3FJCA

Crystal structure of l44w mutant of human acidic fibroblast growth factor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQWQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 35
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fjcA00
3AJ5A 5EHAA 3MALA 4FVVA 1I1EA 1ILR1 1G9CA 2FFUA 4KEKA 3O4BA 2LIQA 1XG6A 2AXMA 1TP0A 5DSSB 1DQGA 3V0BA 4G6MA 4QBVA 1F31A 4IZEA 3LLPA 3ILAA 1EPWA 2VSEA 3BAOA 2KI4A 2Q9XA 5BP5A 5F90A 1VCLA 2KKIA 5FNWA 3NJ5A 5FZZA 21BIA 1JLYA 1DFQA 5JLVA 4ISQA 1DZCA 3NBNA 3UD8A 1G82A 5E24E 1YXWA 1JT3A 1XYFA 1HWPB 2DS0A 4GP3A 4OWJA 1NZKA 1PWAA 4D0ZA 3K1XA 3P6JA 4OEEA 4X37A 3FJ8A 4ZFYB 3A23A 2P39A 1G9AA 5FZYA 2WBCA 3CQAA 3RTJB 3HBWA 3BAHA 2F2FC 4GAFA 5DZUA 4GAIA 2M49A 5BXRA 2IWTB 4I3NA 4P0KA 2Z49A 3FJFA 4II0A 2QN4A 3Q7YA 3V0AA 4H04A 2QYIB 1WD3A 3A21A 4I0YA 1FGAA 2WRYA 1BFBA 3AH1A 3ZXDA 1QXMA 3BA4A 5BOWA 1TIEA 3O4CA 4F34A 3QYDA 4J2SA 1SR4C 3BRDA 4ZFWB 1V6WA 1ABRB 1S0EA 4F83A 3NBDA 3BRFA 2D22A 3CA5A 3HOMA 1Z2VA 3W9TA 2YUGA 4ISRA 4LO7B 1JT4A 3TC2A 2D43A 2VXTI 4ENDA 3BX1C 4EFQA 2GO2A 2D24A 4LO7C 3VUOA 1BLDA 4J2XA 2J3PA 1AVAC 3A07A 4TLPA 3AKGA 5G00A 2VSAA 4A7ZA 4EFPA 3QR5A 1EYLA 4ZLBB 2BEBA 4LO3A 1Q04A 2DREA 4OWLA 3FJIA 2NTDA 3H6RB 2X2TA 3CA1A 3FJ9A 1DIWA 3BTAA 2E4MA 5F8WA 1IJTA 2HWMA 5BVPI 9ILBA 2AFGA 2HWAA 1W3FA 3O49A 1HWMB 4PC4A 4JKXB 3VEQA 3AKIA 3OJVA 3O4OA 4AN6A 1BFGA 3CU1B 3FJEA 4KBBA 1HIBA 4XKIA 4EEEB 3IM6A 2I1BA 4JPZA 1II4A 3VWCA 1FMMS 1PUMB 1E0OA 5BQUA 3A22A 3WA1A 4FGFA 3POKA 4JKQA 2DRZA 3WO4A 3FGMA 1BASA 3HMYA 4EFRA 4GOYA 4EB2B 3WINC 2P23A 2NYYA 3NBEA 3D7WB 5F8YA 1YTOA 3ZC9A 2VUAA 1W3AA 4I4OA 3EF2A 3KMVA 3AKFA 1DJSB 1IT0A 4XFSA 1HWOB 5FZUA 3LTQA 3R4UA 3BB2A 3VT0A 1EVTA 3SNVA 5D61A 4P6AA 1J0SA 4ZA3B 1HWNB 1Q1UA 3Q7WA 1IOBA 1HCEA 4P0JA 4LO8B 3O4DA 3FJDA 4GOVA 3V0BB 4IZXA 1BFCA 3H6SE 1YF8B 1CVSA 1WBCA 4J23B 4P0LA 3B9UA 1L2HA 4KEIA 2K43A 2NZ9A 4LO2A 4I4UA 3WMUA 3AKHA 4D8HA 2F2FA 4KC3A 3JUTA 4LO1C 5EG6C 3VT1A 3BA5A 5HPZA 1N4KA 4QD2B 3BADA 3N0KA 2D44A 4GP0A 3O3QA 2HW9A 4ZFUB 3IM7A 3CRGA 1R8OA 4I37A 2R9KB 3CA6A 4QD2C 2VXRA 3IAGC 1DQOA 1AVXB 3FUQA 3BAUA 5DUYA 3AZWA 2Y9FA 4ZGRB 3ZX7A 4IY9A 5GAQA 1IHKA 4X38A 1SR4A 1G9BA 4J2YA 3F62B 1I1BA 3NBCA 2KI6B 2UUSA 1TWEA 3MPPG 2AAIB 4CJMA 4IY8A 2Q3NB 1ISVA 31BIA 4I4XA 1FMZA 3UJ0A 4Q9GA 1BA7A 4DCKC 3PHZA 2ZR1B 3I2AA 3AJ6A 2XOAA 4HJJA 4G9NA 1ISZA 3CAHA 2ESUA 3OBTA 1JY0A 3UD7A 1V6XA 4JQ0A 2FGFA 3RTIB 5BXSA 2D1ZA 2Y9WC 4G6JA 2Y9GA 1IILA 1ONKB 3N7MA 1M2TB 3OBRA 1NUNA 2ZQOA 4DEPA 1Z0HA 4IYBA 1S0CA 1QQKA 1FQ9A 2BFHA 5FNXA 2FFVA 3VSZA 2VLCA 5JMCA 1JTCA 4HA2A 3O5WB 1AVWB 3UJ4A 1PUUB 6I1BA 1FWVA 1TOOA 1ITBA 2ZQNA 3CRHA 3I29B 2Z48A 4I6IA 2HZ9A 2MIBA 3S8JA 1R8NA 3OGGA 3BAVA 1D0HA 2D23A 3VT2A 3CRIA 4A7KA 4QC4A 1YBIA 1G9DA 1RG8A 3FJHA 3FFZA 3WINA 4I4PA 4OEFA 1MC9A 4IHZA 3FJJA 2RG9B 1FWUA 4XFTA 4DENA 4EKXB 4I4YA 3OJ2A 2E4MC 3BAGA 1QQLA 4KEJA 3FUOA 1IRPA 1V6UA 1EV2A 4A7YA 1S0FA 2NVHA 4Q91A 4QBCA 5F8SA 3UDAA 3I2XA 3BA7A 5DVHA 3FJKA 3F1RA 1WD4A 1GGPB 1RMLA 1BFFA 4LO0C 1OQLB 5BQUC 3OGFA 1AVUA 1BARA 1PC8B 3N7JA 3V79C 2K8RA 3N7LA 4LO1A 1Z4SA 4I4QA 4Q9PA 3PMEA 4X3AA 1Q03A 4ZKTB 1W3GA 3BAQA 4IQPA 2RSTA 8I1BA 1TTUA 4H9WA 3RMXA 5B2HA 3PG0A 1T4QA 5BP5C 3H6QA 3P6IA 1XHBA 2ET2A 3RMYA 2FDBM 4XFUA 3CA3A 4I1EA 2KH2A 1AF9A 1TFMB 4I96A 4OUJA 1PZZA 1K5VA 2D20A 2X2SA 2K4AB 4L4IA 3WO2A 1ISXA 1UPSA 3PUBA 1S0LA 2D7RA 2MLLB 4WBCA 1M16A 4I4RA 1AXMA 3HALA 4LO2C 3HSMA 4QALA 2D7IA 4G9MA 4USPA 4QO3A 1S0BA 4USOA 2MC2A 3FJCA 5BXTA 4IONA 4I4VA 2DRYA 3CA4A 3O44A 1KNMA 1MD6A 3R4SA 4AN7B 5BXPA 3V0AB 3C9ZA 1FN0A 4JRAA 3Q7XA 4X39A 3UD9A 2IHOA 4R6UB 5EC5A 4Z9WB 3IM5A 4QKRA 2FO1A 3HN1A 3O4AA 2BEAA 1S0GA 1JLXA 4L4HA 1A8DA 3FJBA 3WMVA 1XZZA 3IIRA 1ISWA 3AZVA 1FV3A 4ZBVB 1BLAA 3E8LC 1DLLA 1ISYA 3CA0A 1RY7A 2Y9XE 4D0TA 1JT5A 1T9FA 2VU9A 3H6RA 1DZDA 7I1BA 4J2KA 1HKNA 2LIEA 5I1BA 3VSFA 4JP0A 4I4SA 4JAWA 4HR6C 1RZOB 4I7IA 1JQZA 1S0DA 2KLLA 4I2SA 3P53A 4QKSA 1V6VA 1P63A 3AH4A 4ZOTA 3OJMA 3JRRA 4YOLA 41BIA 1HCDA 1WBAA 4Z8SB 1JT7A 5D63A 4OEGA 2GZBA 2F8XC 1K5UA 4LO3C 1SZ6B 3AH2A 1CE7B 1FV2A 4OWKA 3RSJA 1TWMA 3N7KA 3ZXGA 3T8SA 3S8KA 4OW4A 1AFCA 2AQZA 2NP0A 2RQ9A 2L5XA 5D62A 3WO3A 1YYNA 4I1BA 3FJAA 4I8MA 2ERMA 1DFCA 2NM1A 4LO0A 1IRAX 3ZC8A 3BRGC 4G1RA
