3FJ6A

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
361
Chain Sequence
b'GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fj6A00
5F4SA 4JICA 2AGKA 3W7MA 1OK4A 3B05A 4AXKA 1SSDA 2WQPA 5DELA 2JKEA 1N8FA 2QEZA 4GFSA 1FBAA 3WJZA 4CCCA 3LB0A 4NUWA 2V30A 1W3TA 4GBUA 2DZSA 5HUOA 3NQ2A 3AO0A 5KZEA 5I3FA 1SO3A 1WAUA 2CU0A 2J27A 3MJYA 1G4EA 5AHFA 1I2NA 3LCIA 3B0VC 2YW3A 3QM3A 4OT7A 2X16A 1OK6A 1UASA 5CKSA 3L68A 3PB2A 1JJKA 2A5HA 2ZZ6A 1OYAA 1U83A 2QF7A 1TO3A 3QH2A 1MEIA 4PA8A 4O54A 4IX2A 3KOFA 1DJQA 4L4LA 1LROA 3UNDA 3PY2A 4LWWA 3ZFHA 5A5WA 1AW2A 3IVSA 2EKCA 5E0KA 1XC4A 1T99A 3TAOA 1OFBA 5DCBA 3DFSA 1SO4A 3B06A 2NZLA 4AHPA 4HSNA 2GUUA 3DFPA 3Q94A 3IGSA 1JCXA 2YCEA 3M5VA 3QSTA 4UIOA 4LW7A 3I68A 1SQ7A 4PC8A 1IXNA 4ADTA 4CLMA 1Q6OA 5D2WA 4UTIA 5LNVA 1NF7A 3FEMA 1MSSA 1P4CA 4NZJA 3STFA 5DXXA 5K4ZA 2QKFA 3LV5A 5D37A 3W1XA 1SPQA 1JUKA 1QAPA 4QQ3A 3ZWTA 3UWZA 5LGZA 2OZ0A 1ZAIA 3KHJA 3N14A 2WSQA 4IQLA 2WNQA 3W70A 2V82A 1E51A 1ZY9A 5HQEA 1R2RA 4XUGA 1YLVA 2NLIA 3NEVA 5AYZA 4EIVA 5H2ZA 1EUAA 3TFXA 1SZEA 4LVFA 1ZNNA 4Q32A 3P62A 5IBXA 3VI2A 4N6FA 1X7FA 3TE9A 3JS3A 4HPXA 1P5BA 1SZGA 1W5NA 3ATZA 3W7DA 3M47A 3I6RA 3QYQA 1T96A 1OFOA 1B9BA 5G2IA 3GX9A 4FIRA 2C14A 1WBJA 2P0OA 3O1NA 2GPTA 1LBMA 2ZRYA 2F84A 2W6RA 2CZFA 4E0CA 2GJLA 1TQJA 2E6YA 4DBEA 4GNJA 4ICNA 3FYPA 4WD0A 2ALDA 2PRMA 1UJPA 3LLFA 1RR2A 1S3HA 3O15A 4X22A 2E77A 3PB0A 2CZEA 2B0MA 4H4IA 5BOOA 4DPQA 3FFSA 4O4WA 1XFBA 4EVZA 3TH6A 2FDSA 3G1SA 3G3DA 3EX2A 4JR5A 3SJ3A 4JTSA 3EKLA 4UFIA 3W7HA 4KFPA 1OFEA 4X3ZA 4ML9A 2CZDA 4ZMGA 4ORIA 3NOEA 4XKYB 3E49A 1WA3A 3MBDA 3ZWSA 2VXNA 4RZ5A 4N9BA 1W1ZA 4DQWA 4FNQA 1NF0A 3DBPA 4MKNA 3LTSA 1VC4A 4K8EA 1G4TA 3EB2A 3OBKA 3IV3A 4K39A 2Y85A 3NL5A 3C0JA 3BG5A 3O63A 4NJGA 2JK2A 2QCGA 3OA3A 4FXRA 4OHQA 3HPXA 5AYXA 1YPIA 3CT7A 3PUOA 2R94A 4H6KA 3SFKA 4QM1A 3W83A 2RDWA 3R89A 3F1QA 3ZR4A 3P74A 2HTMA 4HNUA 4NNAA 5AYYA 4UTWA 4MY9A 3W1MA 4MIMA 4NX5A 1TJRA 2NXIA 2VENA 3TC6A 1R2SA 1H7PA 3GR7A 1ICQA 1XBXA 2Y7DA 5FEXA 1KFBA 1OF6A 4LS0A 3UWUA 4JXCA 3S5OA 4WOQA 1TRDA 1A53A 1L2UA 5F2MA 5FF2A 3LX9A 2AAMA 4RXFA 4O0ZA 5I3IA 3W7IA 2CLMA 2A0NA 2QAPA 3W1TA 3IIOA 3W76A 1Z44A 1FCVA 4JN6A 3QFEA 4L4MA 5HR6A 4UMBA 3KFTA 3I7QA 3O6DA 1KM2A 3L2IA 5G1TA 4LV4A 4PL1A 1RVGA 3CWOX 1MZHA 5EL1A 5G5IA 1DQWA 1J5TA 4Y90A 1XI3A 4MUZA 1L6YA 3HPSA 1VS1A 1XXXA 4MLJA 1GVSA 3N2XA 4Y9AA 3T40A 1QPOA 1VHNA 3DAQA 2LLEA 3W88A 3U8GA 1OFDA 1DHPA 4S2CA 5FEPA 5AB3A 1W54A 3EXRA 1L6SA 4C1KA 2A7NA 2ZZ4A 1PL9A 3GDMA 4O28A 1F5ZA 3NL6A 4IMFA 2B7QA 2PRLA 3KAOA 3PBWA 4HT3A 1OFAA 4AWTA 1DORA 3WJYA 2NUYA 1V5XA 1GVFA 3ABSA 3VE9A 1OX4B 1BTMA 3USBA 1LOQA 1A5CA 4FNRA 4K38A 1FDJA 5HJLA 1TPFA 2ZQ0A 4JTFA 3PS7A 2H8XA 3HGSA 3TDFA 4JD4A 1LOLA 1PIIA 1ZENA 1MEWA 3RK8A 1RQBA 3V75A 3N34A 4IUOA 3C6CA 4K7VA 3TW7A 1SW3A 4H3DA 4O14A 4LRTA 5T26A 2G5WA 1S5TA 3NQDA 4JY8A 1VYSX 1KLYA 7TIMA 2VKZG 3GDLA 2PURA 1TJPA 1YDOA 4GE8A 1O94A 2H3BA 1BWKA 2B7NA 3PUEA 4JNMA 5AC8A 3MW7A 2XN2A 5C5YA 5IBXC 1FDYA 2NV2A 2A1YA 2Y89A 2NX3A 3BW4A 5I3HA 4UTKA 3QSRA 4JGDA 3NQFA 1AL8A 2C15A 3QMRA 2VFEA 4N4PA 3SZ8A 2ATMA 3EWYA 2TYSA 3FJLA 3P80A 4ZQOA 1TTPA 3O8AA 4UTUA 3QW3A 4MJMA 4UXDA 5EYWA 4DEFA 1WDWA 3EX4A 1KA9F 2I9EA 3PAJA 4HKPA 2Q8LA 4CQ9A 3PBYA 3CC1A 2VFFA 1OF8A 1TMHA 3FKKA 4JY9A 2ZCGA 5TQLA 4DO4A 2J6XA 4I7WA 1R30A 1WBHA 3LBMA 2HMCA 4M6VA 3L0NA 1M7OA 1RV8A 3S1XA 1XBZA 1OYBA 2ZA2A 4HNVA 5LHFA 4YXGA 3P8JA 2ABBA 3K30A 4ALDA 5KZMA 3GNNA 5C2XA 4FXSA 5DCDA 3BLFA 3MYOA 4ADSA 3HOJA 1XCFA 1W5QA 1K8XA 3B8DA 3N9RA 1RPXA 1TPVA 5FF4A 4O19A 3TW6A 2A7PA 3GYEA 3M9YA 1FWTA 3SSJA 3W1NA 5G2HA 5LHEA 2X30A 1QNVA 1YXDA 3LCWA 1G7UA 2ZZ5A 4CCEA 1JQXA 1W0MA 4CNPA 1KBJA 1KTCA 1H7OA 1XL9A 1FWRA 1X6UA 5AN7A 2ZDRA 5C55A 1V7YA 2NXGA 2A6NA 4UTTA 3LRKA 3L21A 5CZSA 3NQGA 4N9CA 1KLZA 3G1YA 3V1PA 1FQ0A 2WNZA 4BWLA 4JDYA 4HNNA 1JUBA 3ZS4A 4UTWC 3SY5A 2NX9A 1VYPX 2VFGA 1TPDA 1ICPA 2WJZA 2W0UA 3DGRA 1N7KA 5TIMA 1QO5A 1LDCA 2ZTKA 4JX4A 2JBMA 3C56A 4IMDA 1PHQA 4YMZA 1XUZA 3W72A 1IIGA 3G3MA 5DXYA 3BLEA 1G67A 1G69A 1GWJA 3DENA 3OHIA 1H63A 4YLWA 1LBLA 3FLUA 3W7RA 1G4PA 4W9TA 3G8RA 3C61A 1AK5A 3TUUA 3CHVA 2V2CA 2E6FA 4UNKA 4OU1A 4XWUA 3LXCA 1SU5A 4BFAA 1OYCA 4NJIA 3T7VA 1J4EA 3TIMA 3UPBA 2W79A 2O7SA 3G22A 2QAFA 5LKYA 1W5MA 1Q6QA 4FIQA 1H7NA 3VCRA 4MZ1A 2YYTA 3KVMA 2CLLA 1HUVA 1O5XA 3ELFA 1QMLA 3W7OA 3R8RA 1ZJIA 5FEWA 3W7QA 5AC7A 3A21A 5G4EA 4M5PA 3IVTA 1KM3A 3A22A 1GG1A 3GDRA 3LOTA 5CPNA 2PE4A 4MVAA 1I2OA 4BI7A 4O52A 2QCMA 2DORA 4M7TA 1LYXA 1XUUA 1O5KA 1TPWA 3TSDA 3H54A 4ZVJA 3UZJA 2FPYA 3T55A 4XKYA 4E38A 4NJJA 1W56A 5U4NA 5FF7A 5K9CA 1RQHA 4KWWA 1TV7A 2E09A 1EPXA 2JGQA 4UCGA 3U2OA 3BG9A 2GQ8A 1JQVA 4R53A 3TKFA 1W3IA 3UYCA 3M0ZA 2BWGA 5D09A 4XQ6A 2QDHA 2C16A 4O10A 4Z0JA 3WK1A 5CZTA 2DZVA 4A2SA 3D0CA 4MFDA 3DHDA 2G96A 3A5VA 4O11A 4WOZA 4M6QA 5AFDA 3RNDA 3HGRA 2V5LA 3STCA 5J5DA 3STGA 2V9DA 1NEYA 4ONVA 1LM1A 4XZ9A 4WQ6A 3HG5A 1FDZA 3TJXA 3G0XA 1A5SA 1KFEA 5HNRA 1GJPA 3GXNA 3NQAA 1C8VA 5FI8A 5HWNA 3BO9A 3EX1A 5F2LA 3IIZA 1YPFA 1FWWA 1FY6A 2ISWA 3G1FA 3HMJG 