA 1G6CA 3QW3A 3IIPA 3PB0A 1KTCA 5K7JA 4JEQA 1KFCA 4AF0A 4DEFA 2FJKA 2EGZA 4YXGA 1L9WA 1TPB1 4JTHA 4LW7A 4K36A 5ABTA 1P5BA 2ISVA 1TTQA 2BWGA 5IM51 4TO8A 2C6QA 2NWSA 1UUMA 3MUXA 3W76A 1N55A 2XN1A 4BF9A 1L2UA 5U7SA 3WJYA 3BPWA 3MO7A 2I14A 1GVSA 4MYXA 3LV5A 3Q37A 3L65A 1R30A 4J9JA 4RXGA 1KM2A 1UUOA 4HNUA 2Y6ZA 4OGZA 4NJHA 3BGJA 4RXFA 5I3HA 3TW7A 1KFKA 4N02A 2E5DA 3QMSA 3HMJG 1TPWA 3QRHA 3HG4A 2RH9A 3W87A 4NT0A 5MHBA 4X3ZA 1F6KA 3P5YA 4MY9A 5D37A 3C0JA 3UWWA 3L0GA 1XBVA 1W5NA 2ZBTA 3S1XA 2ZRVA 2E6FA 1KFEA 3EB2A 4ML9A 4K7YA 3NYZA 4UMAA 3N73A 1RQHA 4GBUA 4QSHA 1SZFA 4ALDA 1EIXA 2DZTA 2PRHA 4DBEA 2H8ZA 1S3HA 5CPOA 3STFA 3BG3A 4MJMA 1HG3A 3VI2A 2J6XA 4OWGA 3DKLA 4JD4A 1VYPX 3P74A 3W3OA 2BLEA 4ZQNA 4AHQA 1W54A 1H50A 3G24A 4O13A 1IXOA 3NZ1A 1ONRA 3O6YX 3LHZA 1H7XA 5HWJA 4GUJA 4WQ6A 2NUWA 5KZEA 2YYUA 3DBPA 3KVLA 2VC6A 3A24A 4FX8A 5BNKA 2NZLA 1YDNA 3GNNA 3IRDA 3W86A 1IXQA 1AW1A 1SSDA 3H54A 1LP6A 4O18A 3GK0A 1YDOA 4XUGA 4OBTA 1H61A 1SZNA 1ALDA 3EWXA 1TPFA 4LRSA 4N6EA 1PIIA 3OHIA 4JYDA 4O10A 3G1HA 1YTEA 1OFOA 1G4PA 3M47A 1WV2A 1SW3A 4Z0JA 4O0KA 3PAJA 2ZRYA 4HHPA 3TV8A 1VCGA 3IIZA 3SFKA 3C8FA 1XDMA 1OX4B 5D38A 3DFNA 2QCHA 1KLZA 1OK6A 4ZVJA 3W71A 4A2SA 4JNMA 5AFDA 4B5NA 5FESA 1LLWA 3UY8A 1LLZA 4JIPA 3MHUA 2Q8LA 1KM1A 3A21A 4M7TA 4JTUA 1W5PA 2G5WA 4Z1BA 3TXZA 1IXPA 4LTSA 4CQ8A 4DF0A 1IF2A 3KXQA 2WOQA 3MBFA 2A6LA 2Y62A 5H91A 2DJLA 1TTPA 1XI3A 3JR2A 3RK8A 1QPOA 1WOAA 5AHMA 1GTHA 4N9BA 3KX6A 3UXAA 5FEWA 2NX1A 4N9DA 4OT7A 3R12A 3W7RA 1Z42A 1LBMA 1X1OA 1A50A 4IGHA 1HO4A 5D30A 1F76A 5LNSA 1HFBA 3SZ8A 4PFMA 4UTWA 3FYPA 1OJXA 2ZFAA 3RNDA 1TJPA 1F05A 2ZQ0A 5E0KA 3CB8A 2YZRA 2R91A 5G4EA 4EOUA 3MI6A 1H60A 1OFBA 4WUIA 1GT8A 2YW3A 1W31A 3BV4A 2GUUA 5DCBA 4LV4A 4QNWA 3LV6A 1RQBA 2QJIA 5KITA 1I8JA 3S0CA 1MZHA 5K9XA 4XTDA 3SJ3A 5C54A 3LM7A 1KM4A 4TR9A 2ZTKA 4Y6GA 1QWGA 4O0ZA 3SIZA 3CIWA 3DI1A 4DO4A 4RK8A 2BSLA 1TREA 1W8SA 1GVFA 2C19A 2GVJA 3M5XA 3P5ZA 5AHFA 4AB4A 1XBZA 1YXDA 3W7EA 3ZWSA 3S1WA 4ZMGA 2A0NA 1RZMA 5G2HA 1LRQA 4IXXA 2H3BA 3W9ZA 1DVJA 5GVJA 1JRBA 4M19A 2FB2A 2J9ZA 3HPZA 4LNYA 3S5NA 4DPPA 4RZ5A 4NNAA 1BTMA 3NOEA 1YTKA 4IX0A
chains in the Genus database with same CATH superfamily
2VFHA 2Z2BA 3WH9A 3BW2A 4S38A 1SO6A 3APYA 1SPQA 3IAPA 4WIWA 3QZEA 3VX1A 1T41A 1NFGA 1TZ9A 1D3CA 5I07A 3GUWA 5D2VA 1HQTA 2C1HA 4PTWA 2BVYA 3E2SA 3L4VA 4JYFA 3DZ1A 6REQB 3M44A 1BTCA 3B40A 1TR1A 1CYGA 2OX1A 2TPSA 1ZAJA 3Q67A 4OVXA 2Q3OA 4KEZA 4D8LA 1QOXA 1QR7A 1KKRA 1TRIA 2DSWA 2W4XA 4M1BA 2Y5EA 5AC4A 2FTPA 4YYFA 1UASA 4NRSA 1ZBCA 2IS7A 4XWUA 4AZCA 5GJNA 1YX1A 3ZVHB 1YEYA 4QAIA 3MWAA 1SO4A 2VWTA 1M7JA 1KGXA 1R2RA 1KLYA 1ADDA 2PWFA 3LB0A 3U9IA 4F0LA 4WLCA 1ML1A 5EMUA 3TH6A 4EACA 4D9PA 2WB5A 4PRRA 3NQGA 3VIJA 2B4GA 3NSXA 3KS5A 3LOTA 3AS0A 3NDYA 1F3TA 5A6JA 3E0IA 3GFXA 4E4UA 3WQCA 1WZMA 1DTNA 4N7QA 4IMDA 3LI0A 2BOGX 2E5CA 2DT3A 2FPTA 4IMFA 2F8QA 4JN8A 4AU0A 2X05A 3ZYZA 1GNXA 3DC0A 3W7HA 4CD8A 1B5TA 5A8MA 3MWCA 4G5DA 4CQAA 2QQ6A 2BS9A 2W62A 4QEHA 2YL5A 3GH7A 3N4EA 5TBOA 4WXYA 3WDHA 4PCTA 1A3WA 1VFMA 4AIOA 2I56A 4KWOA 4Q8WA 4REQA 3SCUA 1TELA 3T2PA 3PF3A 4JHOA 3I6RA 3SM0A 2C1IA 2JK2A 5D4YA 2BXZA 4Q22A 1IV8A 1V6XA 3R8GA 4GH3A 4LOCA 4PYSA 2WC3A 1XUUA 3M0XA 4PUKA 3IUIA 4JOMA 1A3HA 3C2VA 3I68A 3TX9A 4DJDD 5LA2A 4KBXA 1CLXA 2XWEA 3TK7A 5LGXA 5E9AA 4LAZA 3KBMA 4RPPA 5K2ZA 3HTWA 3MP4A 4P7NA 2QXWA 1XHGA 3V5FA 3T05A 2CPUA 1H1NA 5CAKA 3E5BA 3VIGA 1EC8A 4YNGA 2BY3A 3PNUA 1BVZA 4Q7NA 4PCNA 1KNWA 1ZBKA 3SCOA 3S4TA 4OBRA 2Y7DA 5D8WA 5DMYA 3WBAA 3BMXA 4DWDA 4JL2A 1Y5XA 3ABRA 5LNVA 4A05A 3RLHA 4US5A 2R24A 4JN6A 1NDZA 4DJEC 4HU4A 