chains in the Genus database with same CATH superfamily
3AJ5A 5EHAA 3MALA 4FVVA 1I1EA 1ILR1 1G9CA 2FFUA 4KEKA 3O4BA 2LIQA 1XG6A 2AXMA 1TP0A 5DSSB 1DQGA 3V0BA 4G6MA 4QBVA 1F31A 4IZEA 3LLPA 3ILAA 1EPWA 2VSEA 3BAOA 2KI4A 2Q9XA 5BP5A 5F90A 1VCLA 2KKIA 5FNWA 3NJ5A 5FZZA 21BIA 1JLYA 1DFQA 5JLVA 4ISQA 1DZCA 3NBNA 3UD8A 1G82A 5E24E 1YXWA 1JT3A 1XYFA 1HWPB 2DS0A 4GP3A 4OWJA 1NZKA 1PWAA 4D0ZA 3K1XA 3P6JA 4OEEA 4X37A 3FJ8A 4ZFYB 3A23A 2P39A 1G9AA 5FZYA 2WBCA 3CQAA 3RTJB 3HBWA 3BAHA 2F2FC 4GAFA 5DZUA 4GAIA 2M49A 5BXRA 2IWTB 4I3NA 4P0KA 2Z49A 3FJFA 4II0A 2QN4A 3Q7YA 3V0AA 4H04A 2QYIB 1WD3A 3A21A 4I0YA 1FGAA 2WRYA 1BFBA 3AH1A 3ZXDA 1QXMA 3BA4A 5BOWA 1TIEA 3O4CA 4F34A 3QYDA 4J2SA 1SR4C 3BRDA 4ZFWB 1V6WA 1ABRB 1S0EA 4F83A 3NBDA 3BRFA 2D22A 3CA5A 3HOMA 1Z2VA 3W9TA 2YUGA 4ISRA 4LO7B 1JT4A 3TC2A 2D43A 2VXTI 4ENDA 3BX1C 4EFQA 2GO2A 2D24A 4LO7C 3VUOA 1BLDA 4J2XA 2J3PA 1AVAC 3A07A 4TLPA 3AKGA 5G00A 2VSAA 4A7ZA 4EFPA 3QR5A 1EYLA 4ZLBB 2BEBA 4LO3A 1Q04A 2DREA 4OWLA 3FJIA 2NTDA 3H6RB 2X2TA 3CA1A 3FJ9A 1DIWA 3BTAA 2E4MA 5F8WA 1IJTA 2HWMA 5BVPI 9ILBA 2AFGA 2HWAA 1W3FA 3O49A 1HWMB 4PC4A 4JKXB 3VEQA 3AKIA 3OJVA 3O4OA 4AN6A 1BFGA 3CU1B 3FJEA 4KBBA 1HIBA 4XKIA 4EEEB 3IM6A 2I1BA 4JPZA 1II4A 3VWCA 1FMMS 1PUMB 1E0OA 5BQUA 3A22A 3WA1A 4FGFA 3POKA 4JKQA 2DRZA 3WO4A 3FGMA 1BASA 3HMYA 4EFRA 4GOYA 4EB2B 3WINC 2P23A 2NYYA 3NBEA 3D7WB 5F8YA 1YTOA 3ZC9A 2VUAA 1W3AA 4I4OA 3EF2A 3KMVA 3AKFA 1DJSB 1IT0A 4XFSA 1HWOB 5FZUA 3LTQA 3R4UA 3BB2A 3VT0A 1EVTA 2NS2A 5D61A 4P6AA 3SNVA 1J0SA 4ZA3B 1HWNB 1Q1UA 3Q7WA 1IOBA 1HCEA 4P0JA 4LO8B 3O4DA 3FJDA 4MZHA 4GOVA 3V0BB 4IZXA 1BFCA 3H6SE 1YF8B 1CVSA 1WBCA 4J23B 4P0LA 3B9UA 1L2HA 4KEIA 2K43A 2NZ9A 4LO2A 4I4UA 3WMUA 3AKHA 4D8HA 2F2FA 4KC3A 3JUTA 4UY4A 4LO1C 5EG6C 3VT1A 3BA5A 5HPZA 1N4KA 4QD2B 3BADA 3N0KA 2D44A 4GP0A 3O3QA 2HW9A 4ZFUB 3IM7A 3CRGA 1R8OA 4I37A 2R9KB 3CA6A 4QD2C 2VXRA 3IAGC 1DQOA 1AVXB 3FUQA 3BAUA 5DUYA 3AZWA 2Y9FA 4ZGRB 3ZX7A 4IY9A 5GAQA 1IHKA 4X38A 1SR4A 1G9BA 4J2YA 3F62B 1I1BA 3NBCA 2KI6B 2UUSA 1TWEA 3MPPG 2AAIB 4CJMA 4IY8A 2Q3NB 1ISVA 31BIA 4I4XA 1FMZA 3UJ0A 4Q9GA 1BA7A 4DCKC 3PHZA 2ZR1B 3I2AA 3AJ6A 2XOAA 4HJJA 4G9NA 1ISZA 3CAHA 2ESUA 3OBTA 1JY0A 3UD7A 1V6XA 4JQ0A 2FGFA 3RTIB 5BXSA 2D1ZA 2Y9WC 4G6JA 2Y9GA 1IILA 1ONKB 3N7MA 1M2TB 3OBRA 1NUNA 2ZQOA 4DEPA 1Z0HA 4IYBA 1S0CA 1QQKA 1FQ9A 2BFHA 5FNXA 2FFVA 3VSZA 2VLCA 5JMCA 1JTCA 4HA2A 3O5WB 1AVWB 3UJ4A 1PUUB 6I1BA 1FWVA 1TOOA 1ITBA 2ZQNA 3CRHA 3I29B 2Z48A 4I6IA 2HZ9A 2MIBA 3S8JA 1R8NA 3OGGA 3BAVA 1D0HA 2D23A 3VT2A 3CRIA 4A7KA 4QC4A 1YBIA 1G9DA 1RG8A 3FJHA 3FFZA 3WINA 4I4PA 4OEFA 1MC9A 4IHZA 3FJJA 2RG9B 1FWUA 4XFTA 4DENA 4EKXB 4I4YA 3OJ2A 2E4MC 3BAGA 1QQLA 4KEJA 3FUOA 1IRPA 1V6UA 1EV2A 4A7YA 1S0FA 2NVHA 4Q91A 4QBCA 5F8SA 3UDAA 3I2XA 3BA7A 5DVHA 3FJKA 3F1RA 1WD4A 1GGPB 1RMLA 1BFFA 4LO0C 1OQLB 5BQUC 3OGFA 1AVUA 1BARA 1PC8B 3N7JA 3V79C 2K8RA 3N7LA 4LO1A 1Z4SA 4I4QA 4Q9PA 3PMEA 4X3AA 1Q03A 4ZKTB 1W3GA 3BAQA 4IQPA 2RSTA 8I1BA 1TTUA 4H9WA 3RMXA 5B2HA 3PG0A 1T4QA 5BP5C 3H6QA 3P6IA 1XHBA 2ET2A 3RMYA 2FDBM 4XFUA 3CA3A 4I1EA 2KH2A 1AF9A 1TFMB 4I96A 4OUJA 1PZZA 1K5VA 2D20A 2X2SA 2K4AB 4L4IA 3WO2A 1ISXA 1UPSA 3PUBA 1S0LA 2D7RA 2MLLB 4WBCA 1M16A 4I4RA 1AXMA 3HALA 4LO2C 3HSMA 4QALA 2D7IA 4G9MA 4USPA 4QO3A 1S0BA 4USOA 2MC2A 3FJCA 5BXTA 4IONA 4I4VA 2DRYA 3CA4A 3O44A 1KNMA 1MD6A 3R4SA 4AN7B 5BXPA 3V0AB 3C9ZA 1FN0A 4JRAA 3Q7XA 4X39A 3UD9A 