3FJAA

Crystal structure of f132w mutant of human acidic fibroblast growth factor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILWLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 37
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fjaA00
3B9UA 4I4XA 2E4MC 4HR6C 1BFBA 2VXTI 3AH2A 4G9NA 2HW9A 5F8WA 1WD3A 4DENA 1JT4A 1PWAA 4OWLA 1G9AA 1NUNA 4J23B 4QC4A 4L4IA 1I1EA 1TIEA 2D44A 3H6SE 4OWKA 4H04A 3O3QA 2Y9WC 5EG6C 2F2FC 2IHOA 4P0LA 5FZYA 1WBAA 4WBCA 4I4QA 1EVTA 1YBIA 4JKQA 2D43A 41BIA 1TOOA 2VU9A 4ISQA 3FJFA 3IM7A 3O49A 5BXPA 1A8DA 1QXMA 1G9CA 2MIBA 3F1RA 5DUYA 1V6UA 1HCDA 4LO7C 3NBNA 3FJAA 1S0DA 5BP5C 4LO2A 2FFUA 3O44A 4D8HA 2YUGA 3NBEA 1F31A 1XHBA 3BA5A 2KLLA 1PUUB 4G6JA 4LO8B 1DFQA 3AZWA 1W3AA 4I4VA 1IT0A 2ESUA 3UJ0A 2LIQA 1G82A 5FNXA 1TTUA 3BAOA 3RTIB 1BARA 2Y9FA 2VXRA 3AJ5A 1GGPB 2RSTA 5DSSB 1S0BA 3WMUA 1ILR1 2HWMA 1IJTA 1PUMB 2MLLB 4F34A 4XFSA 1ISVA 1HCEA 3OBRA 4LO7B 3HMYA 3IIRA 3UD7A 1W3FA 3EF2A 4D0ZA 2AAIB 1IHKA 1XZZA 4HJJA 3V0BB 3V0AA 5E24E 3FJCA 4A7YA 3WINC 1DJSB 1RZOB 3CAHA 5DVHA 3AJ6A 3D7WB 4Z8SB 4IY8A 1ONKB 2D1ZA 1ISXA 1TWEA 2NP0A 3I29B 1DZCA 3JRRA 6I1BA 1JTCA 4LO3C 9ILBA 4KEKA 1AXMA 3S8KA 2K4AB 4I1EA 4GAIA 3JUTA 1HWNB 4IONA 4XKIA 4EEEB 2NYYA 1FMMS 2KKIA 1AFCA 4TLPA 1RG8A 3WMVA 2HZ9A 3R4UA 1IILA 2F8XC 2VSEA 4ZGRB 3RTJB 1S0LA 1YYNA 3Q7YA 5FZZA 3QR5A 3FJIA 4GP3A 1V6VA 5D61A 5BQUA 1SR4A 1JY0A 4I0YA 3UDAA 4GP0A 5GAQA 4EKXB 3OGGA 1L2HA 3VEQA 2GZBA 3N7JA 4OWJA 4QALA 3BA4A 5F90A 1Z0HA 4QD2B 4DCKC 3FGMA 4LO1A 1Q04A 2BEAA 1EPWA 2ZQOA 1ISZA 3OJVA 2BFHA 4R6UB 4J2SA 5BVPI 3E8LC 3BTAA 4I2SA 1KNMA 3NBCA 4QO3A 2QN4A 4IY9A 1R8NA 2FGFA 3FJ8A 4I4SA 4P0KA 2WBCA 1TWMA 1K5UA 4I96A 2FFVA 3CRGA 3PMEA 5D63A 4QKRA 1HKNA 3CA0A 4I3NA 4G1RA 3OJMA 2J3PA 4J2XA 2Y9GA 2DRYA 3N7MA 3A07A 4A7ZA 5JMCA 4F83A 2KI6B 1S0GA 4KEIA 1AVUA 3V0AB 2I1BA 2VSAA 2M49A 3FJDA 4OEGA 3BAUA 1QQLA 4YOLA 1PZZA 2ZQNA 3VSFA 3Q7XA 1HWPB 1JT5A 2L5XA 1J0SA 3ZX7A 3RMYA 4II0A 2ERMA 1RMLA 4X39A 3BRDA 1BFCA 3PUBA 1I1BA 3IM6A 5FZUA 3AH4A 4P6AA 1XG6A 1IRAX 1VCLA 3BX1C 3BAQA 4ZOTA 2RG9B 4ZA3B 1YF8B 2D22A 4J2YA 5JLVA 3CU1B 4Q91A 3VSZA 3ZXDA 1DLLA 4P0JA 2D20A 3FJJA 5F8YA 3CQAA 3UD8A 1AVXB 1JT3A 2NZ9A 1IRPA 3RMXA 1WD4A 1S0FA 1FV3A 3NBDA 3FJEA 1ITBA 3PG0A 3AKFA 2DRZA 4XFTA 3ZC8A 2D23A 4JAWA 31BIA 4LO0A 1DQGA 4IHZA 4OUJA 4I1BA 4A7KA 5I1BA 3HBWA 4X38A 5D62A 2Y9XE 2E4MA 3O4DA 3O4CA 4KEJA 3ZXGA 4QD2C 4I6IA 1MD6A 1M2TB 4X3AA 1AVAC 1JLYA 4PC4A 5EHAA 4LO2C 2D24A 4Z9WB 2P39A 1FMZA 3AH1A 3S8JA 3O4AA 1BLDA 3NJ5A 2F2FA 1IOBA 3VUOA 2QYIB 1UPSA 2XOAA 4AN7B 3BADA 1FWUA 3CRIA 1YXWA 3KMVA 5BXSA 2BEBA 3LLPA 2AXMA 3CRHA 2AQZA 2X2TA 4D0TA 4IYBA 4G9MA 2VUAA 4ZFWB 1FQ9A 3H6QA 7I1BA 3IAGC 3BA7A 4X37A 2AFGA 4ZFUB 5BP5A 2K8RA 3BRGC 1NZKA 4GOYA 1DQOA 1YTOA 1FGAA 2NVHA 3CA4A 2Z48A 3K1XA 3HOMA 3VWCA 4JKXB 1BLAA 1M16A 3V0BA 1DZDA 4L4HA 1FWVA 1OQLB 3FJKA 2UUSA 3FFZA 3BB2A 3W9TA 4CJMA 2ET2A 3FJ9A 3ILAA 4Q9PA 1T4QA 1FV2A 4USPA 3PHZA 2KH2A 3H6RA 1JLXA 1QQKA 3OGFA 3VT1A 1P63A 1S0EA 4ZKTB 3BAHA 2FO1A 5BXTA 4OEFA 2X2SA 3WA1A 1ABRB 3ZC9A 3A22A 2R9KB 2D7IA 2GO2A 3N0KA 4QKSA 3F62B 3HALA 1ISWA 1BFGA 4FVVA 4I4YA 1FN0A 4IZXA 21BIA 5F8SA 3FUQA 3WINA 2DREA 1G9BA 2WRYA 2ZR1B 4ZBVB 3AKHA 1II4A 1XYFA 2KI4A 4I4UA 1S0CA 2P23A 1V6XA 2MC2A 5BQUC 3IM5A 1JT7A 3AKIA 4I4OA 3CA6A 1R8OA 1SR4C 8I1BA 1D0HA 3N7LA 4LO3A 1CVSA 5FNWA 3P6JA 4Q9GA 4JRAA 4LO1C 3RSJA 3I2AA 1RY7A 4ZFYB 5G00A 3C9ZA 1CE7B 4KC3A 4GAFA 2IWTB 3OJ2A 3BAVA 4KBBA 5BOWA 3BRFA 4QBCA 1JQZA 1AF9A 4QBVA 1W3GA 2FDBM 3UJ4A 4I4PA 3A23A 3O4BA 3FUOA 1HIBA 4J2KA 4JQ0A 1MC9A 3P6IA 2NM1A 3V79C 4OW4A 1EYLA 2VLCA 1Q03A 3VT2A 3BAGA 3VT0A 3MALA 4JPZA 4JP0A 1EV2A 1BA7A 3LTQA 1TP0A 3CA5A 1HWMB 3AZVA 3TC2A 4FGFA 1HWOB 4OEEA 3CA3A 1TFMB 4USOA 4G6MA 4ENDA 1Z2VA 2LIEA 3MPPG 3N7KA 3I2XA 3H6RB 1DFCA 3QYDA 4DEPA 3SNVA 4I7IA 1Z4SA 2HWAA 4EFQA 2Z49A 5EC5A 2D7RA 4H9WA 3FJBA 3WO2A 2K43A 3HN1A 2DS0A 3P53A 3UD9A 3A21A 1T9FA 4HA2A 1K5VA 4IQPA 5BXRA 4EFPA 3FJHA 4GOVA 4ISRA 4AN6A 1DIWA 5B2HA 4IZEA 2Q3NB 3O4OA 3POKA 2RQ9A 1PC8B 3HSMA 3O5WB 4I8MA 3R4SA 1Q1UA 2Q9XA 3AKGA 2NTDA 3WO4A 1SZ6B 4EFRA 1BFFA 1G9DA 3WO3A 1ISYA 4ZLBB 5HPZA 1N4KA 3Q7WA 4LO0C 1E0OA 5DZUA 3T8SA 4XFUA 4EB2B 1BASA 1V6WA 4I4RA 1WBCA 3CA1A 1AVWB 4I37A 3OBTA