1ALDA 2B4GA 6TIMA 1F74A 3G1DA 3OVPA 1M6JA 2FLIA 3OEXA 4PODA 3JRKA 3E0IA 3HG4A 4FHAA 3W75A 4A2RA 4HIBA 1VCFA 2A7RA 3R13A 5AC6A 4YWIA 1SW7A 4Q4KA 4RK8A 5AHEA 3LHWA 4R33A 5FEZA 3TV8A 1LORA 4N9DA 3OG3A 1R46A 1TREA 5CZ0A 1F7BA 3SGZA 1EA0A 3A24A 2F7FA 3MYPA 3DHFA 5BW6A 4JTUA 4UR7A 3Q2DA 3I65A 1NSJA 1SUXA 4Z0SA 4EWND 5F2IA 2ZA3A 3BV4A 4RX0A 4JIPA 4IJBA 3IGUA 3H53A 4IX0A 4Y96A 3W7LA 4GUFA 3C2VA 5AHIA 1AMKA 4BK9A 3NQVA 1IXQA 5F4WA 4HNTA 2CWNA 2E5CA 4LRSA 1BWLA 5I3GA 2NWRA 1B4EA 3UPWA 1FCUA 1OX4A 3PM6A 4ZL1A 4OE7A 2QCFA 4PTNA 5K9XA 3NL3A 1PVNA 4BWLC 3EX6A 3GAYA 1H7XA 1KV5A 3M5XA 1GZGA 1UCWA 3FIGA 4O1CA 5CSSA 2ATSA 2QUUA 3KRZA 3LCGA 5EMUA 2ZZ1A 4LOCA 2H8ZA 4LC8A 4UC5A 2QCNA 4OWGA 1KBIA 5KMYA 4JTJA 1KTNA 1XKYA 3W7GA 1DL3A 2YYUA 1VCGA 1M7PA 2Y70A 3G1AA 4AF0B 5TBOA 4DF2A 2JKAA 3LGEA 2E1DA 4JTLA 1EX5A 1QPQA 2HSAA 3OVRA 5F4XA 2ISSA 5CSRA 1I8JA 4FNPA 3O6YX 4O57A 4XBKA 3LRMA 4Y6GA 3NPWA 1G6CA 3E96A 4LS1A 1H60A 1GTEA 3W22A 3IRDA 4LVBA 2GVJA 1TSIA 1JRBA 4UFMA 4YCOA 1Q3NA 2YPIA 2E5BA 1TTQA 3W7EA 3NQCA 4UNLA 1H1YA 3WFAA 3BGJA 1IIHA 2GOUA 3SECA 1I2PA 4N9EA 1ZHAA 3IEBA 1DV7A 3M6YA 4X9SA 3HF3A 3NZRA 1KFJA 3EWZA 1FWSA 4LVDA 2NX1A 2V8ZA 2DZWA 3GB6A 1F05A 4R7JA 1YTEA 3QMSA 5C54A 2PC4A 1FWNA 4PH6A 3G8EA 4ZZ9A 1XDMA 4NQ1A 2VFHA 3U6WA 2X1UA 1SO6A 3LHYA 3S5NA 2XFWA 4KFOA 1D3GA 1O60A 3W7JA 3W84A 4QJ1A 5ABTA 5BRBA 2Y62A 4GUJA 4A29A 4FEZA 4QISA 3ABOA 1LP6A 1Q6LA 2FIQA 2YR1A 3TR2A 3IIVA 1PHWA 1DVJA 4LTSA 4TU1A 4RJEA 2RFGA 4YL2A 4Z1BA 4PFMA 3C2RA 1ZAHA 1YTDA 3LDVA 3EWBX 1RD5A 5U7SA 1KM5A 2A21A 1FUYA 1B4KA 1PCWA 4I9AA 1N55A 1A50A 3T4CA 4O12A 3GR8A 2EF9A 3MHUA 3GIYA 2RDUA 1GEQA 2VELA 5CGQA 1ME7A 4JX6A 1QCWA 2OT1A 3YPIA 3NO5A 6ALDA 2ZZ3A 3CLMA 4IXXA 3C2EA 1FXQA 1FXPA 1KM1A 2CLIA 4X2RA 1LBFA 2V5BA 3NXFA 4IMEA 4CQAA 3W2KA 1DJNA 2YSWA 2QCEA 3TQVA 2TRSA 3L9CA 1H51A 2CW6A 3C2FA 1SFJA 3S1VA 5KTLA 3HBLA 5BNKA 3L5MA 4MLRA 2QJHA 1T8XA 3W1RA 2Z6IA 1BKSA 2CLEA 3TAKA 4P2VA 2JKPA 2PRHA 4IMGA 1EWDA 3G0SA 1K8ZA 3GK0A 3UD6A 1RZMA 4JTGA 3W2NA 3C8FA 4MZYA 4DO6A 2J9ZA 1Q45A 4Y8FA 2Y63A 4A3UA 3TNOA 3TXZA 1WV2A 2JGYA 1UUOA 3PBUA 3L65A 3MUXA 1WOBA 4LVAA 2ISVA 2PCQA 1JRCA 1LRQA 2V2DA 1NVMA 2C0AA 1W8SA 3CQ0A 4JTKA 5D02A 1AL7A 5CPOA 4KWVA 3UQNA 1GQNA 1Z41A 4ZQPA 2DJXA 2G97A 3BK0A 5KZDA 4I7VA 2Y88A 1FCQA 2B7OA 2FJKA 3N73A 1GVOA 1TPC1 5SWUA 2Y61A 1P0KA 1LOSA 2X1SA 4JDBA 4IWWA 3W3OA 2I14A 4LV9A 5D30A 4IMCA 2DJLA 1MXSA 3O6CA 2YGYA 2P1FA 4UFKA 4OBTA 1ZCOA 3RLUA 1UUMA 3CWNA 3M41A 4JYEA 1LRNA 3WK3A 3WK0A 3EKZA 1H50A 2Y6ZA 3FOKA 2XN1A 3QRHA 1H62A 3E9AA 4K37A 4K36A 1CX9A 1TRIA 4P61A 2CLKA 4UTJA 3CEUA 3LERA 2TMDA 1XM3A 3PR2A 4B5NA 3W1QA 3S5ZA 1QFEA 2A6LA 3P61A 4XTDA 4M6PA 2ZA1A 4PCFA 3LHZA 3O06A 3P84A 4RV8A 4GUGA 1DQXA 2DZXA 5FF3A 2QCCA 1K7EA 3TA6A 3GXTA 1LCOA 3TXVA 1I4NA 3FS2A 2X1TA 1H61A 5D32A 4BF9A 2ZRXA 5F2GA 4Q33A 3UXDA 2WV8A 3KVJA 4MY8A 5D2VA 1LZOA 4QAIA 5HWMA 2R8WA 5D33A 5CPMA 2X1RA 2Y7GA 3M43A 2ZBTA 1D3HA 1EWEA 3EEGA 3E02A 1F6KA 1PCKA 3O16A 5AHNA 4FF7A 5CPLA 1FX6A 4O53A 2G95A 1WXJA 3W9ZA 3TJLA 1TV5A 2WO5A 1D9EA 3GKFA 1SO5A 2E6AA 1OFQA 2DU2A 3KVKA 2X2GA 5MHBA 1SW0A 1UBSA 1QPRA 5KSWA 3R2GA 2VEIA 1WYIA 1JVNA 8TIMA 1W5OA 5HULA 3SW6A 4TR9A 2C13A 2VEKA 2WSRA 4JEQA 3QJAA 3F03K 3W6YA 4ZQRA 3N9SA 4Z08A 1PS9A 2OMAA 5D2YA 4GC4A 1TTJA 3DZ1A 4N4QA 3W7CA 4D2JA 3QQ0A 4HPJA 1P1XA 3QEZA 5L6UA 3LXAA 1LLZA 5DN1A 3BW3A 3W7NA 3I7SA 1Q6RA 3IVUA 1F76A 3UWVA 3W87A 3NPVA 2OJPA 4K6AA 2CZ5A 1JR1A 2GQAA 5DY3A 1JUEA 4NJHA 4O0KA 4UFHA 3DI0A 4LS2A 3STEA 4IPIA 3KRUA 2EHHA 1H7RA 5DBTA 3W73A 3QC3A 4MJZA 2BX7A 5C6MA 1CW2A 1Z42A 1TPUA 3BVJA 2O7QA 5DLCA 3W85A 1W37A 4UFLA 3KRSA 1KFKA 5D03A 4DXVA 4FX7A 4FNTA 4NXKA 3S1UA 4OQVA 1OX5A 3THAA 4AVFA 2HS6A 3SI9A 3DXIA 2BZNA 3S0CA 4AF0A 3IIPA 3G0UA 4IOTA 3LCXA 2RDTA 4AMAA 3NA8A 1Y0EA 2DZPA 4RCXA 2FFCA 3GVGA 1OABA 1J2WA 1W3NA 3UWYA 1K7XA 1IXPA 1TB3A 4OGZA 3P7YA 3R5EA 3LTYA 4FO4A 2OCZA 1VPXA 4O15A 4LY8A 2KZHA 1A5AA 1DOSA 2OT0A 2Q8ZA 2VFDA 2YXGA 3DFNA 2J9XA 2V0TA 3QW4B 3LRLA 2FPTA 2C18A 1GYNA 3PC0A 1PE1A 3PULA 2FTPA 4MFEA 4MYAA 1JCLA 4O50A 3W1UA 4NNBA 1ADOA 3UWWA 3L66A 3LLDA 3NGJA 4NT0A 3EWUA 1FCBA 5HMSA 1JCYA 2E6DA 2RH9A 2QDGA 3NVTA 1GT8A 3DU0A 3NPXA 3BARA 5H91A 3LCFA 2BSLA 2NUWA 1OVDA 1K3UA 3EWXA 4JTTA 2CLFA 1RQEA 1IF2A 1EIXA 3AJXA 1ML1A 3LM7A 3C3NA 3VNDA 1K7FA 4FNSA 4UFJA 1JULA 3W07A 3NYZA 1O4UA 2A4AA 3CEPA 3NDOA 2J24A 3LV6A 2VOMA 4UUIA 2ABAA 2AQWA 4JTEA 4CNNA 1SSGA 1G7VA 2NV1A 1ME8A 3I7RA 2QCLA 3RU6A 1QWGA 2QCHA 4MOZA 2QCDA 4O13A 1IGSA 3HO8A 3NAVA 3LTPA 3P5ZA 3W7KA 4S2BA 4AEOA 4JTHA 2Z1BA 3CPRA 2EGZA 1TPB1 3C2OA 3LHVA 3CU2A 5LZLA 4CQ8A 3TMLA 1TQXA 3BLIA 3G1XA 5IM51 5LNSA 3EWWA 3NL2A 5FF0A 1KW1A 3L0GA 5E93A 4A22A 4K7YA 5HWJA 3NPUA 4FNUA 1JCJA 2WNNA 1AW5A 3VKJA 2ZRZA 3PWAA 5F1UA 1G4SA 3S5YA 3M44A 4UMAA 4EOUA 1HO4A 5DY2A 1HO1A 2DZTA 1TV8A 5CZJA 3PF3A 1UB3A 1KFLA 5EPDA 1I45A 4E2DA 5LNRA 4DF0A 3TSMA 4NJKA 3L5LA 3VFLA 2J88A 3TC7A 1EP2A 3TCEA 1KV8A 3HIJA 2BXVA 2TSYA 2YFOA 4NX0A 3S1WA 3FJ6A 3O07A 2ZRVA 4UR8A 4UTTC 1B3OA 1EUNA 3GDKA 4CCDA 3CTLA 