2IHOA 4R6UB 5EC5A 4Z9WB 3IM5A 4QKRA 2FO1A 3HN1A 3O4AA 2BEAA 1S0GA 1JLXA 4L4HA 4H75A 1A8DA 4MZGB 3FJBA 3WMVA 1XZZA 3IIRA 1ISWA 3AZVA 4MZFB 1FV3A 4ZBVB 1BLAA 3E8LC 1DLLA 1ISYA 3CA0A 1RY7A 2Y9XE 4D0TA 1JT5A 1T9FA 2VU9A 3H6RA 1DZDA 7I1BA 4J2KA 1HKNA 2LIEA 5I1BA 3VSFA 4JP0A 4I4SA 4JAWA 4HR6C 1RZOB 4I7IA 1JQZA 1S0DA 2KLLA 4I2SA 3P53A 4QKSA 1V6VA 1P63A 3AH4A 4ZOTA 3OJMA 3JRRA 4YOLA 41BIA 1HCDA 1WBAA 4Z8SB 1JT7A 5D63A 4OEGA 2GZBA 2F8XC 1K5UA 4LO3C 1SZ6B 3AH2A 1CE7B 1FV2A 4OWKA 3RSJA 1TWMA 3N7KA 3ZXGA 3T8SA 3S8KA 4OW4A 1AFCA 2AQZA 2NP0A 2RQ9A 2L5XA 5D62A 3WO3A 1YYNA 4I1BA 3FJAA 4I8MA 2ERMA 1DFCA 2NM1A 4LO0A 1IRAX 3ZC8A 3BRGC 4G1RA
chains in the Genus database with same CATH topology
3AJ5A 5EHAA 3MALA 4FVVA 1I1EA 1ILR1 1G9CA 2FFUA 4KEKA 3O4BA 2LIQA 1XG6A 2AXMA 1TP0A 5DSSB 1DQGA 3V0BA 4G6MA 4QBVA 1F31A 4IZEA 3LLPA 3ILAA 1EPWA 2VSEA 3BAOA 2KI4A 2Q9XA 5BP5A 5F90A 1VCLA 2KKIA 5FNWA 3NJ5A 5FZZA 21BIA 1JLYA 1DFQA 5JLVA 4ISQA 1DZCA 3NBNA 3UD8A 1G82A 5E24E 1YXWA 1JT3A 1XYFA 1HWPB 2DS0A 4GP3A 4OWJA 1NZKA 1PWAA 4D0ZA 3K1XA 3P6JA 4OEEA 4X37A 3FJ8A 4ZFYB 3A23A 2P39A 1G9AA 5FZYA 2WBCA 3CQAA 3RTJB 3HBWA 3BAHA 2F2FC 4GAFA 5DZUA 4GAIA 2M49A 5BXRA 2IWTB 4I3NA 4P0KA 2Z49A 3FJFA 4II0A 2QN4A 3Q7YA 3V0AA 4H04A 2QYIB 1WD3A 3A21A 4I0YA 1FGAA 2WRYA 1BFBA 3AH1A 3ZXDA 1QXMA 3BA4A 5BOWA 1TIEA 3O4CA 4F34A 3QYDA 4J2SA 1SR4C 3BRDA 4ZFWB 1V6WA 1ABRB 1S0EA 4F83A 3NBDA 3BRFA 2D22A 3CA5A 3HOMA 1Z2VA 3W9TA 2YUGA 4ISRA 4LO7B 1JT4A 3TC2A 2D43A 2VXTI 4ENDA 3BX1C 4EFQA 2GO2A 2D24A 4LO7C 3VUOA 1BLDA 4J2XA 2J3PA 1AVAC 3A07A 4TLPA 3AKGA 5G00A 2VSAA 4A7ZA 4EFPA 3QR5A 1EYLA 4ZLBB 2BEBA 4LO3A 1Q04A 2DREA 4OWLA 3FJIA 2NTDA 3H6RB 2X2TA 3CA1A 3FJ9A 1DIWA 3BTAA 2E4MA 5F8WA 1IJTA 2HWMA 5BVPI 9ILBA 2AFGA 2HWAA 1W3FA 3O49A 1HWMB 4PC4A 4JKXB 3VEQA 3AKIA 3OJVA 3O4OA 4AN6A 1BFGA 3CU1B 3FJEA 4KBBA 1HIBA 4XKIA 4EEEB 3IM6A 2I1BA 4JPZA 1II4A 3VWCA 1FMMS 1PUMB 1E0OA 5BQUA 3A22A 3WA1A 4FGFA 3POKA 4JKQA 2DRZA 3WO4A 3FGMA 1BASA 3HMYA 4EFRA 4GOYA 4EB2B 3WINC 2P23A 2NYYA 3NBEA 3D7WB 5F8YA 1YTOA 3ZC9A 2VUAA 1W3AA 4I4OA 3EF2A 3KMVA 3AKFA 1DJSB 1IT0A 4XFSA 1HWOB 5FZUA 3LTQA 3R4UA 3BB2A 3VT0A 1EVTA 2NS2A 5D61A 4P6AA 3SNVA 1J0SA 4ZA3B 1HWNB 1Q1UA 3Q7WA 1IOBA 1HCEA 4P0JA 4LO8B 3O4DA 3FJDA 4MZHA 4GOVA 3V0BB 4IZXA 1BFCA 3H6SE 1YF8B 1CVSA 1WBCA 4J23B 4P0LA 3B9UA 1L2HA 4KEIA 2K43A 2NZ9A 4LO2A 4I4UA 3WMUA 3AKHA 4D8HA 2F2FA 4KC3A 3JUTA 4UY4A 4LO1C 5EG6C 3VT1A 3BA5A 5HPZA 1N4KA 4QD2B 3BADA 3N0KA 2D44A 4GP0A 3O3QA 2HW9A 4ZFUB 3IM7A 3CRGA 1R8OA 4I37A 2R9KB 3CA6A 4QD2C 2VXRA 3IAGC 1DQOA 1AVXB 3FUQA 3BAUA 5DUYA 3AZWA 2Y9FA 4ZGRB 3ZX7A 4IY9A 5GAQA 1IHKA 4X38A 1SR4A 1G9BA 4J2YA 3F62B 1I1BA 3NBCA 2KI6B 2UUSA 1TWEA 3MPPG 2AAIB 4CJMA 4IY8A 2Q3NB 1ISVA 31BIA 4I4XA 1FMZA 3UJ0A 4Q9GA 1BA7A 4DCKC 3PHZA 2ZR1B 3I2AA 3AJ6A 2XOAA 4HJJA 4G9NA 1ISZA 3CAHA 2ESUA 3OBTA 1JY0A 3UD7A 1V6XA 4JQ0A 2FGFA 3RTIB 5BXSA 2D1ZA 2Y9WC 4G6JA 2Y9GA 1IILA 1ONKB 3N7MA 1M2TB 3OBRA 1NUNA 2ZQOA 4DEPA 1Z0HA 4IYBA 1S0CA 1QQKA 1FQ9A 2BFHA 5FNXA 2FFVA 3VSZA 2VLCA 5JMCA 1JTCA 4HA2A 3O5WB 1AVWB 3UJ4A 1PUUB 6I1BA 1FWVA 1TOOA 1ITBA 2ZQNA 3CRHA 3I29B 2Z48A 4I6IA 2HZ9A 2MIBA 3S8JA 1R8NA 3OGGA 3BAVA 1D0HA 2D23A 3VT2A 3CRIA 4A7KA 4QC4A 1YBIA 1G9DA 1RG8A 3FJHA 3FFZA 3WINA 4I4PA 4OEFA 1MC9A 4IHZA 3FJJA 2RG9B 1FWUA 4XFTA 4DENA 4EKXB 4I4YA 3OJ2A 2E4MC 3BAGA 1QQLA 4KEJA 3FUOA 1IRPA 1V6UA 1EV2A 4A7YA 1S0FA 2NVHA 4Q91A 4QBCA 5F8SA 3UDAA 3I2XA 3BA7A 5DVHA 3FJKA 3F1RA 1WD4A 1GGPB 1RMLA 1BFFA 4LO0C 1OQLB 5BQUC 3OGFA 1AVUA 1BARA 1PC8B 3N7JA 3V79C 2K8RA 3N7LA 4LO1A 1Z4SA 4I4QA 4Q9PA 3PMEA 4X3AA 1Q03A 4ZKTB 1W3GA 3BAQA 4IQPA 2RSTA 8I1BA 1TTUA 4H9WA 3RMXA 5B2HA 3PG0A 1T4QA 5BP5C 3H6QA 3P6IA 1XHBA 2ET2A 3RMYA 2FDBM 4XFUA 3CA3A 4I1EA 2KH2A 1AF9A 1TFMB 4I96A 4OUJA 1PZZA 1K5VA 2D20A 2X2SA 2K4AB 4L4IA 3WO2A 1ISXA 1UPSA 