3FJ6A

Human dihydroorotate dehydrogenase in complex with a leflunomide derivative inhibitor 2
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
361
Chain Sequence
GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAIGADHRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydroorotate dehydrogenase
publication title Structure-based design, synthesis, and characterization of inhibitors of human and Plasmodium falciparum dihydroorotate dehydrogenases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 137
structure length 361
sequence length 364
ec nomenclature ec 1.3.5.2: Dihydroorotate dehydrogenase (quinone).
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01180 DHO_dh Dihydroorotate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fj6A00
5AN7A 1ME8A 4NX5A 4O10A 3UWWA 3VE7A 3EXSA 3GKFA 1SSDA 3OVPA 1FDZA 4IXXA 4LVBA 1AW5A 4ADUA 4FNSA 1JQVA 2GJLA 1W3NA 1TCDA 3GXNA 1OHLA 3TK7A 3BLEA 5AHMA 5LHFA 1F7BA 1X1OA 3TMLA 2R8WA 1OF8A 3MI6A 3NPWA 2ZRWA 1M7PA 5KZDA 3NEVA 3LXAA 2QUTA 3TUUA 3QSTA 4XKYB 5D03A 1G7VA 1VHCA 4HKPA 2EAWA 3R5EA 2VEMA 3STCA 1O5XA 1GVSA 3NQMA 2A0NA 3QH2A 5I3FA 3TIMA 5F1UA 3MMTA 1JCXA 5A8GA 4AHOA 3LHWA 5CPOA 2ZA2A 4IMDA 4O16A 3S5YA 2B7OA 2DZUA 1TPH1 1SPQA 3L0KA 4NXKA 4BWLC 5DY2A 4Y90A 1KBIA 4N9BA 1QO2A 2EHHA 4AHQA 2CLFA 1GZGA 4FNQA 2YX0A 3UY7A 5D2TA 4O53A 1LOSA 3O05A 3R2GA 4IMCA 1H60A 3TFCA 2NUXA 3MHGA 1O94A 1LLZA 4JTGA 3LHTA 4S2BA 4WOQA 1ZENA 4OGZA 1GEQA 3EX3A 3UWVA 4O4VA 4NZJA 4UUIA 2E77A 2VFDA 1UCWA 2OX1A 2CLMA 3NVTA 2JKAA 5HWNA 1N8FA 2H8ZA 4FO4A 4CCCA 2Y85A 1K7EA 1QCWA 3IIOA 3GXPA 4CQ9A 4M7TA 3A22A 2EF9A 4DF0A 1X8FA 4RZ4A 2CW6A 5LNRA 4JTJA 1NFBA 4FHAA 1GG1A 5F1VA 1YPFA 5FF7A 4FIRA 3DU0A 1WA3A 2ATMA 3I7QA 4LY8A 3W7MA 5DN1A 3BLFA 5AFDA 2VEPA 3KRZA 1VLIA 1SR9A 4NNAA 4WJEA 1VPXA 4JYFA 3UZ5A 3WJYA 5KITA 2VFGA 1D3GA 3DHFA 3M43A 2P0OA 3V1PA 4HNTA 1H7WA 3G3DA 3A5VA 3B06A 3S6DA 3CEPA 1H50A 5F4WA 3HG5A 4TMCA 2I9EA 1MEIA 3S1WA 2BZNA 4H3DA 3W1QA 3DFPA 2BXVA 1Q6QA 2FTPA 5D09A 3QPYA 3ZFHA 2ZRXA 4IUOA 3W1AA 3C0JA 3MI2A 3UWUA 4JDBA 4HNVA 4ICNA 3B0VC 1W31A 2BTMA 3G8RA 1I2NA 4AHPA 1EWDA 5CG7A 1NSJA 3LTSA 4O28A 1IGSA 3LCGA 1BTMA 4ZQNA 1ML1A 3G8EA 4CNPA 4Z1CA 3TXZA 3WJWA 1RQEA 2ZRZA 3BG9A 4JTUA 2UV8G 5C54A 1LM1A 1TYGA 3NGJA 4UCGA 1TJPA 5AC8A 1LRNA 3IRDA 3G3MA 4OV9A 1OYBA 4QITA 4R33A 4MVAA 2DP3A 4PL2A 3W1TA 3KVKA 3EX2A 1T96A 2PRLA 2GVLA 3DI1A 4IMEA 4FB7A 2DZTA 4FX8A 1MXSA 1LZOA 1KM5A 3PWAA 2QAPA 3TC7A 3IIZA 2BSLA 5DELA 1H7NA 3M1ZA 1R46A 3ELFA 2YR1A 2DJXA 3LHUA 3HPXA 3T7VA 4BI6A 1TQXA 3N34A 4MZ8A 2HSAA 1W1ZA 3W7GA 4YCPA 5CGQA 3IGXA 1XXXA 2OT0A 4A29A 5AHIA 2A5HA 4WQ6A 2E09A 4CLMA 1OFQA 2W79A 1O5KA 2A1YA 2H3DA 2ZZ2A 3UNDA 1PCKA 3CPRA 5FF2A 1ZALA 3WJZA 4PTNA 3OG3A 2CZFA 5EBUA 5L9FA 4CNOA 3CLMA 3KX6A 2A7RA 3TJLA 4O54A 4N9DA 3S5NA 4CCDA 5ABTA 1X7FA 3BARA 1H61A 2QEZA 3LBMA 1KFEA 4ZQOA 3Q2DA 3EXRA 5HWJA 5FEZA 5T26A 5TBOA 3VI2A 4NT0A 3DAQA 3O06A 1LCOA 1W0MA 4GUIA 1A5AA 4DBEA 3G1VA 1QAPA 3MHUA 3W2UA 1R2RA 3STFA 3I65A 1F6PA 2GPTA 3O15A 4UFJA 3TFXA 2GUUA 2AAMA 3G1SA 3PBVA 4YWIA 3PY2A 4UTTA 3TMQA 2FJKA 3MBDA 3HGSA 3LGEA 2I14A 4O1BA 1ADOA 3O6CA 5DLCA 3G1HA 3BGGA 3TV8A 1QPOA 4KFOA 1VJIA 1W3TA 4K8EA 2F7FA 5I3IA 3W7IA 3QC3A 3WK3A 3NL6A 1IIGA 4IX2A 3N2MA 1FX6A 2A21A 2ZZ4A 1OABA 3QQ1A 4MIMA 1DBTA 1LROA 1TRDA 3MW7A 3PM6A 5LSMA 3LCIA 2A7PA 1P0NA 1ALDA 1KV8A 2WV8A 3T78A 1K8XA 4TX9A 4JIPA 3IGSA 2Y61A 3LBCA 2CFFA 2C14A 4JTHA 1MEWA 4UTMA 3KFTA 3C2RA 1W5MA 3PBUA 5D30A 1IIHA 3HGJA 3CWOX 4JEQA 1PHWA 1M7OA 1OG0A 4K6AA 3W2KA 1JULA 3LHZA 3PUEA 3NQ8A 5BW6A 4JS3A 1QOPA 3V75A 4XTDA 1TTPA 6ALDA 3UWQA 1OK4A 4O12A 2FFCA 5DCDA 5CPLA 4B5NA 3HO8A 1CW2A 4O1DA 2E6FA 2TYSA 3DKLA 2NV2A 4HT3A 2NUYA 3C61A 2X1RA 4JX4A 4FNRA 1KW1A 5LGZA 3PF3A 1WX0A 4ZVJA 1FWSA 1H1ZA 2ZRVA 1NVMA 4MYXA 4FNPA 1ZCOA 4JX5A 4A2RA 3Q37A 2ZZ6A 4MFDA 5C5YA 3W7QA 3JR2A 3NQVA 5K4ZA 3EWUA 5U7SA 5C6MA 1FCVA 4NJKA 3E96A 5EKYA 1S5TA 4N02A 5KINA 3LB0A 3M5XA 4DEFA 1IXNA 2Z1BA 3I68A 4UTJA 1JUBA 3JS3A 3IIPA 3TA6A 3VCRA 1QPRA 3KAOA 3GKAA 2V81A 1MZHA 1G6CA 5L6UA 4XZ9A 4TR9A 1K03A 2YFNA 3QM3A 1YXYA 2QR6A 2NX9A 5AOUA 3TAKA 3YPIA 1I2RA 2AQWA 4OWGA 3B8DA 1OVDA 4OHQA 4KWWA 2WNNA 2QCDB 3QW3A 1OX4A 3KOFA 2FDSA 4HHPA 1YDVA 4JY9A 1YTDA 2ZRYA 3FKRA 4JY8A 5LNWA 3THAA 4O8RA 3PSVA 3NQGA 4MPQA 3R8RA 3UQNA 1VZWA 1LOLA 1EEPA 4NNCA 4RXGA 2RDUA 4Z0JA 3EKZA 4L4MA 3GNDA 1FXPA 2QKFA 2QCGA 4O11A 1QPQA 1L6WA 2CU0A 2NZLA 2Y6ZA 1VGAA 3TX9A 4RR4A 1OX6A 4X9SA 4DXVA 4N4QA 3LM7A 1L6YA 4ADTA 1KLZA 3TQVA 3RK8A 3DKJA 5K2ZA 1S3HA 1OX4B 3BV4A 5HNRA 1AK5A 2C1HA 4IX0A 3L66A 2VFHA 3N9SA 1T99A 3M16A 3S5OA 4O0ZA 1X1ZA 1CX9A 3ANYA 1OFDA 5CPNA 1XKYA 4ADSA 5DBUA 2LLEA 3SGUA 2GVJA 1TMHA 3B0PA 1GVQA 4UTWA 2HS6A 2PCQA 3SIZA 2EGZA 5DCEA 4JN6A 3ABOA 4IPIA 3GXTA 3F03K 4AEOA 1W37A 4NJIA 4BI7A 3N2XA 1LOQA 3S5ZA 4LW7A 3EX1A 3O07A 3MWAA 4Q33A 4ORMA 5DCBA 1K3UA 1UUOA 3W1PA 4U28A 3OEXA 2O7QA 1DKWA 4FNTA 1W8SA 2NLIA 3RF9A 3LLFA 3TDFA 1F76A 3W88A 2CZDA 5G4WA 1F73A 3H54A 3EKLA 4LOCA 5F2MA 3TSDA 4XKYA 3EB2A 3W2LA 3W72A 4RV8A 5IM51 2QCLA 3F4NA 4K7YA 4O1AA 1VYSX 3W71A 1F05A 4NVTA 2ZZ1A 4GFSA 