3GZ3A 2UV8G 1VLWA 2TPSA 1S5WA 3VE7A 2P10A 1QO2A 2Z6JA 2CLHA 1VH7A 4POCA 1W31A 1VR6A 5K9DA 3ATYA 4N2YA 2WKJA 3Q58A 5I3KA 2OX1A 3N2MA 4HHPA 3TQ0A 4Z1AA 1TPEA 1CI1A 3NQ6A 1MEHA 2FB2A 3GLCA 4GWEA 5A8GA 2E5DA 1EEPA 3BGGA 3LXBA 4LUIA 3NG3A 2EAWA 3GXPA 3DFQA 3T78A 5D2XA 3MP3A 1VYRA 4A21A 3P5YA 1GPWA 2IQTA 3DFOA 3NQMA 4LT9A 3INPA 2ZRUA 4LVGA 5EBUA 4MYXA 2C6QA 3PSWA 1DKWA 3QZEA 4AWSA 1THFD 1YYAA 4TMCA 4XTIA 5I3JA 5HR7A 2ZTJA 3MO7A 1QPNA 1SFLA 4FX8A 4GRSA 1C9DA 3IGXA 3L67A 5CG7A 4J9JA 3NQEA 4WX2A 3HQ1A 3S9YA 3TMQA 2ZYFA 1TIMA 4ORMA 4RR4A 2DP3A 3C52A 3W7PA 2FPVA 4JYDA 1H1ZA 3LI0A 4R34A 1JCNA 4WXZA 2DZUA 5EY5A 4UTMA 2ZZ2A 4QIUA 2GJNA 4O1BA 4HSOA 1M5WA 3DKLA 2H90A 2Y7EA 4AAJA 1AG1O 3DFTA 1TPH1 1XBYA 4KKXA 5DBUA 1KM6A 2R14A 3W71A 1I2QA 3ABRA 3UXAA 3SR7A 1L6WA 4RZ4A 2QCDB 3W74A 3M1ZA 3PUDA 3GNDA 2GVGA 3W2JA 5BMXA 4GUHA 5G1YA 4WZHA 3SIZA 4XBSA 5D05A 3TROA 1OG0A 3HJZA 3QPZA 3DI1A 3TU9A 3MP4A 2WSYA 3TX9A 1XBVA 4NU7A 1WX0A 2QJIA 3SGUA 3NR0A 3G24A 2R91A 3NQ8A 3W23A 4QNEA 3WK2A 4UTHA 3MMTA 3QQ1A 4N6EA 4U4MA 2C3ZA 4ZQNA 1EP3A 5AHMA 1SZFA 5DCEA 4YCPA 2HS8A 3TK7A 1GG0A 4QNWA 1ZALA 1F2JA 3E12A 3P67A 1VCVA 4MY1A 4CNOA 4WUIA 4O1DA 3OIXA 4E2BA 5AOUA 3CIXA 3HPZA 3M5ZA 3B0PA 1OX6A 2E68A 3DKJA 3MHFA 4LUJA 3LBCA 1X1ZA 4GXMA 1R2TA 4AB4A 1F6PA 5F1VA 2VEPA 3GKAA 4RKAA 5LNUA 4OV9A 1GVRA 5KINA 3MI6A 4C1LA 3HG3A 3OVQA 1U5JA 4DO5A 2VEMA 3T44A 4PL2A 4LNYA 3NM1A 3MWAA 4U28A 1H5YA 3MHGA 3THQA 1WOAA 3NZ1A 3H55A 1GYLA 3FKRA 2Q3RA 3MI2A 2QUTA 1VQTA 1YXYA 3B04A 4O18A 4IPJA 4TO8A 3N3MA 3G18A 3N19B 2QR6A 1I2RA 1QDSA 4JS3A 3W2LA 3M7WA 3W2UA 3KX6A 3O05A 4O4VA 3F4WA 5LGXA 3LI1A 3B0UX 4WXYA 3A9IA 2EPHA 3W2MA 4RZ6A 3EXSA 4QSHA 4AHOA 2CFFA 2YFNA 3GAKA 4O17A 1VLIA 2V2HA 5J5RA 4UMCA 1ZFJA 4DF1A 1H7WA 3BG3A 2J9YA 1PV8A 4GUIA 1LTDA 1QOPA 1KM4A 1S5VA 4EF9A 3BPWA 4MPQA 5E1QA 1X8FA 3NNTA 3HGJA 4OV4A 4NZFA 1YDVA 1VHCA 5K7JA 2NUXA 1SR9A 2D73A 1ME9A 2YZRA 5BMWA 4FB7A 2A85A 2QJGA 3TQKA 1R47A 2QUVA 5AHLA 1KFCA 1DBTA 3TSBA 1KTBA 4JIQA 3GDTA 4WY0A 2NWSA 3PG9A 5G2WA 2GQ9A 3QF0A 4S1FA 2GVLA 5GVJA 3W86A 1GVQA 3BW2A 1EP1A 2VFIA 5EA9A 4G1KA 1TTIA 3A5FA 1OFPA 3PVFA 3P8IA 4GJ1A 3MP5A 1LRTA 1ONRA 1YTKA 2ZFAA 3R12A 5K4XA 3L0KA 3HGOA 4BR1A 1T0OA 1KM0A 4MZ8A 4O8RA 4TMBA 3KXQA 3HB9A 1K8YA 4JYFA 5K3VA 3M16A 2Y7FA 4K8HA 4QITA 3MBFA 3B03A 3M5YA 1B57A 4BI5A 3W1LA 2RHGA 4LU0A 3L5AA 1GTHA 1P0NA 4Z1DA 3G1VA 1YXCA 3UY7A 5LNWA 1JCMP 4DPPA 1GOXA 1BEUA 5D04C 2YX0A 4O16A 2V81A 4LC6A 1VZWA 4EF8A 3QPYA 3ANYA 1XDLA 3HG2A 2FQIA 1HL2A 4ADUA 1VRDA 5L9FA 2ZZ7A 3P82A 2FB3A 3IIXA 3Q37A 2Z0IA 4NVTA 4I7UA 3TFCA 1A5BA 1ZAJA 1X1OA 3CIWA 1IXOA 3UWQA 4DBDA 4IXHA 2A2IA 2H6RA 2NXHA 2XN0A 4JX5A 3LHUA 1K02A 1SZNA 5D2TA 1HG3A 1HTIA 1OJXA 3QMTA 3S6DA 4RXGA 3W1PA 4FX6M 5FESA 1AW1A 2CLOA 3PG8A 3FA5A 4AWUA 1VJIA 1HFBA 1C29A 1TCDA 1YADA 5HUPA 2C19A 1YDNA 1L9WA 5EKYA 1VGAA 1EB3A 4WY0F 1NFBA 3CM4A 1K03A 3S42A 3ABQA 3RLVA 2I1OA 3W1AA 3LHTA 3RFAA 5KITA 2BLEA 3B4UA 3P60A 4N02A 3LCHA 4RLIA 4UTLA 4TX9A 3DH7A 3EXTA 3KVLA 4PEKA 4BI6A 4AHQA 5HINA 4ZQMA 3S8HA 5K2ZA 4IGHA 1QOQA 1MO0A 2B7PA 3CB8A 3RF9A 3WJWA 2WOQA 4AH7A 1W5PA 1F73A 2BTMA 4JTIA 1O95A 4NNCA 3PBVA 1OFRA 3WJXA 1NAL1 2Z2UA 1OHLA 3G1HA 4DELA 1ICSA 3EX3A 2Q3OA 2VC6A 3UZ5A 3LCLA 2WPBA 2C1HA 4Z1CA 5G4WA 3F4NA 3NQ7A 3UY8A 2RKXA 4HN4A 3FYOA 1LLWA 1Z48A 1QR7A 4M19A 4NXSA 4O1AA 1TYGA 2ZRWA 4WJEA 5LSMA 3JR2A 4M7SA 1WQ5A 2YDAA 3P81A 2YW4A 3A23A 3MI3A 3RMJA 4KFNA 4TIMA 3NM3A 5D38A 3C4UA 3WJSA 4ZQCA 2H3DA 4WY0B 3PSVA
chains in the Genus database with same CATH superfamily
3IUHA 1AD1A 3II1A 4JICA 3W7MA 4WRHA 3B05A 2OB3A 2ZICA 1N8FA 2QEZA 1FBAA 3WJZA 4DUVA 2XVNA 2BHUA 3EDKA 3LB0A 4NUWA 4B91A 2CZVA 1GK8A 1AJ2A 2ICSA 5KZEA 3AMLA 4DRSA 1OCJA 2WXDM 2CERA 3BTNA 3RCNA 3IGHX 2QUNA 2A5HA 2ZZ6A 4MM1A 1KD0A 1OYAA 3NCOA 2QF7A 1DP0A 4PA8A 4MWAD 2PDQA 4LWWA 1KRBC 2IPGA 1AW2A 1PX3A 5IFTA 5C0QA 3H6OA 3AICA 1T99A 3TAOA 4PTVA 4CKQA 4I5XA 5DCBA 2PDYA 4AHPA 3K5XA 1V3KA 1JPDX 2YCEA 3QSTA 3RRAA 1VFSA 3U2CA 1PZ2A 4IUGA 4ADTA 1Q6OA 5D2WA 1M1BA 1V0KA 4RW3A 3FEMA 3EWDA 3WQDA 1MSSA 3STFA 3D3AA 1TUFA 3W1XA 4QQ3A 4W89A 1V0NA 3UWZA 2BGSA 1PX8A 1XD1A 3N14A 4EPBC 4IQLA 4WEVX 3UJ2A 1E51A 1ZY9A 2PEVA 4KGLA 2NLYA 2NLIA 3NEVA 1Q7ZA 3FNDA 1XX1A 1K70A 2GYIA 2PDHA 1UP0A 1SMDA 3TFXA 5HBFA 4LVFA 4IT1A 1ZGDA 2AL1A 1X7FA 3TE9A 3KBJA 4HPXA 4KWOA 3QYQA 1T96A 1J0KA 4GYFA 1FWHC 3GX9A 4FIRA 2HRWA 4KCVA 2Z27A 3VNLA 1XP3A 2PF8A 2ODOA 2W6RA 4E0CA 2J78A 3F2CA 4TQTA 4L4OA 3QOKA 4LH8A 4GNJA 1V0MA 3MS8A 2CWXA 3O15A 4PFHA 4ZA0A 2PTZA 1A5MC 5BOOA 3ZJ8A 3ITYA 2OZTA 4EVZA 3D5HA 3TH6A 2FDSA 3VIJA 4YNGA 4M6UA 4IIHA 3CGTA 4UFIA 4HA0A 4LYPA 4KFPA 4FALA 4F2UA 2CZDA 4ORIA 2HVNA 2BB0A 3ZWSA 2PDGA 4DJEC 1GJWA 1W1ZA 3OU8A 3OW1A 3TTSA 3PZOA 2YBUA 1VC4A 1OQFA 1G4TA 2OKOA 4DBWA 3LNMA 2PWVA 1IE7C 2PWGA 3R7MA 3UR7A 3C0JA 1ZUAX 3O63A 3WLJA 3OA3A 4FXRA 3HPXA 4P7RA 4L65A 2CKRA 4H6KA 2XH4A 3SFKA 2RDWA 1FWGC 1K8CA 1VEMA 3F1QA 1TA3A 4B90A 4UTWA 4AFYA 1Z89A 3N6HA 1TJRA 1W6TA 3OIHA 3T05A 1R2SA 1MW3A 2D3LA 3GR7A 1W91A 3QBUA 2P50A 2QT3A 1F3XA 