3PUBA 1S0LA 2D7RA 2MLLB 4WBCA 1M16A 4I4RA 1AXMA 3HALA 4LO2C 3HSMA 4QALA 2D7IA 4G9MA 4USPA 4QO3A 1S0BA 4USOA 2MC2A 3FJCA 5BXTA 4IONA 4I4VA 2DRYA 3CA4A 3O44A 1KNMA 1MD6A 3R4SA 4AN7B 5BXPA 3V0AB 3C9ZA 1FN0A 4JRAA 3Q7XA 4X39A 3UD9A 2IHOA 4R6UB 5EC5A 4Z9WB 3IM5A 4QKRA 2FO1A 3HN1A 3O4AA 2BEAA 1S0GA 1JLXA 4L4HA 4H75A 1A8DA 4MZGB 3FJBA 3WMVA 1XZZA 3IIRA 1ISWA 3AZVA 4MZFB 1FV3A 4ZBVB 1BLAA 3E8LC 1DLLA 1ISYA 3CA0A 1RY7A 2Y9XE 4D0TA 1JT5A 1T9FA 2VU9A 3H6RA 1DZDA 7I1BA 4J2KA 1HKNA 2LIEA 5I1BA 3VSFA 4JP0A 4I4SA 4JAWA 4HR6C 1RZOB 4I7IA 1JQZA 1S0DA 2KLLA 4I2SA 3P53A 4QKSA 1V6VA 1P63A 3AH4A 4ZOTA 3OJMA 3JRRA 4YOLA 41BIA 1HCDA 1WBAA 4Z8SB 1JT7A 5D63A 4OEGA 2GZBA 2F8XC 1K5UA 4LO3C 1SZ6B 3AH2A 1CE7B 1FV2A 4OWKA 3RSJA 1TWMA 3N7KA 3ZXGA 3T8SA 3S8KA 4OW4A 1AFCA 2AQZA 2NP0A 2RQ9A 2L5XA 5D62A 3WO3A 1YYNA 4I1BA 3FJAA 4I8MA 2ERMA 1DFCA 2NM1A 4LO0A 1IRAX 3ZC8A 3BRGC 4G1RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AJ5 A;  5EHA A;  3MAL A;  4FVV A;  1I1E A;  1ILR 1;  1G9C A;  2FFU A;  4KEK A;  3O4B A;  2LIQ A;  1XG6 A;  2AXM A;  1TP0 A;  5DSS B;  1DQG A;  3V0B A;  4G6M A;  4QBV A;  1F31 A;  4IZE A;  3LLP A;  3ILA A;  1EPW A;  2VSE A;  3BAO A;  2KI4 A;  2Q9X A;  5BP5 A;  5F90 A;  1VCL A;  2KKI A;  5FNW A;  3NJ5 A;  5FZZ A;  21BI A;  1JLY A;  1DFQ A;  5JLV A;  4ISQ A;  1DZC A;  3NBN A;  3UD8 A;  1G82 A;  5E24 E;  1YXW A;  1JT3 A;  1XYF A;  1HWP B;  2DS0 A;  4GP3 A;  4OWJ A;  1NZK A;  1PWA A;  4D0Z A;  3K1X A;  3P6J A;  4OEE A;  4X37 A;  3FJ8 A;  4ZFY B;  3A23 A;  2P39 A;  1G9A A;  5FZY A;  2WBC A;  3CQA A;  3RTJ B;  3HBW A;  3BAH A;  2F2F C;  4GAF A;  5DZU A;  4GAI A;  2M49 A;  5BXR A;  2IWT B;  4I3N A;  4P0K A;  2Z49 A;  3FJF A;  4II0 A;  2QN4 A;  3Q7Y A;  3V0A A;  4H04 A;  2QYI B;  1WD3 A;  3A21 A;  4I0Y A;  1FGA A;  2WRY A;  1BFB A;  3AH1 A;  3ZXD A;  1QXM A;  3BA4 A;  5BOW A;  1TIE A;  3O4C A;  4F34 A;  3QYD A;  4J2S A;  1SR4 C;  3BRD A;  4ZFW B;  1V6W A;  1ABR B;  1S0E A;  4F83 A;  3NBD A;  3BRF A;  2D22 A;  3CA5 A;  3HOM A;  1Z2V A;  3W9T A;  2YUG A;  4ISR A;  4LO7 B;  1JT4 A;  3TC2 A;  2D43 A;  2VXT I;  4END A;  3BX1 C;  4EFQ A;  2GO2 A;  2D24 A;  4LO7 C;  3VUO A;  1BLD A;  4J2X A;  2J3P A;  1AVA C;  3A07 A;  4TLP A;  3AKG A;  5G00 A;  2VSA A;  4A7Z A;  4EFP A;  3QR5 A;  1EYL A;  4ZLB B;  2BEB A;  4LO3 A;  1Q04 A;  2DRE A;  4OWL A;  3FJI A;  2NTD A;  3H6R B;  2X2T A;  3CA1 A;  3FJ9 A;  1DIW A;  3BTA A;  2E4M A;  5F8W A;  1IJT A;  2HWM A;  5BVP I;  9ILB A;  2AFG A;  2HWA A;  1W3F A;  3O49 A;  1HWM B;  4PC4 A;  4JKX B;  3VEQ A;  3AKI A;  3OJV A;  3O4O A;  4AN6 A;  1BFG A;  3CU1 B;  3FJE A;  4KBB A;  1HIB A;  4XKI A;  4EEE B;  3IM6 A;  2I1B A;  4JPZ A;  1II4 A;  3VWC A;  1FMM S;  1PUM B;  1E0O A;  5BQU A;  3A22 A;  3WA1 A;  4FGF A;  3POK A;  4JKQ A;  2DRZ A;  3WO4 A;  3FGM A;  1BAS A;  3HMY A;  4EFR A;  4GOY A;  4EB2 B;  3WIN C;  2P23 A;  2NYY A;  3NBE A;  3D7W B;  5F8Y A;  1YTO A;  3ZC9 A;  2VUA A;  1W3A A;  4I4O A;  3EF2 A;  3KMV A;  3AKF A;  1DJS B;  1IT0 A;  4XFS A;  1HWO B;  5FZU A;  3LTQ A;  3R4U A;  3BB2 A;  3VT0 A;  1EVT A;  3SNV A;  5D61 A;  4P6A A;  1J0S A;  4ZA3 B;  1HWN B;  1Q1U A;  3Q7W A;  1IOB A;  1HCE A;  4P0J A;  4LO8 B;  3O4D A;  3FJD A;  4GOV A;  3V0B B;  4IZX A;  1BFC A;  3H6S E;  1YF8 B;  1CVS A;  1WBC A;  4J23 B;  4P0L A;  3B9U A;  1L2H A;  4KEI A;  2K43 A;  2NZ9 A;  4LO2 A;  4I4U A;  3WMU A;  3AKH A;  4D8H A;  2F2F A;  4KC3 A;  3JUT A;  4LO1 C;  5EG6 C;  3VT1 A;  3BA5 A;  5HPZ A;  1N4K A;  4QD2 B;  3BAD A;  3N0K A;  2D44 A;  4GP0 A;  3O3Q A;  2HW9 A;  4ZFU B;  3IM7 A;  3CRG A;  1R8O A;  4I37 A;  2R9K B;  3CA6 A;  4QD2 C;  2VXR A;  3IAG C;  1DQO A;  1AVX B;  3FUQ A;  3BAU A;  5DUY A;  3AZW A;  2Y9F A;  4ZGR B;  3ZX7 A;  4IY9 A;  5GAQ A;  1IHK A;  4X38 A;  