3N3MA 3TSBA 3PUOA 2Z6IA 3M44A 3E02A 4TU1A 4GNJA 3BW2A 2B7PA 4JTKA 3L5AA 1TJRA 3LDVA 3HMJG 2CLLA 3EWYA 5FF4A 3RNDA 3W7DA 1EPXA 4JTFA 4UNKA 3UPBA 4MY1A 5CPMA 1XI3A 3FOKA 1FDJA 3QW4B 5HQEA 1L2UA 3DFSA 3C2OA 4K7VA 2V5BA 3IVTA 5D38A 3W22A 4UTTC 3KVLA 1FQ0A 1XL9A 1ZAJA 3NOEA 1RQHA 1HO1A 2JGQA 2C13A 3NPXA 2TPSA 3RMJA 1H51A 4OU1A 4IMFA 3RLVA 1KV5A 3LI0A 1ICPA 2ZCGA 3NQDA 2TRSA 5SWUA 4WXYA 5G1TA 3UY8A 2Y7DA 5D2YA 1G67A 3M6YA 3PVFA 4X3ZA 1JUKA 3MYPA 3NQ6A 4DBDA 4EWND 3N19B 3OBKA 5FEXA 1WDWA 1YADA 2W6RA 1ZHAA 3STEA 3WJSA 1KTNA 5CZ0A 2OCZA 3WK2A 3W1LA 2ZFAA 2ZZ3A 3MI3A 3P82A 4MY9A 2Z2UA 3W23A 2OT1A 5CSSA 5K7JA 1LRTA 1DOSA 5K3VA 1DL3A 1R2SA 2PRHA 3I7SA 4N2YA 1B9BA 5D32A 1OFRA 3GLCA 1VCFA 1VCVA 2HMCA 3W7RA 3C2EA 1OYCA 4HNNA 3P5YA 1J4EA 4NJJA 1SFLA 1Z48A 3N9RA 1J5TA 3FS2A 1CI1A 2GQAA 1SO5A 4FXRA 4RKAA 2ZZ5A 1JQXA 5D2WA 3P80A 3G1DA 3C6CA 3HB9A 3PBWA 3ZWSA 1AL7A 4PL1A 1TTJA 3DXIA 3GNNA 4K36A 3MUXA 1S5VA 3LXBA 4FIQA 2J88A 5C2XA 4LUIA 2H90A 4MKNA 1YLVA 2AGKA 3QEZA 1KLYA 4FXSA 4A3UA 5HUOA 3G0SA 3DGRA 5E0KA 3QJAA 2QCMA 4MLJA 1VRDA 1TV8A 2FPTA 3GYEA 1BEUA 2Q8LA 3TH6A 3TW6A 5LKYA 4WY0B 2ZTKA 4ML9A 4DPPA 1QOQA 1I4NA 1SZGA 1QMLA 2WQPA 5TIMA 1BWKA 1FBAA 1KFKA 3NL3A 4N6FA 4Z0SA 3W84A 4CNNA 1JCNA 3BG3A 1KM4A 4FEZA 2JBMA 1EP3A 3M41A 4QJ1A 5AHNA 5HUPA 4S1FA 3N73A 4M6QA 1OYAA 5AHEA 5FF0A 1LYXA 2NWSA 3DFOA 1SO6A 1N55A 3GX9A 2YFOA 1H5YA 4M19A 4D2JA 3EEGA 4JGDA 4MLRA 4AWSA 4H4IA 1C8VA 1G4PA 3KHJA 3AJXA 1M6JA 3O1NA 4WOZA 4XTIA 1W54A 1Z42A 3NR0A 1WYIA 4HPXA 5DY3A 1QDSA 4MY8A 3UPWA 3H53A 1TPC1 4LS1A 4AF0B 3G1FA 5KTLA 4LU0A 3LV5A 1FUYA 4LTSA 3M47A 2VEKA 3U6WA 3OVQA 1D3HA 1TB3A 5F2GA 1TTQA 1JCYA 3B05A 3E12A 4RK8A 4OQVA 3LRLA 3W85A 3SW6A 3DENA 1XUUA 4N6EA 3M5VA 3MP3A 3NNTA 4R34A 3U8GA 4YLWA 1I2PA 1I2OA 4LRSA 1TPVA 3TC6A 1AW1A 3HQ1A 3ABQA 4RZ6A 3DI0A 2DU2A 3W07A 4QISA 1O60A 1GTHA 3DFNA 3W86A 3KRUA 3HF3A 2QCNA 2X16A 3HG3A 1SU5A 3LTPA 1JCJA 1P1XA 1W56A 1EP1A 1DVJA 2I1OA 1O95A 4UMCA 1S5WA 1JCMP 1Z41A 3PS7A 1ZJIA 1ZNNA 1TPB1 3VNDA 3G0XA 4XBKA 1WAUA 3DZ1A 3BPWA 3T55A 1YXCA 1PHQA 3CHVA 3W7OA 1LDCA 1XBXA 2WPBA 1KFCA 3CIXA 3QYQA 4RX0A 5MHBA 1ICQA 3LRMA 3CTLA 3CM4A 5HJLA 2Y89A 3NQAA 1Q6LA 4TO8A 2ATSA 3E49A 1SQ7A 4I7VA 2YPIA 4U4MA 3MYOA 2A85A 3LCXA 4BI5A 1IXQA 3NQ7A 3C56A 2GJNA 3TQ0A 1GOXA 1PS9A 3M5ZA 2CLEA 1QNVA 1KTBA 3TXVA 4WUIA 5KZEA 3HGOA 3NPUA 4R7JA 4RLIA 2WKJA 2W0UA 4DQWA 3LLDA 4C1LA 3LRKA 1H63A 3IV3A 3W73A 1SZNA 2V0TA 3TSMA 3W1RA 4MJZA 1JRBA 5D05A 3CT7A 2ZDRA 1U5JA 2PRMA 4BF9A 5HR6A 5F4XA 2Z0IA 4IQLA 2DZPA 1KFJA 1GPWA 4O4WA 1IXOA 1ZAIA 3NXFA 3PR2A 1A5CA 5AYXA 1A50A 3MP4A 4MFEA 3SSJA 1LBLA 1XM3A 4BWLA 3HOJA 4UIOA 5J5RA 1R2TA 4LVAA 3USBA 2H3BA 4X22A 1H7XA 2C3ZA 2B0MA 2G95A 5KSWA 4E2DA 4E0CA 1Q3NA 1PE1A 4UFHA 2YYUA 2QAFA 1YDOA 3T4CA 4QM1A 2QCFA 2RHGA 3OVRA 4DPQA 3EWBX 3L67A 5I3GA 3QFEA 2QF7A 3TJXA 2ZRUA 4XWUA 5E1QA 8TIMA 3EWXA 4AH7A 2WSRA 2C0AA 1C29A 4HN4A 1U83A 4ZQRA 2NXIA 1TV5A 3UZJA 3L2IA 1SW7A 2A6NA 2R94A 2YXGA 4RJEA 4PEKA 3LXCA 1TSIA 4AVFA 2ISVA 3GR7A 3CWNA 4BFAA 4IWWA 3HBLA 1A53A 3TROA 3QSRA 1HG3A 3UD6A 1OK6A 4QQ3A 2A7NA 3FLUA 2Q3RA 3S42A 4FNUA 2QDGA 3TNOA 3P67A 2OJPA 5HWMA 4EVZA 3F4WA 5HR7A 3ZWTA 1EP2A 2E6DA 1W5OA 3IIXA 2FIQA 3P60A 5E93A 3W2MA 4MUZA 4WX2A 4UFIA 1OFAA 1FCQA 1DQWA 2YGYA 4GRSA 3NL2A 3U2OA 3S9YA 2QCDA 2QJGA 1KTCA 2FPYA 3ZR4A 3BO9A 3DHDA 2XN1A 4QSHA 1IF2A 2J27A 2VELA 2ZTJA 3FYPA 5K9DA 2DZWA 4ZMGA 4NNBA 2DZVA 1D9EA 1HUVA 5TQLA 1AMKA 3FKKA 2X2GA 1I45A 2Y62A 2YDAA 3EWWA 1XDMA 2CZ5A 5HINA 1DV7A 1PL9A 3WFAA 2C18A 3M9YA 1GVRA 3G1YA 4WZHA 4O15A 1F2JA 3L5LA 5U4NA 2G96A 5FI8A 2C15A 1V7YA 4OBTA 3R89A 2NX1A 1P0KA 1YPIA 3FFSA 4FX6M 4A2SA 1KM2A 2Y7FA 1G4TA 5D02A 1YYAA 2Y70A 2Y7GA 5CKSA 4UFMA 2V2CA 1HL2A 3O6YX 4LC6A 5KZMA 5G2IA 2PURA 4KFNA 2YCEA 2RH9A 1FY6A 3P84A 3W87A 3UWZA 2GOUA 4LS2A 1B3OA 1DJQA 3PULA 5EPDA 5IBXA 5I3JA 3E9AA 2QJIA 4QNEA 5BNKA 4O14A 2CWNA 1EB3A 2JK2A 2KZHA 2VOMA 3KVMA 4K39A 2FB3A 3TR2A 1F5ZA 4NZFA 5BRBA 5CZJA 3E0IA 3MBFA 2QUVA 1ICSA 2E1DA 1ME9A 3M5YA 5H91A 3LTYA 1NF7A 1H7PA 2RDTA 2WJZA 3W6YA 3CQ0A 3W74A 3GDMA 5I3HA 3W3OA 1XBZA 3L65A 1TV7A 1PIIA 2ABBA 2NV1A 4HNUA 4QNWA 3H55A 4Y8FA 2GQ8A 3CC1A 1KFBA 4K37A 2NXGA 3LOTA 4L4LA 4LNYA 2ZA1A 4O17A 4HIBA 3LERA 5FF3A 5LNUA 4NJHA 3W7HA 1EUAA 1ME7A 1EX5A 4UFKA 1OX5A 1SFJA 1XUZA 3THQA 7TIMA 4RZ5A 1I2QA 1M5WA 3BGJA 3PAJA 4O13A 6TIMA 1VYPX 5EMUA 1GG0A 2E5DA 3DBPA 1UASA 4Z1AA 1ZY9A 4HSOA 1YDNA 5G1YA 3QPZA 5I3KA 3R12A 1GWJA 4LS0A 4UR8A 1RZMA 1B4KA 4OV4A 4EOUA 4MZYA 1LTDA 3B03A 4KWVA 4O52A 3GDKA 4N9CA 2R91A 5EA9A 3L9CA 5AC7A 4S2CA 1FWTA 1SO3A 3W2JA 2OZ0A 1JCLA 2RKXA 4W9TA 4UTUA 4PH6A 3NPVA 1SW0A 3ZS4A 1KM3A 1TQJA 4Y6GA 4PA8A 4NX0A 1EIXA 2QCEA 5G5IA 3PUDA 3W1NA 3GVGA 4JTTA 2CLKA 2V5LA 2WSYA 2FB2A 3O8AA 1Q6OA 2V2HA 4KKXA 1OJXA 4LVFA 4GUJA 2NX3A 1C9DA 4CQAA 4TMBA 1TIMA 2PC4A 3SY5A 3FJLA 3MO7A 3W1UA 5K9XA 3CEUA 1LLWA 1SW3A 1TRIA 4ZQPA 3B0UX 4K38A 2E6YA 3SFKA 3NDOA 1TTIA 4LV9A 3S1UA 1MSSA 5EYWA 4AXKA 5G2WA 2ISSA 2E5BA 2WO5A 3W1XA 4DO6A 3IVSA 5G4EA 4MOZA 1XDLA 1WV2A 3A9IA 3W75A 4JTEA 2TMDA 2YW3A 1SSGA 3P8IA 4PCFA 3G18A 3T44A 4UFLA 3LI1A 3NZ1A 2F84A 