1PDZA 3L23A 2PMQA 3THCA 3THUA 1A53A 2Z1KA 1H1NA 1SZRA 4O0ZA 2V5KA 4X60A 3FK4A 4PN2A 4H2HA 5JMUA 3IIOA 3W76A 2PGRA 2QDEA 1WZLA 4UMBA 5T91A 4AUBA 2ACUA 4MHBA 3GFYA 3I7QA 1OY0A 4UOJA 1AQMA 4PL1A 1MZHA 4IQJA 3NDYA 4B3ZA 4GZ7A 5CSYA 1EH9A 4Y90A 2POTA 4AEFA 2XPKA 5A2CA 1UW9A 1XIFA 3OB8A 1NARA 4Z2HA 4Y9AA 1VHNA 1GQLA 3DAQA 1BYBA 3UG3A 1EJSC 3U8GA 4W93A 1DHPA 4S2CA 3UVAA 5FEPA 4L9YA 3EXRA 4DUOA 1L6SA 2W62A 2A7NA 2ZZ4A 4IMFA 5XINA 4EPEC 3E5PA 4GVFA 5BWFA 4IGNA 1XIEA 1DORA 5D9NA 5LA2A 3BMXA 1V5XA 5I77A 3ABSA 4Y9OA 1P0BA 1Z7AA 1RY0A 2Z1VA 3USBA 1T41A 4F2TA 1X6NA 1IGWA 3QYSA 4JTFA 4Z2LA 3HGSA 4YWSA 4JD4A 2XJ7A 3WD0A 1PIIA 1ZENA 5LXEA 4CVUA 3N4EA 1C9WA 2VDIA 5C8BB 3SURA 1GHSA 2FGLA 4YHGA 1EJVC 2G5WA 2X0SA 7TIMA 1XIMA 3CNYA 4NAFB 3GDLA 1NWSA 2B7NA 4JNMA 1R3VA 2XN2A 1XLHA 3WUFA 1KR1A 3POCA 1XIJA 4DNMA 2VD8A 4PGLA 2XH0A 1US3A 1JDFA 3QZAA 4UTKA 1C3FA 1WKEA 3V0TA 5E0FA 3WH8A 4LJ3A 1AL8A 3UP8A 1AMYA 3B9DA 1A5NC 2V38A 2IW0A 3SB0A 2GVYA 1BQCA 3QW3A 3WLKX 3FSTA 1WDWA 4H6QA 3EX4A 4NASA 2PODA 2ADAA 3KTCA 4CQ9A 3PBYA 3CC1A 1OF8A 1TMHA 4HZ7A 4C6JA 2ZCGA 1UR8A 2FZ8A 5TQLA 1F3TA 4DO4A 2NT1A 1XIGA 2GL5A 2EPOA 1R30A 1UWUA 3H2OA 1PPIA 3OZPA 4HMEA 1F61A 1EZWA 2HMCA 3F7JA 1E3ZA 4N7QA 3S1XA 1TV4A 1XICA 5DT7A 4BHYA 4ALDA 2ABBA 3K30A 4GBDA 4ADSA 2GGJA 1M7XA 1ZBKA 3MSGA 4B5WA 3TW6A 2A7PA 3LG3A 3W1NA 5LHEA 3CPGA 1Y7VA 3UR2A 5FJJA 4ZFCA 1G7UA 2ZZ5A 3TYAA 1H7OA 2CIPA 1LWHA 1X6UA 5AN7A 1XRTA 2ACRA 2BDQA 4NSBA 4DJFC 2Q6ZA 1GOMA 1MZRA 3AWOA 3L21A 1FQ0A 4I6VA 4KERA 4L9ZA 1VYPX 1AUSL 2W0UA 2PTYA 5TIMA 3WLLA 1QO5A 1E6XM 1LDCA 2ZTKA 2JBMA 4YMZA 3CHCA 4JTAA 3VGBA 2POZA 1GWJA 4LB4A 3DENA 1H63A 3BAJA 1LBLA 4LANA 4IPPA 1XSJA 3BOXA 1G4PA 1XS2A 4IP5A 3G8RA 3VO0A 2OLSA 3HM7A 1JF5A 4XIMA 3LXCA 4BFAA 3LZ5A 3NFUA 1UWIA 1WKDA 4L6DA 4PMDA 4Q7BA 3AZSA 1DXIA 3T0TA 2TAAA 2QV5A 4FIQA 2YYTA 3KVMA 2HWGA 2CLLA 2BNJA 2WLZA 5HXMA 2E8YA 4QAWA 1DE5A 3SIMA 3W7QA 3A21A 4AG0A 3IVTA 2HPMA 3DBNA 1GG1A 2PE4A 3L4UA 4DZIA 4BF7A 4G7EA 2QCMA 1GEHA 1E0TA 1O5KA 1X6LA 3OZOA 3CV1A 3M4HA 1QW7A 3UZJA 3M0LA 3OYXA 3DGBA 1TV7A 2E09A 2JGQA 3GNOA 4AD2A 5LIXX 2GQ8A 5E0CA 1NM9A 2O55A 2UZ9A 2BVDA 4DJDC 3CYVA 2RJHA 1VJZA 3VX1A 3M0ZA 2HBXA 3W81A 5D09A 2QDHA 4O10A 1I75A 3D0CA 2G96A 4O11A 3CL8A 5CAKA 1TJ1A 5EMMA 4CNTA 2CCRA 3HGRA 3M0IA 4HN8A 3VTRA 1XDJA 5D9PA 4LEQA 6ENLA 3REQA 4AC7C 2WCAA 3G0XA 4V1YA 1WZAA 4KEZA 2ZXBA 1O5RA 1QATA 4NZ3A 1C8VA 5FI8A 1JYVA 3VZZA 4GX9A 3VOCA 1A3HA 3QHNA 3EX1A 5F2LA 3IIZA 1YPFA 1FY6A 2ISWA 4B3LA 1BRLB 3BAKA 3VVGA 1V6UA 2C1GA 3BC9A 6TIMA 1F74A 3QV9A 1BVWA 2XDFA 1L8PA 1B9ZA 3OVPA 4ATWA 1M6JA 1E9ZB 2UY3A 4UNIA 3ZZ1A 3H2NA 3HG4A 3QR0A 4DZ5A 5AC6A 1XSKA 4RK8A 5AHEA 2R1NA 2OPJA 4GMEA 1BYAA 5DRCA 5FEZA 1J11A 2E9LA 1KGXA 1LORA 1DWHM 3OG3A 1HJSA 5CZ0A 4FZIA 2ZIDA 3PWGA 4PRTA 1AVAA 2ZX7A 1SUXA 4EWND 2GSEA 2MUCA 4KCTA 4GACA 3R1ZA 4A3HA 4J3XA 4IJBA 1EEXA 4YU1A 4DWSD 3BXWA 4GUFA 4GYJA 1AMKA 4BK9A 3NQVA 4GISA 5F4WA 4HNTA 2HPIA 4DWDA 5EMJA 1FCUA 1PO9A 3PM6A 1U30A 3W26A 1NY1A 1KBLA 4X61A 1UZ1A 2QGHA 4OE7A 2QPXA 2QCFA 5K9XA 3QHOA 3M5XA 4JTDA 3GW0A 1US0A 5CSSA 2ATSA 1C91A 2QUUA 1UD6A 3SCVA 3F4CA 5EMUA 4QJ4B 4LOCA 3WFZA 3HPFA 2QCNA 5J8LA 3W28A 2BXYA 1D7FA 3C3UA 1C7TA 1QU4A 1DL3A 2Y70A 4AF0B 2JKAA 2XISA 2OQHA 4AMCA 3HJEA 1ZRQA 4JTLA 1FA2A 3KCJA 3ICJA 5CBIA 1QPQA 5FA5A 2HSAA 5F4XA 2ISSA 4FA3A 4C6EA 2VRJA 5CSRA 4MDOA 2WLYA 3O6YX 4O57A 4Y6GA 4LBUA 2J79A 1GOKA 2HVOA 2YL9A 4J5NA 4QE5A 3E96A 4M8UA 2PPGA 1NP2A 4LVBA 1F07A 4UQ9A 3CIVA 4TX8A 2YPIA 2E5BA 3UG5A 4L6OA 2VUNA 2VQTA 4B4HA 1H1YA 3BGJA 1IIHA 4KETA 1I2PA 1JF6A 1ZHAA 1L2QA 1ADDA 2OWWA 3LYEA 3KOWA 3SO7A 1KFJA 1V6XA 3DFHA 1R3QA 1GVIA 3MVIA 1F05A 4R7JA 2HQAA 5C54A 3OHMB 3CXOA 3CUJA 4OZOA 2PC4A 5A6JA 3WMSA 3K8MA 1EHNA 1X39A 5IHRA 2VFHA 2RAGA 2D0GA 3BH4A 4IP7A 1FWEC 1SO6A 1ZTVA 3S5NA 3WH7A 4PRWA 3W84A 4QJ1A 1IWAA 2Y62A 4MTVA 1J93A 1E4LA 3CZEA 4GUJA 4FLRA 2EQDA 3CUGA 1LP6A 1Q6LA 3TR2A 4ZO9A 4IM4A 3IIVA 3OLEA 4LTSA 5EMYA 1ZAHA 1YTDA 4S3JA 2F38A 3WLHA 4V1XA 3H7RA 2QYGA 3ARRA 1K6AA 1RD5A 5U7SA 2PP0A 4LUYA 1J6PA 4O12A 3DG6A 2EF9A 3GR8A 3GIYA 2VELA 1J6OA 3N29A 3YPIA 2Z24A 3RR4A 2R1MA 3CLMA 3HMCA 3KLLA 1FXPA 1KM1A 4DIAA 3NXFA 4IMEA 4PUMA 4WK9A 3H24A 2HVMA 1DJNA 2YCJA 2QCEA 3CYJA 3A13A 4JQ1A 4J3UA 1SFJA 4HB7A 3WF1A 1E6ZA 3HBLA 1SJBA 2DPEA 3LU2A 1R38A 1T8XA 3APGA 3GG1A 3IACA 1Q65A 2Z6IA 1BKSA 4P2VA 4PTDA 4F0RA 2PRHA 4IMGA 1EWDA 1FWAC 1DPMA 4GC3A 4B5XA 1MRQA 3I4EA 3ARPA 3T0CA 3W2NA 4MZYA 2G3IA 3B8WA 1TG7A 4IIEA 4L1XA 4H9XA 4KCUA 3SCWA 3QGKC 3RLGA 3VM7A 4Y8FA 1E72M 2R9RA 1PUDA 1UUOA 4R7OA 2WM1A 4M0XA 1BWVA 1HJWA 4AZIA 1LRQA 2V2DA 3NYDA 1W8SA 3S46A 2BY0A 3MPGA 4XZNX 1FHVA 3UQNA 3ITGA 4ZQPA 1NQKA 4MWAC 1VPQA 5F7UA 4REQA 5BZAA 5A95A 2B7OA 1DIKA 2W9MA 2Y61A 2X1SA 2O92A 3RITA 4KMQA 2I14A 4S38A 3PPFA 4LV9A 3O6CA 4DWSB 3OGRA 2P1FA 4UFKA 3TEVA 3CWNA 2BGQA 4TVUA 1LRNA 4QS5A 3WK0A 1O7AA 2QUMA 2XN1A 4K36A 1CX9A 3PR2A 1W9PA 3W1QA 1PDYA 2G37A 1RALA 4E4FA 3F2DA 4M6PA 4S3GA 1FWDC 4PCFA 3LHZA 3P84A 2V5CA 4HPHA 2QCCA 4JKMA 3GXTA 3FS2A 2C7FA 5D32A 