3FJJA

Crystal structure of c83v mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEEVLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Structural basis of conserved cysteine in the fibroblast growth factor family: evidence for a vestigial half-cystine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fjjA00
4G9MA 1JT4A 4OW4A 1ABRB 3FJAA 1AF9A 4IZEA 3IAGC 3CA5A 4I6IA 3EF2A 4DEPA 3HN1A 2D7RA 4FGFA 4QKSA 1AVAC 1V6XA 1HWMB 4I3NA 3AKGA 4J2KA 3WA1A 5BP5A 2I1BA 4KC3A 3P6JA 3WO4A 1XHBA 4XFUA 1II4A 3VUOA 1I1EA 3AZWA 1BLDA 1E0OA 1HWPB 1W3GA 6I1BA 3FJIA 4L4IA 1EV2A 2XOAA 3MPPG 2QN4A 3RMYA 3BRFA 3FJEA 3FUQA 3BB2A 1IOBA 2P39A 4LO0C 2RQ9A 3O44A 4ISQA 1L2HA 2BFHA 1ISZA 3BRDA 1TIEA 3BAHA 3BAQA 3F1RA 4JKQA 1IJTA 4EB2B 1Q04A 3N7LA 4G6JA 8I1BA 2VUAA 3FJKA 3UDAA 4P0LA 1HWOB 3O4CA 3N0KA 3AKIA 1JT3A 4A7KA 3NBNA 2UUSA 2KLLA 3BAGA 1S0LA 2D24A 4J2XA 4J2YA 3HALA 3AZVA 4XFSA 2Y9WC 3WO3A 4IY8A 3H6RA 3TC2A 1J0SA 4I4YA 3BA4A 3OBTA 2VSEA 5FNWA 5G00A 2ZR1B 3VEQA 3S8JA 3UD7A 1S0EA 2FFUA 4GP0A 3WO2A 7I1BA 4H9WA 3V79C 1YF8B 3OJMA 4X3AA 3VT0A 2MIBA 1DQOA 2X2SA 3N7JA 2VLCA 3ZX7A 1FWUA 3VT2A 3IM6A 4ENDA 2R9KB 1D0HA 4I0YA 3CA4A 4OEEA 1HCDA 1FQ9A 1BFBA 5BQUC 4PC4A 1HIBA 3QR5A 2AAIB 1DZDA 1JY0A 4WBCA 1ISWA 1S0FA 3BAOA 1Z2VA 1SR4A 2ZQNA 4A7YA 3BADA 4IQPA 3H6QA 3OGFA 3S8KA 2E4MC 3R4UA 3H6RB 4AN6A 1ILR1 4KEKA 3FJ8A 3OJ2A 5B2HA 4HJJA 3O5WB 4P0KA 2KH2A 3OGGA 4USOA 3O4AA 2F2FA 1WBCA 1TFMB 4Q9PA 4EFQA 1M2TB 2VU9A 1TWMA 4QD2B 1G9AA 3PG0A 4JAWA 2YUGA 2HWMA 4GP3A 1AVWB 4JP0A 4ZLBB 1ONKB 3O4BA 1P63A 9ILBA 1A8DA 1AXMA 4F83A 2DS0A 1W3FA 2L5XA 3POKA 4ZBVB 1JT5A 4IZXA 1NZKA 1RY7A 3R4SA 5EC5A 3ILAA 3SNVA 3CRHA 2AXMA 3JUTA 3BA7A 2KI4A 3W9TA 4D8HA 1RMLA 4IY9A 4GAIA 1XYFA 3Q7WA 3FGMA 4G1RA 3Q7XA 2F2FC 2ZQOA 3P53A 1OQLB 3FJCA 4I4RA 3IM5A 3LLPA 3KMVA 3Q7YA 4LO1C 4R6UB 5BXTA 4GOVA 4ZFWB 3CAHA 2HW9A 4JRAA 1V6WA 4KEIA 