1W5QA 3UZJA 1F9CA 3LSCA 1GOOA 1XG4A 4BF7A 3W2LA 1CXIA 3OLIA 1C29A 2Z1WA 4AYGA 4H9VA 1PZ3A 2VQUA 3BMVA 2CW6A 4DYJA 1VBRA 5FF2A 2FH8A 2P53A 3WG6A 3WF3A 1MUCA 4JQAA 3ZR6A 2WNNA 1OYBA 1QTWA 3CS2A 2DZXA 2VZUA 4UQAA 1SZGA 3QR0A 1P0DA 3KS6A 2HTMA 4W7UA 3BLOA 3E0VA 4LBUA 1V3IA 2YB1A 1XC4A 1ZPTA 4A3YA 5L6UA 3GE7A 3M6YA 1K7FA 4XD6A 3H53A 1QPNA 4X61A 1IEIA 3SQMA 5CZ0A 2Z0IA 1SR9A 3QYQA 2BX7A 3WQEA 5T91A 2BXVA 2UV8G 1UC4A 3SQSA 3H21A 2Z24A 1VGAA 4D6EA 2A1YA 2DFAA 1MRAA 1GVOA 3CL6A 4MWAE 2V3GA 2B7OA 4AYSA 1CW2A 3SUUA 2BGSA 3SADA 2DZSA 1FKWA 2C79A 4A8LA 4H3DA 4F2TA 4QQUA 4ZQPA 4GRSA 3RCYA 1A5AA 2VELA 4KW2A 3I4KA 3V7PA 1J5TA 1C8QA 4F0HA 2BGNE 2KAUC 4IIBA 3WLTA 3ALFA 3IK2A 1XX1A 3L68A 1H11A 4YWIA 1V0MA 4MVAA 1GVYA 2YCKX 4XVEA 3N04A 1Y8BA 2TYSA 2NQ9A 2LLEA 8CGTA 4I6KA 3LBMA 3NQAA 5C0QA 2OO6A 3XINA 2PDPA 1K8CA 1WXJA 4ZO6A 1TIMA 1UZDA 4WK9A 1QT1A 4MWAC 5G1TA 2HVMA 1XYLA 1NOFA 1F07A 2RDWA 3E2RA 5AYXA 9XIAA 1W0MA 3QPZA 3G1AA 4S3DA 2NVAA 2J7EA 3QPYA 3G1YA 4ZA0A 1EQPA 5FF7A 2G37A 1FWBC 3D3AA 1E9YB 3AHVA 2V3FA 2VQTA 1VCVA 3CQHA 1NP0A 1M7OA 1JYNA 3GXNA 5JBFA 3G1RA 1EC7A 3HJZA 1CGWA 5HMSA 1PV8A 3W7NA 3TLLA 3WH7A 2GGGA 3IJDA 4DYEA 3WLRA 3G1SA 4FB7A 1SZRA 1J2BA 3U4FA 1KB3A 1ZENA 1B54A 1O5KA 3VK5A 1Q2RA 3W00A 3E12A 3UWEA 3CLMA 1PJ9A 3C3NA 4D6CA 3K8LA 3C86A 2X09A 3B3DA 3EMCA 2WNQA 1ITUA 3CQIA 2CU0A 1E1FA 4MB1A 5AN7A 3NEHA 1IEQA 1W1PA 4XG1A 2XIMA 1QW7A 2WSYA 5HJXA 1AQFA 2OLHA 2BASA 1KCZA 5I3KA 4NJGA 2GZXA 3SCSA 4HB7A 3OBEA 5H6HA 3WJXA 4FNUA 1XBYA 3L5LA 4UFLA 3N18A 3FN9A 4PMNA 1EB3A 3HOJA 5DELA 5K3VA 1N8FA 2ZTJA 2ZWZA 4F79A 2WZEA 2RFGA 4QTGA 2FZ8A 1NJJA 2DQXA 3BW4A 2WLZA 4DWSD 3GR8A 3QOMA 2PDCA 4PUMA 4WJ8A 1FDJA 1NOUA 4GY1A 2DH2A 5FF4A 3CUIA 4B5TA 1Q5MA 1XKYA 4RE0A 3T7VA 4CNUA 1QNPA 3VKKA 1WYIA 1S5MA 5A8PA 4Q4RA 1TPDA 1G0CA 5C9ZA 2WPBA 5BXSA 1I6NA 1FDZA 2PTWA 1YLVA 4JN7A 1SU5A 3W2KA 4DO5A 1U30A 1R85A 1E6XM 4GX8A 1IEXA 4FX7A 3TA9A 4CKQA 2HCVA 1RJPA 2X1IA 2YXXA 1OGSA 1VD6A 5M3WA 3WLQA 3RFAA 4HK5A 3EMQA 1UKSA 1G4SA 2BFGA 4XVDA 5CLWA 5E5CA 4LAUA 3L5AA 4H6RA 1ZNNA 4XD4A 3FHQA 5IRPA 2BG5A 3KP0A 1NOWA 3ICJA 3OPSA 4M82A 4LYRA 2OSYA 3B8VA 2RHGA 1KM3A 3NVTA 2QGHA 2WQDA 4J4KA 4XSMA 4PEEA 4Z2GA 3N3MA 4NP7A 4LS0A 2QLYA 3W70A 4YL2A 2Y8VA 3TJXA 2WZIA 1FWWA 3BLPX 1JCLA 1XLLA 2VP8A 5SWUA 5A6TC 4J3XA 3VOGA 5HQEA 4X22A 4EPDC 1UOZA 3STEA 1K3UA 1W6TA 4D2JA 1RAKA 1DJNA 2WJFA 4CD5A 4UTKA 5IDZA 2QMJA 5BRPA 5F2GA 4LEFA 4L4OA 1EZ2A 4TMCA 3VGGA 3ARRA 5E9XA 1U5JA 2POZA 2QUMA 4LEQA 1W1YA 1EKOA 3UBPC 3W7JA 5A6MA 2Y7EA 3CUHA 1VLWA 3H12A 2OZ3A 1A5LC 2QF8A 1DORA 1K70A 3B4UA 2VC5A 3JS3A 5E70A 2E6YA 4WVXA 3SGUA 3EXRA 2JALA 4M81A 4DBSA 1SQ7A 3DX5A 2J7GA 3BCJA 5AC8A 3TN3A 2CXEA 4QQ3A 4KWUA 2QJMA 2GWGA 1J11A 4V27A 5CBJA 3WFZA 2ZX9A 1K8ZA 2ZE3A 4W5ZA 3THAA 4PUNA 3WUGA 3RRAA 1P0NA 1F5ZA 3U8GA 1R7OA 4AZHA 5H1WA 1EBGA 3P0XA 2PB1A 1UA3A 2OJPA 1YBQB 3SURA 3P0WA 2R14A 2NQHA 3MQTA 1V6YA 3OZYA 4V2XA 3TAKA 3BK0A 4MZ1A 5KZDA 1FA2A 1MI3A 5GQBA 5AYZA 1HUVA 1EH9A 2DIKA 3W1RA 3DESA 5I00A 1E73M 2BP1A 2PDMA 1J18A 4GKTA 5FI8A 2GOUA 4BI5A 1OINA 3UVAA 4PH6A 4CQCA 1X6UA 1UYQA 2HJPA 3GNOA 1XG3A 3HPSA 1SFJA 3RU6A 2OGJA 1SZEA 4AHPA 4CU7A 5IXEA 3ATYA 2VX4A 4RV3A 3UF9A 2HSAA 1BSLA 4GVIA 3LHWA 2AQVA 2ZUTA 3MP5A 2XSXA 2Y4SA 1WB0A 1RLCL 5A8OA 1O60A 4KFOA 4ZE5A 1JUEA 3H7RA 2W27A 4B2DA 5H8PA 2ZUUA 4UFIA 4ZQOA 1QNOA 4DJFD 4QIUA 2CBJA 4GY0A 3EWUA 2PGFA 3TE9A 4NXSA 4XKMA 1X8CA 1OYCA 1E1EA 4AZGA 4H6QA 4UXDA 4E2BA 1BG9A 2QVHA 3MYOA 4BEQA 3HA1A 2ADAA 4JDBA 4ADUA 3IGSA 3W81A 2I17A 2BODX 4W8LA 4DELA 3IJLA 3LSBA 1UKTA 3BXWA 1IEVA 3S1GA 1JZ3A 2YXOA 4JAWA 3QOKA 4S3CA 