5FJIA 1H5VA 2WJDA 2ZRXA 2PDPA 3WBYA 3TYCA 4Q33A 5AECA 2WV8A 3CBWA 3KVJA 4JPGA 5D2VA 1E1CA 1LZOA 4F0MA 1PYMA 1K9FA 5D33A 3PFRA 7A3HA 2KAUC 2X1RA 4FXJA 1M41A 2ZBTA 1K9EA 2XFRA 4TVCA 4Q7NA 5JBEA 3TC3A 1PCKA 3O16A 3N4FA 3WNKA 1R9ZA 5C7VA 4H8UA 4GI4A 1FP9A 1TV5A 1D9EA 3GKFA 4XB3A 2DU2A 5E6ZA 7REQA 2P5NA 4PBFA 1FHLA 1SW0A 3G2GA 4U2YA 3BZJA 2ZE3A 2WC4A 4C6PA 3N4AA 1IZCA 4JFWA 2D20A 1W5OA 4AIUA 1FH8A 4J3VA 3SW6A 2C13A 1MXGA 1BXCA 2J74A 3QJAA 3W6YA 1U5VA 2WVVA 4X2PA 3DZ1A 3W7CA 4IG2A 3FW6A 4FP1A 3I7SA 3IVUA 1SFSA 1F76A 3UWVA 3EMCA 4XZMX 3KDOA 4H6EA 2OJPA 4K6AA 1V8EA 2CZ5A 3CT2A 4J2MA 5E5CA 1UKOA 1JUEA 4ZFMA 4GGBA 4UFHA 3DI0A 4FOUA 3VABA 2EHHA 1H7RA 2RDXA 1A4LA 1IT7A 2J7DA 2E25A 3SUVA 5IDZA 1AH3A 4GYKA 2G3FA 4M24A 2O7QA 2WZEA 3CUXA 4UFLA 4YN5A 4PEEA 1DJZA 4DXVA 4FX7A 1W9VA 4ACYA 1HJQA 3LD5A 3MUY1 2PZ0A 1OC7A 4AVFA 3WF2A 3SI9A 4H7ZA 3DXIA 1YRRA 2BZNA 3G0UA 1ZJBA 5LIWX 3JUGA 4JAWA 2XVPA 5C2GA 1O66A 3GVGA 1OABA 3AXKA 2IKJA 1K7XA 3GXDA 3P7YA 2OCZA 2J7GA 4LY8A 1MI3A 1R0MA 3GTIA 3M6DA 2V0TA 5CPSA 1GUVA 4ATDA 2VD9A 4F8XA 2FTPA 2DSWA 3W1UA 1QWKA 4NNBA 3LLDA 2E0PA 4NT0A 3EWUA 1SYTA 4TV6A 1JCYA 2RH9A 2A3HA 2QPUA 1OGGA 3NPXA 3BARA 3ITLA 3M0HA 3LCFA 4QROA 1UPMB 3V5CA 2VEGA 3BLKA 1RK6A 1EIXA 2QULA 3UZWA 1JULA 3W07A 4HA4A 4HZ8A 4PTXA 3NYZA 4P8UA 3LV6A 4CQBA 4QTGA 3W01A 1YE4A 2ABAA 2AQWA 3T09A 1SSGA 2JF6A 2V3GA 3RU6A 2QCHA 3VOFA 4MOZA 4O13A 1IGSA 3NAVA 3CS2A 4RNFA 4UB9A 2FVKA 4ZBCA 2Z1BA 3TMLA 3BJTA 4Q4SA 1TQXA 1ITCA 4YTUA 3URAA 3ZSSA 1CGTA 3C5QA 5DFAA 3VIGA 4A22A 3SCPA 4IIDA 3UZYA 4CEXC 2RGLA 1ZQ5A 1AW5A 4M81A 4B9YA 4RDVA 4QE1A 3WLIA 3OOQA 3S5YA 3M44A 3TYUA 4U33A 1KXTA 1GOQA 1LQ0A 4LAMA 1HO1A 3B8VA 2DZTA 2ZX6A 2VZOA 1M7JA 3GU1A 3PF3A 1UB3A 3RM8A 5EPDA 3V36A 1UH3A 4DF0A 4G1NA 4E2OA 4ZO8A 5DO8A 3VYLA 3CZKA 4OUIA 2PZNA 1KXQA 2YFOA 1BF6A 3MWCA 4MNLA 1IT0A 3S1WA 2G4JA 4UTTC 3M0XA 1B3OA 1H09A 1U33A 1VLWA 2YB1A 3VE7A 2E7FA 1E9YB 5AC5A 1VH7A 5K9DA 5A8QA 4IIBA 3KS6A 1MFVA 4D71A 1LL7A 2F61A 3E3HA 3R79A 3N2MA 1MEHA 2FB2A 1O5QA 1XQLA 1RXOB 2OSXA 3MANA 1IWBA 2E5DA 2WNWA 1Q8JA 2G3NA 4E3TA 2D2JA 3LXBA 3IRSA 2DT1A 3GXPA 3KL3A 3T78A 2Y4SA 3H2CA 3R10A 5D2XA 5DEZA 3RIKA 4BKNA 3M64A 3N2OA 3NQMA 1T8QA 4E2VA 1D8CA 4OFCA 5EBUA 4MYXA 1E0WA 3QZEA 2DIKA 4XTIA 5I3JA 2OEKA 2ZC8A 2ZTJA 2XVLA 3MUIA 4IF2A 4F66A 4GKTA 2WMKA 4D6GA 4JYDA 1H1ZA 3WQ8A 3G5EA 4P7OA 4GZIA 1X8CA 1NOUA 4NILA 1SGJA 3GU9A 3TN5A 4O1BA 1XF0A 3N2BA 1M5WA 2Y7EA 4PBGA 1TPH1 7PTDA 3PPCA 3UR8A 3W71A 4J35A 3ABRA 3UXAA 3WELA 1EBGA 3K13A 1L6WA 4RZ4A 2QCDB 3TROA 2EO7A 1R9YA 3HJZA 5MKGA 4LYRA 4H7VA 3NR0A 3NQ8A 3W23A 4QNEA 1OD0A 3FJNA 3EDDA 4U4MA 3U4FA 2C79A 1EP3A 2BV9A 5AHMA 5DCEA 4YCPA 4UQAA 3TK7A 4LBSA 3JW7A 2ZWZA 3GG8A 1VCVA 4CNOA 3OIXA 3FAXA 4GIRA 3ZQ9A 1YBQA 3MHFA 4DVOA 1BPLB 3LBCA 3U5UA 7XIMA 5F1VA 3A3HA 4K8GA 5KINA 3ZVIA 3AJ7A 4J2PA 4PB3A 3H22A 1U5JA 4N0RA 4PL2A 1EJTC 3MWAA 4PBEA 1YNYA 4H41A 3BANA 3R58A 5A2AA 3S83A 3VIFA 3HZ3A 2WMHA 1P6BA 3MI2A 2AOSA 1VQTA 1YXYA 2VL4A 3B04A 4W5UA 3N3MA 2YLAA 3G18A 3N19B 1I2RA 4KWSA 3W2UA 1QUMA 1EXPA 4I9TA 4TX6A 3FA4A 2BBFA 4OOZA 3WO8A 1KWKA 2X0YA 2QMKA 3GHTA 4AHOA 1Z6KA 1MVYA 3ABXA 2CFFA 3BOFA 3APYA 1P48A 1JYWA 4GVHA 4DF1A 3QVQA 5A2BA 1BHGA 4OV4A 1JGIA 1QRQA 3COTA 1TZ7A 3MCOA 3TYEA 1SR9A 1RK5A 2YZRA 4GCXA 2A85A 4JIRA 2QJGA 4U2ZA 3QTGA 3VDCA 1QHOA 1HT6A 4AYGA 1KQZA 5ECUA 4MNJA 3UWEA 3OJGA 2J7BA 2GVLA 2HNEA 1UR4A 4CN6A 5EA9A 1AH0A 1TTIA 4L1GA 1EXBA 1OFPA 4JFVA 1ITUA 3P8IA 3GM8A 2ZFAA 3WN6A 2EPKX 3L0KA 5K4XA 2YCIX 3HGOA 1T0OA 1KM0A 2W92A 3HB9A 1E0XA 1K8YA 4R7WA 1HVQA 2HE5A 1K4HA 2Y7FA 1OGSA 3KS5A 2QXWA 3MBFA 2PF0A 1BKHA 5JXQA 3ARQA 3T2PA 1HZYA 3A4JA 3KHDA 1HKVA 3RILA 2OSYA 3I6TA 4AVNA 1Q6CA 1JZ3A 4J4KA 3GC4A 4Z1DA 2VT0A 1R3RA 1J96A 5AYIA 4JKLA 1VZWA 2WZIA 4Q6XA 1XDLA 1TX0A 3HG2A 4O1EA 1Q6FA 5T9CE 3U4AA 1VRDA 3WQ5A 3P82A 2FB3A 1UOKA 4MNKA 4NVTA 1L0PA 1E6PA 5DMNA 2VCCA 1ZAJA 1X1OA 3CZ8A 3DYPA 3CL6A 3LHUA 2IXUA 3EBVA 4I5RA 1SZNA 3TVAA 3H4GA 1HTIA 3VGDA 1FTXA 1K77A 2CLOA 3PG8A 4RNIA 1VJIA 4O1FA 1TCDA 1V03A 4ZB5A 4WJXA 3WH9A 1M03A 5EKYA 1XLJA 1EB3A 3RLHA 5MF5A 1NFBA 4DN1A 1WKFA 3HQPA 3U3HA 2C1IA 3RFAA 5KITA 2BLEA 3B4UA 9CGTA 4KQNA 2YA0A 3WQOA 4RLIA 1Z32X 4DI8A 3U7BA 1QK2A 4MSSA 3WQEA 4UWMA 5CSUA 2PD5A 3ANVA 3F4DA 4JFTA 1K6WA 3TOYA 2WOQA 3PTDA 4FF5A 4JCMA 1W5PA 1E0VA 5EMLA 2BTMA 4UQBA 4AZGA 4NNCA 3WJXA 2Y8KA 2Z2UA 1OHLA 4IICA 3EX3A 2Q3OA 2WPBA 2P3ZA 3WBAA 1V6WA 3F4NA 1XLEA 1RCQA 2Z4GA 4HN4A 1LLWA 2INZA 4HJFA 4W7WA 2QW5A 1VPYA 2ZRWA 1DXEA 1M3UA 3P81A 1XCXA 3BJSA 2XU2A 5D38A 4ZQCA 3LA4A 1OIMA 1QJWA 4AVOA 2R1LA 1H2JA 4MUPA 3CMJA 2Q02A 5F4SA 2AGKA 4Q8OA 4AXKA 2WQPA 3WLRA 4PB5A 1FVPA 2FGBA 4BZYA 2Y2WA 1GOOA 3S47A 5I3FA 1SO3A 2CU0A 3TP4A 1G4EA 1BYDA 4WVXA 1DJHA 3MDWA 1OK6A 1UASA 3I4KA 5JBDA 1JDCA 4K1GA 2O9PA 2P8BA 3E38A 5DRIA 3QH2A 2YBTA 4O54A 3KOFA 1DJQA 3ERPA 1S2TA 5D4YA 3PY2A 3IVSA 4A3QA 1LLOA 5E0KA 4QLKA 3K1GA 1ZP3A 4Q8PA 1OFBA 3TJIA 1SO4A 3B06A 3UJSA 2GUUA 2YKKA 3N2CA 3DFPA 3MTWA 3WF4A 3BE7A 2J25A 3M5VA 1LG1A 4QP0A 4LW7A 1RP9A 2BGNE 4B15A 4PC8A 