3FFZA 2VXTI 4J23B 3N7KA 3D7WB 5DSSB 2GO2A 5F90A 4I7IA 5D63A 4Z9WB 3HOMA 1AVUA 3I2AA 1DFCA 5BP5C 3B9UA 3MALA 1GGPB 1TP0A 4ZFUB 3PMEA 1BASA 2FGFA 1PZZA 1RZOB 3C9ZA 3A23A 4D0TA 1ITBA 1JTCA 4OUJA 4QBCA 1R8OA 4P0JA 3FJFA 4KBBA 2DRZA 2ERMA 4LO7B 5BXRA 4G9NA 4P6AA 3RTJB 3HMYA 4EKXB 21BIA 4F34A 3OBRA 1NUNA 3PHZA 1FWVA 4LO3A 3CRGA 2DRYA 3UD9A 1K5VA 4JQ0A 3FUOA 4USPA 2D1ZA 1K5UA 3IM7A 3FJHA 4KEJA 5GAQA 4YOLA 1BFGA 1N4KA 2Z48A 1G9BA 2FO1A 1S0GA 1T9FA 4QALA 2D43A 1QXMA 3IIRA 1YBIA 3AJ5A 2F8XC 4ZOTA 1FGAA 4X37A 3VT1A 3BTAA 4X38A 3A22A 2NP0A 3VSZA 4I8MA 1KNMA 1TOOA 1CE7B 4LO3C 4OWLA 2K8RA 4H04A 4II0A 4OWKA 1IRPA 4OWJA 1DQGA 3K1XA 1JLXA 1EYLA 1YTOA 4QD2C 4I1BA 4ZKTB 4OEFA 2Y9FA 2KI6B 5D62A 1BLAA 3F62B 4I2SA 3O49A 2Q9XA 3HSMA 2NYYA 3CA3A 1WBAA 1R8NA 1DJSB 3I29B 4L4HA 1TTUA 1FMMS 3ZXGA 4ZA3B 5HPZA 4QBVA 3FJ9A 1QQKA 4Q91A 3BX1C 4ZFYB 3CRIA 4I4XA 3UJ4A 1ISYA 5EG6C 1SR4C 1S0DA 4XFTA 1T4QA 5BVPI 1WD3A 2AQZA 1G9CA 3H6SE 1ISVA 1PC8B 4JKXB 5DZUA 1FV2A 1S0CA 3WINA 5FZZA 3CA0A 4G6MA 4GAFA 3AKHA 4XKIA 1EVTA 2X2TA 3NBEA 2NTDA 3AJ6A 4A7ZA 3V0BB 3AKFA 2NZ9A 4LO0A 1AFCA 2QYIB 2ET2A 4I4VA 1I1BA 3FJBA 5I1BA 5JLVA 1HCEA 1EPWA 5FZUA 3O4DA 1BFCA 2WBCA 1IRAX 3CQAA 1PWAA 4LO2A 5EHAA 3LTQA 3ZC8A 1AVXB 1MC9A 4QO3A 5F8WA 1S0BA 1HKNA 2D22A 2BEBA 2J3PA 2RG9B 4LO8B 3WINC 1RG8A 3WMVA 5DVHA 5FNXA 4LO7C 2ESUA 4I96A 1BA7A 3N7MA 3RMXA 4I37A 2NVHA 2LIEA 1JQZA 3VWCA 1W3AA 4HR6C 4TLPA 1FV3A 2IHOA 4JPZA 1SZ6B 3CA1A 2MLLB 4AN7B 1V6VA 2D7IA 2WRYA 1VCLA 2P23A 3CA6A 2HWAA 4I4UA 2D20A 3I2XA 2Y9GA 4I4QA 4IHZA 4LO2C 5D61A 41BIA 2VSAA 1DFQA 3O4OA 3A07A 4D0ZA 1BFFA 1Q03A 1YYNA 3UD8A 3RSJA 1PUUB 3NBDA 1HWNB 1IT0A 1FN0A 3A21A 4I4PA 3E8LC 3ZC9A 3OJVA 4I4OA 1Z4SA 1Q1UA 4I1EA 5E24E 4IONA 3AH1A 3BAVA 3QYDA 1DIWA 3V0AA 3T8SA 2GZBA 3NBCA 1M16A 2HZ9A 31BIA 5BQUA 1CVSA 2D44A 1JLYA 2D23A 3AH4A 3FJDA 5DUYA 1DLLA 4Q9GA 3RTIB 1TWEA 4EFPA 