4M5PA 2VFIA 3C4UA 2QDHA 1AW2A 2X30A 3WK1A 1TPUA 4DF2A 3O6DA 4XUGA 3ATZA 3PB0A 4JTLA 1XBYA 3QRHA 5LNVA 3FIGA 3L68A 1KA9F 2XN0A 4Z1DA 2NUWA 3L5MA 3HGRA 3KRSA 3C3NA 2Q3OA 1O4UA 4ALDA 4TIMA 1AL8A 3NL5A 2FQIA 4UTIA 3NQEA 3BW4A 3G0UA 4LC8A 3VKJA 3TAOA 4JTIA 4WY0A 3MJYA 2YYTA 2IQTA 4JICA 5F2IA 3SZ8A 1EUNA 3MP5A 4NJGA 3GDRA 4UMAA 5HULA 4ZL1A 2P10A 2CLIA 4DO5A 3S8HA 4AB4A 4GE8A 5D04C 3PG8A 3P74A 4GUHA 4UTHA 3W70A 1UUMA 2X1UA 3HJZA 2HTMA 4XBSA 4JYDA 2JGYA 3W76A 1XBVA 3HIJA 2G97A 1GQNA 4OE7A 2YZRA 1SZFA 3SECA 1NAL1 4MJMA 3NYZA 4Y96A 4JR5A 1AG1O 5FEWA 1Y0EA 1XFBA 4AF0A 4LT9A 4HSNA 3BG5A 2XFWA 1VR6A 3QMTA 3TCEA 3UWYA 4O57A 3SJ3A 3PG9A 1JJKA 2DJLA 1L6SA 2ZA3A 3OA3A 1GVOA 1K7XA 3W7CA 3NG3A 3TW7A 2VEIA 4P61A 1OFPA 4JX6A 1P5BA 3NZRA 3WJXA 1GT8A 4DELA 1Q6RA 2TSYA 1SZEA 1GYLA 2BWGA 4EIVA 4WY0F 1K02A 3CB8A 2O7SA 1RPXA 3UXDA 1JUEA 2VENA 3LCLA 1UJPA 4FF7A 4NXSA 4GBUA 1H62A 3N14A 3DFTA 3R13A 4K8HA 1RD5A 5LNSA 3INPA 4Z1BA 4N9EA 3EWZA 3S0CA 3TKFA 4UTLA 5K9CA 1R47A 2WNZA 4I7WA 4GWEA 5CZTA 2WNQA 3LCHA 3G24A 1FCUA 2HS8A 5LZLA 3NO5A 3W83A 3LX9A 4HPJA 2P1FA 4Y9AA 3FYOA 4A21A 1QR7A 4X2RA 2QJHA 3BW3A 3FJ6A 2FPVA 3DFQA 1LBMA 3P62A 3PB2A 3Q58A 3WK0A 2QCCA 3ABRA 3PC0A 3W7EA 2JKEA 2V8ZA 1G4SA 3IEBA 4R53A 1P4CA 1DHPA 4DF1A 5AHFA 4O19A 4GUFA 3A24A 2A6LA 5IBXC 4UC5A 3QMRA 2J9ZA 3F1QA 1QPNA 3HG2A 4AWUA 3GIYA 4GC4A 1FWWA 1QFEA 3B04A 1DQXA 3S1VA 4DO4A 3MHFA 5LHEA 1UB3A 2ZQ0A 3VFLA 3TQKA 4JXCA 3RU6A 1EA0A 3EX4A 2BX7A 4JTSA 2DORA 3P7YA 4LVDA 2PE4A 2YSWA 2ZZ7A 4IGHA 1IXPA 1WOAA 2VFFA 2CLHA 2V9DA 2E6AA 5C55A 1X6UA 4UTWC 1YTEA 1J2WA 2R14A 1B4EA 1VYRA 1SUXA 1MO0A 2NXHA 4IXHA 3A21A 5D2XA 2J24A 3EXTA 4I9AA 5F2LA 4O18A 2Z6JA 5LGXA 2Q8ZA 4O0KA 3A23A 3RLUA 1KM6A 1OF6A 3CIWA 3ATYA 1JVNA 4J9JA 3C8FA 3D0CA 2OMAA 1T8XA 1H7RA 4GXMA 1FXQA 1FCBA 1LBFA 1TPFA 2V30A 4Q4KA 3BK0A 2VFEA 2FLIA 4BK9A 4EF9A 2ALDA 2ZYFA 4ORIA 2H6RA 1ONRA 1WBHA 2JKPA 1F6KA 2RFGA 3NQCA 3GR8A 4XQ6A 4YXGA 4O50A 2NWRA 1WBJA 2A2IA 4AWTA 5G2HA 2GQ9A 4M6PA 3G1XA 1W5PA 4M7SA 4Q32A 4A22A 1A5BA 4FX7A 3IVUA 1NF0A 3HG4A 1MEHA 3SI9A 3GAYA 3O63A 4OT7A 2Y63A 1G4EA 2B4GA 5BOOA 1RV8A 2DZSA 4ZQMA 4GJ1A 1BWLA 1PV8A 3LCFA 3GB6A 1JR1A 3LV6A 2J9XA 1FWRA 3BLIA 1OFBA 1SO4A 2C6QA 4MYAA 5DBTA 2ISWA 1LORA 2CZEA 2WOQA 3PBYA 3QQ0A 1QWGA 4AMAA 3UXAA 3GK0A 4I7UA 1DJNA 1LRQA 3P8JA 4ZZ9A 4ONVA 1TREA 3NM3A 2EPHA 1I8JA 1JRCA 3HPZA 4YCOA 5CSRA 3M0ZA 4UR7A 3LCWA 2Y88A 4IOTA 1KFLA 3TE9A 3RFAA 3W7NA 5CZSA 3G22A 3NQFA 4E38A 5D2VA 2ABAA 1E51A 1K8YA 2C16A 3BVJA 3W7LA 4H6KA 2VXNA 5KMYA 4UTKA 4JNMA 3OIXA 3GDLA 5AYZA 1A5SA 2B7QA 4UMBA 3GAKA 4G1KA 1V5XA 3KXQA 3IIVA 5GVJA 3M7WA 2GVGA 1H1YA 1TPWA 1YXDA 3QMSA 1RR2A 1ZFJA 4M6VA 5A5WA 4IMGA 2CLOA 4BR1A 3JRKA 2H8XA 1W5NA 1PCWA 1KM1A 1WOBA 3UYCA 3KVJA 4WD0A 3W7KA 3ABSA 5DXYA 3GZ3A 3STGA 1L9WA 2A4AA 5BMXA 4LRTA 4JDYA 3GDTA 1N7KA 1PVNA 2V2DA 1QO5A 4N4PA 2VKZG 4P2VA 1FDYA 3PSWA 2C19A 4C1KA 5K4XA 4NQ1A 4AAJA 2DZXA 1VH7A 1THFD 1W5QA 2BLEA 4JD4A 1RVGA 3W7PA 3QZEA 4UNLA 4RCXA 5J5DA 1ZAHA 1R30A 1T0OA 4POCA 3TU9A 1HFBA 3C2VA 3QF0A 4LVGA 4YL2A 3I6RA 4CCEA 1K7FA 1H7OA 1TPEA 4CQ8A 3G1AA 4IPJA 1HTIA 2E68A 4KFPA 2RDWA 3W2NA 1LP6A 5FEPA 2X1TA 3S1XA 5AB3A 5H2ZA 4O1CA 3O16A 2D73A 4LWWA 4WXZA 5D33A 3T40A 1RQBA 2J6XA 3W7JA 1WQ5A 4IJBA 5D37A 2B7NA 3FEMA 1B57A 2WSQA 1VCGA 5AC6A 1HO4A 1VLWA 5AHLA 3A5FA 3SGZA 4LV4A 4PODA 5HMSA 3W1MA 1NEYA 1DORA 1Z44A 3EX6A 4RXFA 3P61A 2QCHA 1VHNA 1XCFA 2Y7EA 3SR7A 5EL1A 3FA5A 4JYEA 3HPSA 4JIQA 2ZBTA 4PC8A 1BKSA 3L0GA 1K8ZA 4QAIA 1G69A 1G7UA 2G5WA 1FWNA 3NM1A 3VE9A 4PFMA 5FESA 1WXJA 1GJPA 4QIUA 1VS1A 1GYNA 2X1SA 4Z08A 4E2BA 5EY5A 3I7RA 4MZ1A 5F4SA 2YW4A 1Q45A 4NU7A 2V82A 2VC6A 1OFOA 3B4UA 3P81A 3NQ2A 2EKCA 4YMZA 1VC4A 1VQTA 2E5CA 1GVFA 3K30A 3Q94A 1OFEA 3L21A 4UXDA 1GTEA 5AYYA 1TPDA 1UBSA 3IGUA 3C2FA 2XN2A 1YTKA 3C52A 3OHIA 3NAVA 4GUGA 4EF8A 3AO0A 3W9ZA 4LUJA 1TO3A 3LHYA 3LHVA 1F74A 1KM0A 4ZQCA 1KBJA 3CU2A 5BMWA 1XC4A 4NUWA 1EWEA 3DH7A 3P5ZA 2QUUA 2J9YA 3L0NA 3NA8A 5DXXA 1W3IA
chains in the Genus database with same CATH superfamily
5AN7A 4DBSA 3UWWA 3GTIA 3EXSA 4PMOA 1SSDA 2HNHA 1QHZA 4LVBA 3WQWA 4FNSA 3N12A 1NQKA 2GJLA 3R10A 5AHMA 5LHFA 4MWAE 3TMLA 3LSCA 4PMZA 2R8WA 1PKNA 2BXYA 5KZDA 1PKMA 2H9AA 5I09A 1VHCA 2EAWA 3R5EA 2PDXA 4Y9OA 3NQMA 3QH2A 3URBA 5I3FA 5F1UA 1NP2A 4XUYA 3SN4A 2F6UA 3IV8A 5BXRA 3VZZA 4IMDA 4LF1A 3S5YA 4H6RA 4QEHA 2B7OA 4Y90A 4IL2A 3H2NA 1QO2A 3PTQA 2EHHA 3BLOA 4HCHA 1JYWA 4FLOA 3AWNA 2OTDA 1B90A 1XQKA 4MNMA 2VMFA 3RDKA 1LOSA 1VF8A 1H60A 1S2UA 1TE6A 2YL8A 4C7FA 1EF3A 1OC7A 1GEQA 3UWVA 4MAZA 1EJUC 4NZJA 2EPMX 4LYKA 3U5UA 2YL6A 3QQWA 5T9BG 2OX1A 2JKAA 5GJMA 1E40A 1KRMA 2H8ZA 3B9NA 4FO4A 2Y85A 2AL2B 1J0KA 3C8NA 3RITA 4MMWA 5LNRA 3A4AA 2RJGA 4GI6A 4UOJA 3VMNA 5FF7A 3DU0A 3I7QA 3BLFA 3KRZA 1KCKA 1VLIA 4NNAA 2BY0A 1UR4A 3A9BA 1JPIA 2FH8A 3V1PA 3CEPA 3A3XA 1H50A 3MKCA 3NIYA 4BA0A 3WFLA 2V5CA 2TAAA 4TMCA 4CN6A 4KWSA 3DFPA 3QV7A 1OCQA 3QPYA 3ZFHA 1VFFA 3MI2A 4J3UA 4HMCA 1ISVA 4ICNA 1I2NA 3GWQA 2O0TA 1ELSA 5CG7A 3LTSA 2VWTA 4O28A 1IGSA 1BTMA 5JBFA 1ML1A 1Q7MA 4Z1CA 1A3HA 4ZFCA 4X9YA 3R58A 1HJQA 2ZUNA 2UV8G 2YCJA 3P3BA 1TYGA 4CKQA 