1BXCA 3LBOA 3IVUA 1Q6RA 4CU6A 4XQ6A 3QMRA 4GGBA 1KD0A 1EBHA 1A5BA 2ZUWA 4B15A 3W1AA 1R47A 1XV8A 3ARWA 1OC6A 3UFYA 4JQ1A 5EMLA 5BOFA 4G2DA 1KBLA 1OADA 4Q4SA 5HNTA 1QDSA 4XIAA 2WKGA 3BLIA 1X7IA 3O9NA 4ZE4A 1TE1A 3EWCA 1W17A 3CO4A 4ML4A 5I24A 3GB6A 1EF3A 1VQTA 2J77A 3UXDA 1WDRA 1A4LA 5D9OA 1TJ1A 3CUJA 3L9CA 1FWGC 4MAVA 1GHRA 3GIYA 2J24A 2OEKA 5AYIA 4KEUA 5HMEA 3MA8A 4B9ZA 1GCYA 4GIAA 4PZVA 4HN4A 3NQEA 2A7RA 2B7PA 2GUYA 3CAKA 3CV6A 3FLUA 3B0UX 2ONEA 2VEIA 3WIJA 4CGTA 3CAVA 3T1GA 4A29A 3K1GA 5HR6A 1TQJA 1X8FA 1OG6A 2GQAA 4FXJA 3ZO9A 4BI6A 3W1LA 4JTRA 2DEPA 4Q4KA 1VEOA 3S83A 4GYFA 2V5CA 4HT3A 1JJKA 3V16A 2DSZA 2R8WA 3PWAA 5HJYA 3NCOA 2XFRA 3UG5A 2V5BA 4EX4A 1F3EA 2I5QA 5HMFA 1T7LA 1K9TA 2VEKA 2VX6A 3M64A 1FH8A 2O9RA 5C6MA 4IL0A 4ZTYA 1TFVA 4IJBA 3VO0A 2QT3A 4GQ0A 4M56A 1R0MA 5LA0A 2D2HA 3GDKA 1E4NA 4FS9A 1PCWA 3H4WA 3QM3A 4JBRA 3N2BA 1X7FA 3N6HA 3AXKA 1OIFA 2AMGA 3TVAA 1DJXA 1I2PA 1EJTC 3CU2A 3W2NA 1V3KA 3S46A 1E6PA 1Q65A 1T99A 2ZUNA 2XN0A 3CPUA 4JX4A 5BWAA 3ITCA 3P81A 2V9DA 4GXPA 1CX9A 5TD4A 3VM7A 3M46A 1OX5A 3H24A 4JTIA 5HMDA 4ZFMA 2VUYA 3SBFA 1DQXA 1B4EA 1GQJA 3KVKA 3P67A 4I7VA 1CCWB 3KWXA 2Y1HA 4KCUA 1KR0A 2VMFA 3VZXA 1F7BA 3MYPA 1ZFJA 3I7SA 1TIWA 2CETA 3MSGA 4LANA 1CECA 5LXXA 3B9OA 3CUGA 4LPCA 5CPTA 3T8QA 4O4WA 5M5DA 3HPXA 4H00A 4MM1A 1HJXA 1UH4A 1XRVA 2ZC1A 1SM9A 1MQPA 1IWBA 3W7PA 4LUTA 1A5OC 4XZBA 2GVYA 3HPAA 2J75A 2DZBA 2C7FA 5JH2A 4Z0SA 2O4QA 2QPXA 4LB3A 1RQEA 1ZUAX 2IKHA 4HNVA 4QLJA 2PP1A 3BMWA 4UUIA 4F48A 2OKOA 3LI1A 3E2VA 3AMGA 5I06A 2L5HA 1POJA 4PUUA 3NL3A 1U33A 1XSIA 2OT1A 3AHYA 2FTYA 1PBGA 3QEZA 1V7AA 1R3RA 5IDIA 2PP0A 4H8UA 3N6JA 3WLNA 1T8XA 4URIA 2AL1A 3N1AA 1N82A 2GJXB 3UG8A 1VHCA 3MCOA 1KXTA 4CU8A 1JGIA 1Q66A 1RBLA 3W38A 1B3YA 1NSJA 4WX2A 5CG7A 4JTSA 4LS1A 4H9UA 3TR2A 3IWPA 4ZB2A 3LPFA 2BY0A 3A9BA 5BMXA 3BICA 1CZ1A 1UR9A 3B0YA 3TA6A 2VEMA 3GTXA 4JCMA 4C6OA 3GVRA 1XLJA 3I3DA 3SCNA 1TYGA 3ZT5A 3VNIA 1RP8A 3PULA 1V6VA 2OCZA 3FKKA 3GG8A 4ECLA 3NZRA 3UNTA 5LHEA 1LQ0A 1XYFA 3S1VA 1VPXA 3TTQA 4JIIX 5C5YA 3WN6A 5C2XA 1LCOA 1EJRC 1RH9A 2AGKA 1WBJA 2QAFA 2WHLA 3GR7A 4JX5A 4H83A 3RMEA 3B8WA 4J2MA 3CMJA 3WQ5A 2CLPA 5EKYA 3LRMA 5HQMA 4K1WA 3W72A 3TW9A 4B4HA 3NPVA 3I7QA 1QJWA 2HEJA 3O6DA 1P6BA 2VL4A 3DFPA 1J9YA 3L66A 3M0MA 5EMJA 2XFWA 3LTYA 4K8GA 1W5OA 1G1YA 2UY3A 4GQBA 3NDOA 5EBAA 3BLFA 3FEMA 1EEXA 4LH8A 1X1NA 1H7RA 4U28A 5A8QA 1JNEA 4Z08A 2XVLA 2HXTA 3MHGA 2EJAA 5REQB 2XIBA 4FR1A 4HZ8A 1MZRA 2GSHA 3I6TA 4IMEA 4XD5A 1H3GA 1S39A 3PJTA 3TJIA 1UR3M 4QLKA 4AG0A 5CZTA 2NXGA 3LGEA 4GKLA 2G4JA 3LTSA 3W7OA 4EK7A 1GKQA 3AIVA 3WSUA 1B9BA 5A6BA 3UYIA 4CN4A 5ABEA 1UZ1A 3QF0A 1TO3A 3T2OA 2Y61A 4BWLA 3A64A 4ZOAA 4R85A 2ZVRA 1Q8JA 2PGEA 1PL9A 5A6KA 2ABBA 1H2JA 1H49A 4LX4A 1DE5A 4W93A 2ZZ2A 1V51A 4MJ4A 3WK1A 1ZRQA 1NAL1 4LRTA 2YYTA 3R79A 1EX1A 2A6NA 3G1FA 2PTZA 4I5RA 3A12A 2D73A 3TU9A 4OJYA 3QV8A 4JY9A 2NVCA 3N25A 3O63A 6XIMA 1C7TA 4GC4A 2ZX6A 3QKZA 2V5JA 4QS5A 3SCRA 2BXYA 2I5IA 2ZZ4A 1PXGA 1M6JA 5I5RA 2RDTA 3LTPA 2ODOA 1RVGA 3EWWA 3DG7A 3I6EA 3OLDA 2H9AA 2I16A 4JTLA 1KM0A 2X1RA 4HSHA 5IBXA 2TAAA 4H19A 2PZNA 2FDSA 4DNMA 1KGWA 5CSYA 2ATMA 4J3WA 1O1ZA 1TA3B 2XGIA 4FAMA 5A94A 4MZYA 4X0VA 4RW5A 4P8VA 3Q45A 4W5UA 2CKRA 4S3JA 3BV7A 3A13A 4NIRA 1LBFA 1BAGA 1GKPA 3MY9A 1MEIA 3TQKA 4R7JA 4MZ8A 3ONBA 3RXZA 1JULA 4YS1A 3N2TA 3QC0A 3K2GA 4ORMA 1NDWA 4PL1A 2OYKA 3Q58A 4KKXA 1ME9A 3DOPA 2Y63A 4Y9AA 3SUVA 3B06A 4FK9A 2C15A 5I3IA 4RX0A 3V18A 1S38A 4D8ZA 1HN1A 4WGXA 4RZ4A 2G3JA 3CYVA 3TC7A 5F2IA 2WSQA 4WSJA 4DYKA 5TAOA 3AQUA 5I0DA 4F9DA 3P14A 3CASA 3IJ7A 2IKIA 4WHBA 3NQVA 3VX0A 4UMBA 