4OEGA 2IWTB 4I4SA 4Z8SB 1PUMB 2NM1A 4QKRA 4DENA 2MC2A 1DZCA 1MD6A 4ISRA 2E4MA 3HBWA 2K4AB 2LIQA 1XG6A 5BXSA 3ZXDA 3PUBA 1JT7A 5JMCA 2BEAA 1FMZA 3BAUA 3UJ0A 2Q3NB 5F8YA 4QC4A 4EEEB 4FVVA 3CU1B 2K43A 3V0BA 3WMUA 4IYBA 5F8SA 1Z0HA 2VXRA 4X39A 3AH2A 2AFGA 4HA2A 3O3QA 1ISXA 1XZZA 3VSFA 4DCKC 2M49A 2KKIA 4EFRA 1IILA 2FFVA 3V0AB 3BA5A 4J2SA 2Y9XE 2FDBM 4CJMA 1IHKA 4ZGRB 3P6IA 2DREA 2RSTA 3JRRA 3FJJA 5FZYA 1YXWA 3BRGC 1UPSA 3NJ5A 1G9DA 5BOWA 1QQLA 4GOYA 2Z49A 1V6UA 5BXPA 1G82A 4LO1A 1WD4A 1BARA 1F31A
chains in the Genus database with same CATH superfamily
4G9MA 1JT4A 4OW4A 1ABRB 3FJAA 1AF9A 4IZEA 3IAGC 3CA5A 4I6IA 3EF2A 4DEPA 3HN1A 2D7RA 4FGFA 4QKSA 1AVAC 1V6XA 1HWMB 4I3NA 3AKGA 4J2KA 3WA1A 5BP5A 2I1BA 4KC3A 3P6JA 3WO4A 1XHBA 4XFUA 1II4A 3VUOA 1I1EA 3AZWA 1BLDA 1E0OA 1HWPB 1W3GA 6I1BA 3FJIA 4L4IA 1EV2A 2XOAA 3MPPG 2QN4A 3RMYA 3BRFA 3FJEA 3FUQA 3BB2A 1IOBA 2P39A 4LO0C 2RQ9A 3O44A 4ISQA 1L2HA 2BFHA 1ISZA 3BRDA 1TIEA 3BAHA 3BAQA 3F1RA 4JKQA 1IJTA 4EB2B 1Q04A 3N7LA 4G6JA 8I1BA 2VUAA 3FJKA 3UDAA 4P0LA 1HWOB 3O4CA 3N0KA 3AKIA 1JT3A 4A7KA 3NBNA 2UUSA 2KLLA 3BAGA 1S0LA 2D24A 4J2XA 4J2YA 3HALA 3AZVA 4XFSA 2Y9WC 3WO3A 4IY8A 3H6RA 3TC2A 1J0SA 4I4YA 3BA4A 3OBTA 2VSEA 5FNWA 5G00A 2ZR1B 3VEQA 3S8JA 3UD7A 1S0EA 2FFUA 4GP0A 3WO2A 7I1BA 4H9WA 3V79C 1YF8B 3OJMA 4X3AA 3VT0A 2MIBA 1DQOA 2X2SA 3N7JA 2VLCA 3ZX7A 1FWUA 3VT2A 3IM6A 4H75A 4ENDA 2R9KB 1D0HA 4I0YA 3CA4A 4OEEA 4UY4A 1HCDA 1FQ9A 1BFBA 5BQUC 4PC4A 1HIBA 3QR5A 2AAIB 1DZDA 1JY0A 4WBCA 1ISWA 1S0FA 3BAOA 1Z2VA 1SR4A 2ZQNA 4A7YA 3BADA 4IQPA 3H6QA 3OGFA 3S8KA 2E4MC 3R4UA 3H6RB 4AN6A 1ILR1 4KEKA 3FJ8A 3OJ2A 5B2HA 4HJJA 3O5WB 4P0KA 2KH2A 3OGGA 4USOA 3O4AA 2F2FA 1WBCA 1TFMB 4Q9PA 4EFQA 1M2TB 2VU9A 1TWMA 4QD2B 1G9AA 3PG0A 4JAWA 2YUGA 2HWMA 4GP3A 1AVWB 4JP0A 4ZLBB 1ONKB 3O4BA 1P63A 9ILBA 1A8DA 1AXMA 4F83A 2DS0A 1W3FA 2L5XA 3POKA 4ZBVB 1JT5A 4IZXA 