chains in the Genus database with same CATH superfamily
3B9UA 4I4XA 2E4MC 4HR6C 1BFBA 2VXTI 3AH2A 4G9NA 2HW9A 5F8WA 1WD3A 4DENA 1JT4A 1PWAA 4OWLA 1G9AA 1NUNA 4J23B 4QC4A 4L4IA 1I1EA 1TIEA 2D44A 3H6SE 4OWKA 4H04A 3O3QA 2Y9WC 5EG6C 2F2FC 2IHOA 4P0LA 5FZYA 1WBAA 4WBCA 4I4QA 1EVTA 1YBIA 4JKQA 2NS2A 2D43A 41BIA 1TOOA 2VU9A 4ISQA 3FJFA 3IM7A 3O49A 5BXPA 1A8DA 1QXMA 1G9CA 2MIBA 3F1RA 5DUYA 1V6UA 1HCDA 4LO7C 3NBNA 3FJAA 1S0DA 5BP5C 4LO2A 2FFUA 3O44A 4D8HA 2YUGA 3NBEA 1F31A 1XHBA 3BA5A 2KLLA 1PUUB 4G6JA 4LO8B 1DFQA 3AZWA 1W3AA 4I4VA 1IT0A 2ESUA 3UJ0A 2LIQA 1G82A 5FNXA 1TTUA 3BAOA 3RTIB 1BARA 2Y9FA 2VXRA 3AJ5A 1GGPB 2RSTA 4H75A 5DSSB 1S0BA 3WMUA 1ILR1 2HWMA 1IJTA 1PUMB 2MLLB 4F34A 4XFSA 1ISVA 1HCEA 3OBRA 4LO7B 3HMYA 3IIRA 3UD7A 1W3FA 3EF2A 4D0ZA 2AAIB 1IHKA 1XZZA 4HJJA 3V0BB 3V0AA 5E24E 3FJCA 4A7YA 3WINC 1DJSB 1RZOB 3CAHA 5DVHA 3AJ6A 3D7WB 4Z8SB 4IY8A 1ONKB 2D1ZA 1ISXA 1TWEA 2NP0A 3I29B 1DZCA 3JRRA 6I1BA 1JTCA 4LO3C 9ILBA 4KEKA 1AXMA 3S8KA 2K4AB 4I1EA 4GAIA 3JUTA 1HWNB 4IONA 4XKIA 4EEEB 2NYYA 1FMMS 2KKIA 1AFCA 4TLPA 1RG8A 3WMVA 2HZ9A 3R4UA 1IILA 2F8XC 2VSEA 4ZGRB 3RTJB 1S0LA 1YYNA 3Q7YA 5FZZA 3QR5A 3FJIA 4GP3A 1V6VA 5D61A 5BQUA 1SR4A 1JY0A 4I0YA 3UDAA 4GP0A 5GAQA 4EKXB 3OGGA 1L2HA 3VEQA 2GZBA 3N7JA 4OWJA 4QALA 3BA4A 5F90A 1Z0HA 4QD2B 4DCKC 3FGMA 4LO1A 1Q04A 2BEAA 1EPWA 2ZQOA 1ISZA 3OJVA 2BFHA 4R6UB 4J2SA 5BVPI 3E8LC 3BTAA 4I2SA 1KNMA 3NBCA 4QO3A 2QN4A 4IY9A 1R8NA 2FGFA 3FJ8A 4I4SA 4P0KA 2WBCA 1TWMA 1K5UA 4I96A 2FFVA 3CRGA 3PMEA 5D63A 4QKRA 1HKNA 3CA0A 4I3NA 4G1RA 3OJMA 2J3PA 4J2XA 2Y9GA 2DRYA 3N7MA 3A07A 4A7ZA 5JMCA 4F83A 4UY4A 2KI6B 1S0GA 4KEIA 1AVUA 3V0AB 2I1BA 2VSAA 2M49A 3FJDA 4OEGA 3BAUA 1QQLA 4YOLA 1PZZA 2ZQNA 3VSFA 3Q7XA 1HWPB 1JT5A 2L5XA 1J0SA 3ZX7A 3RMYA 4II0A 2ERMA 1RMLA 4X39A 3BRDA 1BFCA 3PUBA 1I1BA 3IM6A 5FZUA 3AH4A 4P6AA 1XG6A 1IRAX 1VCLA 3BX1C 3BAQA 4ZOTA 2RG9B 4ZA3B 1YF8B 2D22A 4J2YA 5JLVA 3CU1B 4Q91A 3VSZA 3ZXDA 1DLLA 4P0JA 2D20A 3FJJA 5F8YA 3CQAA 3UD8A 1AVXB 1JT3A 2NZ9A 1IRPA 3RMXA 1WD4A 1S0FA 1FV3A 3NBDA 3FJEA 1ITBA 3PG0A 3AKFA 2DRZA 4XFTA 3ZC8A 2D23A 4JAWA 31BIA 4LO0A 1DQGA 4IHZA 4OUJA 4I1BA 4A7KA 5I1BA 3HBWA 4X38A 5D62A 2Y9XE 2E4MA 3O4DA 3O4CA 4KEJA 3ZXGA 4QD2C 4I6IA 1MD6A 1M2TB 4X3AA 1AVAC 1JLYA 4PC4A 5EHAA 4LO2C 2D24A 4Z9WB 2P39A 1FMZA 3AH1A 3S8JA 3O4AA 1BLDA 3NJ5A 2F2FA 1IOBA 3VUOA 2QYIB 1UPSA 2XOAA 4AN7B 3BADA 1FWUA 3CRIA 1YXWA 3KMVA 5BXSA 2BEBA 3LLPA 2AXMA 3CRHA 2AQZA 2X2TA 4MZGB 4IYBA 4D0TA 4G9MA 2VUAA 4ZFWB 1FQ9A 3H6QA 7I1BA 3IAGC 3BA7A 4X37A 2AFGA 4ZFUB 5BP5A 2K8RA 3BRGC 1NZKA 4GOYA 1DQOA 1YTOA 1FGAA 2NVHA 3CA4A 2Z48A 3K1XA 3HOMA 3VWCA 4JKXB 1BLAA 1M16A 3V0BA 1DZDA 4L4HA 1FWVA 1OQLB 3FJKA 2UUSA 3FFZA 3BB2A 3W9TA 4CJMA 2ET2A 3FJ9A 3ILAA 4Q9PA 1T4QA 1FV2A 4USPA 3PHZA 2KH2A 3H6RA 1JLXA 1QQKA 3OGFA 3VT1A 1P63A 1S0EA 4ZKTB 3BAHA 2FO1A 5BXTA 4OEFA 2X2SA 3WA1A 1ABRB 3ZC9A 3A22A 2R9KB 2D7IA 2GO2A 3N0KA 4QKSA 3F62B 3HALA 1ISWA 1BFGA 4FVVA 4I4YA 1FN0A 4IZXA 21BIA 5F8SA 3FUQA 3WINA 2DREA 1G9BA 2WRYA 2ZR1B 4ZBVB 3AKHA 1II4A 1XYFA 2KI4A 4I4UA 1S0CA 2P23A 1V6XA 2MC2A 5BQUC 3IM5A 1JT7A 3AKIA 4I4OA 3CA6A 1R8OA 1SR4C 8I1BA 1D0HA 3N7LA 4LO3A 1CVSA 5FNWA 3P6JA 4Q9GA 4JRAA 4LO1C 3RSJA 3I2AA 1RY7A 4ZFYB 5G00A 3C9ZA 1CE7B 4KC3A 4GAFA 2IWTB 3OJ2A 3BAVA 4KBBA 5BOWA 3BRFA 4QBCA 1JQZA 1AF9A 4QBVA 1W3GA 2FDBM 3UJ4A 4I4PA 3A23A 3O4BA 3FUOA 1HIBA 4J2KA 4JQ0A 1MC9A 3P6IA 2NM1A 3V79C 