2PBOA 2WANA 3TNBA 4UTIA 5LNVA 3CV7A 1YE6A 3MSRA 5DXXA 2FTWA 4C6DA 3S3GA 1SPQA 1V08A 1HVXA 2JFEX 3CQJA 3KDNA 4MNMA 3CMGA 3PBGA 3ZWTA 5LGZA 2OZ0A 1ZAIA 3KHJA 2RJGA 5CQ1A 2WNQA 1IEQA 3W70A 4HU8A 5EFFA 2V82A 1UR3M 4XUGA 1YLVA 5H2ZA 2FZBA 1EUAA 3BURA 4JN7A 4C5YA 3PZGA 2DSZA 3E6EA 3BV7A 1BFNA 4H9TA 3P62A 3FXYA 1VFUA 1EJRC 5H6HA 3GO2A 1FH9A 1EKOA 1P5BA 1SZGA 3ATZA 3W7DA 2CBVA 3M47A 3I6RA 3QR1A 5GPRA 3WNMA 1WBJA 2OXNA 3O1NA 1Q7MA 1EO7A 2ZRYA 1AQ0A 3DERA 3GUGA 3BOLA 1TQJA 2E6YA 3TA9A 3UT0A 4WD0A 1UJPA 4CD4A 2Y8VA 4E3VA 4H4IA 3FFSA 3S9ZA 4O4WA 3BCJA 4Q8MA 2J8TA 5G1MA 1ZBWA 4TUFA 3G1SA 3G3DA 4G7EB 3MU7A 4JR5A 4JTSA 3W7HA 4NAFA 1F6YA 4ZMGA 3WLMA 4GH1A 4GQRA 1W3KA 3USZA 2GJXA 5AZ1A 1NF0A 4MKNA 5BXSA 4KEVA 4UQEA 3OBKA 2Y85A 3NL5A 2HXUA 4J27A 4M56A 1JDAA 1RBLA 2QCGA 4NJGA 4OHQA 5BWAA 1YPIA 2R94A 2HXTA 3WDRA 3R0KA 4QBXA 3GW3A 4HNUA 4NNAA 5AYYA 4U3AA 1CTNA 4MIMA 2WCSA 2BY3A 2NXIA 3TC6A 2VC5A 3TYDA 3CUFA 1ICQA 2NW0A 3F5KA 5FEXA 1HQTA 3CHEA 4LS0A 3UWUA 4JXCA 3PZMA 5CBBA 4LX4A 1CXEA 4K3ZA 3W7IA 3WH5A 3W1TA 5HMFA 3VNJA 4JN6A 3QFEA 4L4MA 3AAMA 5HR6A 4DLFA 3VX0A 4HYWA 3KFTA 3O6DA 3DHPA 3W02A 5G1TA 4LV4A 3CWOX 2AAAA 5EL1A 1TX2A 1DQWA 5B7YA 4PUEA 4MUZA 2OQYA 4OKDA 1B3ZA 1DJXA 4JTCA 2D2HA 4MLJA 2WB5A 1DWGM 3T40A 1XQKA 2OG9A 1JCTA 3C0QA 1OFDA 5HJYA 1JGMA 2JIWA 4JTQA 4C1KA 3S6OA 1L8NA 1HKWA 1F5ZA 5A94A 3IAQA 2OO6A 5CGMA 3KAOA 4LYKA 3RCMA 1OFAA 3B8UA 5JH1A 1GVFA 4OECA 1LOQA 1J5SA 1A5CA 1FDJA 3B8SA 2ZQ0A 1H4PA 2W67A 3TYZA 1LOLA 3GD6A 4W84A 3U48A 1FP8A 1MEWA 2WPGA 4FOJA 1RQBA 3V75A 3C6CA 3ECQA 1KNWA 2ZXAA 2FZMA 1PKMA 1TWIA 2YJQA 4AXNA 1S5TA 4FR1A 3BWWA 1AODA 2Z26A 1O94A 1BWKA 3GIPA 5AC8A 3MW7A 3GVVA 2J7CA 1QBBA 2INEA 1CIUA 1FDYA 1H0GA 3WEMA 3KCLA 5I3HA 2VURA 2VI0A 3AMKA 4XD5A 3TW9A 3T0BA 3AXIA 1EFZA 2WCGA 2VCAA 3FJLA 3P80A 3LQGA 1KA9F 3PAJA 4EAMA 2PP3A 2Y5JA 4RV3A 3OLDA 2QJJA 2VFFA 2QF8A 1Q4WA 4JY9A 1E6RA 1DJYA 2J6XA 3BUVA 1WBHA 3AU2A 3QHMA 1WO2A 5A1AA 1M7OA 1XBZA 2ZA2A 4YXGA 3P8JA 1OGBA 1XH1A 1D2KA 1FWIC 1UMLA 3ARTA 5DCDA 3UGRA 2Y0FA 3BLFA 5FOOA 1KXHA 4S39A 2DT3A 2WSKA 1X1NA 3HOJA 1RPXA 1TPVA 1XLKA 5FF4A 2XSBA 2FYMA 4O19A 3GYEA 4O0QA 3C0LA 2WHKA 5G2HA 1QNVA 3BMVA 2WJFA 1BRLA 1H0IA 1W0MA 4JN8A 5C55A 6REQB 1V7YA 3NZQA 2PLMA 2NXGA 3PAOA 1CBGA 3WEOA 4UTTA 1Z69A 4U5KA 3GWQA 4M80A 1BVZA 3G1YA 3V1PA 2WNZA 1B3XA 4HJWA 4BWLA 1I60A 4AD1A 1Y5XA 1JUBA 4JHOA 4UTWC 4E8GA 2VFGA 4Q3MA 3ZIZA 3DGRA 5HNNA 3ORWA 1PAMA 3C56A 1JNDA 3MVTA 1IIGA 1PKLA 5DXYA 3ITTA 3BLEA 4H9MA 3R0UA 1G69A 4HCLA 4L1WA 3CMFA 4UTFA 2WAGA 4XZBA 4W9TA 3ZMRA 4GYPA 1K9DA 2ZX8A 4XWUA 4ZODA 4K1WA 3U5YA 3A3WA 1OYCA 5KZ6A 1J4EA 2A79A 3UPBA 4PUJA 3WCZA 2JALA 2QAFA 3BMWA 2V3DA 4MZ1A 3UERA 3VIMA 1R3TA 5T9BG 1HUVA 3ELFA 1RBOB 4ZCWA 1QMLA 3W7OA 3UXIA 1YIXA 3PNUA 3J7HA 4Q4QA 2X42A 2ZUTA 3DYMA 4O52A 3ENLA 3EDJA 4D8ZA 4WR3A 3SN4A 1DIOA 3MUZ1 4NJJA 5U4NA 5FF7A 1QNOA 5AY7A 1V3MA 4REQB 4KWWA 1EPXA 4R53A 3SCNA 3VIPA 2HDJA 3GHSA 1XLGA 3TKFA 1VF8A 1PIGA 3GH5A 3K8LA 1ECEA 4GGHA 4XQ6A 2PDLA 2C16A 3GXIA 4Z0JA 3WK1A 5CZTA 4MFDA 3VUSA 3TTYA 1B3VA 4PMXA 2ZUVA 1UD3A 3A12A 4D6IA 3RGTA 2IKGA 2BY2A 1XLBA 5J5DA 2V9DA 1W1TA 4XZ9A 3VZYA 3MC5A 4QE4A 4WQ6A 4C5ZA 2VWSA 4MF4A 2Z7KA 3LENA 4YJ5A 2ZUSA 3DEQA 1S5NA 5HNRA 1GJPA 1R9XA 1EHAA 3NQAA 1ZSXA 5PTDA 3APTA 3CAQA 1FWWA 3CB3A 4G9PA 4IJCA 3M07A 1ALDA 2B4GA 3WG6A 3ZLFA 2FLIA 4TTGA 1UR0A 3JRKA 3W75A 1PB0A 1VCFA 2I56A 3R13A 1R5YA 4QXIA 1JZ6A 1G1YA 5A6AA 3M0YA 5E09A 4G5DA 2VJXA 3TV8A 2X1IA 1YPXA 3R25A 1S2VA 4O8AA 3CO8A 3VD9A 2F7FA 3EAUA 5BW6A 1XLDA 5I00A 4JFSA 4UR7A 5EB8A 1NSJA 3PN8A 2W61A 3VMPA 3AC0A 3N3TA 2VRQA 3H53A 4Y96A 3W7LA 3EA3A 4XZLX 4GABA 1MDRA 5I7GA 2PDUA 1IXQA 1ECQA 1KCZA 2E5CA 4R9XA 2NWRA 4H1ZA 4RNHA 3WLNA 2DEPA 1T40A 2OYMA 3TR9A 2Q09A 3IK4A 3N25A 4V33A 1RVKA 3EX6A 2VZUA 1H7XA 4F0SA 1GZGA 4NAEA 4P5UA 2PLJA 1XCWA 3KRZA 4UZSA 2ZZ1A 3EB4A 4B3KA 4UC5A 4OWGA 5BOFA 1GW9A 1J0YA 3VGGA 4W88A 1XKYA 1V7AA 1QHPA 1VCGA 2CHRA 3P93A 5HA7A 4B5SA 3MSDA 1E15A 3NEHA 1XYFA 2DY3A 3OODA 1EX5A 1QVBA 2P8CA 3ARZA 3EDEA 2X0HA 2Z25A 5LIUX 3IRDA 4IPLA 2GVJA 1N82A 3VMOA 4DYJA 4XV0A 5CCZA 2HJPA 5AVHA 1O1ZA 3PNZA 1XLIA 4DWSA 4C65A 2GOUA 3SECA 5I3DA 4HK5A 1N8IA 5DX7A 3M6YA 5D8ZA 3HF3A 4NZCA 2AQVA 3EWZA 1ZLPA 2NV9A 1CXHA 3NVDA 1YTEA 3XIMA 3MCMA 4PUUA 4MKVA 1FWNA 1KO0A 1W2PA 2VC9A 1RUSA 1TWDA 5BROA 3G8EA 3FCPA 5JU6A 4ZZ9A 1NJJA 1XDMA 4NQ1A 1J12A 3U6WA 3V4BA 2D2OA 1WNOA 1UR1A 3W7JA 5CLWA 4PUWA 3GBDA 4A29A 4FEZA 3GBEA 1EYWA 2FIQA 8XIMA 2J7FA 1DVJA 5CC3A 3ONBA 2DDXA 2QPSA 4TU1A 4RJEA 4YL2A 1O68A 4U31A 3QQWA 4EPKA 2A21A 4QRNA 1PCWA 4I9AA 3SUWA 1Q66A 1OBAA 1A50A 2CNCA 3MHUA 4W5ZA 1GEQA 2GSJA 3OPSA 3SY8A 4H9UA 5CGQA 4JX6A 3SY1A 2EPLX 3A3XA 4LGXA 2WMGA 1W1A1 1OCNA 3GTHA 3LPPA 2CBIA 1XINA 3HQOA 2CLIA 2V6AA 4X2RA 1LBFA 2V5BA 4CQAA 4HHLA 4PSRA 1HL9A 1VEOA 2YSWA 1M53A 2TRSA 2VTFA 1QI0A 1H51A 1UD4A 1UA3A 3T08A 2YDRA 3S1VA 4CQDA 2HISA 1B3YA 3H70A 1P0DA 4LCRA 1OC5A 1R7AA 3O7UA 4NL1A 1LJYA 2CLEA 2PTWA 1FHDA 4ZENA 3NZGA 4JNZA 2JKPA 2PWDA 4MAVA 2YL6A 4JTGA 3ZT5A 4J3WA 3Q65A 4Q8NA 3FN9A 