1SR4 A;  1G9B A;  4J2Y A;  3F62 B;  1I1B A;  3NBC A;  2KI6 B;  2UUS A;  1TWE A;  3MPP G;  2AAI B;  4CJM A;  4IY8 A;  2Q3N B;  1ISV A;  31BI A;  4I4X A;  1FMZ A;  3UJ0 A;  4Q9G A;  1BA7 A;  4DCK C;  3PHZ A;  2ZR1 B;  3I2A A;  3AJ6 A;  2XOA A;  4HJJ A;  4G9N A;  1ISZ A;  3CAH A;  2ESU A;  3OBT A;  1JY0 A;  3UD7 A;  1V6X A;  4JQ0 A;  2FGF A;  3RTI B;  5BXS A;  2D1Z A;  2Y9W C;  4G6J A;  2Y9G A;  1IIL A;  1ONK B;  3N7M A;  1M2T B;  3OBR A;  1NUN A;  2ZQO A;  4DEP A;  1Z0H A;  4IYB A;  1S0C A;  1QQK A;  1FQ9 A;  2BFH A;  5FNX A;  2FFV A;  3VSZ A;  2VLC A;  5JMC A;  1JTC A;  4HA2 A;  3O5W B;  1AVW B;  3UJ4 A;  1PUU B;  6I1B A;  1FWV A;  1TOO A;  1ITB A;  2ZQN A;  3CRH A;  3I29 B;  2Z48 A;  4I6I A;  2HZ9 A;  2MIB A;  3S8J A;  1R8N A;  3OGG A;  3BAV A;  1D0H A;  2D23 A;  3VT2 A;  3CRI A;  4A7K A;  4QC4 A;  1YBI A;  1G9D A;  1RG8 A;  3FJH A;  3FFZ A;  3WIN A;  4I4P A;  4OEF A;  1MC9 A;  4IHZ A;  3FJJ A;  2RG9 B;  1FWU A;  4XFT A;  4DEN A;  4EKX B;  4I4Y A;  3OJ2 A;  2E4M C;  3BAG A;  1QQL A;  4KEJ A;  3FUO A;  1IRP A;  1V6U A;  1EV2 A;  4A7Y A;  1S0F A;  2NVH A;  4Q91 A;  4QBC A;  5F8S A;  3UDA A;  3I2X A;  3BA7 A;  5DVH A;  3FJK A;  3F1R A;  1WD4 A;  1GGP B;  1RML A;  1BFF A;  4LO0 C;  1OQL B;  5BQU C;  3OGF A;  1AVU A;  1BAR A;  1PC8 B;  3N7J A;  3V79 C;  2K8R A;  3N7L A;  4LO1 A;  1Z4S A;  4I4Q A;  4Q9P A;  3PME A;  4X3A A;  1Q03 A;  4ZKT B;  1W3G A;  3BAQ A;  4IQP A;  2RST A;  8I1B A;  1TTU A;  4H9W A;  3RMX A;  5B2H A;  3PG0 A;  1T4Q A;  5BP5 C;  3H6Q A;  3P6I A;  1XHB A;  2ET2 A;  3RMY A;  2FDB M;  4XFU A;  3CA3 A;  4I1E A;  2KH2 A;  1AF9 A;  1TFM B;  4I96 A;  4OUJ A;  1PZZ A;  1K5V A;  2D20 A;  2X2S A;  2K4A B;  4L4I A;  3WO2 A;  1ISX A;  1UPS A;  3PUB A;  1S0L A;  2D7R A;  2MLL B;  4WBC A;  1M16 A;  4I4R A;  1AXM A;  3HAL A;  4LO2 C;  3HSM A;  4QAL A;  2D7I A;  4G9M A;  4USP A;  4QO3 A;  1S0B A;  4USO A;  2MC2 A;  3FJC A;  5BXT A;  4ION A;  4I4V A;  2DRY A;  3CA4 A;  3O44 A;  1KNM A;  1MD6 A;  3R4S A;  4AN7 B;  5BXP A;  3V0A B;  3C9Z A;  1FN0 A;  4JRA A;  3Q7X A;  4X39 A;  3UD9 A;  2IHO A;  4R6U B;  5EC5 A;  4Z9W B;  3IM5 A;  4QKR A;  2FO1 A;  3HN1 A;  3O4A A;  2BEA A;  1S0G A;  1JLX A;  4L4H A;  1A8D A;  3FJB A;  3WMV A;  1XZZ A;  3IIR A;  1ISW A;  3AZV A;  1FV3 A;  4ZBV B;  1BLA A;  3E8L C;  1DLL A;  1ISY A;  3CA0 A;  1RY7 A;  2Y9X E;  4D0T A;  1JT5 A;  1T9F A;  2VU9 A;  3H6R A;  1DZD A;  7I1B A;  4J2K A;  1HKN A;  2LIE A;  5I1B A;  3VSF A;  4JP0 A;  4I4S A;  4JAW A;  4HR6 C;  1RZO B;  4I7I A;  1JQZ A;  1S0D A;  2KLL A;  4I2S A;  3P53 A;  4QKS A;  1V6V A;  1P63 A;  3AH4 A;  4ZOT A;  3OJM A;  3JRR A;  4YOL A;  41BI A;  1HCD A;  1WBA A;  4Z8S B;  1JT7 A;  5D63 A;  4OEG A;  2GZB A;  2F8X C;  1K5U A;  4LO3 C;  1SZ6 B;  3AH2 A;  1CE7 B;  1FV2 A;  4OWK A;  3RSJ A;  1TWM A;  3N7K A;  3ZXG A;  3T8S A;  3S8K A;  4OW4 A;  1AFC A;  2AQZ A;  2NP0 A;  2RQ9 A;  2L5X A;  5D62 A;  3WO3 A;  1YYN A;  4I1B A;  3FJA A;  4I8M A;  2ERM A;  1DFC A;  2NM1 A;  4LO0 A;  1IRA X;  3ZC8 A;  3BRG C;  4G1R A; 
#chains in the Genus database with same CATH topology
 3AJ5 A;  5EHA A;  3MAL A;  4FVV A;  1I1E A;  1ILR 1;  1G9C A;  2FFU A;  4KEK A;  3O4B A;  2LIQ A;  1XG6 A;  2AXM A;  1TP0 A;  5DSS B;  1DQG A;  3V0B A;  4G6M A;  4QBV A;  1F31 A;  4IZE A;  3LLP A;  3ILA A;  1EPW A;  2VSE A;  3BAO A;  2KI4 A;  2Q9X A;  5BP5 A;  5F90 A;  1VCL A;  2KKI A;  5FNW A;  3NJ5 A;  5FZZ A;  21BI A;  1JLY A;  1DFQ A;  5JLV A;  4ISQ A;  1DZC A;  3NBN A;  3UD8 A;  1G82 A;  5E24 E;  1YXW A;  1JT3 A;  1XYF A;  1HWP B;  2DS0 A;  4GP3 A;  4OWJ A;  1NZK A;  1PWA A;  4D0Z A;  3K1X A;  3P6J A;  4OEE A;  4X37 A;  3FJ8 A;  4ZFY B;  3A23 A;  2P39 A;  1G9A A;  5FZY A;  2WBC A;  3CQA A;  3RTJ B;  3HBW A;  3BAH A;  2F2F C;  