4OW4A 1EYLA 2VLCA 1Q03A 3VT2A 3BAGA 3VT0A 3MALA 4JPZA 4JP0A 1EV2A 1BA7A 3LTQA 1TP0A 3CA5A 1HWMB 3AZVA 3TC2A 4FGFA 1HWOB 4OEEA 3CA3A 1TFMB 4USOA 4G6MA 4ENDA 1Z2VA 2LIEA 3MPPG 3N7KA 3I2XA 3H6RB 1DFCA 3QYDA 4DEPA 3SNVA 4I7IA 1Z4SA 2HWAA 4EFQA 2Z49A 5EC5A 2D7RA 4H9WA 3FJBA 3WO2A 2K43A 3HN1A 4MZHA 2DS0A 3P53A 3UD9A 3A21A 1T9FA 4HA2A 1K5VA 4IQPA 5BXRA 4EFPA 3FJHA 4GOVA 4ISRA 4AN6A 1DIWA 5B2HA 4IZEA 2Q3NB 3O4OA 3POKA 4MZFB 2RQ9A 1PC8B 3HSMA 3O5WB 4I8MA 3R4SA 1Q1UA 2Q9XA 3AKGA 2NTDA 3WO4A 1SZ6B 4EFRA 1BFFA 1G9DA 3WO3A 1ISYA 4ZLBB 5HPZA 1N4KA 3Q7WA 4LO0C 1E0OA 5DZUA 3T8SA 4XFUA 4EB2B 1BASA 1V6WA 4I4RA 1WBCA 3CA1A 1AVWB 4I37A 3OBTA
chains in the Genus database with same CATH topology
3B9UA 4I4XA 2E4MC 4HR6C 1BFBA 2VXTI 3AH2A 4G9NA 2HW9A 5F8WA 1WD3A 4DENA 1JT4A 1PWAA 4OWLA 1G9AA 1NUNA 4J23B 4QC4A 4L4IA 1I1EA 1TIEA 2D44A 3H6SE 4OWKA 4H04A 3O3QA 2Y9WC 5EG6C 2F2FC 2IHOA 4P0LA 5FZYA 1WBAA 4WBCA 4I4QA 1EVTA 1YBIA 4JKQA 2NS2A 2D43A 41BIA 1TOOA 2VU9A 4ISQA 3FJFA 3IM7A 3O49A 5BXPA 1A8DA 1QXMA 1G9CA 2MIBA 3F1RA 5DUYA 1V6UA 1HCDA 4LO7C 3NBNA 3FJAA 1S0DA 5BP5C 4LO2A 2FFUA 3O44A 4D8HA 2YUGA 3NBEA 1F31A 1XHBA 3BA5A 2KLLA 1PUUB 4G6JA 4LO8B 1DFQA 3AZWA 1W3AA 4I4VA 1IT0A 2ESUA 3UJ0A 2LIQA 1G82A 5FNXA 1TTUA 3BAOA 3RTIB 1BARA 2Y9FA 2VXRA 3AJ5A 1GGPB 2RSTA 4H75A 5DSSB 1S0BA 3WMUA 1ILR1 2HWMA 1IJTA 1PUMB 2MLLB 4F34A 4XFSA 1ISVA 1HCEA 3OBRA 4LO7B 3HMYA 3IIRA 3UD7A 1W3FA 3EF2A 4D0ZA 2AAIB 1IHKA 1XZZA 4HJJA 3V0BB 3V0AA 5E24E 3FJCA 4A7YA 3WINC 1DJSB 1RZOB 3CAHA 5DVHA 3AJ6A 3D7WB 4Z8SB 4IY8A 1ONKB 2D1ZA 1ISXA 1TWEA 2NP0A 3I29B 1DZCA 3JRRA 6I1BA 1JTCA 4LO3C 9ILBA 4KEKA 1AXMA 3S8KA 2K4AB 4I1EA 4GAIA 3JUTA 1HWNB 4IONA 4XKIA 4EEEB 2NYYA 1FMMS 2KKIA 1AFCA 4TLPA 1RG8A 3WMVA 2HZ9A 3R4UA 1IILA 2F8XC 2VSEA 4ZGRB 3RTJB 1S0LA 1YYNA 3Q7YA 5FZZA 3QR5A 3FJIA 4GP3A 1V6VA 5D61A 5BQUA 1SR4A 1JY0A 4I0YA 3UDAA 4GP0A 5GAQA 4EKXB 3OGGA 1L2HA 3VEQA 2GZBA 3N7JA 4OWJA 4QALA 3BA4A 5F90A 1Z0HA 4QD2B 4DCKC 3FGMA 4LO1A 1Q04A 2BEAA 1EPWA 2ZQOA 1ISZA 3OJVA 2BFHA 4R6UB 4J2SA 5BVPI 3E8LC 3BTAA 4I2SA 1KNMA 3NBCA 4QO3A 2QN4A 4IY9A 1R8NA 2FGFA 3FJ8A 4I4SA 4P0KA 2WBCA 1TWMA 1K5UA 4I96A 2FFVA 3CRGA 3PMEA 5D63A 4QKRA 1HKNA 3CA0A 4I3NA 4G1RA 3OJMA 2J3PA 4J2XA 2Y9GA 2DRYA 3N7MA 3A07A 4A7ZA 5JMCA 4F83A 4UY4A 2KI6B 1S0GA 4KEIA 1AVUA 3V0AB 2I1BA 2VSAA 2M49A 3FJDA 4OEGA 3BAUA 1QQLA 4YOLA 1PZZA 2ZQNA 3VSFA 3Q7XA 1HWPB 1JT5A 2L5XA 1J0SA 3ZX7A 3RMYA 4II0A 2ERMA 1RMLA 4X39A 3BRDA 1BFCA 3PUBA 1I1BA 3IM6A 5FZUA 3AH4A 4P6AA 1XG6A 1IRAX 1VCLA 3BX1C 3BAQA 4ZOTA 2RG9B 4ZA3B 1YF8B 2D22A 4J2YA 5JLVA 3CU1B 4Q91A 3VSZA 3ZXDA 1DLLA 4P0JA 2D20A 3FJJA 5F8YA 3CQAA 3UD8A 1AVXB 1JT3A 2NZ9A 1IRPA 3RMXA 1WD4A 1S0FA 1FV3A 3NBDA 3FJEA 1ITBA 3PG0A 3AKFA 2DRZA 4XFTA 3ZC8A 2D23A 4JAWA 31BIA 4LO0A 1DQGA 4IHZA 4OUJA 4I1BA 4A7KA 5I1BA 3HBWA 4X38A 5D62A 2Y9XE 2E4MA 3O4DA 3O4CA 4KEJA 3ZXGA 4QD2C 4I6IA 1MD6A 1M2TB 4X3AA 1AVAC 1JLYA 4PC4A 5EHAA 4LO2C 2D24A 4Z9WB 2P39A 1FMZA 3AH1A 3S8JA 3O4AA 1BLDA 3NJ5A 2F2FA 1IOBA 3VUOA 2QYIB 1UPSA 2XOAA 4AN7B 3BADA 1FWUA 3CRIA 1YXWA 3KMVA 5BXSA 2BEBA 3LLPA 2AXMA 3CRHA 2AQZA 2X2TA 4MZGB 4IYBA 4D0TA 4G9MA 2VUAA 4ZFWB 1FQ9A 3H6QA 7I1BA 3IAGC 3BA7A 4X37A 2AFGA 4ZFUB 5BP5A 2K8RA 3BRGC 1NZKA 4GOYA 1DQOA 1YTOA 1FGAA 2NVHA 3CA4A 2Z48A 3K1XA 3HOMA 3VWCA 4JKXB 1BLAA 1M16A 3V0BA 1DZDA 4L4HA 1FWVA 1OQLB 3FJKA 2UUSA 3FFZA 3BB2A 3W9TA 4CJMA 2ET2A 3FJ9A 3ILAA 4Q9PA 1T4QA 1FV2A 4USPA 3PHZA 2KH2A 3H6RA 1JLXA 1QQKA 3OGFA 3VT1A 1P63A 1S0EA 4ZKTB 3BAHA 2FO1A 5BXTA 4OEFA 2X2SA 3WA1A 1ABRB 3ZC9A 3A22A 2R9KB 2D7IA 2GO2A 3N0KA 4QKSA 3F62B 3HALA 1ISWA 1BFGA 4FVVA 4I4YA 1FN0A 4IZXA 21BIA 5F8SA 3FUQA 3WINA 2DREA 1G9BA 2WRYA 2ZR1B 4ZBVB 3AKHA 1II4A 1XYFA 2KI4A 4I4UA 1S0CA 2P23A 1V6XA 2MC2A 5BQUC 3IM5A 1JT7A 3AKIA 4I4OA 3CA6A 1R8OA 1SR4C 8I1BA 1D0HA 3N7LA 4LO3A 1CVSA 