1NZKA 1RY7A 3R4SA 5EC5A 3ILAA 3SNVA 3CRHA 2AXMA 3JUTA 3BA7A 2KI4A 3W9TA 4D8HA 1RMLA 4IY9A 4GAIA 1XYFA 3Q7WA 3FGMA 4G1RA 3Q7XA 2F2FC 2ZQOA 3P53A 1OQLB 3FJCA 4I4RA 3IM5A 3LLPA 3KMVA 3Q7YA 4LO1C 4R6UB 5BXTA 4GOVA 4ZFWB 3CAHA 2HW9A 4JRAA 1V6WA 4KEIA 3FFZA 2VXTI 4J23B 3N7KA 3D7WB 5DSSB 2GO2A 5F90A 4I7IA 5D63A 4Z9WB 3HOMA 1AVUA 3I2AA 1DFCA 5BP5C 3B9UA 3MALA 1GGPB 1TP0A 4ZFUB 3PMEA 1BASA 2FGFA 1PZZA 1RZOB 3C9ZA 3A23A 4D0TA 1ITBA 1JTCA 4OUJA 4QBCA 1R8OA 4P0JA 3FJFA 4KBBA 2DRZA 2ERMA 4LO7B 5BXRA 4G9NA 4P6AA 3RTJB 3HMYA 4EKXB 21BIA 4F34A 3OBRA 1NUNA 3PHZA 1FWVA 4LO3A 3CRGA 2DRYA 3UD9A 1K5VA 4JQ0A 3FUOA 4USPA 2D1ZA 1K5UA 3IM7A 3FJHA 4KEJA 5GAQA 4YOLA 1BFGA 1N4KA 2Z48A 1G9BA 2FO1A 1S0GA 1T9FA 4QALA 2D43A 1QXMA 3IIRA 1YBIA 3AJ5A 2F8XC 4ZOTA 1FGAA 4X37A 3VT1A 3BTAA 4X38A 3A22A 2NP0A 3VSZA 4I8MA 1KNMA 1TOOA 1CE7B 4LO3C 4OWLA 2K8RA 4H04A 4II0A 4OWKA 1IRPA 4OWJA 1DQGA 3K1XA 1JLXA 1EYLA 1YTOA 4QD2C 4I1BA 4ZKTB 4OEFA 2Y9FA 2KI6B 5D62A 1BLAA 3F62B 4I2SA 3O49A 2Q9XA 3HSMA 2NYYA 3CA3A 1WBAA 1R8NA 1DJSB 3I29B 4L4HA 1TTUA 1FMMS 3ZXGA 4ZA3B 5HPZA 4QBVA 4MZGB 3FJ9A 1QQKA 4Q91A 3BX1C 4ZFYB 3CRIA 4I4XA 3UJ4A 1ISYA 5EG6C 1SR4C 1S0DA 4XFTA 1T4QA 5BVPI 1WD3A 2AQZA 1G9CA 3H6SE 1ISVA 1PC8B 4JKXB 5DZUA 1FV2A 1S0CA 3WINA 5FZZA 3CA0A 4G6MA 4GAFA 3AKHA 4XKIA 1EVTA 2X2TA 3NBEA 2NTDA 3AJ6A 4A7ZA 3V0BB 3AKFA 2NZ9A 4LO0A 1AFCA 2QYIB 2ET2A 4I4VA 1I1BA 3FJBA 5I1BA 5JLVA 1HCEA 1EPWA 5FZUA 3O4DA 1BFCA 2WBCA 1IRAX 3CQAA 1PWAA 4LO2A 5EHAA 3LTQA 3ZC8A 1AVXB 1MC9A 4MZFB 4QO3A 5F8WA 1S0BA 1HKNA 2D22A 2BEBA 2J3PA 2RG9B 4LO8B 3WINC 1RG8A 3WMVA 5DVHA 5FNXA 4LO7C 2ESUA 4I96A 1BA7A 3N7MA 3RMXA 4I37A 2NVHA 2LIEA 1JQZA 3VWCA 1W3AA 4HR6C 4TLPA 1FV3A 2IHOA 4JPZA 1SZ6B 3CA1A 2MLLB 4AN7B 1V6VA 2D7IA 2WRYA 1VCLA 2P23A 3CA6A 2HWAA 4I4UA 2D20A 3I2XA 2Y9GA 4I4QA 4IHZA 4LO2C 5D61A 41BIA 2VSAA 1DFQA 3O4OA 3A07A 4D0ZA 1BFFA 1Q03A 1YYNA 