4GAF A;  5DZU A;  4GAI A;  2M49 A;  5BXR A;  2IWT B;  4I3N A;  4P0K A;  2Z49 A;  3FJF A;  4II0 A;  2QN4 A;  3Q7Y A;  3V0A A;  4H04 A;  2QYI B;  1WD3 A;  3A21 A;  4I0Y A;  1FGA A;  2WRY A;  1BFB A;  3AH1 A;  3ZXD A;  1QXM A;  3BA4 A;  5BOW A;  1TIE A;  3O4C A;  4F34 A;  3QYD A;  4J2S A;  1SR4 C;  3BRD A;  4ZFW B;  1V6W A;  1ABR B;  1S0E A;  4F83 A;  3NBD A;  3BRF A;  2D22 A;  3CA5 A;  3HOM A;  1Z2V A;  3W9T A;  2YUG A;  4ISR A;  4LO7 B;  1JT4 A;  3TC2 A;  2D43 A;  2VXT I;  4END A;  3BX1 C;  4EFQ A;  2GO2 A;  2D24 A;  4LO7 C;  3VUO A;  1BLD A;  4J2X A;  2J3P A;  1AVA C;  3A07 A;  4TLP A;  3AKG A;  5G00 A;  2VSA A;  4A7Z A;  4EFP A;  3QR5 A;  1EYL A;  4ZLB B;  2BEB A;  4LO3 A;  1Q04 A;  2DRE A;  4OWL A;  3FJI A;  2NTD A;  3H6R B;  2X2T A;  3CA1 A;  3FJ9 A;  1DIW A;  3BTA A;  2E4M A;  5F8W A;  1IJT A;  2HWM A;  5BVP I;  9ILB A;  2AFG A;  2HWA A;  1W3F A;  3O49 A;  1HWM B;  4PC4 A;  4JKX B;  3VEQ A;  3AKI A;  3OJV A;  3O4O A;  4AN6 A;  1BFG A;  3CU1 B;  3FJE A;  4KBB A;  1HIB A;  4XKI A;  4EEE B;  3IM6 A;  2I1B A;  4JPZ A;  1II4 A;  3VWC A;  1FMM S;  1PUM B;  1E0O A;  5BQU A;  3A22 A;  3WA1 A;  4FGF A;  3POK A;  4JKQ A;  2DRZ A;  3WO4 A;  3FGM A;  1BAS A;  3HMY A;  4EFR A;  4GOY A;  4EB2 B;  3WIN C;  2P23 A;  2NYY A;  3NBE A;  3D7W B;  5F8Y A;  1YTO A;  3ZC9 A;  2VUA A;  1W3A A;  4I4O A;  3EF2 A;  3KMV A;  3AKF A;  1DJS B;  1IT0 A;  4XFS A;  1HWO B;  5FZU A;  3LTQ A;  3R4U A;  3BB2 A;  3VT0 A;  1EVT A;  2NS2 A;  5D61 A;  4P6A A;  3SNV A;  1J0S A;  4ZA3 B;  1HWN B;  1Q1U A;  3Q7W A;  1IOB A;  1HCE A;  4P0J A;  4LO8 B;  3O4D A;  3FJD A;  4MZH A;  4GOV A;  3V0B B;  4IZX A;  1BFC A;  3H6S E;  1YF8 B;  1CVS A;  1WBC A;  4J23 B;  4P0L A;  3B9U A;  1L2H A;  4KEI A;  2K43 A;  2NZ9 A;  4LO2 A;  4I4U A;  3WMU A;  3AKH A;  4D8H A;  2F2F A;  4KC3 A;  3JUT A;  4UY4 A;  4LO1 C;  5EG6 C;  3VT1 A;  3BA5 A;  5HPZ A;  1N4K A;  4QD2 B;  3BAD A;  3N0K A;  2D44 A;  4GP0 A;  3O3Q A;  2HW9 A;  4ZFU B;  3IM7 A;  3CRG A;  1R8O A;  4I37 A;  2R9K B;  3CA6 A;  4QD2 C;  2VXR A;  3IAG C;  1DQO A;  1AVX B;  3FUQ A;  3BAU A;  5DUY A;  3AZW A;  2Y9F A;  4ZGR B;  3ZX7 A;  4IY9 A;  5GAQ A;  1IHK A;  4X38 A;  1SR4 A;  1G9B A;  4J2Y A;  3F62 B;  1I1B A;  3NBC A;  2KI6 B;  2UUS A;  1TWE A;  3MPP G;  2AAI B;  4CJM A;  4IY8 A;  2Q3N B;  1ISV A;  31BI A;  4I4X A;  1FMZ A;  3UJ0 A;  4Q9G A;  1BA7 A;  4DCK C;  3PHZ A;  2ZR1 B;  3I2A A;  3AJ6 A;  2XOA A;  4HJJ A;  4G9N A;  1ISZ A;  3CAH A;  2ESU A;  3OBT A;  1JY0 A;  3UD7 A;  1V6X A;  4JQ0 A;  2FGF A;  3RTI B;  5BXS A;  2D1Z A;  2Y9W C;  4G6J A;  2Y9G A;  1IIL A;  1ONK B;  3N7M A;  1M2T B;  3OBR A;  1NUN A;  2ZQO A;  4DEP A;  1Z0H A;  4IYB A;  1S0C A;  1QQK A;  1FQ9 A;  2BFH A;  5FNX A;  2FFV A;  3VSZ A;  2VLC A;  5JMC A;  1JTC A;  4HA2 A;  3O5W B;  1AVW B;  3UJ4 A;  1PUU B;  6I1B A;  1FWV A;  1TOO A;  1ITB A;  2ZQN A;  3CRH A;  3I29 B;  2Z48 A;  4I6I A;  2HZ9 A;  2MIB A;  3S8J A;  1R8N A;  3OGG A;  3BAV A;  1D0H A;  2D23 A;  3VT2 A;  3CRI A;  4A7K A;  4QC4 A;  1YBI A;  1G9D A;  1RG8 A;  3FJH A;  3FFZ A;  3WIN A;  4I4P A;  4OEF A;  1MC9 A;  4IHZ A;  3FJJ A;  2RG9 B;  1FWU A;  4XFT A;  4DEN A;  4EKX B;  4I4Y A;  3OJ2 A;  2E4M C;  3BAG A;  1QQL A;  4KEJ A;  3FUO A;  1IRP A;  1V6U A;  1EV2 A;  4A7Y A;  1S0F A;  2NVH A;  4Q91 A;  4QBC A;  5F8S A;  3UDA A;  3I2X A;  3BA7 A;  5DVH A;  3FJK A;  3F1R A;  1WD4 A;  1GGP B;  1RML A;  1BFF A;  4LO0 C;  1OQL B;  5BQU C;  3OGF A;  1AVU A;  1BAR A;  1PC8 B;  3N7J A;  3V79 C;  2K8R A;  3N7L A;  4LO1 A;  1Z4S A;  4I4Q A;  4Q9P A;  3PME A;  4X3A A;  1Q03 A;  4ZKT B;  1W3G A;  3BAQ A;  4IQP A;  2RST A;  8I1B A;  1TTU A;  4H9W A;  3RMX A;  5B2H A;  3PG0 A;  1T4Q A;  5BP5 C;  3H6Q A;  3P6I A;  1XHB A;  2ET2 A;  3RMY A;  2FDB M;  