3NGJA 2DGAA 4QROA 2ZE0A 3L2MA 3IRDA 3WMBA 1OYBA 5CPTA 3TTYA 3KVKA 1T96A 1ZCCA 3DI1A 4IMEA 4DWSA 2WSKA 2NQJA 4EP8C 3T0CA 1TX2A 2D2JA 3TC7A 1QPKA 2BSLA 3AS1A 1S1PA 5A8OA 4YTTA 1R46A 3ELFA 2YR1A 2D1ZA 3WY1A 4IIEA 3N34A 4OOUA 4MZ8A 3W7GA 3E2RA 3W37A 2YJQA 1FWCC 1K9TA 1J9YA 5AHIA 3W01A 3RM4A 1EOMA 3VNIA 3P14A 3WIJA 2PGRA 4AW7A 2ZZ2A 1XRVA 2ZUTA 4ZB0A 1OM0A 1ZALA 3E5PA 3OG3A 1AZ2A 1E0TA 3CLMA 2WZHA 3VIGA 2A7RA 4UOQA 3TJLA 4N9DA 4PMDA 4B4FA 2VZTA 4MJ4A 2DW6A 1DIOA 1F9CA 1H61A 4WKHA 4XZMX 1NU5A 3UA3A 2PLCA 1EJWC 1SFTA 2QVNA 5T26A 5TBOA 3GS6A 4J3VA 3LMZA 1PPIA 1LCOA 2QIWA 1M1BA 3WF0A 1R3SA 1FH7A 3STFA 4L80A 1F6PA 2GPTA 3O15A 3TFXA 1VBJA 2YA0A 4YWIA 4UTTA 1B2YA 3BZJA 3LM3A 7A3HA 5CJMA 3TLLA 3G1HA 3B8SA 2AMGA 1F3WA 1PZ3A 3HURA 4FK9A 4KFOA 1VJIA 1W3TA 2C71A 4IQJA 3AXIA 2F7FA 1IEWA 1M3UA 1VKFA 4PCNA 4IX2A 2A21A 2W4XA 3F5KA 3WQCA 1E5JA 4L64A 4IGMA 1LROA 5DFAA 4W93A 2JEPA 2A7PA 3Q4DA 4LNCA 4LBRA 3QFWA 4MB3A 1M41A 4S3FA 2WV8A 1OD0A 3T78A 1K8XA 4DAFA 3IGSA 3K2GA 3H2CA 1XP3A 3LENA 2V5DA 2CFFA 4UTMA 4DUXA 3GTNA 3C2RA 4Y8EA 1XLBA 2ESCA 3CWOX 3HGJA 3PPFA 1RPKA 1Q2SA 2J74A 3LHZA 4H2CA 3WG6A 1RVKA 2WVTA 4J27A 3C3UA 1V0KA 4QHRA 4AD1A 1OK4A 3LD5A 2FFCA 1OIMA 5DCDA 1PUDA 3HO8A 4NRRA 4FALA 1C92A 2X1RA 3KWSA 1CB2A 3ZJ7A 4D6EA 2HNEA 1FWSA 1H1ZA 2ZUMA 2EG8A 2Q6ZA 2MNRA 5D9NA 4A2RA 2VTFA 1JAKA 4PMUA 3CAKA 5D8WA 1A49A 1SMDA 3OYXA 3VGFA 1FWBC 3NQVA 5K4ZA 5GNXA 3F5LA 3H4XA 4N02A 3GFXA 3LB0A 3VKKA 3K5XA 1FVPA 3SCTA 5JMUA 4HA1A 4B3ZA 5LXXA 1XFCA 3JS3A 4NZ1A 3BANA 4C6BA 4D6JA 3VCRA 1Y7VA 3A12A 3RCYA 3GKAA 1V6TA 4UB9A 1MZHA 1KWKA 4RW5A 4NRSA 4TR9A 1MMFA 1K03A 1E4MM 3TAKA 4AC7C 3UJEA 4G6CA 4OWGA 2OLHA 3WUEA 5G4HC 2DUXA 1HW6A 3FKRA 1DIKA 4O8RA 3PSVA 4AZ6A 2QV5A 3P2VA 2RDUA 4Z0JA 1CGTA 2OSXA 2GVEA 1QPQA 2HBXA 4M1BA 4BEUA 5DMMA 3V7PA 4DXVA 4MHBA 3WH7A 3RK8A 4R9OA 1GJWA 3MSDA 1E9YB 1S3TC 5FJRA 1AK5A 2C1HA 1T99A 1L8PA 4DUVA 4NASA 2J7HA 2GVJA 3KRBA 4TTUA 4UTWA 3AJ7A 3T2QA 4IT1A 3BOLA 4PUUA 3MKVA 1NWRA 5DCEA 4IPIA 2YB1A 2FZ9A 3GXTA 2HE5A 1Z8AA 3S5ZA 4QCEA 2B31A 2V67A 3O07A 1W3JA 4ORMA 4ICMA 1CENA 5AC5A 4ZTXA 3W1PA 3WQGA 3M64A 5HNUA 3R25A 4OKDA 1W8SA 2NLIA 3PZOA 3HMCA 4HB7A 3TDFA 4XAGA 3AMCA 4HBKA 3RRAA 2BVYA 1W9XA 1V6VA 1F73A 3H54A 3CWHA 3W72A 4RV8A 1KNWA 1XIHA 4XG1A 5IM51 2QMJA 1UR1A 4RE4A 4PMNA 4O1AA 1VYSX 4Y9NA 3WLOA 4HSHA 3CAWA 4GFSA 4DJFC 1CXIA 4XO6A 2Z6IA 3E02A 3NDZA 2EKGA 1WXYA 1MQQA 4GNJA 4RDYA 5ABGA 1XS2A 2CLLA 3RNDA 4NZ4A 1XR2A 4JTFA 4GK8A 2IKHA 3UPBA 1V4YA 3PZGA 3FOKA 1XD0A 4HYWA 9XIAA 5AY7A 3KVLA 3PZMA 1EJTC 1AODA 1XL9A 3B8UA 1RAKA 2KAUC 2Q8XA 3RMJA 4OU1A 2AL2A 3CYJA 4CNTA 3ITVA 1KV5A 1WDSA 2ZCGA 5SWUA 3V3WA 3UFYA 3WKZA 5G1TA 4S3KA 3UY8A 5D2YA 2OR2A 1G67A 4PE8A 1D2KA 1FTXA 3V16A 4EWND 5AVHA 4KWOA 5FEXA 1UROA 1YADA 1AFSA 2XVNA 3P82A 4MY9A 5CSSA 3UR5A 1DOSA 3VDHA 5K3VA 1MYRA 3H24A 4N2YA 1OFRA 4ZE4A 1VCFA 2PDIA 1T40A 2HMCA 1CGWA 1EJ7L 3P5YA 3HFTA 4NJJA 3XINA 3G6LA 1J5TA 1GKPA 2GJXA 1UWRA 1CI1A 3V1HA 1SO5A 2ZZ5A 1JQXA 3D3AA 2E25A 4WEVX 4B9ZA 4H9UA 3GNNA 4UCFA 4ZSTA 1J12A 4LUIA 3SCQA 1KLYA 4F0MA 3N13A 5HUOA 3CPGA 2ZIDA 2GSHA 1VRDA 4MPKA 4US5A 2FPTA 2PDFA 1ADDA 4CD5A 4PMYA 3BSMA 3TW6A 4E4PA 2ZTKA 4DPPA 5C9UA 1SZGA 3KHDA 1QMLA 2WQPA 3JZUA 4C91A 1KFKA 4N6FA 1MW0A 3RX4A 3BG3A 4XD3A 1QI5A 3M41A 3QPEA 5AHNA 3TYZA 2GUBA 4M6QA 1R3RA 2G4JA 5FF0A 2NWSA 4PTXA 1XLHA 1GHRA 3GX9A 2XWDA 4FA3A 1TJ1A 3K4WA 4JGDA 2GL5A 4DJDA 1C8VA 3KHJA 1M6JA 1W54A 4L1WA 5DY3A 1QDSA 3H53A 4DM2A 3BTNA 4Q8TA 4IJCA 5BZAA 2Z2BA 1PX3A 4LTSA 2VGGA 3ONCA 3PTDA 3H21A 2OPJA 1D3HA 1NWUA 4GNKB 1TTQA 1J0JA 2OU4A 2G3JA 1F3EA 5GQBA 4YWSA 3VOGA 4OQVA 3LRLA 3WMLA 2BY3A 3DENA 4A3YA 1JDCA 4W8LA 1AJZA 4B5SA 1I2OA 4TVUA 4PTVA 4D6DA 3HQ1A 3BLPX 3ABQA 4ES4A 2GJRA 1O60A 3W86A 1ISXA 4ML4A 3HF3A 2R1MA 2D2OA 4V27A 5KZ6A 1SU5A 3LTPA 1PDZA 2X05A 3WQEA 1TUXA 2OGYA 4UMCA 1ZJIA 3MVIA 1ZNNA 1A5KC 1XF0A 4QBXA 1N2VA 2GYIA 3BPWA 2OKOA 2RDXA 3OODA 2PP1A 2PDMA 1LDCA 1KFCA 2WHJA 7ODCA 3QYQA 2CLPA 4AWEA 2EJ1A 4H7ZA 2Y89A 3NQAA 3E49A 4I7VA 2IMRA 1E6SM 3BLKA 3LPFA 3SRFA 2IQ0A 1KB3A 3FDKA 3VZYA 3TQ0A 1O6IA 1J6OA 2GSJA 4PCPA 1KXTA 2CLEA 1QNVA 4WDWA 3URQA 3NPUA 4Q4QA 2A3BA 2VYOA 3GU9A 1RCOB 3M6DA 5C2GA 4GO9A 4C6FA 1MUMA 1PB0A 5AVNA 4D8AA 4QG8A 6ENLA 2Z0IA 3JW7A 2DZPA 5C0QA 3GU1A 5I7GA 1ZAIA 3PWGA 3NXFA 1CXLA 3OU8A 5DMNA 3QC0A 4AX7A 5AYXA 4JEJA 1A50A 3SSJA 4B91A 3GHUA 1LBLA 3HOJA 2X0HA 1EDQA 3E6EA 3WF3A 5J5RA 5A8QA 3USBA 3ARQA 1V6YA 1VFSA 1CECA 3CZKA 2B0MA 1QHPA 1PE1A 1R8LA 4PBGA 4DPQA 3OVRA 1YX1A 4AIEA 1Q6GA 4GG9A 3ITXA 1E3XA 2J7EA 4EPEC 5BWAA 3THCA 2ZRUA 3A47A 1BF2A 4AD2A 2PODA 1KRAC 4AVOA 2NXIA 1TV5A 4RJEA 3PZVA 3PJUA 1TSIA 3GR7A 4BFAA 4IWWA 3GM8A 3POHA 1UOZA 1A53A 2EPOA 4CU7A 3T0AA 3WDIA 1J96A 1E71M 2Q3RA 2IXVA 3S42A 3M0JA 4W7UA 3TNOA 3WENA 3GG7A 2PD9A 4EVZA 2HJPA 2OYMA 2PBOA 5HR7A 1W5OA 2FIQA 3W2MA 4LSBA 3GQYA 2E3ZA 1DQWA 2HV5A 4GRSA 3U2OA 1TA3B 1Q4NX 3E2QA 2QJGA 3B40A 3VNLA 3FSUA 3OGRA 1IF2A 2J27A 3HV9A 5K9DA 2X7WA 3M0YA 3MDWA 1JD7A 3PPCA 3LNPA 3VNKA 4Q8QA 2INZA 3FKKA 4JPGA 5EMMA 3TP4A 4WDUA 1XDMA 4QE4A 5HINA 4B5UA 3OZMA 2C18A 1GVRA 3UZYA 2OKTA 3ZZ1A 3L5LA 4D72A 