1OCNA 3DBNA 3FKRA 1W1B1 2DIEA 1K7EA 1AMYA 1TSIA 2XHYA 1QNRA 4NYUA 1QI3A 2VNCA 2VC7A 1YIXA 2F38A 2G3NA 2WVVB 3TYEA 3FJNA 5IHSA 5JQ9A 3PUEA 3U4AA 5C9RA 1W56A 4GVGA 2RUSA 1VYRA 4LAKA 4UFJA 1QK2A 1TRDA 2GFTA 3BUVA 1BYAA 4QSFA 3OLGA 1MEWA 4J3VA 3BG5A 3R58A 2YDSA 1JCJA 1QNVA 3E02A 3LPPA 3IIPA 1HJSA 4E5TA 1IGWA 1L9WA 1TPB1 4LJ3A 1E6NA 7PTDA 5ABTA 1TTQA 4IQEA 1WDDA 5IM51 4MNLA 3VD5A 1UUMA 1N55A 1WZAA 1HX0A 3UERA 1E9ZB 3MO7A 4KH2A 4RNFA 3QPEA 4G7EB 4US5D 4FSAA 3QFWA 1KXHA 3VZYA 5DQPA 1BRLB 1KM2A 2Y6ZA 3N12A 1EXPA 1UWQA 2VTFA 4JKMA 1A47A 4RXFA 2E8ZA 4KIEA 2D22A 3QMSA 1TPWA 4F4RA 2PA6A 3RHGA 2RH9A 4FXFA 3VNZA 6CGTA 2PWUA 3P5YA 4PUWA 1EGZA 2SFPA 1P7TB 3C0JA 2WSKA 3GW0A 2XFFA 2WANA 3S1XA 2E6FA 1KFEA 1IWPA 3CMGA 4GBUA 4QSHA 4ALDA 2R6OA 5DMNA 3OGVA 5CPOA 4JEJA 4UQ9A 2J6XA 4OWGA 3HQOA 1FWCC 2VI0A 3P74A 4QP0A 2GJXA 3O7UA 3ME3A 3B8IA 3O6YX 3AYSA 2NUWA 4JFTA 2YYUA 4DXKA 1TMLA 4HZMA 3IRDA 3W86A 3AZTA 1IXQA 3PTMA 4ATDA 3U0HA 3UT0A 1GKRA 1UR2A 3IRSA 4O18A 2I9UA 3GK0A 4OBTA 4AWEA 1MQRA 1PIIA 1PEZA 4JYDA 2HXUA 1GOMA 4RUBA 4AD3A 1W9XA 2V69A 2G3MA 3VD7A 4Z0JA 1XLDA 4O0KA 2WHMA 1V79A 3C8FA 1UMYA 4MUPA 2QCHA 1KLZA 2QUNA 4G8TA 4ZVJA 3VMOA 4JNMA 5AFDA 1CXLA 3B9EA 3AXXA 3URQA 3MUIA 2G5WA 2HBXA 4Z1BA 1F8MA 1IXPA 1YDYA 4LTSA 1DHKA 1FH7A 4FZIA 1MDLA 1I1XA 2XIJA 2A6LA 2DJLA 3V5CA 1TTPA 3L23A 3RK8A 5AHMA 1R87A 3W28A 4N9DA 4MKSA 1A50A 3VD9A 1HO4A 3VIIA 2YKKA 3ZJKA 2YL8A 1RP9A 1CNVA 3H2OA 3H4GA 2ZQ0A 4Q8TA 5E0KA 1L0PA 3CB8A 4EOUA 3MI6A 2GDUA 3PZVA 4Q6JA 2OU4A 5BYWA 1E0UA 1M3UA 5IFPA 2RDXA 3BV4A 3KL3A 4QNWA 2QJIA 4E3VA 3GUGA 4K1GA 5HOSA 3KBJA 5A2BA 5K9XA 2R9RA 3SJ3A 4LQ1A 4E8GA 1RD6A 1FWJC 2FZDA 3WLLA 4Y6GA 1QWGA 4C6NA 2ZXDA 3GU9A 3SIZA 4LBRA 1X6NA 4RK8A 4ICMA 1V0KA 3GYCA 3SRDA 3W7EA 1C91A 4ZMGA 1E6RA 2A0NA 3V0SA 3AIQA 1WZLA 1QW8A 4PRTA 3IPWA 1LRQA 5G2HA 3H7UA 1DVJA 5GVJA 2R82A 4M19A 2J9ZA 1XIGA 3GVWA 4MWAB 2VRKA 4RDWA 3ERPA 2VDIA 3NOEA 1O5QA 2F61A 1Q63A 4PMRA 2D20A 1QOPA 5CG0A 3SR7A 4MFEA 4U4MA 1MW0A 3ZQ9A 5AVHA 3N29A 3TSDA 2E9BA 2G8ZA 3LMZA 2FZ9A 1C8VA 1KA9F 1GK8A 2A85A 2F84A 3PZTA 2QCDA 3DEQA 4F0RA 2ZOXA 1VRDA 4GLEA 4L80A 3TYCA 1K9EA 3H6OA 3BJSA 5DF0A 3D46A 4R7WA 2OR2A 3EOLA 4HTBA 5A6AA 5H8MA 1E1CB 4I3GA 1FHDA 2HMCA 3R6IA 4N4PA 2YBUA 1VFHA 3BQ5A 3E38A 3ITLA 4JIRA 1WZKA 4UMCA 4DVOA 3WD2A 1JAKA 4BI7A 4C6KA 2Q8ZA 1Q45A 3VTRA 2J25A 3EOOA 1GZJA 2BY1A 2IQDA 1MFUA 4QROA 3UP8A 3VFCA 1M53A 2PTYA 4QM1A 2PDBA 4DJDA 3NPUA 1JCMP 2XH2A 3O16A 2NT0A 1O12A 4FLSA 5IHRA 1UUQA 4JTEA 1A5CA 4UQDA 1QO5A 4DF1A 3S3GA 1UR1A 1XYZA 1Y5WA 1EEPA 4H7ZA 3LXCA 1X6LA 3EA2A 3N14A 2DIJA 3VDHA 3PBGA 3GVVA 1PYMA 2DY3A 1XIDA 3R0KA 3G18A 4P5UA 3N15A 2FB3A 2O92A 2FVMA 3BL3A 4LYQA 2KZHA 4WJXA 3PAOA 3DFQA 5BW6A 1H1ZA 3WUEA 2QNEA 3STCA 2F6UA 1Z48A 4DQWA 2X7VA 3VCNA 2NT1A 3F4NA 3A5FA 5KZ6A 3GZAA 3AU2A 1AZ2A 5HWMA 1J0IA 3AJ7A 3FGCA 2FPVA 1FXQA 4WD0A 3LZ3A 3W1XA 4O4VA 4UQEA 4M1RA 2CWNA 3PP7A 1W9BM 1BHGA 4DAFA 2BB0A 2NUYA 3WENA 2PCEA 2CZEA 1P0EA 5DBUA 4R9OA 2P10A 3W1TA 1OC7A 2B31A 5KSWA 4CNNA 4JQ3A 4PN2A 4OUIA 5K9DA 4UZUA 4AXKA 2QCNA 4KETA 4ORIA 2GJNA 2WHKA 4CNOA 4HZ7A 1TTIA 5AY7A 2UY2A 3R43A 3FY1A 2WBKA 4GUHA 1DV7A 4M6VA 1ISZA 3T0TA 4FLQA 3TFCA 3APTA 3M0KA 4LYKA 2OSWA 3TZNA 4U10A 2HNHA 1KFJA 1UD5A 3TNOA 3UR8A 4LCSA 3UD6A 2ISFA 1JZ8A 2JE8A 2D24A 1F74A 1GVEA 4AD1A 5HBFA 4TX9A 1JFXA 2VEGA 3OZPA 1VFFA 4D6IA 2XVKA 4L1WA 4HGXA 1W9UA 3STPA 2VX7A 4HMDA 3LCWA 4IT1A 3ABSA 1MW2A 3IARA 2DSVA 1CGTA 2JKPA 1M04A 2CLEA 5DXYA 2WZMA 4XZNX 5D32A 3KWSA 2H90A 1EJUC 1QAPA 4HA1A 2XTKA 2VX5A 3S5OA 5J5RA 3EMZA 4GNVA 4ZODA 1ICSA 1FWAC 1W91A 3HGRA 4RNIA 1US2A 5TQLA 