5FNWA 3P6JA 4Q9GA 4JRAA 4LO1C 3RSJA 3I2AA 1RY7A 4ZFYB 5G00A 3C9ZA 1CE7B 4KC3A 4GAFA 2IWTB 3OJ2A 3BAVA 4KBBA 5BOWA 3BRFA 4QBCA 1JQZA 1AF9A 4QBVA 1W3GA 2FDBM 3UJ4A 4I4PA 3A23A 3O4BA 3FUOA 1HIBA 4J2KA 4JQ0A 1MC9A 3P6IA 2NM1A 3V79C 4OW4A 1EYLA 2VLCA 1Q03A 3VT2A 3BAGA 3VT0A 3MALA 4JPZA 4JP0A 1EV2A 1BA7A 3LTQA 1TP0A 3CA5A 1HWMB 3AZVA 3TC2A 4FGFA 1HWOB 4OEEA 3CA3A 1TFMB 4USOA 4G6MA 4ENDA 1Z2VA 2LIEA 3MPPG 3N7KA 3I2XA 3H6RB 1DFCA 3QYDA 4DEPA 3SNVA 4I7IA 1Z4SA 2HWAA 4EFQA 2Z49A 5EC5A 2D7RA 4H9WA 3FJBA 3WO2A 2K43A 3HN1A 4MZHA 2DS0A 3P53A 3UD9A 3A21A 1T9FA 4HA2A 1K5VA 4IQPA 5BXRA 4EFPA 3FJHA 4GOVA 4ISRA 4AN6A 1DIWA 5B2HA 4IZEA 2Q3NB 3O4OA 3POKA 4MZFB 2RQ9A 1PC8B 3HSMA 3O5WB 4I8MA 3R4SA 1Q1UA 2Q9XA 3AKGA 2NTDA 3WO4A 1SZ6B 4EFRA 1BFFA 1G9DA 3WO3A 1ISYA 4ZLBB 5HPZA 1N4KA 3Q7WA 4LO0C 1E0OA 5DZUA 3T8SA 4XFUA 4EB2B 1BASA 1V6WA 4I4RA 1WBCA 3CA1A 1AVWB 4I37A 3OBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B9U A;  4I4X A;  2E4M C;  4HR6 C;  1BFB A;  2VXT I;  3AH2 A;  4G9N A;  2HW9 A;  5F8W A;  1WD3 A;  4DEN A;  1JT4 A;  1PWA A;  4OWL A;  1G9A A;  1NUN A;  4J23 B;  4QC4 A;  4L4I A;  1I1E A;  1TIE A;  2D44 A;  3H6S E;  4OWK A;  4H04 A;  3O3Q A;  2Y9W C;  5EG6 C;  2F2F C;  2IHO A;  4P0L A;  5FZY A;  1WBA A;  4WBC A;  4I4Q A;  1EVT A;  1YBI A;  4JKQ A;  2D43 A;  41BI A;  1TOO A;  2VU9 A;  4ISQ A;  3FJF A;  3IM7 A;  3O49 A;  5BXP A;  1A8D A;  1QXM A;  1G9C A;  2MIB A;  3F1R A;  5DUY A;  1V6U A;  1HCD A;  4LO7 C;  3NBN A;  3FJA A;  1S0D A;  5BP5 C;  4LO2 A;  2FFU A;  3O44 A;  4D8H A;  2YUG A;  3NBE A;  1F31 A;  1XHB A;  3BA5 A;  2KLL A;  1PUU B;  4G6J A;  4LO8 B;  1DFQ A;  3AZW A;  1W3A A;  4I4V A;  1IT0 A;  2ESU A;  3UJ0 A;  2LIQ A;  1G82 A;  5FNX A;  1TTU A;  3BAO A;  3RTI B;  1BAR A;  2Y9F A;  2VXR A;  3AJ5 A;  1GGP B;  2RST A;  5DSS B;  1S0B A;  3WMU A;  1ILR 1;  2HWM A;  1IJT A;  1PUM B;  2MLL B;  4F34 A;  4XFS A;  1ISV A;  1HCE A;  3OBR A;  4LO7 B;  3HMY A;  3IIR A;  3UD7 A;  1W3F A;  3EF2 A;  4D0Z A;  2AAI B;  1IHK A;  1XZZ A;  4HJJ A;  3V0B B;  3V0A A;  5E24 E;  3FJC A;  4A7Y A;  3WIN C;  1DJS B;  1RZO B;  3CAH A;  5DVH A;  3AJ6 A;  3D7W B;  4Z8S B;  4IY8 A;  1ONK B;  2D1Z A;  1ISX A;  1TWE A;  2NP0 A;  3I29 B;  1DZC A;  3JRR A;  6I1B A;  1JTC A;  4LO3 C;  9ILB A;  4KEK A;  1AXM A;  3S8K A;  2K4A B;  4I1E A;  4GAI A;  3JUT A;  1HWN B;  4ION A;  4XKI A;  4EEE B;  2NYY A;  1FMM S;  2KKI A;  1AFC A;  4TLP A;  1RG8 A;  3WMV A;  2HZ9 A;  3R4U A;  1IIL A;  2F8X C;  2VSE A;  4ZGR B;  3RTJ B;  1S0L A;  1YYN A;  3Q7Y A;  5FZZ A;  3QR5 A;  3FJI A;  4GP3 A;  1V6V A;  5D61 A;  5BQU A;  1SR4 A;  1JY0 A;  4I0Y A;  3UDA A;  4GP0 A;  5GAQ A;  4EKX B;  3OGG A;  1L2H A;  3VEQ A;  2GZB A;  3N7J A;  4OWJ A;  4QAL A;  3BA4 A;  5F90 A;  1Z0H A;  4QD2 B;  4DCK C;  3FGM A;  4LO1 A;  1Q04 A;  2BEA A;  1EPW A;  2ZQO A;  1ISZ A;  3OJV A;  2BFH A;  4R6U B;  4J2S A;  5BVP I;  3E8L C;  3BTA A;  4I2S A;  1KNM A;  3NBC A;  4QO3 A;  2QN4 A;  4IY9 A;  1R8N A;  2FGF A;  3FJ8 A;  4I4S A;  4P0K A;  2WBC A;  1TWM A;  1K5U A;  4I96 A;  2FFV A;  3CRG A;  3PME A;  5D63 A;  4QKR A;  1HKN A;  3CA0 A;  4I3N A;  4G1R A;  3OJM A;  2J3P A;  4J2X A;  2Y9G A;  2DRY A;  3N7M A;  3A07 A;  4A7Z A;  5JMC A;  4F83 A;  2KI6 B;  1S0G A;  4KEI A;  1AVU A;  3V0A B;  2I1B A;  2VSA A;  2M49 A;  3FJD A;  4OEG A;  3BAU A;  1QQL A;  4YOL A;  1PZZ A;  2ZQN A;  3VSF A;  3Q7X A;  1HWP B;  1JT5 A;  2L5X A;  1J0S A;  3ZX7 A;  3RMY A;  4II0 A;  2ERM A;  1RML A;  4X39 A;  3BRD A;  1BFC A;  3PUB A;  1I1B A;  3IM6 A;  5FZU A;  3AH4 A;  4P6A A;  1XG6 A;  1IRA X;  1VCL A;  3BX1 C;  3BAQ A;  4ZOT A;  2RG9 B;  4ZA3 B;  1YF8 B;  2D22 A;  4J2Y A;  5JLV A;  3CU1 B;  4Q91 A;  3VSZ A;  3ZXD A;  1DLL A;  4P0J A;  2D20 A;  3FJJ A;  5F8Y A;  3CQA A;  