1H0GA 2E28A 2NX1A 2VDHA 2PBGA 1E0XA 3FFSA 3T07A 1UR3M 1G4TA 3FA3A 1OWQA 2ALRA 2XISA 5ABFB 2NSXA 4GI9A 1UHVA 3FVMA 4FP1A 3WDPP 4DJEA 2PURA 4AG0A 5B7YA 2YCEA 1UP3A 3N2CA 5FJIA 2GOUA 4LS2A 4ERIA 2WW5A 4RDVA 2DEPA 4GFIA 4U33A 2QUMA 2XVGA 1IT0A 4CEUC 4E4UA 3HQNA 3FN9A 4XAFA 5BRBA 4KQNA 3E0IA 2FVLA 2J62A 2E1DA 8XIMA 1P43A 1A3WA 1ME9A 1BKHA 2OVLA 3SCNA 1UQZA 3AXKA 2YCIX 3AAMA 4CCZA 3CUFA 1H7PA 2X0YA 2RDTA 3QY6A 3CQ0A 4GGHA 2WCAA 3ONBA 3W3OA 1TV7A 2NV1A 5CBBA 4HNUA 1QU4A 4QNWA 3H55A 1NOWA 1JFXA 3S1GA 2GQ8A 1ONXA 4K37A 1XLKA 2QDDA 3EOSA 3CLWA 4H01A 1FHUA 4O17A 3LERA 5FF3A 1AD1A 3URAA 3W7HA 4KIEA 3ZVIA 1OX5A 2UZ9A 7TIMA 4RZ5A 3EA2A 3BGJA 3NJ3A 4CN1A 1UQYA 3ERPA 1OZMA 4IP5A 3M0VA 4GKTA 5TAOA 4Z1AA 1E4IA 1ZY9A 5EMJA 1YDNA 3GG0A 3QPZA 5I3KA 1GWJA 4LS0A 4ZB2A 3NFUA 4EOUA 4H9ZA 1HKWA 4N9CA 3GNXA 3L9CA 4PMQA 4PUJA 1FWTA 1SO3A 3CUHA 1V93A 4R7WA 1WNOA 4ZE5A 5A6JA 1KM3A 4Q6JA 4LH8A 3GIPA 1OC5A 3WLLA 4MWAC 4PCTA 4NX0A 1QWKA 3WBXA 1EIXA 1XLCA 5G5IA 3AHYA 1IT7A 5BOEA 3VCCA 2CLKA 2ZWZA 2WSYA 4GUJA 4TMBA 2VI0A 2XGZA 4XAPA 3MO7A 4NF7A 1G01A 4XB3A 3AIUA 1SW3A 3UXLA 1TRIA 1ESWA 3GVQA 4AIOA 2E6YA 3NDOA 1TTIA 2ZX5A 4LV9A 3DHUA 4JFVA 4DI9A 5EYWA 2OZ3A 5G2WA 1W3KA 2E5BA 2WO5A 3N17A 3IVSA 3URNA 3A9IA 4AD4A 3D3FA 4ATWA 1H3GA 3G18A 3LI1A 4LX4A 4M5PA 1XKJA 2EO7A 3CTTA 2X30A 1YKWA 1OY0A 3DG3A 1TPUA 3O6DA 3B9EA 2QV4A 4N42A 1JYXA 2XN0A 1FH8A 1UPPA 2NUWA 2OEMA 3MTWA 3C3NA 3USZA 1O4UA 3NL5A 2VVSA 3L4XA 1UZDA 3BW4A 3G0UA 4LC8A 3TAOA 4A8NA 1ZP4A 1S5NA 4BQ5A 4JTIA 3CUGA 2IQTA 4NHVA 2E7FA 4JICA 1HKVA 3SQMA 2EG7A 4ZL1A 3TYBA 1S2WA 2P10A 3T08A 2CLIA 4DO5A 4V33A 2FZ8A 3VX0A 4HCDA 4UTHA 3W70A 3RGTA 1EHAA 3WD4A 4DYJA 3CZ8A 3KBJA 1CTNA 4C7GA 4JYDA 3HIJA 2G97A 3K46A 2ICSA 1GQNA 1C7SA 2XUCA 3WLIA 3SECA 1NAL1 4MJMA 4JR5A 1UR9A 5FEWA 3VGEA 1H0IA 4IP7A 1VR6A 3TCEA 4KMQA 3PG9A 1JJKA 2DJLA 1K7XA 4MNLA 1J18A 2VEIA 4P61A 3KTXA 1B9ZA 4EIVA 2PWFA 3PJXA 1K02A 2OQYA 1EZWA 3CB8A 2BG5A 4YTQA 3UXDA 3V0SA 1FOBA 5CSYA 1U5VA 3SCPA 2E0PA 4CD8A 4C1NB 3R13A 2PDGA 5DMLA 3MU7A 3C0QA 4N9EA 4NG3A 3VZXA 1ZLPA 2VC5A 3E0VA 5IFTA 5LYRA 4AZHA 1LT7A 4L56A 5CZTA 2DSUA 2WNQA 3LCHA 1FCUA 2HS8A 4FOKA 3LX9A 1DTNA 3BH4A 3LEPA 4Y9AA 3FYOA 3MO4A 4A21A 4F0RA 4X2RA 1POKA 4BF5A 3FJ6A 3UU0A 2VX5A 2D3LA 1EDGA 3DFQA 3PB2A 4IHCA 3WK0A 2V8ZA 1DEDA 4R53A 4C6CA 4DF1A 1V6WA 3A24A 5IBXC 2WHKA 3QMRA 2VD8A 1H5VA 2JQXA 4PRTA 3HG2A 2XDFA 4GC4A 1FWWA 1QFEA 3WLRA 1DHKA 5BU9A 1NP0A 3S1VA 3MHFA 1KKRA 1JI2A 5H8MA 5JIWA 1EA0A 3UCDA 3QZAA 3NWRA 2BX7A 1QW8A 1P7TB 4UBPC 2FJUB 2PE4A 3B9AA 4IGHA 2CLHA 1JZ4A 2E6AA 3VKCA 2KX9A 1A5OC 2R14A 1B4EA 1MO0A 4IXHA 3UPMA 3A21A 4NSBA 5D2XA 4EXAA 3EXTA 4O18A 3FHAA 1HL8A 4WGHA 3A23A 1DJWA 4H8VA 3MCOA 1OF6A 1JVNA 1I0BA 4JIEA 2OFJA 3GH7A 4KCVA 3AICA 2CKRA 2GGIA 1FCBA 2Z7KA 3BK0A 1CGVA 1W9BM 2FFIA 3BV7A 2ZYFA 4ORIA 4XBJA 2H6RA 3EB3A 1DE6A 1GK8A 2JKPA 7REQB 3NQCA 3GR8A 5ENLA 3BSHA 3PBGA 1MFVA 4KCTA 4AWTA 2V6AA 1UD6A 2E67A 5ECUA 3LGDA 4M7SA 4FX7A 1NF0A 1YE4A 1N8IA 4WKAA 2ISDA 3SI9A 3GAYA 4OT7A 4D9PA 3S9ZA 2QULA 5BOOA 1RV8A 1IEVA 2J79A 4IQEA 4DI8A 1VBHA 5I77A 1FWRA 1SO4A 4AMCA 1DYSA 2ISWA 1LORA 4A8IA 1GNXA 2QGHA 3MA8A 1VB9A 4MADA 3WYZA 1NTHA 1DJNA 1TWZA 1XSKA 4ONVA 2XIQA 4LAUA 2V69A 1FWFC 1W1TA 3PTMA 3CV2A 4UR7A 3NVDA 3TE9A 1T41A 3I4KA 2WAGA 3W7NA 3WLPA 5CZSA 4E38A 1WP6A 1EXBA 2PF0A 2X8RA 2Z27A 2I56A 1GORA 2VXNA 3RO6A 4TX6A 5A6LA 3OIXA 2BS9A 3O6AA 5JQ9A 2Z1VA 3WNOA 1I1XA 3GAKA 1IGWA 3M7WA 4C6KA 2VR5A 2F6KA 1ZFJA 4PUKA 3CZJA 2HVOA 2A3CA 1HJUA 1UH4A 2PC8A 3L4TA 3BLLA 3UYCA 3KVJA 3H7UA 3KCLA 3W7KA 3GZ3A 1L9WA 1TZZA 4Y2WA 4LRTA 1DP0A 3UG3A 4JDYA 3DG7A 1HQTA 2QLYA 4N4PA 3CT2A 4C90A 4P2VA 3NXLA 4L9ZA 1BPLB 4KW2A 5K4XA 2RGLA 1THFD 1W5QA 4JD4A 3MCMA 4J28A 4PSPA 1U2YA 3AZRA 4POCA 3N3TA 2GGJA 2WM0A 3C2VA 4LVGA 4W4QA 3ITOA 4F0SA 1ZBVA 1OCNA 4FAMA 1TPEA 3B9DA 5FAGA 4CQ8A 3TZFA 4JQAA 5IFPA 2EXOA 3W2NA 4P8WA 2XYLA 3S1XA 1JYVA 4LYPA 5AB3A 3O16A 5D33A 2O4MA 4IJBA 4Z42C 5D37A 5GNZA 3B4YA 3KLKA 2WSQA 2UY5A 3TTSA 1VCGA 1VLWA 5AHLA 1BQCA 3F5JA 1XLMA 4XD6A 3KP1A 3ZT5A 3VM5A 4H9MA 3EX6A 1KBBA 5A6BA 3L4VA 4RXFA 1VHNA 2XWEA 1XCFA 3NCOA 4JIQA 2CHRA 3L0GA 1K8ZA 4AZCB 4K3ZA 1V77A 4KEUA 3EZ4A 1Q8JA 1WXJA 4KGJA 2BASA 2X1SA 3CQKA 4E2BA 1SM9A 2PS2A 3N4FA 1JPHA 1Q45A 3U7BA 1Z9AA 2DT3A 3HN3A 5A2CA 3NQ2A 3PZNA 4YMZA 4ZA0A 3TN6A 2E5CA 3OQEA 2Z1WA 3Q94A 1R6WA 1PO9A 1OFEA 1GTEA 1YTKA 3OHIA 4GUGA 4YYCA 3BDKA 3W9ZA 4OUEA 3LHVA 1F74A 4DM1A 2DH2A 4W5ZA 3PHAA 3CU2A 2HXTA 3VKDA 1B3ZA 4GZJA 4ATLA 1EWEA 3DH7A 1VEPA 1BSIA 5DO8A 2P53A 1FWJC 3FSTA 1ME8A 3KL3A 1AJ2A 4DB7A 5C9RA 1FDZA 1AW5A 1UKTA 4MKVA 1EC8A 3MV11 4BKNA 3BL3A 3H12A 3S6TA 1XD1A 1F7BA 1HP5A 4IH3A 3MI6A 1U5HA 3VDGA 3SUUA 2QUTA 3ITLA 3TUUA 3O3RA 3ZLFA 1V3IA 2XZ7A 1ODUA 1RHCA 1XH1A 3BMVA 2AKMA 3N04A 2VEMA 2ZXAA 2XTKA 3A13A 3WFZA 3TIMA 3MMTA 1S38A 3SRKA 2ASHA 2C0HA 1SPQA 3L0KA 1UKQA 1GHSA 3OLGA 1MFUA 3FDGA 4AHQA 3ZJKA 4WHBA 4J35A 2CLFA 1EBHA 1H49A 1W1VA 1GZGA 4FNQA 2J75A 3EBVA 3UY7A 3ES8A 3UCQA 2G3IA 3BXWA 7CGTA 1O94A 3LHTA 1ZENA 4OGZA 3QR1A 1PWLA 3WQDA 4O4VA 1R3QA 2INFA 2E77A 3ES7A 2NQZA 3EWCA 2REQB 2VFDA 1ISYA 1UCWA 2J7FA 5HWNA 