3G3MA 1SFTA 3GTIA 1DIKA 1C8XA 3QQ0A 3LRKA 1R3QA 3WQGA 4GI9A 3UXLA 1HKIA 4NY2A 1EWEA 2FH6A 3ARTA 4WRHA 1GZGA 1NEYA 3R2GA 3PTKA 3PPGA 4B5UA 4JR5A 1B90A 1MXDA 2P8CA 2VR4A 1Q6LA 2GJPA 3UXKA 3KL5A 1NY1A 4YLWA 4HBKA 5D02A 1JUKA 1FCVA 4AZ7A 1MFVA 1ISYA 1WDWA 5GNYA 5GNZA 2FLIA 2J7CA 3HQ1A 3TOYA 4K6AA 1TUXA 2A21A 4HHLA 3IJ8A 3C8NA 2X42A 1FWSA 1U1JA 4RKAA 4YVPA 4S3EA 1BKSA 2G96A 3S9IA 1AL7A 4GCXA 2I5GA 1NTHA 3FJ6A 4G1KA 4ZTXA 3FSUA 2ACSA 3NGJA 2NQLA 4H01A 4XD3A 5DX7A 4EAYA 3ITXA 2JBMA 3QV9A 4AEOA 4X9SA 4PE8A 1W1VA 1DPMA 2G3IA 3MZ2A 3WD3A 4WSKA 4FXRA 1E3ZA 4JTGA 1OHLA 1XLCA 1QI4A 2PEVA 1VR6A 1XISA 5CQ1A 1KV5A 1C90A 3EPNA 1ZQ5A 4A3RA 1DJWA 4MB3A 3L4ZA 2HWGA 3W07A 3FA4A 1ODZA 1KR1A 1X98A 2V0TA 2GDQA 1TPH1 3SGZA 4EF9A 3CMFA 3WQFA 1GQKA 1I2RA 3ARQA 5CJMA 3TN6A 3W84A 4CQDA 4YTQA 2P88A 3G1DA 4QITA 4N9CA 2W91A 2W5FA 2XJ7A 1DIOA 1PKMA 3OZMA 3SCVA 4LXFA 4HJWA 4GNJA 4HA3A 4NXKA 2BDQA 3ORWA 1R3WA 2E25A 4KRZA 4DZAA 2BOFX 4RLIA 1IIGA 4UQBA 3C2RA 2ZUSA 2XGZA 4U31A 4Y9MA 3OVQA 6XIAA 3MVTA 3N6QA 2JFEX 1XH0A 2ZA2A 2VC9A 1GJPA 3TQVA 3NZGA 1POKA 4ILSA 3TOPA 5HNRA 4AHOA 4XKYA 3S8HA 1DKWA 4R7OA 3L4UA 4NI3A 1K02A 3K1DA 4IFRA 4ZFCA 4L4PA 1AH3A 2GSEA 1OSEA 4DWSA 3ZT6A 1BSIA 2GGIA 2D1ZA 1S1PA 3GW3A 4AY7A 1JD9A 3KBNA 4S3KA 1SUXA 1OIMA 2Y89A 1CI1A 4NJKA 4UIOA 3H26A 2Y70A 4O12A 4MADA 3FK4A 2H8XA 1LTDA 4AF0B 1KCLA 1PB0A 3W24A 4L61A 3BW3A 4HPGA 3M0IA 4EIVA 4QE5A 4X0NA 3RRXA 5DT7A 3B9DA 4OKDA 4WOZA 1DJYA 4NJJA 2FFCA 4UNIA 4QJ3B 1OF8A 3CB3A 2QJGA 3NQ7A 5IFTA 1UJQA 5DFAA 2J78A 1EZWA 1X97A 3E0LA 4PCFA 3UESA 2CC0A 1GQLA 3IJIA 2CKSA 3UQNA 3GS6A 4PB3A 4I9JA 4GA8A 5CKSA 2C1GA 1PCKA 3FJLA 4O1BA 5IOBA 1TJRA 1ITCA 4E0CA 4FHAA 5C55A 1UWTA 1DYSA 2J7HA 1H5YA 4ICNA 3P82A 4AMCA 3QZAA 1OVDA 3S5YA 1W32A 1LZOA 3P60A 3OOQA 2DUZA 5LGZA 3LHTA 1PDYA 1YHTA 2QCMA 2ASHA 3PZGA 3DYOA 4FPSA 3AC0A 4RW3A 3TC3A 4PUEA 3ARUA 1FDYA 3GFZA 1HVQA 8TIMA 1XLHA 1G94A 3WNPA 4OUEA 1H62A 4AD2A 4HK6A 4WDTA 4UTMA 3LHVA 4GUIA 2CNCA 2ZZ6A 2WBGA 1QATA 5G2WA 2HBVA 4PMVA 1QCWA 3CHFA 5H8UA 3PPFA 4AY8A 2HVNA 3MCMA 3RGTA 3C2YA 2VM8A 4NJIA 2PD9A 1S5WA 5DEZA 3EKGA 4BHYA 1ZP3A 3CPRA 4FMVA 3H2CA 4JTAA 4EXBA 4NZJA 4E6MA 3W7CA 1RCXB 1B9ZA 4PMQA 2VFGA 1VLIA 3B8TA 1LUCA 1QO2A 3GC5A 5C7VA 1EJVC 1OFEA 3PJUA 4QLLA 3P7YA 2O56A 3OVRA 4QE1A 2AKMA 1GONA 3URBA 1VEMA 2FTWA 1XPGA 2AL2B 4PRWA 4AWTA 2QEZA 5D2XA 1XRTA 3EA3A 2VGIA 1UW9A 3GHSA 4LUIA 3CWOX 3MO4A 2FPYA 2FGZA 1NARA 1JI2A 3B4YA 3RX4A 2Y24A 3FFSA 5J5DA 1UIPA 4PUJA 5KMYA 4BWLC 4JS3A 4PGLA 4NAEA 5BRQA 3PG8A 4INFA 4ACYA 3TQPA 3OVPA 4C60A 1WDPA 3GKFA 1Q6EA 3N19B 3LXAA 3BOXA 3NO1A 1MVYA 3LZ5A 1RK6A 1AW5A 3RUBL 1E55A 4PA8A 1TPEA 4PODA 1RXOB 2CZ5A 3EBVA 4LUYA 1E4MM 2HV5A 4F2UA 2DUAA 2Z6JA 5CJ5A 4IFKA 4MGGA 1N8IA 4P7LA 1LOLA 3WEZA 4MAZA 1C9WA 3A47A 3M5VA 3KRBA 1JG9A 4DJFA 2PU1A 1OFDA 1JYXA 1VBUA 4KEMA 2QW5A 1W3NA 4H4IA 3TSMA 3S5SA 1ZLPA 2YBTA 2QYGA 1OYAA 2QIWA 4UR8A 3MVIA 2XSAA 2POTA 2QDHA 3UR7A 3AHXA 5M1TA 5IBXC 1F73A 4NHVA 4MKNA 1J6OA 2PLKA 3VNKA 4AZIA 3WBEA 5FA5A 2Q3RA 3CQ0A 5D9PA 1AQ0A 2TRSA 4XZWA 3BANA 1XXXA 3UVIA 3HIJA 3KZPA 2HS8A 5A6BD 3ARPA 5AKQA 5CAHA 3TJLA 3H55A 1RJQA 4PMXA 3DHUA 4Y2WA 4LUJA 2CLMA 3NQ2A 3DFYA 1H7PA 4AZCB 5KEZA 1W8GA 3CL8A 3FCPA 3MHFA 1L2QA 4PB4A 5D8ZA 4M80A 2ACUA 2PF0A 3UZYA 3TYUA 4OIFA 3FYOA 1VIZA 4B91A 2DDXA 3MT1A 3EX1A 2GWNA 3RJXA 1XLBA 3WF0A 3CQKA 4H6KA 3ES8A 5DY3A 1E9IA 2IPGA 4B3ZA 3N9KA 3RPTA 3L4XA 1ZJHA 5AYBA 1GZ1A 2O0TA 2UBPC 5HXMA 4RDZA 4ACZA 4D6GA 2ZA3A 1Z89A 2GQ8A 1AD1A 5D04C 2E1WA 3ZLFA 3CEUA 1S2CA 5BU6A 3PANA 3NPWA 3ABQA 3WK2A 2VFIA 3AUOA 3YPIA 3O07A 3KHDA 1O6IA 3AISA 3SIMA 2YCEA 