3UD8A 3RSJA 1PUUB 3NBDA 1HWNB 1IT0A 1FN0A 3A21A 4I4PA 3E8LC 3ZC9A 3OJVA 4I4OA 1Z4SA 1Q1UA 4I1EA 5E24E 4IONA 3AH1A 3BAVA 3QYDA 1DIWA 3V0AA 3T8SA 2GZBA 3NBCA 1M16A 2HZ9A 31BIA 5BQUA 4MZHA 1CVSA 2D44A 1JLYA 2D23A 3AH4A 3FJDA 5DUYA 1DLLA 4Q9GA 3RTIB 1TWEA 4EFPA 4OEGA 2IWTB 4I4SA 4Z8SB 1PUMB 2NM1A 4QKRA 4DENA 2MC2A 1DZCA 1MD6A 4ISRA 2E4MA 3HBWA 2K4AB 2LIQA 2NS2A 1XG6A 5BXSA 3ZXDA 3PUBA 1JT7A 5JMCA 2BEAA 1FMZA 3BAUA 3UJ0A 2Q3NB 5F8YA 4QC4A 4EEEB 4FVVA 3CU1B 2K43A 3V0BA 3WMUA 4IYBA 5F8SA 1Z0HA 2VXRA 4X39A 3AH2A 2AFGA 4HA2A 3O3QA 1ISXA 1XZZA 3VSFA 4DCKC 2M49A 2KKIA 4EFRA 1IILA 2FFVA 3V0AB 3BA5A 4J2SA 2Y9XE 2FDBM 4CJMA 1IHKA 4ZGRB 3P6IA 2DREA 2RSTA 3JRRA 3FJJA 5FZYA 1YXWA 3BRGC 1UPSA 3NJ5A 1G9DA 5BOWA 1QQLA 4GOYA 2Z49A 1V6UA 5BXPA 1G82A 4LO1A 1WD4A 1BARA 1F31A
chains in the Genus database with same CATH topology
4G9MA 1JT4A 4OW4A 1ABRB 3FJAA 1AF9A 4IZEA 3IAGC 3CA5A 4I6IA 3EF2A 4DEPA 3HN1A 2D7RA 4FGFA 4QKSA 1AVAC 1V6XA 1HWMB 4I3NA 3AKGA 4J2KA 3WA1A 5BP5A 2I1BA 4KC3A 3P6JA 3WO4A 1XHBA 4XFUA 1II4A 3VUOA 1I1EA 3AZWA 1BLDA 1E0OA 1HWPB 1W3GA 6I1BA 3FJIA 4L4IA 1EV2A 2XOAA 3MPPG 2QN4A 3RMYA 3BRFA 3FJEA 3FUQA 3BB2A 1IOBA 2P39A 4LO0C 2RQ9A 3O44A 4ISQA 1L2HA 2BFHA 1ISZA 3BRDA 1TIEA 3BAHA 3BAQA 3F1RA 4JKQA 1IJTA 4EB2B 1Q04A 3N7LA 4G6JA 8I1BA 2VUAA 3FJKA 3UDAA 4P0LA 1HWOB 3O4CA 3N0KA 3AKIA 1JT3A 4A7KA 3NBNA 2UUSA 2KLLA 3BAGA 1S0LA 2D24A 4J2XA 4J2YA 3HALA 3AZVA 4XFSA 2Y9WC 3WO3A 4IY8A 3H6RA 3TC2A 1J0SA 4I4YA 3BA4A 3OBTA 2VSEA 5FNWA 5G00A 2ZR1B 3VEQA 3S8JA 3UD7A 1S0EA 2FFUA 4GP0A 3WO2A 7I1BA 4H9WA 3V79C 1YF8B 3OJMA 4X3AA 3VT0A 2MIBA 1DQOA 2X2SA 3N7JA 2VLCA 3ZX7A 1FWUA 3VT2A 3IM6A 4H75A 4ENDA 2R9KB 1D0HA 4I0YA 3CA4A 4OEEA 4UY4A 1HCDA 1FQ9A 1BFBA 5BQUC 4PC4A 1HIBA 3QR5A 2AAIB 1DZDA 1JY0A 4WBCA 1ISWA 1S0FA 3BAOA 1Z2VA 1SR4A 2ZQNA 4A7YA 3BADA 4IQPA 3H6QA 3OGFA 3S8KA 2E4MC 3R4UA 3H6RB 4AN6A 