3KP0A 3IIOA 3LPPA 2F6XA 2ZOXA 4M7TA 1H41A 4US5D 3BCJA 2EF9A 1VPQA 4RZ4A 1VD6A 3ALFA 3RPMA 4JTJA 1NFBA 4MF4A 1EBGA 4LYQA 3TJ4A 4FIRA 1EO7A 1HJWA 2Z7GA 2ATMA 4L6HA 2VEPA 1SR9A 1Q6FA 4JYFA 3WJYA 5KITA 1RBLA 4C65A 4HNTA 1H7WA 1KQYA 4QRNA 5F4WA 1DWAM 4ZFMA 1P0BA 3HG5A 1LJYA 1MEIA 4C6EA 1B5TA 3S1WA 4H3DA 1E9ZB 3FXGA 3W1QA 5I06A 1NM9A 2ZRXA 4JTQA 3ZT6A 4JDBA 4MB4A 3B0VC 1W31A 3G8RA 4UQEA 1EWDA 4R9XA 2BB0A 4WSKA 1BHGA 4ZQNA 3G8EA 1O5RA 3KL0A 1BYDA 2ZRZA 2E9BA 1YE6A 3IJ6A 3REQB 1DWGM 1XIFA 5D4YA 5GJPA 4PMXA 1J0HA 3G3MA 3VABA 4QITA 1J5SA 4YIWA 3UGRA 3W1TA 3EX2A 9CGTA 2GVLA 4FB7A 3WNLA 1RALA 1JDDA 3PWAA 2YL9A 5C2CA 2WANA 4OECA 3M1ZA 3WEMA 1XLAA 2ON3A 3L4ZA 4XSMA 2DJXA 5FIPA 1SFSA 2DUAA 2FZMA 3T7VA 3D47A 1TQXA 3S5SA 4I5XA 2HSAA 1EJVC 1W1ZA 1LQ0A 3GY1A 4RZBA 2FGLA 3IGXA 4AC1X 1PTDA 5HANA 3MUY1 3M0MA 1IR1A 2X41A 1OFQA 3IWPA 4KCUA 4F2UA 1PCKA 3CPRA 3CZLA 4HNOA 5FF2A 4ACZB 2CZFA 2WVUA 5EBUA 3BAKA 2WBGA 4FPSA 1RK5A 7XIMA 2PDQA 4CD7A 2RUSA 4DJFA 1F07A 2Y8UA 3WBAA 3S5NA 4DRSA 3MDUA 1KFEA 1K70A 3EXRA 3JZEA 3UWEA 4QXIA 2BMBA 5FEZA 1RBAA 1W0MA 1FWDC 1BXCA 4EK7A 4DBEA 1A5NC 1E9LA 3I65A 4UFJA 3G1SA 3PY2A 3MBDA 3LGEA 4O1BA 1ADOA 3CL6A 4GY7A 2BVTA 3BGGA 3TV8A 4DYEA 3IK4A 4MWAB 2OGJA 4IFKB 2IPJA 4V2XA 3CYVA 1A3XA 3GW0A 3WK3A 5FOOA 1FWGC 3NL6A 1O7AA 1FX6A 3CV7A 3GE7A 3WQ8A 3UYIA 3MZNA 1OABA 2JALA 1R86A 4HU8A 1B3VA 5LSMA 1GOOA 4Q3MA 4RE2A 3I3EA 1ZBCA 1IHIA 1K9FA 2RJHA 5A8MA 2NQLA 3RYSA 1ZL1A 2PA6A 4GISA 1R9ZA 5D30A 4QS5A 4OFCA 4XVDA 4GYPC 1JULA 2XGBA 3PUEA 3NQ8A 3AXMA 3V75A 2ADAA 4XTDA 4AYSA 1TTPA 4GY1A 3H26A 6ALDA 5BRQA 5CPLA 1LF1A 1FKXA 4FSAA 2BOGX 2VT0A 3W81A 3CL7A 2E6FA 2TYSA 2NV2A 5TF0A 2NUYA 4H41A 4FNRA 1KW1A 5LGZA 3L12A 3DYMA 1WX0A 5LA0A 2ZRVA 4A35A 1NARA 3H4WA 4MYXA 4FNPA 1ZCOA 1KFWA 3GTFA 4W7VA 5M5DA 1W1YA 3N29A 3NO1A 1F3TA 4MFDA 4DNHA 1G5AA 1R3TA 4AXNA 3RM9A 3W7QA 3CL8A 3A6OA 4C7DA 1E15A 1SJBA 3AIEA 2P8BA 3EWUA 1US2A 3ZT7A 3LS9A 4NJKA 5EKYA 5HPOA 4BS0A 3M5XA 1PYFA 4DEFA 2WZIA 2WC4A 3VDBA 3IIPA 3NDYA 2WJEA 4DJED 3WO8A 4LYRA 1FKWA 2V81A 4XZ9A 1J6PA 1V6UA 3GUWA 1JZ2A 3QM3A 2AQWA 3B8TA 3SY8A 1VFOA 3K4DA 4OHQA 4KWWA 2QCDB 5I79A 4H6QA 1XLJA 3H7RA 3LUTA 3BCDA 4HHPA 1YDVA 3BURA 4JY9A 2BBFA 2ZRYA 1MUWA 4AZCA 4ECLA 3THAA 3VIFA 4HVXA 4MPQA 4F0HA 2WZEA 3UQNA 4GX9A 1VZWA 1EEPA 2ZICA 3LN3A 4RXGA 2NQHA 4AZ7A 3EKZA 3OZYA 3GNDA 4O11A 3N11A 2CU0A 3IJDA 3TN4A 3TX9A 4RR4A 4F3HA 1OX6A 3KBMA 4N4QA 1FRBA 8CGTA 1GVIA 3KLLA 1FWIC 5K2ZA 3S2JA 1HZYA 1OX4B 1GOQA 4ZSUA 2VURA 1RD6A 3R11A 4IPLA 3N9SA 1R9XA 3GW3A 3CV1A 4O0ZA 4X61A 3ANYA 1XKYA 2VDIA 2DSVA 3U5YA 4ADSA 5DBUA 2LLEA 3AHTA 4Q4SA 5A2AA 2QZRA 2O9OA 3K8MA 3UJRA 2I9UA 1TMHA 1Y65A 2HS6A 4H7VA 3SIZA 5A3HA 3QN3A 3ABOA 3T05A 2GZXA 1W37A 2P3ZA 3SM0A 1IR2A 4US6A 1HKMA 5HJYA 1F8MA 1K3UA 4U28A 1A80A 3WLMA 3RJXA 1JIBA 3OEXA 5DT7A 1DKWA 4FNTA 3GIQA 5A6AA 3TYDA 3W88A 3EKLA 2WWDA 3EB2A 2QCLA 2W66A 3QR3A 5JBDA 3VIIA 4WVXA 5LIXX 1GOMA 5FSEC 3N3MA 1JCTA 3TSBA 3PUOA 4I90A 3M44A 3B3DA 4H8UA 4TU1A 3BW2A 2B7PA 5HAOA 5CAKA 3RUBL 4G7EB 3F2CA 4JTKA 3WF1A 3W6MA 1RH9A 2POZA 3L5AA 4MB1A 1TJRA 3LDVA 3SUSA 3HMJG 2I5GA 2O9PA 5FF4A 4O1EA 3PFMA 1W3LA 4E8DA 2Z4GA 4UNKA 1AQMA 5CPMA 4BQ4A 4NZ3A 1L2UA 3DFSA 4GIRA 1UC5A 4K7VA 3IS4A 3IVTA 3ARWA 3V35A 2HK1A 2PWVA 1FQ0A 1EJXC 2PP0A 4EACA 2A3LA 1PZ0A 2G41A 2REQA 1RQHA 1FH9A 2GGHA 1HO1A 2JGQA 3NPXA 3I10A 1H51A 4ZGYA 1REQB 4IMFA 2W62A 4M1RA 3NQDA 5CAHA 4L6DA 2BOFX 2F38A 3M6YA 1W1A1 1JUKA 3MYPA 3EDEA 4DBDA 3N19B 3OBKA 3OQ8A 2W6RA 1ZHAA 3STEA 4OUIA 5CZ0A 3DHPA 2OCZA 4RE3A 3WK2A 3W1LA 4QJ3B 4UWMA 3RN6A 3PK7A 2HRWA 2PRHA 2FTWA 3WELA 2V63A 5D32A 1JL8A 1ZJBA 3U48A 1MZRA 3K1DA 1E1FA 3WDHA 1Z48A 2VGBA 4GZIA 4RW3A 3T81A 4RKAA 5D2WA 4Y9PA 3TEVA 3I6TA 3G1DA 4U10A 4L6OA 4PL1A 3CGTA 3FCPA 4NP7A 3DXIA 1WKFA 5BU6A 4K36A 1S5VA 4FIQA 4NYYA 3VMPA 4MKNA 3REQA 2ZUWA 4PTWA 1YLVA 3QEZA 1UA7A 4L9XA 3FAWA 1K9DA 2WYSA 5BYWA 2YLAA 1UWIA 3AYVA 3GYEA 3C2YA 3QTPA 1BEUA 4IFRA 3TH6A 4GKLA 4WY0B 4CD6A 3EMCA 4ML9A 1I4NA 2BY1A 3TJIA 4YTUA 4LXFA 4CNNA 1JCNA 4FEZA 1YEYA 1J0YA 1Q13A 3WNNA 4QJ1A 1QI4A 4S1FA 3N73A 4JQ3A 4U3AA 3B0XA 1LYXA 2QMKA 4CN4A 1W9VA 2VX7A 2YFOA 4M19A 4EXBA 3EEGA 4AZIA 4MLRA 4AWSA 4H4IA 2W5FA 1G4PA 4WOZA 3O1NA 4GVFA 3MSRA 2O55A 4U5KA 1ZJHA 3NR0A 4HPXA 4MY8A 4KWUA 5IHRA 3UPWA 4GZEA 3M0HA 1TPC1 4LS1A 1BFNA 1ZS2A 2PEVA 4WR3A 4AF0B 3RR1A 2XIOA 3TC3A 3M47A 1NQ6A 3RPDA 1X6NA 4C6OA 5F2GA 3B05A 5A8PA 1FP8A 3HPFA 5HK4A 1XUUA 3LZ5A 3AIBA 4HCLA 3WSUA 4X60A 4LBUA 1TPVA 4H6EA 4IMAA 2HQAA 3GBDA 1EPVA 3WL0A 3WUGA 4QISA 2RAGA 3H22A 2GQ3A 4XZHA 3SQSA 4TV6A 2X16A 1W56A 1JCJA 1DVJA 2I1OA 1O95A 1S5WA 1Z41A 4Q8MA 3DZ1A 3T55A 3CHVA 2WPBA 3HPAA 2FMOA 5MHBA 1RUSA 1YBQA 3MZ2A 1OCBA 2FHFA 4C6QA 5FJOA 3CM4A 4PBEA 1Q6LA 4TO8A 2ATSA 1BG4A 1EQCA 4U4MA 1VFUA 4MWAA 3QY7A 2CYGA 4IFKA 3RIKA 4HTBA 1JNDA 2CC0A 1GOXA 1KGXA 3HQOA 1DWHM 1FHDA 3CZGA 4R7JA 2YIHA 1ISWA 4RLIA 2CWXA 4LUTA 3LLDA 4I5UA 4C1LA 4ZBCA 3LRKA 1H63A 2W92A 1D3CA 3IV3A 3UXKA 2XSBA 5E70A 5HQMA 1FWEC 3MB9A 4BF9A 5HR6A 2W91A 3WH6A 1GPWA 1IXOA 4QLKA 5T9CE 5AZ0A 1A5CA 1UD3A 4MG4A 4MFEA 4S39A 4BWLA 2CPUA 2DT1A 1GEHA 1R2TA 1QW9A 4PTDA 