1S3TC 2L5HA 2E4TA 4HA3A 3TNOA 4NRRA 1RBAA 1WXYA 2JGYA 3T0AA 4ZO6A 2GGIA 4WCJA 1JRCA 1DXFA 3AUOA 5D02A 3EPNA 3WBEA 3RG6A 4KWVA 1Z41A 2PGWA 1ONEA 5KZDA 4I7VA 3W24A 3AMDA 2XZ7A 3DUGA 1NTHA 1GVOA 2ZXDA 1A0EA 2VR4A 3VC5A 5H8MA 3WFLA 4IWWA 1ISVA 2DJLA 1HXJA 1MXSA 2PDIA 3EOSA 4XZHA 3NQBA 4AX7A 1ZCOA 1UUMA 4PCNA 1WCGA 2O9OA 4B5TA 3QRHA 1H62A 3E9AA 4K37A 1HP5A 1TVPA 2CLKA 3RPMA 3LERA 1XM3A 3OBEA 4WGHA 3VKAA 3WNLA 1UOZA 2J13A 3GTXA 3BJFA 2ASHA 1S38A 4RV8A 1JDDA 4QCEA 2DZXA 5FF3A 4W8LA 3TA6A 3TXVA 3KBNA 2GJPA 4BF9A 1B0IA 2EXOA 5F2GA 4AZ7A 3VDBA 1QTWA 4MY8A 2XM1A 4OIFA 2R8WA 1F3WA 3QGAC 5IRPA 2UWFA 1WKYA 4JZ5A 2Y7GA 5EBAA 4RL3A 1JG9A 2G4FA 4X9YA 5HATA 2JF7A 3WD4A 1IEVA 1WXJA 3TTOA 2X2GA 4B5VA 3SQLA 1UBSA 4H00A 1QPRA 1YBQB 1WYIA 3NUKA 1VRXA 1JVNA 3D46A 1G01A 4TR9A 3F03K 4LB3A 4ZQRA 2RGMA 4Z08A 4GC4A 3NXLA 3VNYA 3QQ0A 4HPJA 2WMFA 1P1XA 1RP8A 6PTDA 5L6UA 3LXAA 3E2QA 3W7NA 1Q6RA 3W87A 1POKA 3UBPC 4JBRA 5C71A 2WZHA 3ANUA 2GQAA 5DY3A 2ISDA 3T42A 4AWEA 1JYXA 4IPNB 3KRUA 3VDAA 4XAGA 4D8AA 3ZR6A 4W86A 1TPUA 2WMIB 3BAIA 5DLCA 1W37A 5D03A 4D8LA 3KP0A 4FNTA 3W25A 4OQVA 3U9IA 3RX2A 2GFTA 2HS6A 2VCBA 3R8HA 3P6LA 2RDTA 1LUCA 3AROA 4Y8EA 2EPNA 1PX4A 1Y0EA 1B3WA 2DZPA 1F8MA 4FLSA 1Q6EA 3MUAA 3T9PA 1Q2RA 3LTYA 3LY0A 1VPXA 4UR9A 2KZHA 1DOSA 2BMBA 1CPUA 4ZR8A 2XIIA 4MJ4A 2IPWA 1VB9A 1PE1A 1U5HA 4MFEA 2B31A 2XH2A 1XG3A 3UWWA 3TZNA 3L66A 1FCBA 5HMSA 3R8GA 2QDGA 2J8FA 3NVTA 3U0HA 1NFGA 5H91A 4JQAA 4K2SA 1TZZA 2BSLA 2EPMX 2UY5A 1IF2A 1UP3A 3AJXA 2MNRA 3C3NA 3VNDA 3AIVA 4FNSA 4UFJA 3RPDA 4AX6A 3TJ4A 3CEPA 2A4AA 3NDOA 3SAZA 4AW7A 3PJXA 2VOMA 3UPMA 3FDKA 2DFAA 4CNNA 1G7VA 3BSHA 4NIRA 2F6XA 1ME8A 3PTKA 1UZ4A 3I7RA 1JFXA 1UD8A 4ZOBA 1AFSA 3AYSA 2QCDA 5BU6A 4V2XA 3LTPA 5H8PA 3W7KA 4JHZA 4AEOA 3SN1A 4PZVA 3CPRA 7CGTA 3G6LA 3CU2A 2OZ8A 3EB3A 3BLIA 4GZEA 3AIWA 5LNSA 2X05A 4K7YA 5HWJA 3CAKA 1UJQA 4FNUA 2WNNA 4ZXOA 1HO4A 3S2NA 3SUSA 4QEHA 1FWJC 3LN3A 1C8XA 2VQUA 5A6SA 3FHAA 3VGFA 4YIWA 2VGGA 3L5LA 3VFLA 3C86A 3TC7A 1EP2A 2WC7A 3CV6A 1KV8A 4E5TA 2BXVA 1DJGA 2ZRVA 4INFA 2PU1A 4ZTXA 3GDKA 1F8IA 5I79A 3GZ3A 4D6DA 3PWIA 1X96A 2TPSA 1QNQA 1S5WA 5J04A 2Z6JA 1FH7A 4FAMA 1VR6A 3VIOA 1XYZA 1UBPC 4FLOA 4HPNA 1A5OC 4GINA 1RHCA 2XGBA 3CK5A 3VOIA 4JEJA 3BAXA 1H41A 2XVKA 3LUTA 4S3AA 5A8GA 3BGGA 4CD8A 4DYEA 2PDJA 1TVNA 2BG5A 1OINA 4LUIA 4D1IA 4EPDC 4CUCA 2QIWA 2QJNA 3MP3A 1CLXA 2XIQA 3VIHA 3P5YA 1GPWA 1IZJA 3H7UA 4HHMA 3ITVA 2IQTA 2VDGA 4LT9A 2GZXA 3INPA 3AOFA 1IQ8A 3GQYA 4LVGA 1GKRA 2DVUA 2DIJA 4D6HA 1THFD 4TMCA 1J0JA 3PP7A 5HR7A 1UQYA 4ZE5A 5FL1A 4Q8TA 1SFLA 4H8NA 2VRKA 1RA5A 3M0VA 1TIMA 1RJRA 3AUJA 4RR4A 5E70A 4MB1A 3HV9A 1EC9A 5BU9A 4WXZA 2DZUA 4S23A 4UTMA 1B5TA 2ZZ2A 2INFA 4LXFA 3HA1A 4HSOA 1V51A 3DKLA 2H90A 4AAJA 1XBYA 5DBUA 3AFBA 4QR6A 3OP2A 2PWUA 3KWSA 4IFKB 4B2DA 5BMXA 5G1YA 1DWIM 3OTRA 1A49A 4XBSA 5D05A 1OG0A 1U1JA 4Q4PA 1FFQA 3IARA 1UH4A 3DI1A 3U2ZA 1DIEA 3MP4A 3TX9A 3N9KA 1WX0A 1S2UA 2QJIA 2I9UA 3WUBA 2R91A 3WK2A 3BCDA 3MMTA 2C3ZA 4ZQNA 4H83A 2GVEA 3OLGA 1N8WA 4TXEA 1A47A 2OLHA 3VC6A 3B40A 3CL7A 2PTXA 3P67A 4MY1A 3VKKA 2ZX9A 4WUIA 4U3CA 5GJMA 3M5ZA 5H1WA 4NG3A 1WPCA 1OX6A 3DKJA 4LUJA 3V5FA 1X1ZA 4WSKA 1R2TA 1F6PA 3QY7A 4GIAA 2VEPA 3GKAA 4XIAA 1BLIA 3MI6A 1BTCA 4GXPA 3DX5A 4A4AA 3NM1A 3S2CA 5CJMA 4U28A 4TTUA 3MHGA 3NZ1A 2P53A 5JIWA 5D9MA 4BS0A 1MUWA 5IFPA 4IMAA 3WLPA 4WDXA 4RDZA 5DANA 2PFHA 4QS6A 3AWNA 2VZTA 1XV8A 5ABHA 4FXFA 1PWLA 3LPOA 1WE5A 1XHGA 3T4WA 3FDGA 3GUWA 2IXVA 2NQZA 1GCYA 2YB4A 3FSUA 1E6SM 5M03A 4WXYA 4Z42C 4BF5A 3FJ4A 3RYSA 1E9LA 4QSHA 5RUBA 1MYRA 4PCPA 2YFNA 4OBSA 2DQXA 2V2HA 3GC2A 5J5RA 2ZOXA 5BRQA 1B1YA 1H7WA 4GUIA 1S5VA 1QOPA 4EF9A 3BPWA 5E1QA 5K7JA 4OTKA 6A3HA 2OU4A 2PB1A 2GDUA 2D73A 1ME9A 1LG2A 1O1HA 4FB7A 1PWMA 3BLPX 3S2LA 1CECA 4GOAA 1BYCA 2QUVA 1KFCA 3TSBA 2XGIA 2GJXB 3PG9A 2G50A 3QF0A 3AYRA 2DVXA 4GY7A 1JI2A 2Q01A 3DHUA 4KWUA 4HGXA 4AD4A 4IIFA 3FY1A 4L80A 1VIZA 5HQLA 3KBWA 4GJ1A 1LRTA 1S1RA 3R12A 1J8VA 3ARSA 3XINA 4G6CA 4MZ8A 4O8RA 1SJCA 1U1UA 4AY8A 1UHVA 4QITA 8XIAA 4XO6A 4V27A 2WBGA 3W1LA 3L5AA 1EGZA 4H8HA 2CEQA 2FFIA 5LNWA 3CPUA 2I5GA 4DPPA 1GOXA 3H2EA 4AQLA 1HJVA 1EGVA 3NDZA 2V81A 1TR1A 3AYVA 4LF1A 2GSHA 1KCXA 2AMXA 2I7GA 2VM8A 1PJ9A 4DX3A 3Q37A 2Q8XA 1IXOA 2GGEA 2Z29A 3UWQA 5FAGA 4DBDA 3WQCA 2NXHA 3LGDA 4JX5A 3MZNA 4IFRA 1K02A 3GU2A 1OJXA 3QMTA 4F0LA 3WLTA 3S6DA 1WP6A 1AW1A 1EDTA 1PZ0A 1HFBA 1YADA 3WZ0E 5HUPA 1R3YA 2XIMA 1I6NA 1TWSA 1DTUA 4GQQA 5HDRA 2I1OA 1G5AA 1XIDA 3LHTA 3P60A 4N02A 3G1RA 2XYLA 4UTLA 4TX9A 1E4NA 4W8BA 3DH7A 3IJDA 3ME3A 4PEKA 4EXAA 4BI6A 2YDQA 5HINA 3SCTA 3S8HA 5K2ZA 1LWIA 4EKJA 2PTDA 4IGHA 4AIEA 1XFCA 2FDMA 4OUEA 4US6A 8A3HA 3E0VA 2CBUA 2XFYA 2WYSA 4JTIA 4XD6A 3PBVA 3M0JA 3JZUA 2BXZA 2DSUA 3WQPA 4DELA 1GNXA 3UZ5A 1TE1A 1BAGA 2C1HA 4AZCB 2VMFA 4DAIA 5G4WA 2PA6A 1LWJA 3LBOA 3UY8A 3WBWA 3FYOA 3K4DA 2WKGA 1AQFA 1Z48A 1IT8A 1VFMA 2G41A 4WJEA 3CLWA 3K4AA 4GNKB 3BSMA 1KQYA 3A23A 1ITQA 3MI3A 4CD6A 1IEIA 3CHFA 2H3DA 4WY0B 3B8TA 3JU2A 2A3AA 3I3EA 2RUSA 1A3XA 4QLLA 4V28A 4CCZA 1S2WA 2JKEA 