4XFU A;  3CA3 A;  4I1E A;  2KH2 A;  1AF9 A;  1TFM B;  4I96 A;  4OUJ A;  1PZZ A;  1K5V A;  2D20 A;  2X2S A;  2K4A B;  4L4I A;  3WO2 A;  1ISX A;  1UPS A;  3PUB A;  1S0L A;  2D7R A;  2MLL B;  4WBC A;  1M16 A;  4I4R A;  1AXM A;  3HAL A;  4LO2 C;  3HSM A;  4QAL A;  2D7I A;  4G9M A;  4USP A;  4QO3 A;  1S0B A;  4USO A;  2MC2 A;  3FJC A;  5BXT A;  4ION A;  4I4V A;  2DRY A;  3CA4 A;  3O44 A;  1KNM A;  1MD6 A;  3R4S A;  4AN7 B;  5BXP A;  3V0A B;  3C9Z A;  1FN0 A;  4JRA A;  3Q7X A;  4X39 A;  3UD9 A;  2IHO A;  4R6U B;  5EC5 A;  4Z9W B;  3IM5 A;  4QKR A;  2FO1 A;  3HN1 A;  3O4A A;  2BEA A;  1S0G A;  1JLX A;  4L4H A;  4H75 A;  1A8D A;  4MZG B;  3FJB A;  3WMV A;  1XZZ A;  3IIR A;  1ISW A;  3AZV A;  4MZF B;  1FV3 A;  4ZBV B;  1BLA A;  3E8L C;  1DLL A;  1ISY A;  3CA0 A;  1RY7 A;  2Y9X E;  4D0T A;  1JT5 A;  1T9F A;  2VU9 A;  3H6R A;  1DZD A;  7I1B A;  4J2K A;  1HKN A;  2LIE A;  5I1B A;  3VSF A;  4JP0 A;  4I4S A;  4JAW A;  4HR6 C;  1RZO B;  4I7I A;  1JQZ A;  1S0D A;  2KLL A;  4I2S A;  3P53 A;  4QKS A;  1V6V A;  1P63 A;  3AH4 A;  4ZOT A;  3OJM A;  3JRR A;  4YOL A;  41BI A;  1HCD A;  1WBA A;  4Z8S B;  1JT7 A;  5D63 A;  4OEG A;  2GZB A;  2F8X C;  1K5U A;  4LO3 C;  1SZ6 B;  3AH2 A;  1CE7 B;  1FV2 A;  4OWK A;  3RSJ A;  1TWM A;  3N7K A;  3ZXG A;  3T8S A;  3S8K A;  4OW4 A;  1AFC A;  2AQZ A;  2NP0 A;  2RQ9 A;  2L5X A;  5D62 A;  3WO3 A;  1YYN A;  4I1B A;  3FJA A;  4I8M A;  2ERM A;  1DFC A;  2NM1 A;  4LO0 A;  1IRA X;  3ZC8 A;  3BRG C;  4G1R A; 
#chains in the Genus database with same CATH homology
 3AJ5 A;  5EHA A;  3MAL A;  4FVV A;  1I1E A;  1ILR 1;  1G9C A;  2FFU A;  4KEK A;  3O4B A;  2LIQ A;  1XG6 A;  2AXM A;  1TP0 A;  5DSS B;  1DQG A;  3V0B A;  4G6M A;  4QBV A;  1F31 A;  4IZE A;  3LLP A;  3ILA A;  1EPW A;  2VSE A;  3BAO A;  2KI4 A;  2Q9X A;  5BP5 A;  5F90 A;  1VCL A;  2KKI A;  5FNW A;  3NJ5 A;  5FZZ A;  21BI A;  1JLY A;  1DFQ A;  5JLV A;  4ISQ A;  1DZC A;  3NBN A;  3UD8 A;  1G82 A;  5E24 E;  1YXW A;  1JT3 A;  1XYF A;  1HWP B;  2DS0 A;  4GP3 A;  4OWJ A;  1NZK A;  1PWA A;  4D0Z A;  3K1X A;  3P6J A;  4OEE A;  4X37 A;  3FJ8 A;  4ZFY B;  3A23 A;  2P39 A;  1G9A A;  5FZY A;  2WBC A;  3CQA A;  3RTJ B;  3HBW A;  3BAH A;  2F2F C;  4GAF A;  5DZU A;  4GAI A;  2M49 A;  5BXR A;  2IWT B;  4I3N A;  4P0K A;  2Z49 A;  3FJF A;  4II0 A;  2QN4 A;  3Q7Y A;  3V0A A;  4H04 A;  2QYI B;  1WD3 A;  3A21 A;  4I0Y A;  1FGA A;  2WRY A;  1BFB A;  3AH1 A;  3ZXD A;  1QXM A;  3BA4 A;  5BOW A;  1TIE A;  3O4C A;  4F34 A;  3QYD A;  4J2S A;  1SR4 C;  3BRD A;  4ZFW B;  1V6W A;  1ABR B;  1S0E A;  4F83 A;  3NBD A;  3BRF A;  2D22 A;  3CA5 A;  3HOM A;  1Z2V A;  3W9T A;  2YUG A;  4ISR A;  4LO7 B;  1JT4 A;  3TC2 A;  2D43 A;  2VXT I;  4END A;  3BX1 C;  4EFQ A;  2GO2 A;  2D24 A;  4LO7 C;  3VUO A;  1BLD A;  4J2X A;  2J3P A;  1AVA C;  3A07 A;  4TLP A;  3AKG A;  5G00 A;  2VSA A;  4A7Z A;  4EFP A;  3QR5 A;  1EYL A;  4ZLB B;  2BEB A;  4LO3 A;  1Q04 A;  2DRE A;  4OWL A;  3FJI A;  2NTD A;  3H6R B;  2X2T A;  3CA1 A;  3FJ9 A;  1DIW A;  3BTA A;  2E4M A;  5F8W A;  1IJT A;  2HWM A;  5BVP I;  9ILB A;  2AFG A;  2HWA A;  1W3F A;  3O49 A;  1HWM B;  4PC4 A;  4JKX B;  3VEQ A;  3AKI A;  3OJV A;  3O4O A;  4AN6 A;  1BFG A;  3CU1 B;  3FJE A;  4KBB A;  1HIB A;  4XKI A;  4EEE B;  3IM6 A;  2I1B A;  4JPZ A;  1II4 A;  3VWC A;  1FMM S;  1PUM B;  1E0O A;  5BQU A;  3A22 A;  3WA1 A;  4FGF A;  3POK A;  4JKQ A;  2DRZ A;  3WO4 A;  3FGM A;  1BAS A;  3HMY A;  4EFR A;  4GOY A;  4EB2 B;  3WIN C;  2P23 A;  2NYY A;  3NBE A;  3D7W B;  5F8Y A;  1YTO A;  3ZC9 A;  2VUA A;  1W3A A;  4I4O A;  3EF2 A;  3KMV A;  3AKF A;  1DJS B;  1IT0 A;  4XFS A;  1HWO B;  5FZU A;  3LTQ A;  3R4U A;  3BB2 A;  3VT0 A;  1EVT A;  2NS2 A;  5D61 A;  4P6A A;  3SNV A;  1J0S A;  4ZA3 B;  1HWN B;  1Q1U