3PWIA 3WL1A 3N4EA 1PTGA 3CK5A 1E73M 4B92A 1H7XA 5LIYX 4XAYA 5EFFA 5KSWA 9XIMA 3PZQA 3DYPA 3MS8A 4DUWA 2QAFA 1EHNA 2ZVRA 4HNCA 3UT0A 3L67A 3UETA 3QFEA 4E8CA 4XWUA 4UR9A 8TIMA 3EWXA 4GQGA 2WSRA 3D5HA 3WCZA 2WB5A 3KBNA 4RNJA 4ILSA 1U83A 4ZQRA 3AC0A 3L2IA 2IUZA 4PEKA 5CPSA 2XJ7A 4OJYA 3HBLA 3WD2A 3TROA 4CU6A 3WF4A 4QQ3A 1IEQA 2ZADA 1E6ZA 4KRUA 4IQDA 1S2TA 4U31A 2J7BA 2OJPA 4FZIA 3F4WA 2XH2A 3ZWTA 4QP0A 1TELA 2J7DA 3PZUA 2RGMA 4O1FA 4UFIA 1FCQA 4M80A 1AQHA 3K1GA 2QCDA 3IUHA 2DV0A 3ZR4A 1NY1A 2XN1A 3SCRA 2GDVA 4DHGA 2VELA 1BXBA 2DZWA 1FWHC 2DZVA 4XX6A 4LALA 2XVLA 2BOEX 1NDZA 2NVCA 3EWWA 2P3EA 1HL9A 2CZ5A 1DV7A 3M9YA 4DZHA 2C15A 1V7YA 3R89A 4WJ8A 3AMKA 1YPIA 4FX6M 3RRXA 4YPJA 3DECA 4AD3A 2J8GA 1HL2A 3O6YX 4KFNA 1NWSA 4K8GA 2X40A 2Z24A 2ZDSA 3BQ5A 5IBXA 3ZYZA 3E9AA 1LL7A 2QJIA 4QNEA 4QJ4B 5BNKA 2CWNA 1EB3A 2YBUA 4MNKA 2JK2A 2SFPA 5I0DA 1V0MA 3V36A 2FB3A 3BAYA 3W25A 1F5ZA 3VIKA 4NZFA 3U57A 3ARYA 3W29A 3PFRA 1V3MA 1BD0A 2CIPA 1Q8AA 3H4GA 4QCFA 3M4HA 3TZNA 2DUZA 3W6YA 1WZAA 3VYLA 4DWSC 3OB8A 5I3HA 3GC4A 4UQCA 2NQ5A 1PIIA 3S47A 4D8ZA 1UH2A 4FI4A 3RX3A 4DXXA 4CVWA 1KFBA 4LNYA 2ZA1A 4HIBA 2WM1A 1EX5A 1SFJA 1M53A 7TAAA 1MNSA 3PAJA 1I2QA 3AU2A 4O13A 1X39A 1LUCB 1E0WA 1KBLA 2ZUSA 1UBPC 3WDRA 3UJSA 4G7EA 1UWUA 3EMZA 1ITXA 3H2FA 3R12A 2O9TA 1B4KA 4OV4A 5M03A 1LTDA 3OYZA 1NOFA 4KWVA 1A4LA 4O52A 1US0A 3RLGA 2D22A 3M0LA 4S3BA 2CESA 3R43A 3JU2A 1JCLA 1OIFA 4W9TA 1PZ2A 1W1PA 3O7UA 4ASTA 2WCSA 4IGSA 3ZS4A 4Y6GA 4L65A 4JQ4A 5CGMA 2NT0A 1LL6A 3E74A 1REQA 3ORWA 3PUDA 1MXDA 1DE5A 3W1NA 2V5LA 2MUCA 2FB2A 3O8AA 1Q6OA 2TODA 1ONWA 2VRKA 4KKXA 2NX3A 4HU3A 5H8UA 5A6SA 1C9WA 4GYKA 4J5NA 1A47A 1LQAA 3SY5A 5DMYA 2CBJA 3I6EA 1MUCA 5HDRA 1E1EA 3B0UX 3VKBA 4CEXC 1NWTA 3GU2A 4J40A 4AXKA 4IFOA 1MW2A 5G4EA 1A5MC 1XLDA 1G0CA 4IIGA 1SSGA 3ZLGA 5I24A 3VINA 4JN8A 2F84A 3WF2A 3OO2A 2QDHA 1YDYA 2ZKMX 1K1DA 4ICCX 3WK1A 1E5NA 3RPTA 4XUGA 4CVUA 3PB0A 4JTLA 2FMNA 1XBYA 3SY1A 3QRHA 3ZR5A 3R4IA 1KA9F 4F4RA 3EDFA 4I6VA 2VCAA 3GC5A 3HGRA 1C8YA 4YU1A 4ZOAA 4Q8OA 2CBIA 4R85A 3VILA 4HJWA 1AZ1A 3VD4A 1EGMA 4BJHA 4HGXA 4KRTA 4IG2B 4IUGA 4WY0A 3MJYA 2YYTA 2POTA 2F2KA 3MP5A 4UMAA 1UKPA 1HN1A 3ZO9A 2DQWA 3PG8A 1UUMA 3HJZA 2HTMA 2F61A 3FK4A 1LL4A 1XFBA 1DIEA 1XYBA 4AF0A 4JQ1A 4BQ2A 2ZUUA 4ZODA 1XJBA 3UZWA 4XD4A 4MSSA 4O57A 4L1XA 3SJ3A 2JFEX 3RXZA 2WHLA 4FMVA 2E8ZA 1QASA 1WXZA 1XPYA 3W7CA 1PZ1A 3AIRA 4EE9A 1P5BA 5H8PA 3NZRA 1C91A 1GT8A 1TV3A 4DELA 5DRCA 4GIYA 2BWGA 3CMJA 3B97A 1JUEA 2VENA 1UJPA 1UIOA 4GBUA 3N14A 3DFTA 5IRPA 4RPQA 1VIZA 4L1GA 1TJ0A 3INPA 4Z1BA 3EWZA 3S0CA 3GO2A 3TKFA 2GGGA 1K6WA 4ZEPA 2AKZA 4DN1A 1XYAA 4PSRA 3ZM8A 4CU8A 3VDAA 3G24A 5LZLA 3NO5A 4AY7A 5CPQA 3MJMA 3NSNA 1UG6A 4L4OA 4TTGA 4B9YA 4RNIA 1LBMA 5HJXA 3OTRA 3Q58A 2QCCA 2PTYA 2HPIA 3ABRA 5FA5A 3IEBA 1G4SA 3KL5A 1R3YA 3SUVA 5A69A 4O19A 4DJFD 4AIUA 4YNGA 1UR8A 3OZPA 1IEIA 3E1F1 4DBUA 3B04A 1DQXA 2XIBA 1EC9A 4DO4A 3TQKA 4JXCA 3RU6A 1XDJA 1CXKA 3WLHA 1BGGA 3PPGA 3P7YA 1E1CA 3RM8A 2ZZ7A 2YB4A 1TZ7A 1WOAA 1CGYA 1WZLA 4GQ0A 2GK1B 3JVAA 4UTWC 1H09A 1WAWA 2PDPA 3O2LA 1VYRA 1SUXA 2NXHA 4RUBA 1GJUA 4AY8A 4I9AA 5F2LA 4H9TA 2YL5A 1A4MA 1CZ1A 3CIWA 3ATYA 1XIJA 3D0CA 2OMAA 1T8XA 3BICA 1FXQA 1TPFA 2V30A 3HJEA 4IIBA 1JZ5A 2ZX8A 3A4WA 1EF2A 1N82A 2DIEA 1DJYA 4EF9A 2ALDA 1TZ9A 4QLLA 4UOZA 4OZOA 1V0LA 3P0XA 1Z69A 3CAVA 2RFGA 2WLYA 3XIMA 3KTSA 2XFYA 4M3PA 1BQGA 2VRJA 2PWEA 3NSXA 1W5PA 2WXDM 4Q32A 1A5BA 1GOKA 3QZ6A 3HG4A 2OYLA 2Y63A 2OQLA 2B4GA 3M0XA 3UBPC 2DZSA 3AZSA 3NUKA 3LCFA 3GB6A 3GVRA 2C1IA 2DFAA 2C6QA 2HPMA 2CZEA 2BV9A 3QQ0A 2V3EA 1BWVA 4AMAA 2PZ0A 5FJJA 4I7UA 3FA4A 1I1WA 1L0PA 3W27A 1K4GA 3SBFA 1TREA 3ZIZA 1KKOA 2EPHA 3IAQA 1GZ1A 1RCXB 1JRCA 4A4AA 1X98A 1ENUA 2Y88A 1KFLA 4P7LA 3RFAA 3MUCA 2PMQA 3G22A 2DZAA 1UWSA 1K8YA 2C16A 1NDWA 3W7LA 1JZ8A 4GXPA 1RCQA 1E3ZA 4H6KA 5KMYA 2XGIA 4X0VA 4JNZA 4NI3A 4JNMA 4DVOA 1J01A 4HOZA 3GDLA 1RA5A 3K13A 4CQDA 1V5XA 1GYMA 1IT8A 1RR2A 3QMSA 4M6VA 5A5WA 3R8GA 2CLOA 1PAMA 3T42A 1C7TA 4YVXA 2H8XA 2R9RA 2Z1XA 1W5NA 1PCWA 3N1AA 3ZVHB 1XYFA 4QAWA 4MGGA 2V5KA 1G1YA 3GDTA 2V2DA 1QO5A 1EL3A 1QRQA 4B3KA 1EQPA 3PJWA 1FDYA 1X97A 1ZTVA 1J11A 3QLDA 2YDSA 1P6CA 2DZXA 3AS2A 1RVGA 1W32A 3W7PA 3QZEA 2E4TA 1T0OA 3TU9A 1VBGA 2YKKA 3GH4A 1MRQA 4JHZA 3I3BA 1V8EA 3QF0A 4PMJA 1OBAA 1HKIA 2C1GA 4F79A 4GY0A 6REQB 1BLIA 5HATA 3EPNA 4PRRA 1KCZA 4U5IA 2E68A 4KFPA 3RAOA 4CGTA 2RDWA 1JZ7A 5KEZA 1VAHA 1LP6A 2X1TA 2WMFA 4LAMA 3TW9A 4H04A 4KETA 4M81A 3M0IA 4OBRA 4WXZA 3W7JA 2DSKA 1XX1A 2OYKA 3FEMA 1B57A 4W87A 1HO4A 4DJDC 1AQFA 1LUCA 2XIMA 3VM7A 5HMSA 3ZSSA 4GQQA 1NEYA 1EH9A 1DORA 1O1HA 1BVZA 2QCHA 1RY0A 2V68A 3FA5A 2ZBTA 3FXYA 4YHEA 4QFUA 1G69A 2G5WA 5JIPA 1I60A 3WQ5A 4PFMA 2WLZA 5FESA 1XC6A 4DO7A 3D6NA 1GYNA 5ABHA 4Z08A 4X63A 4HOXA 4HN8A 3I7RA 4MZ1A 2BDQA 2HWGA 4NU7A 3V5CA 3VIMA 2V82A 2WMJA 3B4UA 2EKCA 5HOSA 1VC4A 2HVNA 5TNVA 2WNWA 1GOIA 1UYQA 1GVFA 1AH4A 2C7FA 3ENLA 2Z29A 2R1PA 3L21A 4UXDA 1TPDA 1UBSA 3IGUA 4IJRA 1XLIA 3C52A 3WLTA 3AO0A 3ARSA 1W9PA 4NAEB 1E55A 1YMYA 1KM0A 4ZQCA 4V1XA 3SCUA 2VX4A 3VX1A 3POCA 2Y5EA 4S23A 3C5QA 3P5ZA 2QUUA 5XIAA 2J9YA 3Q67A 5FSDC 