2I5IA 3DDMA 4CCCA 2BVWA 1P43A 3RHGA 2DZSA 5HUOA 1S1PA 2J27A 3MJYA 1MWOA 3URQA 3ARUA 2I16A 4LFYA 4B9ZA 4W85A 3LCIA 3B0VC 3QM3A 4ZXLA 5CKSA 3L68A 2IMRA 1JJKA 1QPKA 4CNSA 1U83A 3KOXA 1MEIA 2W5FA 1ISWA 3HPAA 3TWBA 3P0XA 1LROA 3UNDA 4W7UA 4AZBA 3R6IA 2O4MA 4EP8C 4F0HA 1M9HA 1XC4A 3TN6A 1LT8A 3DFSA 4PMJA 4HSNA 1MFUA 3Q94A 4XSLA 1JCXA 4UIOA 4IP4A 3I68A 4EANA 1IXNA 3H23A 4WDTA 3E0FA 2HBVA 1NF7A 1Y65A 2E9MA 2VWTA 1P4CA 1XRFA 3BQ6A 4C7FA 2Y5SA 2QKFA 3LV5A 5D37A 1E9IA 3AMCA 3E5BA 1QAPA 1MDLA 3HV8A 2VX5A 4XVEA 2D0HA 3NSMA 4ERGA 2R24A 4PMZA 4Q4RA 2OTDA 3NGFA 3FEQA 5HQEA 1CXFA 1R2RA 3FHQA 4JIIX 4EIVA 2E67A 3IAPA 3SJNA 3KOZA 2GWGA 2QLYA 1SZEA 5A6LA 3RMEA 3S5SA 3OLIA 5IBXA 1RCXB 4C6CA 4DI9A 4N6FA 1OSEA 2IPFA 3JS3A 3ISIX 4V15A 1WDSA 4D6FA 4KGJA 4JHMA 1OFOA 2O9RA 1V6TA 4CU7A 2P0OA 4ERIA 2GPTA 4MB3A 3GXFA 5FL0A 2F84A 4JKKA 2CZFA 3EPOA 4A8RA 1Q63A 2GJLA 2WSPA 1F9CA 4DBEA 2E8ZA 4I9JA 5HMDA 4ICNA 3FYPA 2ALDA 2PRMA 1JZ8A 2WZMA 3LLFA 1RR2A 1NDYA 3CJPA 4X22A 5C9RA 2B0MA 4DPQA 2W91A 3TLLA 3VIIA 1HIZA 2W27A 3RM9A 3H21A 4LBRA 3N13A 1C93A 3QXBA 3SJ3A 3EKLA 3LS9A 1QBAA 2B81A 1M65A 3DOPA 3NOEA 3E49A 2PDKA 2VXNA 3OO2A 1RA0A 3SSZA 3LTSA 2Z00A 3PFMA 4K8EA 1U1HA 3UNTA 3L2MA 3EB2A 2DV0A 1Q8AA 3IV3A 4GO9A 3ZJ7A 4GY1A 3GG7A 3WEZA 5ENLA 4JFUA 3PUOA 4PCTA 5HQMA 4QM1A 1IHIA 3R89A 5A6BA 3P74A 2HTMA 2W63A 2G3JA 3W1MA 4NX5A 1I0BA 3V1HA 2AMGA 3BGAA 5A8NA 2PWHA 2JEPA 4PMUA 3F5JA 2XZ9A 1H7PA 2ZC1A 3B3DA 3T0DA 2Y7DA 5C9WA 1KFBA 1XPYA 1OF6A 1K9TA 2F9RA 1TRDA 2QGYA 1NDWA 5F2MA 3NO1A 3LX9A 2AAMA 2QMJA 4GKLA 5E6YA 3UXLA 1AZ1A 1M68A 1ODUA 2A0NA 3WF3A 1FCVA 1NDVA 3V5OA 2CITA 6REQA 1RVGA 4DO7A 1EYEA 1V77A 1XGEA 3BAWA 3CZGA 4ZE4A 5ECVA 2QS8A 1K4GA 1L6YA 1VS1A 3EYPA 4ZO7A 4CEUC 4LY4A 1QPOA 1NIUA 1W9UA 3C8NA 4BCEA 2FHBA 4KH2A 2LLEA 4L6HA 4GNVA 4IJRA 3XISA 3PTQA 1W54A 4NZ5A 5I03A 2PWFA 3GDMA 4O28A 4S3KA 1C7SA 4RPQA 1V3IA 2EEXA 4C6QA 3GNXA 3EGJA 3IJ8A 4I5UA 2XG9A 1UKPA 3QC0A 2WHMA 4JIHA 3O0KA 4F3HA 5HJLA 4IL2A 3LQLA 5D8WA 3BAYA 3PS7A 1A0DA 3TDFA 1DTNA 5LA0A 3A4AA 4NAEB 1ZPTA 4ZOEA 3UESA 1NOFA 2PU0A 2A3BA 3RK8A 4MDPA 4IUOA 1XGZA 2BVYA 1K1DA 2XIJA 4O14A 4H3DA 3EPMA 4LRTA 1MRAA 5T26A 2UY4A 4LCSA 1VYSX 3ARWA 2YDSA 2PURA 3WQ6A 4PMOA 1TJPA 1YDOA 5A8MA 1JAKA 2H3BA 3V0SA 4Z1YA 3PUEA 1EX1A 5C5YA 2NV2A 2A1YA 5FD0A 3P0WA 5FJRA 3QSRA 3NQFA 1OM0A 2C15A 4FMVA 4AZ5A 2AQOA 3BLOA 2VFEA 2AGTA 2ATMA 3EWYA 1TTPA 3O8AA 1P7TB 4UXDA 5EYWA 4DEFA 1PSCA 2V3EA 4EX4A 1JEZA 4JNYA 2ANUA 4QEEA 5GQBA 3CUHA 1ZP4A 2R6OA 1OZMA 2BHYA 9XIMA 4I7WA 2JEQA 3LBMA 3QLLA 3URNA 5B80A 1CGXA 4LEFA 3GIQA 2YXXA 1RV8A 4IHCA 3DYOA 5KZMA 2NQHA 5C2XA 4GIYA 2DVTA 4MAZA 3MYOA 3T1GA 1Y5VA 3AS3A 2HNHA 3QOMA 2GLKA 1K8XA 3B8DA 3N9RA 4RNJA 1D3CA 3VOGA 1FRBA 2UY2A 2D69A 2EG6A 3M9YA 1FWTA 4HU0A 2X30A 2VVNA 4F40A 4RZBA 1TELA 1JPIA 3UJFA 3E74A 1JQXA 1KTCA 1XL9A 1FWRA 3RX3A 2ZDRA 2J47A 2VZSA 4PTMA 5BYWA 3SQMA 3CQIA 5CZSA 4N9CA 1KLZA 2BODX 3OQ8A 4XX6A 4IGSA 4C1NB 4IGMA 3ZS4A 1TPDA 2WJZA 2AL2B 2YLLA 1GYMA 3G3MA 1V0LA 3SRHA 1DHKA 3SN0A 1G67A 3PZTA 3B9AA 3N17A 3OHIA 4YLWA 4CQCA 3FLUA 3W7RA 3AZTA 4BQ5A 4UCFA 3TUUA 3CHVA 4S3FA 2V2CA 4C6MA 4UNKA 4QDMA 2GK1B 5FJPA 1SU5A 3L4XA 3EOLA 4JQ4A 3T7VA 3TIMA 1IR2A 2W79A 4L61A 1H7NA 3VCRA 3B9NA 1O5XA 4EACA 3G77A 3E2SA 5G4HC 2BVTA 5AC7A 1Z3NA 4W8AA 3EOEA 3KE0A 3GDRA 2WVTA 2PDMA 1I2OA 4BI7A 1J9YA 4M7TA 2XGZA 5HAOA 3FVDA 3NWRA 1TPWA 1DE6A 3TSDA 5FACA 3GVQA 3H54A 2WMJA 2FPYA 1RAKA 4XKYA 2NQ5A 4BY3A 2QVHA 4E38A 1W56A 2FHCA 3PZIA 3UEQA 3RUBL 5K9CA 4H19A 1RQHA 4HQVA 3U2OA 3S1GA 1JQVA 4DY1A 5A8OA 3QKZA 1RD6A 4MMWA 4NKCA 8RUCA 2OYLA 3OBAA 4IQDA 3IANA 2BWGA 4H8VA 2ALRA 2DZVA 4H6RA 3A5VA 1ISYA 1GKPA 3GG0A 2V5LA 2I17A 2VZVA 3STCA 4BJHA 3L7RA 3STGA 3S2MA 1F3EA 4AD0A 3Q4DA 4ONVA 2DSKA 3TJXA 1UWAA 1BSIA 1GZ1A 4LUSB 1A5SA 1KFEA 1GQKA 1JYNA 3GXNA 1XC6A 1XISA 3W0KA 5CPTA 1JZ2A 3BO9A 4D9PA 3SBFA 3HMJG 1V3JA 3G1DA 5I09A 5A6TC 4LNCA 3OEXA 4PODA 4KEUA 3E0IA 4HIBA 4ZSTA 2DGAA 5EU9A 1SW7A 2OR2A 3SFWA 3LHWA 1XYBA 4RE4A 1SMAA 4R33A 1R46A 2YCLB 3A24A 3AHXA 3MYPA 1PTDA 3GR4A 2GJRA 3SUTA 4JTUA 3ZO9A 1EDGA 4E8DA 3Q2DA 2G8ZA 3I65A 4F9JA 2FHFA 4ICCX 3H26A 4RE0A 3QV7A 2ZA3A 3BV4A 4RX0A 2DW7A 3BZGA 1BG4A 3TTQA 1RCOB 1SFTA 5FCZA 2X8RA 3C2VA 3OQEA 1QI3A 4LRSA 1BWLA 2VGBA 5I3GA 4AZ6A 2C71A 1AQHA 1B4EA 1OX4A 4GVGA 4ZL1A 5CG0A 1TJ0A 4PTNA 3NL3A 1PVNA 4BWLC 3WD1A 2OKTA 3GAYA 2XTKA 4ROPA 1KV5A 1UCWA 2I57A 3FIGA 3ZVHA 3VKCA 3LCGA 1NH6A 1Z8AA 2UBPC 4WKFA 5KMYA 3AYTA 4F2BA 3IPWA 4YHEA 4B2DD 2PCEA 1WUFA 1ZBCA 3VNZA 2DH3A 2YYUA 3G1AA 5TBOA 2HK1A 4DF2A 2W4XA 1LUCB 4GYPC 5AYBA 5FKYA 9RUBA 2OEJA 1UKTA 3GNPA 3AU6A 1I8JA 2WW5A 4FNPA 4R27A 3D47A 3UGVA 3NPWA 1G6CA 1Q6GA 1TV3A 1J2BA 2PUZA 3W22A 3GZAA 4TVDA 1JRBA 4UFMA 1Q3NA 4Q8QA 5T8GA 5XIAA 2GQ3A 1W1B1 1UWQA 3LZ3A 1TTQA 3W7EA 3WFAA 4ZEPA 1E6NA 1UZDA 2X2YA 3VK5A 4N9EA 1J79A 3IEBA 3E0LA 4FS9A 1DV7A 4IISA 1L6FA 7ODCA 1FWSA 4LVDA 2V8ZA 3S2JA 4D6JA 1O12A 3GB6A 4HMDA 3QMSA 4DAFA 2WM0A 2DW6A 5TD4A 4HMCA 4GO8A 2X1UA 5BOEA 2XFWA 4KFOA 1O60A 4NYYA 4HPGA 4BA0A 4HYRA 3NSNA 2D23A 4ACZB