A;  3Q7W A;  1IOB A;  1HCE A;  4P0J A;  4LO8 B;  3O4D A;  3FJD A;  4MZH A;  4GOV A;  3V0B B;  4IZX A;  1BFC A;  3H6S E;  1YF8 B;  1CVS A;  1WBC A;  4J23 B;  4P0L A;  3B9U A;  1L2H A;  4KEI A;  2K43 A;  2NZ9 A;  4LO2 A;  4I4U A;  3WMU A;  3AKH A;  4D8H A;  2F2F A;  4KC3 A;  3JUT A;  4UY4 A;  4LO1 C;  5EG6 C;  3VT1 A;  3BA5 A;  5HPZ A;  1N4K A;  4QD2 B;  3BAD A;  3N0K A;  2D44 A;  4GP0 A;  3O3Q A;  2HW9 A;  4ZFU B;  3IM7 A;  3CRG A;  1R8O A;  4I37 A;  2R9K B;  3CA6 A;  4QD2 C;  2VXR A;  3IAG C;  1DQO A;  1AVX B;  3FUQ A;  3BAU A;  5DUY A;  3AZW A;  2Y9F A;  4ZGR B;  3ZX7 A;  4IY9 A;  5GAQ A;  1IHK A;  4X38 A;  1SR4 A;  1G9B A;  4J2Y A;  3F62 B;  1I1B A;  3NBC A;  2KI6 B;  2UUS A;  1TWE A;  3MPP G;  2AAI B;  4CJM A;  4IY8 A;  2Q3N B;  1ISV A;  31BI A;  4I4X A;  1FMZ A;  3UJ0 A;  4Q9G A;  1BA7 A;  4DCK C;  3PHZ A;  2ZR1 B;  3I2A A;  3AJ6 A;  2XOA A;  4HJJ A;  4G9N A;  1ISZ A;  3CAH A;  2ESU A;  3OBT A;  1JY0 A;  3UD7 A;  1V6X A;  4JQ0 A;  2FGF A;  3RTI B;  5BXS A;  2D1Z A;  2Y9W C;  4G6J A;  2Y9G A;  1IIL A;  1ONK B;  3N7M A;  1M2T B;  3OBR A;  1NUN A;  2ZQO A;  4DEP A;  1Z0H A;  4IYB A;  1S0C A;  1QQK A;  1FQ9 A;  2BFH A;  5FNX A;  2FFV A;  3VSZ A;  2VLC A;  5JMC A;  1JTC A;  4HA2 A;  3O5W B;  1AVW B;  3UJ4 A;  1PUU B;  6I1B A;  1FWV A;  1TOO A;  1ITB A;  2ZQN A;  3CRH A;  3I29 B;  2Z48 A;  4I6I A;  2HZ9 A;  2MIB A;  3S8J A;  1R8N A;  3OGG A;  3BAV A;  1D0H A;  2D23 A;  3VT2 A;  3CRI A;  4A7K A;  4QC4 A;  1YBI A;  1G9D A;  1RG8 A;  3FJH A;  3FFZ A;  3WIN A;  4I4P A;  4OEF A;  1MC9 A;  4IHZ A;  3FJJ A;  2RG9 B;  1FWU A;  4XFT A;  4DEN A;  4EKX B;  4I4Y A;  3OJ2 A;  2E4M C;  3BAG A;  1QQL A;  4KEJ A;  3FUO A;  1IRP A;  1V6U A;  1EV2 A;  4A7Y A;  1S0F A;  2NVH A;  4Q91 A;  4QBC A;  5F8S A;  3UDA A;  3I2X A;  3BA7 A;  5DVH A;  3FJK A;  3F1R A;  1WD4 A;  1GGP B;  1RML A;  1BFF A;  4LO0 C;  1OQL B;  5BQU C;  3OGF A;  1AVU A;  1BAR A;  1PC8 B;  3N7J A;  3V79 C;  2K8R A;  3N7L A;  4LO1 A;  1Z4S A;  4I4Q A;  4Q9P A;  3PME A;  4X3A A;  1Q03 A;  4ZKT B;  1W3G A;  3BAQ A;  4IQP A;  2RST A;  8I1B A;  1TTU A;  4H9W A;  3RMX A;  5B2H A;  3PG0 A;  1T4Q A;  5BP5 C;  3H6Q A;  3P6I A;  1XHB A;  2ET2 A;  3RMY A;  2FDB M;  4XFU A;  3CA3 A;  4I1E A;  2KH2 A;  1AF9 A;  1TFM B;  4I96 A;  4OUJ A;  1PZZ A;  1K5V A;  2D20 A;  2X2S A;  2K4A B;  4L4I A;  3WO2 A;  1ISX A;  1UPS A;  3PUB A;  1S0L A;  2D7R A;  2MLL B;  4WBC A;  1M16 A;  4I4R A;  1AXM A;  3HAL A;  4LO2 C;  3HSM A;  4QAL A;  2D7I A;  4G9M A;  4USP A;  4QO3 A;  1S0B A;  4USO A;  2MC2 A;  3FJC A;  5BXT A;  4ION A;  4I4V A;  2DRY A;  3CA4 A;  3O44 A;  1KNM A;  1MD6 A;  3R4S A;  4AN7 B;  5BXP A;  3V0A B;  3C9Z A;  1FN0 A;  4JRA A;  3Q7X A;  4X39 A;  3UD9 A;  2IHO A;  4R6U B;  5EC5 A;  4Z9W B;  3IM5 A;  4QKR A;  2FO1 A;  3HN1 A;  3O4A A;  2BEA A;  1S0G A;  1JLX A;  4L4H A;  4H75 A;  1A8D A;  4MZG B;  3FJB A;  3WMV A;  1XZZ A;  3IIR A;  1ISW A;  3AZV A;  4MZF B;  1FV3 A;  4ZBV B;  1BLA A;  3E8L C;  1DLL A;  1ISY A;  3CA0 A;  1RY7 A;  2Y9X E;  4D0T A;  1JT5 A;  1T9F A;  2VU9 A;  3H6R A;  1DZD A;  7I1B A;  4J2K A;  1HKN A;  2LIE A;  5I1B A;  3VSF A;  4JP0 A;  4I4S A;  4JAW A;  4HR6 C;  1RZO B;  4I7I A;  1JQZ A;  1S0D A;  2KLL A;  4I2S A;  3P53 A;  4QKS A;  1V6V A;  1P63 A;  3AH4 A;  4ZOT A;  3OJM A;  3JRR A;  4YOL A;  41BI A;  1HCD A;  1WBA A;  4Z8S B;  1JT7 A;  5D63 A;  4OEG A;  2GZB A;  2F8X C;  1K5U A;  4LO3 C;  1SZ6 B;  3AH2 A;  1CE7 B;  1FV2 A;  4OWK A;  3RSJ A;  1TWM A;  3N7K A;  3ZXG A;  3T8S A;  3S8K A;  4OW4 A;  1AFC A;  2AQZ A;  2NP0 A;  2RQ9 A;  2L5X A;  5D62 A;  3WO3 A;  1YYN A;  4I1B A;  3FJA A;  4I8M A;  2ERM A;  1DFC A;  2NM1 A;  4LO0 A;  1IRA X;  3ZC8 A;  3BRG C;  4G1R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...