4XD5A 1M7XA 2GFTA 4ROQA 4MKSA 4NX5A 4O10A 4A3RA 3VE7A 3RMEA 1WKDA 4IXXA 2OG9A 1OG6A 1JQVA 1W3NA 4ZO6A 1Q7ZA 1TCDA 3TYEA 1MQPA 3GXIA 4JN7A 1OHLA 3TK7A 2GDUA 1X1OA 4ZENA 4Q4OA 3NPWA 4GYPA 4XZNX 2ZRWA 2J7CA 1E0UA 2JE8A 3CXOA 3NEVA 1NELA 5IXEA 1AVAA 3QSTA 5D03A 3VD5A 4HKPA 2GOKA 1ZBWA 1O5XA 3STCA 1GVSA 2A0NA 3WLQA 3NTYA 1UA3A 3LYEA 4W7WA 5A8GA 4AHOA 5CPOA 2ZA2A 3H23A 4IG2A 1TPH1 4LQ1A 2PWDA 4Q8PA 4HHMA 5DY2A 1KBIA 5DEZA 1B31A 5IHSA 3CAQA 2YX0A 3CHFA 1WDQA 1PSCA 4O53A 4TVCA 3O05A 4GQRA 5G1MA 2QT3A 4FLSA 4C5ZA 3TFCA 2NUXA 1S5MA 3MHGA 1LLZA 3ABZA 3LMYA 4JTGA 5FAJA 4LEQA 3EX3A 4ZXLA 6TAAA 3LZ3A 4UUIA 1NFPA 3TCSA 4IIFA 1XIEA 1E6PA 4GMEA 3BC9A 1N8FA 4CCCA 5CBJA 4CQ9A 1K7EA 1QCWA 5HBFA 1ECEA 5A94A 3SIMA 1WDDA 2CW6A 2VQTA 1EO5A 3A64A 3TQPA 1DXFA 4FHAA 1XRTA 1GG1A 3HQPA 5F1VA 1Q63A 3ARRA 4JL1A 4A8RA 3H6OA 3VOCA 4D6IA 1QI3A 4IICA 1B3XA 1WA3A 2IS7A 3KS6A 1BYCA 1HIZA 5AFDA 3EDJA 4HYVA 3LBOA 1VFLA 4C6PA 4WJEA 3UZ5A 4QS6A 5GNYA 1D3GA 3M43A 4LAOA 4A3HA 2P0OA 3R94A 3G3DA 4KEVA 3B06A 2G4FA 1XRFA 4G56A 4ZOBA 3S6DA 4DLFA 2IKGA 2R1NA 1XWYA 3S3GA 4Z2IA 1NDVA 3ITTA 2I9EA 2G0WA 2P8CA 4GACA 2BXVA 1Q6QA 5D09A 4IUOA 3C0JA 3UWUA 2BGQA 2BTMA 3BE7A 4JFUA 4AHPA 1QW7A 2NLYA 1NSJA 6XIAA 3HTWA 4OOZA 2QJNA 1DWJM 5IOBA 1PJ9A 1B3YA 2DSWA 1RQEA 1R0MA 1NDYA 1LM1A 1Y8BA 3VNJA 4UCGA 5HMEA 1TJPA 4B4HA 1LRNA 5PTDA 1DTUA 4HPNA 2ODOA 1MNZA 4MVAA 2J66A 3GXDA 1MDRA 4PL2A 4JQ2A 3OGSA 2DZTA 2OXNA 3F4DA 4FX8A 1LZOA 2XM2A 2PAJA 1KM5A 3NGFA 1E4LA 4RDZA 2DQXA 2AQVA 2OOFA 1H7NA 4IIDA 1BRLB 5DRIA 1YHTA 2GK1A 3LHUA 1IZJA 4IM4A 3HPXA 4DY1A 3GHSA 5DQPA 3QV8A 3KOYA 3AHXA 3VU2A 4YCPA 4MWAD 3W53A 1CGUA 3B9OA 1XXXA 4DWSB 4A29A 1DJHA 7ENLA 4FLQA 4CLMA 3NZPA 1RLCL 1LWJA 3NYDA 2X0SA 2W79A 2H3DA 4B90A 1CGXA 4NAFB 1QBAA 3UNDA 1EOKA 3L4UA 4Z2JA 1QT1A 4L7ZA 3WJZA 2ISFA 5L9FA 4YVPA 1GOWA 3GC2A 4O54A 3ICJA 4CCDA 1X7FA 2D24A 2QEZA 3EOEA 3WBWA 3LBMA 1XGDA 4UQAA 4ZQOA 3VIHA 2WK2A 3VI2A 3HV8A 4NT0A 3DAQA 3KS5A 3O06A 4R5EA 4GUIA 1A5AA 5JU6A 1JF6A 1XSJA 3MHUA 3V5FA 3APTA 2QGYA 2PU0A 4PB4A 3AUOA 2GUUA 3PBVA 4KF1A 2FJKA 3HGSA 2I14A 1TCMA 4S38A 1PBGA 1JGMA 5DLCA 4QE5A 4YTSA 1O12A 1QATA 4B16A 1QPOA 2CHNA 4V15A 2D69A 1Y5WA 3QC3A 3W7IA 5I3IA 1S2AA 1IIGA 3N2MA 1YNQA 4AY1A 1E6XM 3VA8A 3GD6A 3QQ1A 4MIMA 1DBTA 1OT1A 3PM6A 4E4FA 4LCRA 1P0NA 2WHMA 1ALDA 1WB0A 4TX9A 4JIPA 2QUNA 2Y61A 3STPA 1XCXA 1UP0A 2C14A 2PDKA 1MEWA 4JTHA 5CQ1A 3KFTA 3VGGA 1W5MA 3PBUA 5JH1A 3OPSA 1U1UA 1L2QA 3T2PA 3UR7A 4L61A 1OG0A 1JF5A 3W2KA 4ENLA 1BTCA 4JS3A 1QOPA 2OEJA 3GHRA 3QGKC 7PTDA 5FL1A 5B7ZA 3UWQA 3DBNA 3TA9A 3ZVHA 1QK2A 4B5NA 3AXHA 2BVWA 2PLMA 2VNCA 4GH3A 1CW2A 4M0XA 4O1DA 2XPKA 3LY0A 1DWFM 3DKLA 4HU4A 4NY2A 4HT3A 3BJTA 3C61A 2WC7A 4JX4A 4QJ5B 4K2SA 4GINA 3TTEA 3PF3A 4ZVJA 1YQ2A 3N6JA 1DJXA 1S2VA 1UMLA 3KOWA 1UJQA 3QBUA 1J0IA 1DWIM 5C5YA 3MY9A 5F7UA 2VUYA 4FOJA 3D46A 1UWQA 2Z26A 4C6LA 5C6MA 3E96A 2CETA 1S5TA 6REQA 5KINA 3U0HA 4HTYA 3N6QA 4TX8A 4N0RA 2FHBA 1IXNA 2O4QA 2Z1BA 3I68A 1JUBA 4UTJA 4OTKA 2QS8A 1UMYA 2PZNA 3TA6A 4H19A 1C8QA 1QPRA 3KAOA 3NURA 1TV2A 3EWDA 1HT6A 3VOHA 5L6UA 3KE0A 3XISA 1V02A 1YXYA 2QR6A 2NX9A 1I2RA 3T2OA 3B8DA 1OVDA 1C8XA 2WNNA 4V28A 5CJNA 5E6ZA 5T8GA 2O9RA 4GVGA 4QDMA 1UD4A 4HOWA 1BVWA 5LNWA 5IDZA 4QR6A 3R8RA 1ECQA 4ZB5A 4NNCA 3VOFA 1XCWA 4GI8A 5I00A 1FXPA 1C3FA 4G1NA 4QTGA 4MJ2A 4E2VA 5A8NA 1SR0A 1OC6A 1VGAA 1TWSA 2ZUVA 2JF6A 1JZ3A 3LM7A 3QY8A 5XINA 4PZVA 3CUJA 1QOXA 4I6KA 3U3HA 1V79A 3BZGA 3WX7A 2PWHA 2PWUA 1VBUA 2Y1HA 2PI6A 2VFHA 3TOPA 4GC3A 3M16A 3S5OA 1BSLA 1CX9A 2O92A 2R1KA 3GDBA 2XM1A 4V1YA 5FACA 1AD4A 3W24A 4NAEA 1K9EA 1P1MA 4D1JA 2EPLX 5CC6A 3MV01 5C70A 3OP2A 2PCQA 1BAGA 2EGZA 2FZNA 3TYCA 2X2YA 2ZVIA 2XSAA 3F03K 3GFYA 3IK2A 3N2XA 3DN5A 3V4BA 3LLXA 3MWAA 3MUZ1 4HZ6A 5DCBA 2IPWA 1UUOA 3SFWA 4H9YA 1EC7A 3THUA 2Y5SA 4D6GA 1L6GA 1PX8A 4GABA 2JEQA 4JTCA 5KETA 2CZDA 3VVGA 1GQIA 4EX4A 2QPUA 4LF2A 1DJGA 1ITQA 1MQRA 4K7YA 2XHYA 3MPGA 3W71A 4NVTA 3NSMA 1GCYA 2ZZ1A 3UGVA 4GQBA 2YZ5A 5FCZA 3FY1A 3WQFA 4LCSA 3RU8X 2NVDA 1K77A 1OADA 2BVDA 2CNCA 3H70A 3EA1A 3EWYA 3S6OA 1EPXA 3QLLA 2NT1A 3EMQA 4MY1A 1XI3A 1XIBA 1FDJA 1XSIA 3QW4B 2OO6A 3GXMA 3H2EA 3DOPA 1HKKA 3KM8A 3GHTA 4JCMA 3W22A 3RJYA 2ZWYA 3PBMA 3ITGA 5AKQA 1KXQA 5EMYA 2IXUA 2IPFA 1GONA 1IYXA 4LAZA 2J6VA 3LI0A 5CBIA 2TRSA 4S3CA 2OQHA 4WXYA 4F48A 3AIVA 2Y2WA 5FL0A 4X3ZA 2D0HA 2DVXA 3CV6A 1WDWA 1KXHA 1NOUA 1TG7A 1KTNA 2EJAA 3DIPA 2ZZ3A 3E2SA 2Z2UA 1WPCA 3L7RA 1R2SA 2PB1A 5I6SA 4BZYA 4HNNA 1WE5A 3AQUA 3OIHA 3ZOAA 2P5NA 3NZGA 1SFLA 2EBNA 3FS2A 1UP2A 4G2DA 2VHLA 2BHYA 1TKKA 3NEHA 2H90A 5HNNA 4RL3A 4AZBA 1O68A 2AGKA 4A3UA 4LANA 4ZO8A 2FZBA 1CXHA 3DGRA 2D0GA 3QJAA 4RNFA 2J78A 1TV8A 2WPGA 4QGCA 5AZ1A 4KCWA 2Q8LA 5AC4A 2GJXB 5B80A 3P0WA 4XK2A 2DDXA 5C9XA 1QOQA 1VEMA 1FBAA 3W84A 4Z0SA 1OQFA 3R8HA 1BRLA 1KM4A 1D8WA 1EP3A 5HUPA 1DIDA 4OVXA 1IWPA 3PNZA 4L4PA 3DFOA 2YDQA 3K8LA 1N55A 4P7OA 1H5YA 4D2JA 1AH0A 1MW1A 1CLKA 3AJXA 3DUGA 1Z42A 1WYIA 3VGBA 3BJFA 3PAOA 3BQ6A 2HCVA 3G1FA 1WDRA 5KTLA 1DJZA 3LV5A 2VEKA 2CXEA 3GG1A 3IUIA 4U2ZA 1JCYA 4HHHA 1XH2A 4NAFA 1E0VA 4RK8A 3ECQA 5E09A 3DX5A 4Q7IA 1RBOB 4Z2HA 3M5VA 3MP3A