1ILR1 4KEKA 3FJ8A 3OJ2A 5B2HA 4HJJA 3O5WB 4P0KA 2KH2A 3OGGA 4USOA 3O4AA 2F2FA 1WBCA 1TFMB 4Q9PA 4EFQA 1M2TB 2VU9A 1TWMA 4QD2B 1G9AA 3PG0A 4JAWA 2YUGA 2HWMA 4GP3A 1AVWB 4JP0A 4ZLBB 1ONKB 3O4BA 1P63A 9ILBA 1A8DA 1AXMA 4F83A 2DS0A 1W3FA 2L5XA 3POKA 4ZBVB 1JT5A 4IZXA 1NZKA 1RY7A 3R4SA 5EC5A 3ILAA 3SNVA 3CRHA 2AXMA 3JUTA 3BA7A 2KI4A 3W9TA 4D8HA 1RMLA 4IY9A 4GAIA 1XYFA 3Q7WA 3FGMA 4G1RA 3Q7XA 2F2FC 2ZQOA 3P53A 1OQLB 3FJCA 4I4RA 3IM5A 3LLPA 3KMVA 3Q7YA 4LO1C 4R6UB 5BXTA 4GOVA 4ZFWB 3CAHA 2HW9A 4JRAA 1V6WA 4KEIA 3FFZA 2VXTI 4J23B 3N7KA 3D7WB 5DSSB 2GO2A 5F90A 4I7IA 5D63A 4Z9WB 3HOMA 1AVUA 3I2AA 1DFCA 5BP5C 3B9UA 3MALA 1GGPB 1TP0A 4ZFUB 3PMEA 1BASA 2FGFA 1PZZA 1RZOB 3C9ZA 3A23A 4D0TA 1ITBA 1JTCA 4OUJA 4QBCA 1R8OA 4P0JA 3FJFA 4KBBA 2DRZA 2ERMA 4LO7B 5BXRA 4G9NA 4P6AA 3RTJB 3HMYA 4EKXB 21BIA 4F34A 3OBRA 1NUNA 3PHZA 1FWVA 4LO3A 3CRGA 2DRYA 3UD9A 1K5VA 4JQ0A 3FUOA 4USPA 2D1ZA 1K5UA 3IM7A 3FJHA 4KEJA 5GAQA 4YOLA 1BFGA 1N4KA 2Z48A 1G9BA 2FO1A 1S0GA 1T9FA 4QALA 2D43A 1QXMA 3IIRA 1YBIA 3AJ5A 2F8XC 4ZOTA 1FGAA 4X37A 3VT1A 3BTAA 4X38A 3A22A 2NP0A 3VSZA 4I8MA 1KNMA 1TOOA 1CE7B 4LO3C 4OWLA 2K8RA 4H04A 4II0A 4OWKA 1IRPA 4OWJA 1DQGA 3K1XA 1JLXA 1EYLA 1YTOA 4QD2C 4I1BA 4ZKTB 4OEFA 2Y9FA 2KI6B 5D62A 1BLAA 3F62B 4I2SA 3O49A 2Q9XA 3HSMA 2NYYA 3CA3A 1WBAA 1R8NA 1DJSB 3I29B 4L4HA 1TTUA 1FMMS 3ZXGA 4ZA3B 5HPZA 4QBVA 4MZGB 3FJ9A 1QQKA 4Q91A 3BX1C 4ZFYB 3CRIA 4I4XA 3UJ4A 1ISYA 5EG6C 1SR4C 1S0DA 4XFTA 1T4QA 5BVPI 1WD3A 2AQZA 1G9CA 3H6SE 1ISVA 1PC8B 4JKXB 5DZUA 1FV2A 1S0CA 3WINA 5FZZA 3CA0A 4G6MA 4GAFA 3AKHA 4XKIA 1EVTA 2X2TA 3NBEA 2NTDA 3AJ6A 4A7ZA 3V0BB 3AKFA 2NZ9A 4LO0A 1AFCA 2QYIB 2ET2A 4I4VA 1I1BA 3FJBA 5I1BA 5JLVA 1HCEA 1EPWA 5FZUA 3O4DA 1BFCA 2WBCA 1IRAX 3CQAA 1PWAA 4LO2A 5EHAA 3LTQA 3ZC8A 1AVXB 1MC9A 4MZFB 4QO3A 5F8WA 1S0BA 1HKNA 2D22A 2BEBA 2J3PA 2RG9B 4LO8B 3WINC 1RG8A 3WMVA 5DVHA 5FNXA 4LO7C 