3UD8 A;  1AVX B;  1JT3 A;  2NZ9 A;  1IRP A;  3RMX A;  1WD4 A;  1S0F A;  1FV3 A;  3NBD A;  3FJE A;  1ITB A;  3PG0 A;  3AKF A;  2DRZ A;  4XFT A;  3ZC8 A;  2D23 A;  4JAW A;  31BI A;  4LO0 A;  1DQG A;  4IHZ A;  4OUJ A;  4I1B A;  4A7K A;  5I1B A;  3HBW A;  4X38 A;  5D62 A;  2Y9X E;  2E4M A;  3O4D A;  3O4C A;  4KEJ A;  3ZXG A;  4QD2 C;  4I6I A;  1MD6 A;  1M2T B;  4X3A A;  1AVA C;  1JLY A;  4PC4 A;  5EHA A;  4LO2 C;  2D24 A;  4Z9W B;  2P39 A;  1FMZ A;  3AH1 A;  3S8J A;  3O4A A;  1BLD A;  3NJ5 A;  2F2F A;  1IOB A;  3VUO A;  2QYI B;  1UPS A;  2XOA A;  4AN7 B;  3BAD A;  1FWU A;  3CRI A;  1YXW A;  3KMV A;  5BXS A;  2BEB A;  3LLP A;  2AXM A;  3CRH A;  2AQZ A;  2X2T A;  4D0T A;  4IYB A;  4G9M A;  2VUA A;  4ZFW B;  1FQ9 A;  3H6Q A;  7I1B A;  3IAG C;  3BA7 A;  4X37 A;  2AFG A;  4ZFU B;  5BP5 A;  2K8R A;  3BRG C;  1NZK A;  4GOY A;  1DQO A;  1YTO A;  1FGA A;  2NVH A;  3CA4 A;  2Z48 A;  3K1X A;  3HOM A;  3VWC A;  4JKX B;  1BLA A;  1M16 A;  3V0B A;  1DZD A;  4L4H A;  1FWV A;  1OQL B;  3FJK A;  2UUS A;  3FFZ A;  3BB2 A;  3W9T A;  4CJM A;  2ET2 A;  3FJ9 A;  3ILA A;  4Q9P A;  1T4Q A;  1FV2 A;  4USP A;  3PHZ A;  2KH2 A;  3H6R A;  1JLX A;  1QQK A;  3OGF A;  3VT1 A;  1P63 A;  1S0E A;  4ZKT B;  3BAH A;  2FO1 A;  5BXT A;  4OEF A;  2X2S A;  3WA1 A;  1ABR B;  3ZC9 A;  3A22 A;  2R9K B;  2D7I A;  2GO2 A;  3N0K A;  4QKS A;  3F62 B;  3HAL A;  1ISW A;  1BFG A;  4FVV A;  4I4Y A;  1FN0 A;  4IZX A;  21BI A;  5F8S A;  3FUQ A;  3WIN A;  2DRE A;  1G9B A;  2WRY A;  2ZR1 B;  4ZBV B;  3AKH A;  1II4 A;  1XYF A;  2KI4 A;  4I4U A;  1S0C A;  2P23 A;  1V6X A;  2MC2 A;  5BQU C;  3IM5 A;  1JT7 A;  3AKI A;  4I4O A;  3CA6 A;  1R8O A;  1SR4 C;  8I1B A;  1D0H A;  3N7L A;  4LO3 A;  1CVS A;  5FNW A;  3P6J A;  4Q9G A;  4JRA A;  4LO1 C;  3RSJ A;  3I2A A;  1RY7 A;  4ZFY B;  5G00 A;  3C9Z A;  1CE7 B;  4KC3 A;  4GAF A;  2IWT B;  3OJ2 A;  3BAV A;  4KBB A;  5BOW A;  3BRF A;  4QBC A;  1JQZ A;  1AF9 A;  4QBV A;  1W3G A;  2FDB M;  3UJ4 A;  4I4P A;  3A23 A;  3O4B A;  3FUO A;  1HIB A;  4J2K A;  4JQ0 A;  1MC9 A;  3P6I A;  2NM1 A;  3V79 C;  4OW4 A;  1EYL A;  2VLC A;  1Q03 A;  3VT2 A;  3BAG A;  3VT0 A;  3MAL A;  4JPZ A;  4JP0 A;  1EV2 A;  1BA7 A;  3LTQ A;  1TP0 A;  3CA5 A;  1HWM B;  3AZV A;  3TC2 A;  4FGF A;  1HWO B;  4OEE A;  3CA3 A;  1TFM B;  4USO A;  4G6M A;  4END A;  1Z2V A;  2LIE A;  3MPP G;  3N7K A;  3I2X A;  3H6R B;  1DFC A;  3QYD A;  4DEP A;  3SNV A;  4I7I A;  1Z4S A;  2HWA A;  4EFQ A;  2Z49 A;  5EC5 A;  2D7R A;  4H9W A;  3FJB A;  3WO2 A;  2K43 A;  3HN1 A;  2DS0 A;  3P53 A;  3UD9 A;  3A21 A;  1T9F A;  4HA2 A;  1K5V A;  4IQP A;  5BXR A;  4EFP A;  3FJH A;  4GOV A;  4ISR A;  4AN6 A;  1DIW A;  5B2H A;  4IZE A;  2Q3N B;  3O4O A;  3POK A;  2RQ9 A;  1PC8 B;  3HSM A;  3O5W B;  4I8M A;  3R4S A;  1Q1U A;  2Q9X A;  3AKG A;  2NTD A;  3WO4 A;  1SZ6 B;  4EFR A;  1BFF A;  1G9D A;  3WO3 A;  1ISY A;  4ZLB B;  5HPZ A;  1N4K A;  3Q7W A;  4LO0 C;  1E0O A;  5DZU A;  3T8S A;  4XFU A;  4EB2 B;  1BAS A;  1V6W A;  4I4R A;  1WBC A;  3CA1 A;  1AVW B;  4I37 A;  3OBT A; 
#chains in the Genus database with same CATH topology
 3B9U A;  4I4X A;  2E4M C;  4HR6 C;  1BFB A;  2VXT I;  3AH2 A;  4G9N A;  2HW9 A;  5F8W A;  1WD3 A;  4DEN A;  1JT4 A;  1PWA A;  4OWL A;  1G9A A;  1NUN A;  4J23 B;  4QC4 A;  4L4I A;  1I1E A;  1TIE A;  2D44 A;  3H6S E;  4OWK A;  4H04 A;  3O3Q A;  2Y9W C;  5EG6 C;  2F2F C;  2IHO A;  4P0L A;  5FZY A;  1WBA A;  4WBC A;  4I4Q A;  1EVT A;  1YBI A;  4JKQ A;  2NS2 A;  2D43 A;  41BI A;  1TOO A;  2VU9 A;  4ISQ A;  3FJF A;  3IM7 A;  3O49 A;  5BXP A;  1A8D A;  1QXM A;  1G9C A;  2MIB A;  3F1R A;  5DUY A;  1V6U A;  1HCD A;  4LO7 C;  3NBN A;  3FJA A;  1S0D A;  5BP5 C;  4LO2 A;  2FFU A;  3O44 A;  4D8H A;  2YUG A;  3NBE A;  1F31 A;  1XHB A;  3BA5 A;  