2EXOA 1JF6A 3M5ZA 1DBTA 1K8YA 2G95A 2J7BA 5HULA 2DU2A 2YJQA 3LCIA 5HDRA 3KBWA 3P3BA 4HNLA 2CZFA 2PBGA 3FHAA 3BOLA 4Y9NA 3UZZA 1UZ4A 2XVNA 4REQB 4XISA 3VIKA 4H7CA 2WMFA 1RSCA 3RO6A 3VIMA 4L56A 4U5IA 1MW1A 3H7VA 4M51A 3MANA 1MXGA 3E6EA 3FXGA 1GG1A 2X7WA 4GBDA 4DZ5A 1QBBA 3R0UA 4AMAA 1XGDA 2XSBA 3OU8A 5C9XA 3UWZA 3AS1A 3DN5A 2JGQA 3QMTA 1W3JA 5T26A 1JDCA 4QCEA 2WKJA 2NV2A 1OT1A 3NZQA 2DGAA 1W2PA 2DW7A 3D0CA 1AJ2A 2HISA 1FVPA 3GG0A 4J3SA 3QVQA 2NX9A 2X1SA 1HKJA 3PBYA 1WAUA 2C0HA 3BAXA 1QMLA 2PDXA 3BLDA 4C91A 2QKFA 3M7WA 1ZU8A 3WF4A 3UETA 4F0SA 3L67A 2CLKA 1EGMA 2R1MA 4B5XA 3LD5A 3L0NA 4CEUC 5CZSA 3PPCA 3THQA 5I77A 2BGQA 5AVNA 3PSWA 2YCLA 1AODA 3VDCA 3GDLA 5LKYA 4B9YA 3NAVA 4J27A 3IAQA 4JIEA 3TP4A 3SAZA 3M5YA 4M29A 5CC3A 3POHA 4UR9A 4QHRA 2Z2UA 4L9YA 4UNKA 1DHPA 1FWDC 1G01A 3S47A 1UKQA 4JFWA 3EWZA 1UMLA 4O0QA 5CBBA 1UOKA 3O6AA 3RX3A 1Z44A 4TVUA 2J9XA 2OKTA 5E0FA 2HS6A 1SJBA 1RV8A 3A6OA 4ZB5A 4MIMA 1LQ2A 3MV11 1FCQA 3FV9A 1V7YA 1Y65A 3M43A 3WJWA 1EX5A 1GYMA 2XISA 2QAPA 1X1ZA 2D3NA 1WDQA 3NQ6A 3GVGA 3P8IA 3IGXA 3AUJA 3VCCA 4KQNA 1US0A 2DT1A 3P80A 1NF0A 5LZLA 2PURA 4PMJA 3V36A 3VNJA 5CPNA 2ZX8A 2NV9A 4OOZA 2VRQA 4PBEA 5A2AA 4LGXA 3SCPA 4N9EA 3CT2A 3D5HA 1OCJA 1J0HA 3XISA 1LWIA 4J40A 4B5VA 4AXNA 4JHMA 3INPA 3KOXA 4UTTA 2V6AA 4ZO7A 3KCOA 4E3TA 3UPWA 4MSSA 1KBBA 2NQ5A 2J9YA 3WH5A 1ME8A 3ZSSA 1C9DA 2XYLA 1E0WA 4OU1A 1VYSX 1EUNA 1S1RA 3DC8A 3T8LA 5DRIA 1JPHA 3F7JA 2VXNA 3WNLA 2PDYA 3LNPA 3SN1A 4O50A 3CEPA 3TONA 1LL7A 1S46A 3GXIA 4ZO8A 4ATWA 2I9EA 1FFRA 3EX2A 3Q65A 4MF4A 4TV5A 5JBEA 2VFEA 1W3IA 4GIRA 1TG7A 3O05A 3EB4A 3TTYA 4NYYA 1F6PA 4CVWA 4ADSA 2YDAA 3OQEA 5JUVA 3OHMB 4P7QA 2QZRA 3CUXA 2ESCA 4JTJA 3RPMA 2WPGA 1Q6QA 1EOMA 2NW0A 1TVLA 4NZ4A 2JKEA 4UTUA 5FJUA 1PZ1A 4IFOA 6ALDA 1G67A 1PAMA 1UC5A 3ZLHA 4Y9PA 5LNRA 4Q3MA 1OB0A 1IR2A 4GO8A 1PIGA 1S3TC 1WKEA 1UBSA 3W7QA 4MKVA 1JZ7A 2ZZ5A 4RR4A 1LL6A 1W3HA 1CT5A 1BF2A 1JZ4A 1Q4WA 4K39A 2FFIA 3LN3A 4H9XA 5FF3A 2CLHA 2VHLA 5CBIA 1T96A 4DRSA 2PTDA 1UQYA 4NZCA 5CPSA 1QNQA 1TVPA 4LC6A 3LHUA 2CLLA 4KCTA 2J66A 4H9TA 2FHCA 3VIHA 2QCLA 3NUKA 3VYLA 5ECUA 5CH9A 5KINA 1E70M 4GFIA 1DP0A 1E51A 2AAAA 4ROQA 5AZ0A 5LIXX 2FHBA 1VFUA 3CAWA 5M2FX 1EIBA 3OBAA 4PSPA 4ZGYA 1I60A 4DJDC 4QG8A 2Z1KA 3PS7A 4ZO9A 3VOJA 3W75A 1EJ7L 2IUZA 4JQ2A 3NL2A 4YTSA 3EDJA 4OE7A 2PCQA 5EMKA 3UJFA 3G0XA 4LALA 4H9YA 1IWAA 3B8SA 4GFSA 1A5MC 4BZYA 3THCA 1GOQA 1RPKA 1LROA 3TFXA 4UTFA 4JXCA 2ZRUA 4TVCA 3RAOA 1DJZA 3PZOA 5AC5A 2E5BA 3NEVA 2XG9A 3O06A 3RCMA 5I3DA 1AK5A 2GK1A 2YX0A 3IJ6A 1MSSA 4IG2A 4DPQA 2VRJA 4K8EA 3IJ9A 1K4GA 3KRSA 6PTDA 3F2CA 5FSEC 4GCAA 4GYKA 4A8IA 3UPMA 2PBOA 4BQ4A 2A2IA 3UR2A 5I02A 4J3UA 1IYXA 2PPGA 4QX4A 3OB8A 4NQ1A 2YA1A 3OZOA 2EQDA 3KTXA 2IXUA 3SFWA 4Q4MA 3AIRA 2ZCGA 5D03A 4AZ5A 4I90A 2BOEX 2Z4GA 4LY4A 4B16A 1XGEA 2E8YA 4AEEA 3ARYA 1KTNA 1QHZA 4A3HA 4V1XA 1G7UA 2IPJA 4YTTA 1OABA 4E2OA 4GZIA 3EYPA 1EHNA 4IHCA 4WDXA 4CN6A 4QFUA 3CQJA 3CJPA 5G4WA 5M17A 3EZ4A 3WF1A 4O54A 2ZDRA 2P3ZA 3SSJA 1QHOA 4BK9A 4O15A 4LCQA 3SCWA 2CWXA 1VJIA 3WBWA 2A3CA 4GUGA 2EPHA 4PCSA 2DVTA 4MUZA 3WQ6A 4GMEA 3TEVA 2C13A 4FEZA 3LLFA 4FA3A 5CZJA 4C90A 1M01A 4ZOCA 3D3FA 3AFBA 2B7NA 4MG4A 3W7DA 2OWCA 4HNTA 1K77A 2R1PA 3P61A 4GI4A 2QJJA 3AMDA 3LA4A 3AU6A 3L7RA 1AA1B 1M41A 1HF6A 4BJHA 1XL9A 1R46A 4AVFA 1TWSA 5CGTA 3BTNA 3OGSA 2NWRA 3VABA 3R0DA 4GQGA 3SN4A 2OXNA 1HNYA 3U7BA 4ZQMA 3NQCA 3CK5A 1VJZA 4W7VA 1LM1A 2IPWA 1WA3A 3RCNA 4PMUA 3VDGA 3MI3A 4UFMA 2F6XA 3EX4A 1TCDA 4R9XA 3W7LA 4E38A 1SW0A 4JNYA 3M0HA 1S2UA 2W63A 1ADOA 1HP5A 4Z1CA 4LWWA 4K68A 4GVFA 1IT8A 2UWFA 2Y85A 3W88A 3UJSA 