2KLL A;  1PUU B;  4G6J A;  4LO8 B;  1DFQ A;  3AZW A;  1W3A A;  4I4V A;  1IT0 A;  2ESU A;  3UJ0 A;  2LIQ A;  1G82 A;  5FNX A;  1TTU A;  3BAO A;  3RTI B;  1BAR A;  2Y9F A;  2VXR A;  3AJ5 A;  1GGP B;  2RST A;  4H75 A;  5DSS B;  1S0B A;  3WMU A;  1ILR 1;  2HWM A;  1IJT A;  1PUM B;  2MLL B;  4F34 A;  4XFS A;  1ISV A;  1HCE A;  3OBR A;  4LO7 B;  3HMY A;  3IIR A;  3UD7 A;  1W3F A;  3EF2 A;  4D0Z A;  2AAI B;  1IHK A;  1XZZ A;  4HJJ A;  3V0B B;  3V0A A;  5E24 E;  3FJC A;  4A7Y A;  3WIN C;  1DJS B;  1RZO B;  3CAH A;  5DVH A;  3AJ6 A;  3D7W B;  4Z8S B;  4IY8 A;  1ONK B;  2D1Z A;  1ISX A;  1TWE A;  2NP0 A;  3I29 B;  1DZC A;  3JRR A;  6I1B A;  1JTC A;  4LO3 C;  9ILB A;  4KEK A;  1AXM A;  3S8K A;  2K4A B;  4I1E A;  4GAI A;  3JUT A;  1HWN B;  4ION A;  4XKI A;  4EEE B;  2NYY A;  1FMM S;  2KKI A;  1AFC A;  4TLP A;  1RG8 A;  3WMV A;  2HZ9 A;  3R4U A;  1IIL A;  2F8X C;  2VSE A;  4ZGR B;  3RTJ B;  1S0L A;  1YYN A;  3Q7Y A;  5FZZ A;  3QR5 A;  3FJI A;  4GP3 A;  1V6V A;  5D61 A;  5BQU A;  1SR4 A;  1JY0 A;  4I0Y A;  3UDA A;  4GP0 A;  5GAQ A;  4EKX B;  3OGG A;  1L2H A;  3VEQ A;  2GZB A;  3N7J A;  4OWJ A;  4QAL A;  3BA4 A;  5F90 A;  1Z0H A;  4QD2 B;  4DCK C;  3FGM A;  4LO1 A;  1Q04 A;  2BEA A;  1EPW A;  2ZQO A;  1ISZ A;  3OJV A;  2BFH A;  4R6U B;  4J2S A;  5BVP I;  3E8L C;  3BTA A;  4I2S A;  1KNM A;  3NBC A;  4QO3 A;  2QN4 A;  4IY9 A;  1R8N A;  2FGF A;  3FJ8 A;  4I4S A;  4P0K A;  2WBC A;  1TWM A;  1K5U A;  4I96 A;  2FFV A;  3CRG A;  3PME A;  5D63 A;  4QKR A;  1HKN A;  3CA0 A;  4I3N A;  4G1R A;  3OJM A;  2J3P A;  4J2X A;  2Y9G A;  2DRY A;  3N7M A;  3A07 A;  4A7Z A;  5JMC A;  4F83 A;  4UY4 A;  2KI6 B;  1S0G A;  4KEI A;  1AVU A;  3V0A B;  2I1B A;  2VSA A;  2M49 A;  3FJD A;  4OEG A;  3BAU A;  1QQL A;  4YOL A;  1PZZ A;  2ZQN A;  3VSF A;  3Q7X A;  1HWP B;  1JT5 A;  2L5X A;  1J0S A;  3ZX7 A;  3RMY A;  4II0 A;  2ERM A;  1RML A;  4X39 A;  3BRD A;  1BFC A;  3PUB A;  1I1B A;  3IM6 A;  5FZU A;  3AH4 A;  4P6A A;  1XG6 A;  1IRA X;  1VCL A;  3BX1 C;  3BAQ A;  4ZOT A;  2RG9 B;  4ZA3 B;  1YF8 B;  2D22 A;  4J2Y A;  5JLV A;  3CU1 B;  4Q91 A;  3VSZ A;  3ZXD A;  1DLL A;  4P0J A;  2D20 A;  3FJJ A;  5F8Y A;  3CQA A;  3UD8 A;  1AVX B;  1JT3 A;  2NZ9 A;  1IRP A;  3RMX A;  1WD4 A;  1S0F A;  1FV3 A;  3NBD A;  3FJE A;  1ITB A;  3PG0 A;  3AKF A;  2DRZ A;  4XFT A;  3ZC8 A;  2D23 A;  4JAW A;  31BI A;  4LO0 A;  1DQG A;  4IHZ A;  4OUJ A;  4I1B A;  4A7K A;  5I1B A;  3HBW A;  4X38 A;  5D62 A;  2Y9X E;  2E4M A;  3O4D A;  3O4C A;  4KEJ A;  3ZXG A;  4QD2 C;  4I6I A;  1MD6 A;  1M2T B;  4X3A A;  1AVA C;  1JLY A;  4PC4 A;  5EHA A;  4LO2 C;  2D24 A;  4Z9W B;  2P39 A;  1FMZ A;  3AH1 A;  3S8J A;  3O4A A;  1BLD A;  3NJ5 A;  2F2F A;  1IOB A;  3VUO A;  2QYI B;  1UPS A;  2XOA A;  4AN7 B;  3BAD A;  1FWU A;  3CRI A;  1YXW A;  3KMV A;  5BXS A;  2BEB A;  3LLP A;  2AXM A;  3CRH A;  2AQZ A;  2X2T A;  4MZG B;  4IYB A;  4D0T A;  4G9M A;  2VUA A;  4ZFW B;  1FQ9 A;  3H6Q A;  7I1B A;  3IAG C;  3BA7 A;  4X37 A;  2AFG A;  4ZFU B;  5BP5 A;  2K8R A;  3BRG C;  1NZK A;  4GOY A;  1DQO A;  1YTO A;  1FGA A;  2NVH A;  3CA4 A;  2Z48 A;  3K1X A;  3HOM A;  3VWC A;  4JKX B;  1BLA A;  1M16 A;  3V0B A;  1DZD A;  4L4H A;  1FWV A;  1OQL B;  3FJK A;  2UUS A;  3FFZ A;  3BB2 A;  3W9T A;  4CJM A;  2ET2 A;  3FJ9 A;  3ILA A;  4Q9P A;  1T4Q A;  1FV2 A;  4USP A;  3PHZ A;  2KH2 A;  3H6R A;  1JLX A;  1QQK A;  3OGF A;  3VT1 A;  1P63 A;  1S0E A;  4ZKT B;  3BAH A;  2FO1 A;  5BXT A;  4OEF A;  2X2S A;  3WA1 A;  1ABR B;  3ZC9 A;  3A22 A;  2R9K B;  2D7I A;  2GO2 A;  3N0K A;  4QKS A;  3F62 B;  3HAL A;  1ISW A;  1BFG A;  4FVV A;  4I4Y A;  1FN0 A;  4IZX A;  21BI A;  5F8S A;  3FUQ A;  3WIN A;  2DRE A;  1G9B A;  2WRY A;  2ZR1 B;  4ZBV B;  3AKH A;  1II4 A;  1XYF A;  2KI4 A;  4I4U A;  1S0C A;  2P23 A;  1V6X A;  2MC2 A;  5BQU C;  3IM5 A;  1JT7 A;  3AKI A;  4I4O A;  3CA6 A;  1R8O A;  1SR4 C;  8I1B A;  1D0H A;  3N7L A;  4LO3 A;  1CVS A;  5FNW A;  3P6J A;  4Q9G A;  4JRA A;  4LO1 C;  3RSJ A;  3I2A A;  1RY7 A;  4ZFY B;  5G00 A;  3C9Z A;  1CE7 B;  4KC3 A;  4GAF A;  2IWT B;  3OJ2 A;  3BAV A;  4KBB A;  5BOW A;  3BRF A;  4QBC A;  1JQZ A;  1AF9 A;  4QBV A;  1W3G A;  2FDB M;  3UJ4 A;  4I4P A;  3A23 A;  3O4B A;  3FUO A;  1HIB A;  4J2K A;  4JQ0 A;  1MC9 A;  3P6I A;  2NM1 A;  3V79 C;  4OW4 A;  1EYL A;  2VLC A;  1Q03 A;  3VT2 A;  3BAG A;  3VT0 A;  3MAL A;  4JPZ A;  4JP0 A;  1EV2 A;  1BA7 A;  3LTQ A;  1TP0 A;  3CA5 A;  1HWM B;  3AZV A;  3TC2 A;  4FGF A;  1HWO B;  4OEE A;  3CA3 A;  1TFM B;  4USO A;  4G6M A;  4END A;  1Z2V A;  2LIE A;  3MPP G;  3N7K A;  3I2X A;  3H6R B;  1DFC A;  3QYD A;  4DEP A;  3SNV A;  4I7I A;  1Z4S A;  2HWA A;  4EFQ A;  2Z49 A;  5EC5 A;  2D7R A;  4H9W A;  3FJB A;  3WO2 A;  2K43 A;  3HN1 A;  4MZH A;  2DS0 A;  3P53 A;  3UD9 A;  3A21 A;  1T9F A;  4HA2 A;  1K5V A;  4IQP A;  5BXR A;  4EFP A;  3FJH A;  4GOV A;  4ISR A;  4AN6 A;  1DIW A;  5B2H A;  4IZE A;  2Q3N B;  3O4O A;  3POK A;  4MZF B;  2RQ9 A;  1PC8 B;  3HSM A;  3O5W B;  4I8M A;  3R4S A;  1Q1U A;  2Q9X A;  3AKG A;  2NTD A;  3WO4 A;  1SZ6 B;  4EFR A;  1BFF A;  1G9D A;  3WO3 A;  1ISY A;  4ZLB B;  5HPZ A;  1N4K A;  3Q7W A;  4LO0 C;  1E0O A;  5DZU A;  3T8S A;  4XFU A;  4EB2 B;  1BAS A;  1V6W A;  4I4R A;  1WBC A;  3CA1 A;  1AVW B;  4I37 A;  3OBT A; 
#chains in the Genus database with same CATH homology
 3B9U A;  4I4X A;  2E4M C;  4HR6 C;  1BFB A;  2VXT I;  3AH2 A;  4G9N A;  2HW9 A;  5F8W A;  1WD3 A;  4DEN A;  1JT4 A;  1PWA A;  4OWL A;  1G9A A;  1NUN A;  4J23 B;  4QC4 A;  4L4I A;  1I1E A;  1TIE A;  2D44 A;  3H6S E;  4OWK A;  4H04 A;  3O3Q A;  2Y9W C;  5EG6 C;  2F2F C;  2IHO A;  4P0L A;  5FZY A;  1WBA A;  4WBC A;  4I4Q A;  1EVT A;  1YBI A;  4JKQ A;  2NS2 A;  2D43 A;  41BI A;  1TOO A;  2VU9 A;  4ISQ A;  3FJF A;  3IM7 A;  3O49 A;  5BXP A;  1A8D A;  1QXM A;  1G9C A;  2MIB A;  3F1R A;  5DUY A;  1V6U A;  1HCD A;  4LO7 C;  3NBN A;  3FJA A;  1S0D A;  5BP5 C;  4LO2 A;  2FFU A;  3O44 A;  4D8H A;  2YUG A;  3NBE A;  1F31 A;  1XHB A;  3BA5 A;  2KLL A;  1PUU B;  4G6J A;  4LO8 B;  1DFQ A;  3AZW A;  1W3A A;  4I4V A;  1IT0 A;  2ESU A;  3UJ0 A;  2LIQ A;  1G82 A;  5FNX A;  1TTU A;  3BAO A;  3RTI B;  1BAR A;  2Y9F A;  2VXR A;  3AJ5 A;  1GGP B;  2RST A;  4H75 A;  5DSS B;  1S0B A;  3WMU A;  1ILR 1;  2HWM A;  1IJT A;  1PUM B;  2MLL B;  4F34 A;  4XFS A;  1ISV A;  1HCE A;  3OBR A;  4LO7 B;  3HMY A;  3IIR A;  3UD7 A;  1W3F A;  3EF2 A;  4D0Z A;  2AAI B;  1IHK A;  1XZZ A;  4HJJ A;  3V0B B;  3V0A A;  5E24 E;  3FJC A;  4A7Y A;  3WIN C;  1DJS B;  1RZO B;  3CAH A;  5DVH A;  3AJ6 A;  3D7W B;  4Z8S B;  4IY8 A;  1ONK B;  2D1Z A;  1ISX A;  1TWE A;  2NP0 A;  3I29 B;  1DZC A;  3JRR A;  6I1B A;  1JTC A;  4LO3 C;  9ILB A;  4KEK A;  1AXM A;  3S8K A;  2K4A B;  4I1E A;  4GAI A;  3JUT A;  1HWN B;  4ION A;  4XKI A;  4EEE B;  2NYY A;  1FMM S;  2KKI A;  1AFC A;  4TLP A;  1RG8 A;  3WMV A;  2HZ9 A;  3R4U A;  1IIL A;  2F8X C;  2VSE A;  4ZGR B;  3RTJ B;  1S0L A;  1YYN A;  3Q7Y A;  5FZZ A;  3QR5 A;  3FJI A;  4GP3 A;  1V6V A;  5D61 A;  5BQU A;  1SR4 A;  1JY0 A;  4I0Y A;  3UDA A;  4GP0 A;  5GAQ A;  4EKX B;  3OGG A;  1L2H A;  3VEQ A;  2GZB A;  3N7J A;  4OWJ A;  4QAL A;  3BA4 A;  5F90 A;  1Z0H A;  4QD2 B;  4DCK C;  3FGM A;  4LO1 A;  1Q04 A;  2BEA A;  1EPW A;  2ZQO A;  1ISZ A;  3OJV A;  2BFH A;  4R6U B;  4J2S A;  5BVP I;  3E8L C;  3BTA A;  4I2S A;  1KNM A;  3NBC A;  4QO3 A;  2QN4 A;  4IY9 A;  1R8N A;  2FGF A;  3FJ8 A;  4I4S A;  4P0K A;  2WBC A;  1TWM A;  1K5U A;  4I96 A;  2FFV A;  3CRG A;  3PME A;  5D63 A;  4QKR A;  1HKN A;  3CA0 A;  4I3N A;  4G1R