1TWDA 4NZ5A 4C1NA 3HO8A 1U83A 3UU0A 4NF7A 4UB9A 3QW3A 2PD5A 3NOYA 1KTCA 4DUXA 1XLFA 3II1A 3N4AA 4DEFA 4YXGA 2D2GA 4JTHA 1ECEA 1PZ0A 7TAAA 4K36A 2ISVA 4HPNA 3OO2A 2Y5SA 3WLHA 3W6LA 3OW1A 3TYAA 3PK7A 1GQIA 2IMRA 3BPWA 4DB7A 1MDRA 1GVSA 4MYXA 3LV5A 3Q37A 4LBSA 4J9JA 1HW6A 5FIPA 4W86A 3VGDA 2DH3A 4BEUA 1YE6A 2FKPA 3AZSA 1SJAA 1KFKA 4N02A 1XIHA 3VOHA 4UWMA 1KKOA 4JKKA 3HMJG 5LYRA 4IUGA 1K6AA 4QRNA 5BROA 4HNCA 3W87A 4NT0A 1E4LA 2PAJA 1W3KA 4WF7A 3A4JA 1F6KA 2INFA 4J28A 1GUVA 3L0GA 1Y7VA 4I8DA 1R38A 4ML9A 1CLVA 2VGBA 5BU9A 3GG7A 3M0LA 1S2TA 1EIXA 2PRHA 4EANA 4PCPA 5FJPA 1UIOA 3VI2A 5CC6A 1VYPX 1BKHA 1UD2A 4G1NA 3ARVA 1EPVA 3UGRA 2WZHA 3AWOA 3NDZA 2ZX5A 3LHZA 4GABA 1H7XA 4GUJA 5KZEA 3KVLA 4S3AA 2VC6A 1JPMA 5BNKA 2NZLA 2J7FA 3HN3A 3H54A 3AI0A 1LP6A 2BHZA 3LLXA 4XUGA 2J4GA 3H70A 1TPFA 1KC7A 3THDA 3H2EA 1UWRA 2J74A 4PULA 4O10A 1G4PA 4Z2IA 4A3QA 4PMOA 3GM8A 1YKWA 2DT0A 3PAJA 1IHIA 4HHPA 1VCGA 1CTNA 1OX4B 3CUZA 4DWSC 4AY1A 3E1F1 3A4WA 1XICA 4GINA 3W71A 4A2SA 1XLGA 2FMOA 4KRTA 5FESA 4FOUA 1V3HA 2Q8LA 4LCRA 3ITOA 3T4WA 1E6SM 1D7FA 1W5PA 5FSDC 4CQ8A 4DF0A 2WOQA 2E67A 3MBFA 3QTPA 2Q8XA 3M0VA 2Y62A 1XI3A 1QPOA 1UWUA 1W9PA 1GTHA 4MJ2A 4N9BA 2HK1A 3BAWA 1YNQA 4Q8QA 3JUGA 4GHRA 3W7RA 4IQDA 4KF1A 1F76A 2BHYA 3SZ8A 3AIWA 1EF2A 3UJRA 4UTWA 1OJXA 1UD8A 3RNDA 5B80A 1TJPA 1KRAC 1F05A 3G5EA 4E4PA 2OWWA 2R91A 1KBKA 1QI0A 1OFBA 4O1FA 5JXQA 2YW3A 2GUUA 1RQBA 2PLJA 3NIYA 3VZZA 3K46A 1KM4A 2V67A 5J8LA 4C6CA 1JZ2A 3FDKA 2BVWA 4DO4A 2BSLA 3R25A 2GVJA 3WEMA 3P5ZA 4AB4A 3LGGA 3PTQA 3WDQA 4ZSTA 1ZJBA 2OLSA 2DZAA 1PDZA 4IXXA 2H3BA 3S2MA 1N2VA 1HVXA 1JRBA 4TQTA 3A3WA 2YA2A 3S5NA 2X40A 3WY1A 4RZ5A 1T5AA 1YTKA 4XZIA 5FJOA 3U2CA 3QKEA 3KOFA 4IQJA 3NSNA 4KPLA 1Q8AA 4C6LA 3CHEA 5A2CA 2DW6A 4YPJA 3HG3A 3ZSTA 3W83A 4H9MA 1XLIA 1RD5A 2Y7GA 4PB5A 4MTVA 4UOJA 5ABGA 3RX2A 5F4SA 1TUFA 2VUNA 1JCTA 4OQVA 3QSTA 4O1DA 3WUFA 5AHIA 4X60A 4C1KA 4IMAA 2YIHA 4GZEA 1P4CA 3TDFA 4DZHA 5A5WA 5LSMA 3MKCA 1NP2A 4P8UA 3HF3A 1LQAA 4V15A 3FDGA 3TYBA 3IVSA 1QPQA 2A3EA 2O7QA 3TJ4A 1UA7A 4H6EA 5BXTA 1QPKA 2VZTA 3KHJA 4MB4A 4F9JA 3PM6A 2HE8A 4Q8PA 1SVDA 1X39A 2W61A 3H2FA 2VCBA 3DAQA 3EEZA 4IP7A 5F1VA 3SCQA 5LXEA 4LUTB 3E49A 1VFSA 3N9SA 2FVLA 4RNJA 4B3LA 3SCTA 4D1IA 1R9XA 1SMDA 1EHAA 3MSDA 3SY8A 4QJ4B 1AW2A 1IQ8A 3T0CA 3CIXA 3GU2A 3VNLA 2PDGA 3ALGA 4KCWA 2AQWA 4DXXA 4Z2JA 1CEOA 5F4WA 1LT7A 2YLAA 3O15A 2I1OA 5BOOA 1QI5A 5BXPA 1UZHA 1I1WA 1ZY9A 1FCUA 1XLMA 1OCQA 3MUZ1 3NPXA 3QGAC 2ACQA 2F7FA 3ABOA 2J88A 3U3HA 2Y8KA 3G3DA 5HA7A 4N42A 1OK4A 2PWHA 4TVDA 3DIPA 1XFCA 5A6LA 1WUEA 3G1VA 4DJFC 1TV2A 1K8XA 1JNDA 2WC7A 4XTIA 2CIPA 3QXBA 4FIRA 3KLKA 1W5MA 4GZ7A 2OWXA 1VPYA 4K7VA 4EXAA 1EYEA 1LOQA 3T44A 3PC0A 4C6FA 5HPCA 4W8BA 1KQZA 2J27A 2J8TA 2PZ0A 3TN4A 4E8CA 4LS2A 4A2RA 1GYLA 3B9AA 4GVHA 3U5YA 2R1NA 4J3TA 3FXYA 3L2MA 3MZNA 1E0TA 1V3MA 3NO5A 3JW7A 4HU3A 3IGUA 3I7RA 1XD1A 2C18A 4GOAA 2ZX7A 4HHHA 1FY6A 5LHFA 3LLDA 2C91A 3BQ6A 1JDAA 3WMSA 2VR5A 1XD0A 3HMCA 1FH9A 5C7HA 3ISIX 3RMJA 1OX6A 4FF7A 2ZWYA 4JX6A 4HSOA 4W89A 2ZA1A 1HL2A 2REQA 3FX4A 3WQVA 4LSBA 3NR0A 4CCEA 4X9YA 3ZMRA 3GX9A 3VKJA 1XCXA 3M1ZA 4RZ6A 2PODA 4N6FA 1HT6A 2OFJA 3UWQA 3TYDA 2FGBA 2NVDA 1CIUA 1AQMA 3FNDA 5K9CA 4WXZA 4I9AA 5DCEA 5A8NA 1FKXA 2WMKA 4FO4A 3CV2A 2OVLA 3PR2A 1XJBA 1JXJA 4PBGA 3WNKA 4LAOA 2Z00A 1E6QM 4HQVA 3CZJA 2O9OA 2ZUMA 3UWYA 7REQB 3GHTA 3F5JA 3QGKC 3M41A 1OX4A 5FEZA 2QPUA 1JPDX 3B05A 3UYCA 2QUTA 3KFTA 3AICA 4ATLA 3CV1A 3S2CA 3LCLA 1R2SA 3K30A 3AXHA 3WMCA 1J6PA 3WLOA 5JH1A 1ITXA 3TWBA 4NX5A 1S5NA 1WQ5A 3E74A 2FVKA 3W23A 4KFPA 3M0YA 3WNNA 4JTFA 2VYOA 4NZFA 3U7VA 1PPIA 