A;  3OJM A;  2J3P A;  4J2X A;  2Y9G A;  2DRY A;  3N7M A;  3A07 A;  4A7Z A;  5JMC A;  4F83 A;  4UY4 A;  2KI6 B;  1S0G A;  4KEI A;  1AVU A;  3V0A B;  2I1B A;  2VSA A;  2M49 A;  3FJD A;  4OEG A;  3BAU A;  1QQL A;  4YOL A;  1PZZ A;  2ZQN A;  3VSF A;  3Q7X A;  1HWP B;  1JT5 A;  2L5X A;  1J0S A;  3ZX7 A;  3RMY A;  4II0 A;  2ERM A;  1RML A;  4X39 A;  3BRD A;  1BFC A;  3PUB A;  1I1B A;  3IM6 A;  5FZU A;  3AH4 A;  4P6A A;  1XG6 A;  1IRA X;  1VCL A;  3BX1 C;  3BAQ A;  4ZOT A;  2RG9 B;  4ZA3 B;  1YF8 B;  2D22 A;  4J2Y A;  5JLV A;  3CU1 B;  4Q91 A;  3VSZ A;  3ZXD A;  1DLL A;  4P0J A;  2D20 A;  3FJJ A;  5F8Y A;  3CQA A;  3UD8 A;  1AVX B;  1JT3 A;  2NZ9 A;  1IRP A;  3RMX A;  1WD4 A;  1S0F A;  1FV3 A;  3NBD A;  3FJE A;  1ITB A;  3PG0 A;  3AKF A;  2DRZ A;  4XFT A;  3ZC8 A;  2D23 A;  4JAW A;  31BI A;  4LO0 A;  1DQG A;  4IHZ A;  4OUJ A;  4I1B A;  4A7K A;  5I1B A;  3HBW A;  4X38 A;  5D62 A;  2Y9X E;  2E4M A;  3O4D A;  3O4C A;  4KEJ A;  3ZXG A;  4QD2 C;  4I6I A;  1MD6 A;  1M2T B;  4X3A A;  1AVA C;  1JLY A;  4PC4 A;  5EHA A;  4LO2 C;  2D24 A;  4Z9W B;  2P39 A;  1FMZ A;  3AH1 A;  3S8J A;  3O4A A;  1BLD A;  3NJ5 A;  2F2F A;  1IOB A;  3VUO A;  2QYI B;  1UPS A;  2XOA A;  4AN7 B;  3BAD A;  1FWU A;  3CRI A;  1YXW A;  3KMV A;  5BXS A;  2BEB A;  3LLP A;  2AXM A;  3CRH A;  2AQZ A;  2X2T A;  4MZG B;  4IYB A;  4D0T A;  4G9M A;  2VUA A;  4ZFW B;  1FQ9 A;  3H6Q A;  7I1B A;  3IAG C;  3BA7 A;  4X37 A;  2AFG A;  4ZFU B;  5BP5 A;  2K8R A;  3BRG C;  1NZK A;  4GOY A;  1DQO A;  1YTO A;  1FGA A;  2NVH A;  3CA4 A;  2Z48 A;  3K1X A;  3HOM A;  3VWC A;  4JKX B;  1BLA A;  1M16 A;  3V0B A;  1DZD A;  4L4H A;  1FWV A;  1OQL B;  3FJK A;  2UUS A;  3FFZ A;  3BB2 A;  3W9T A;  4CJM A;  2ET2 A;  3FJ9 A;  3ILA A;  4Q9P A;  1T4Q A;  1FV2 A;  4USP A;  3PHZ A;  2KH2 A;  3H6R A;  1JLX A;  1QQK A;  3OGF A;  3VT1 A;  1P63 A;  1S0E A;  4ZKT B;  3BAH A;  2FO1 A;  5BXT A;  4OEF A;  2X2S A;  3WA1 A;  1ABR B;  3ZC9 A;  3A22 A;  2R9K B;  2D7I A;  2GO2 A;  3N0K A;  4QKS A;  3F62 B;  3HAL A;  1ISW A;  1BFG A;  4FVV A;  4I4Y A;  1FN0 A;  4IZX A;  21BI A;  5F8S A;  3FUQ A;  3WIN A;  2DRE A;  1G9B A;  2WRY A;  2ZR1 B;  4ZBV B;  3AKH A;  1II4 A;  1XYF A;  2KI4 A;  4I4U A;  1S0C A;  2P23 A;  1V6X A;  2MC2 A;  5BQU C;  3IM5 A;  1JT7 A;  3AKI A;  4I4O A;  3CA6 A;  1R8O A;  1SR4 C;  8I1B A;  1D0H A;  3N7L A;  4LO3 A;  1CVS A;  5FNW A;  3P6J A;  4Q9G A;  4JRA A;  4LO1 C;  3RSJ A;  3I2A A;  1RY7 A;  4ZFY B;  5G00 A;  3C9Z A;  1CE7 B;  4KC3 A;  4GAF A;  2IWT B;  3OJ2 A;  3BAV A;  4KBB A;  5BOW A;  3BRF A;  4QBC A;  1JQZ A;  1AF9 A;  4QBV A;  1W3G A;  2FDB M;  3UJ4 A;  4I4P A;  3A23 A;  3O4B A;  3FUO A;  1HIB A;  4J2K A;  4JQ0 A;  1MC9 A;  3P6I A;  2NM1 A;  3V79 C;  4OW4 A;  1EYL A;  2VLC A;  1Q03 A;  3VT2 A;  3BAG A;  3VT0 A;  3MAL A;  4JPZ A;  4JP0 A;  1EV2 A;  1BA7 A;  3LTQ A;  1TP0 A;  3CA5 A;  1HWM B;  3AZV A;  3TC2 A;  4FGF A;  1HWO B;  4OEE A;  3CA3 A;  1TFM B;  4USO A;  4G6M A;  4END A;  1Z2V A;  2LIE A;  3MPP G;  3N7K A;  3I2X A;  3H6R B;  1DFC A;  3QYD A;  4DEP A;  3SNV A;  4I7I A;  1Z4S A;  2HWA A;  4EFQ A;  2Z49 A;  5EC5 A;  2D7R A;  4H9W A;  3FJB A;  3WO2 A;  2K43 A;  3HN1 A;  4MZH A;  2DS0 A;  3P53 A;  3UD9 A;  3A21 A;  1T9F A;  4HA2 A;  1K5V A;  4IQP A;  5BXR A;  4EFP A;  3FJH A;  4GOV A;  4ISR A;  4AN6 A;  1DIW A;  5B2H A;  4IZE A;  2Q3N B;  3O4O A;  3POK A;  4MZF B;  2RQ9 A;  1PC8 B;  3HSM A;  3O5W B;  4I8M A;  3R4S A;  1Q1U A;  2Q9X A;  3AKG A;  2NTD A;  3WO4 A;  1SZ6 B;  4EFR A;  1BFF A;  1G9D A;  3WO3 A;  1ISY A;  4ZLB B;  5HPZ A;  1N4K A;  3Q7W A;  4LO0 C;  1E0O A;  5DZU A;  3T8S A;  4XFU A;  4EB2 B;  1BAS A;  1V6W A;  4I4R A;  1WBC A;  3CA1 A;  1AVW B;  4I37 A;  3OBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...