2PDNA 4HA0A 3IK4A 2X1TA 1OM0A 4GD0A 1KV8A 2D2JA 1YNPA 1G7VA 3OBKA 4AAJA 1GVQA 2DT2A 3IV3A 2C14A 2QDEA 3HV8A 2QCCA 1FFQA 2H9AB 3STGA 3I3EA 3R13A 2RDUA 3UY7A 2D69A 1TX2A 1XR2A 3A4AA 1EGVA 2V2HA 3APGA 3VE7A 1Z7AA 1T6MA 4IPPA 1R2TA 4GJIA 1ITQA 3K5XA 1H1YA 3OYZA 5HPOA 2YL9A 1MWOA 4KFNA 2PMQA 3ZJ7A 3G1XA 3W27A 3WJSA 1EO7A 2Z29A 3URAA 4HHMA 4EAMA 3RDKA 2CBVA 1OD0A 2QUUA 1JXKA 2QDGA 5HUPA 4DUWA 5I03A 2VO5A 2UZ9A 3P62A 3CHDA 4UZSA 1FWTA 2V63A 1CENA 1CB2A 9CGTA 2A3BA 2QR6A 4EVZA 1XP3A 1EP2A 1F2JA 3DG3A 4ZSUA 2OEMA 5D2YA 5AC6A 4YCPA 2FIQA 4NX0A 1XWYA 4QDPA 4O1CA 1TV3A 4RL3A 3WLIA 1PHWA 1TR9A 1ZSXA 1YMYA 4S1FA 2PGWA 4GACA 3CWHA 3BC9A 3ZOAA 1GGOA 4H41A 1I0DA 1FRBA 1K7XA 5DMLA 1SJCA 4MNKA 1B4KA 2V82A 1JQXA 3W7IA 4WSHA 4F3HA 3BZJA 5BCAA 4OV4A 3VFLA 1X96A 3AYRA 2BVTA 2W79A 3ZLGA 2WLYA 1CXHA 2D0GA 2WVUA 2TSYA 4IIGA 1TJ2A 3L4YA 4A8NA 1P1XA 3C2EA 2ZRZA 3NQBA 3U2ZA 3ZFHA 4IMCA 4FNSA 3PUOA 2Y2WA 3V75A 3BAIA 2QDDA 3EXTA 3L2LA 4DUOA 2INZA 4UBPC 2XINA 1UWSA 4A4AA 4GG9A 4GK8A 3WLSA 1JYWA 5AHEA 3SSZA 1MUMA 4UTTC 2DORA 1H51A 3LERA 3IIOA 4WY0A 1WKYA 3WQ8A 4S3GA 1E9LA 5BWFA 1EWDA 5DANA 3PJXA 4I6VA 3SW6A 1XYAA 2PDKA 4UFKA 2V38A 3TN5A 3GR4A 3DFSA 3GHRA 4PTNA 1H5VA 2W67A 3ENLA 4HOXA 1NM9A 1DE6A 4BQ3A 3DHFA 3PBVA 3WLPA 4Q8UA 4UR7A 5FAGA 4C5ZA 1FOBA 3VINA 4AX6A 3KCLA 4CD7A 4PFHA 2OMAA 2AOSA 1KBJA 3QQ1A 3KVMA 3NM1A 3SB0A 5F7UA 4CNTA 3FAXA 3G2GA 3S6TA 1FCBA 2Y5JA 4AEFA 2AGTA 1TMHA 1J10A 1NF7A 1UD6A 3TKFA 3ZR5A 3IIVA 1DWAM 2ZYFA 4IPNB 3TMQA 3T0AA 1SR0A 4F8XA 2E9MA 4XBKA 1KFLA 1HIZA 3CYJA 1L6YA 2V30A 1Z9AA 3QC3A 3SDOA 3ITVA 4HU8A 5TIMA 3RN6A 1GWJA 1EJWC 2PDLA 1OZMA 4L6HA 1VZWA 3HJEA 1DOSA 1YE4A 7ODCA 1KGUA 1WCGA 5CPQA 4B3KA 4MPQA 3SUSA 3GWQA 2NQZA 2ABAA 1GOXA 2XM2A 3W1MA 2E4TA 3LG3A 2OOFA 2OG9A 2QUVA 7A3HA 1LORA 1MQQA 2YCIX 1SO3A 4MFDA 1P43A 4OOUA 3FOKA 1XBXA 2PLCA 1B3WA 2WO5A 5FEXA 4LVDA 2O4MA 2OZ0A 4JKLA 4YU1A 3WFAA 3LCHA 3GH5A 3W7MA 1EYWA 3EWYA 1HXJA 1HJVA 2V81A 4HU0A 4IGSA 3GZ3A 3NNTA 2YXGA 4JYEA 1Q13A 4M6UA 3WQPA 4MMWA 2BZNA 2WMIA 3RG6A 3TYZA 1VH7A 5JIWA 3U6WA 5E93A 1QK0A 3UCQA 3IUDA 3U57A 3QGVA 4M0XA 4RCXA 2OGYA 4K38A 4KERA 4HIBA 4NU7A 1PS9A 3GNRA 5CCZA 3ZS4A 1ONXA 2VKZG 4QBXA 4XX6A 3GTFA 1VCFA 2WNZA 2V3EA 3C56A 1M7PA 3CH0A 4AVOA 1CLKA 1HGYA 1GJUA 3WNOA 2E0PA 2WV8A 2X0YA 2Z1BA 4CNSA 4GGHA 2OYLA 3OA5A 3OA3A 5BOEA 1Z41A 3LHYA 4E4FA 3VKDA 4AVNA 3TTSA 4HJFA 4YN5A 3MMUA 1RCQA 4ZBCA 3WL0A 3T78A 1N7KA 7REQA 1XPYA 1YADA 1UG6A 3DFHA 4H8NA 1V8EA 2A79A 4LVAA 5CJNA 3H8AA 3T09A 4IQLA 2G3FA 2PC8A 3L12A 4E2VA 1XIIA 3NXLA 1W1TA 3WFLA 2PRLA 3FJ4A 2OODA 4GYJA 1QW9A 3K4DA 2XWDA 1TV7A 1VJSA 4NNBA 4NUWA 2WC4A 3S2LA 1O95A 1OF6A 1GJWA 2X30A 2YL6A 4B4FA 1UWAA 2OB3A 1UPPA 1VC4A 1F3WA 2CBUA 4XBSA 5CC7A 3HV9A 4IOTA 3LY0A 3AOFA 3PZUA 4TTUA 2PF8A 2D2OA 1RR2A 2QCDB 3QH2A 3BDKA 3UNDA 2ISWA 7XIMA 3S1UA 4NNCA 4IL2A 4GIYA 2W66A 2VOMA 3S2NA 2ZZ1A 1AUSL 2OZ8A 4L6DA 1KXQA 1AFSA 3W29A 3PZNA 2QPSA 2UY4A 1HKVA 3BLEA 2GJRA 3R8RA 3SEPA 3MJYA 3N9RA 1DIDA 1V3LA 2XH0A 1E4IA 3ARZA 4DBDA 1UB3A 1C92A 3G8RA 3T07A 2A5HA 3QV6A 1CBGA 1QXLA 1HP4A 5CLTA 4C6PA 3GG1A 2ALRA 3W1NA 4F40A 3JVAA 5C2CA 3BE7A 4UTJA 6TIMA 2QJHA 3SUWA 1R3YA 2DV0A 3WQWA 4Y9OA 1PIFA 4NAFA 5B7YA 4A3UA 1DWGM 4ZEPA 2KX9A 4MY8A 4O1AA 4O19A 3V35A 1WBHA 3POCA 1MEHA 2CZDA 2HK0A 1MNSA 4NZ1A 3GXPA 2VDGA 2DUXA 1ISVA 3EWDA 3TW6A 3HG2A 4L9XA 5KTLA 2XIIA 1FWNA 5A3HA 5BXRA 5EMMA 1TX0A 1BF6A 2EPNA 3KAOA 1B30A 5D05A 3N17A 4C6IA 3VAVA 2ZZ7A 3CZGA 5DLCA 4H2HA 2WZTA 2WYSA 3QTGA 1L6WA 4ZXLA 3P84A 3WD1A 1YDVA 4W87A 3UEQA 1Q4NX 1TCMA 2Z6IA 3KBVA 4LUSA 3GC2A 3GDRA 1ODUA 4BFAA 4JTTA 3LS9A 3REQA