2ESUA 4I96A 1BA7A 3N7MA 3RMXA 4I37A 2NVHA 2LIEA 1JQZA 3VWCA 1W3AA 4HR6C 4TLPA 1FV3A 2IHOA 4JPZA 1SZ6B 3CA1A 2MLLB 4AN7B 1V6VA 2D7IA 2WRYA 1VCLA 2P23A 3CA6A 2HWAA 4I4UA 2D20A 3I2XA 2Y9GA 4I4QA 4IHZA 4LO2C 5D61A 41BIA 2VSAA 1DFQA 3O4OA 3A07A 4D0ZA 1BFFA 1Q03A 1YYNA 3UD8A 3RSJA 1PUUB 3NBDA 1HWNB 1IT0A 1FN0A 3A21A 4I4PA 3E8LC 3ZC9A 3OJVA 4I4OA 1Z4SA 1Q1UA 4I1EA 5E24E 4IONA 3AH1A 3BAVA 3QYDA 1DIWA 3V0AA 3T8SA 2GZBA 3NBCA 1M16A 2HZ9A 31BIA 5BQUA 4MZHA 1CVSA 2D44A 1JLYA 2D23A 3AH4A 3FJDA 5DUYA 1DLLA 4Q9GA 3RTIB 1TWEA 4EFPA 4OEGA 2IWTB 4I4SA 4Z8SB 1PUMB 2NM1A 4QKRA 4DENA 2MC2A 1DZCA 1MD6A 4ISRA 2E4MA 3HBWA 2K4AB 2LIQA 2NS2A 1XG6A 5BXSA 3ZXDA 3PUBA 1JT7A 5JMCA 2BEAA 1FMZA 3BAUA 3UJ0A 2Q3NB 5F8YA 4QC4A 4EEEB 4FVVA 3CU1B 2K43A 3V0BA 3WMUA 4IYBA 5F8SA 1Z0HA 2VXRA 4X39A 3AH2A 2AFGA 4HA2A 3O3QA 1ISXA 1XZZA 3VSFA 4DCKC 2M49A 2KKIA 4EFRA 1IILA 2FFVA 3V0AB 3BA5A 4J2SA 2Y9XE 2FDBM 4CJMA 1IHKA 4ZGRB 3P6IA 2DREA 2RSTA 3JRRA 3FJJA 5FZYA 1YXWA 3BRGC 1UPSA 3NJ5A 1G9DA 5BOWA 1QQLA 4GOYA 2Z49A 1V6UA 5BXPA 1G82A 4LO1A 1WD4A 1BARA 1F31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G9M A;  1JT4 A;  4OW4 A;  1ABR B;  3FJA A;  1AF9 A;  4IZE A;  3IAG C;  3CA5 A;  4I6I A;  3EF2 A;  4DEP A;  3HN1 A;  2D7R A;  4FGF A;  4QKS A;  1AVA C;  1V6X A;  1HWM B;  4I3N A;  3AKG A;  4J2K A;  3WA1 A;  5BP5 A;  2I1B A;  4KC3 A;  3P6J A;  3WO4 A;  1XHB A;  4XFU A;  1II4 A;  3VUO A;  1I1E A;  3AZW A;  1BLD A;  1E0O A;  1HWP B;  1W3G A;  6I1B A;  3FJI A;  4L4I A;  1EV2 A;  2XOA A;  3MPP G;  2QN4 A;  3RMY A;  3BRF A;  3FJE A;  3FUQ A;  3BB2 A;  1IOB A;  2P39 A;  4LO0 C;  2RQ9 A;  3O44 A;  4ISQ A;  1L2H A;  2BFH A;  1ISZ A;  3BRD A;  1TIE A;  3BAH A;  3BAQ A;  3F1R A;  4JKQ A;  1IJT A;  4EB2 B;  1Q04 A;  3N7L A;  4G6J A;  8I1B A;  2VUA A;  3FJK A;  3UDA A;  4P0L A;  1HWO B;  3O4C A;  3N0K A;  3AKI A;  1JT3 A;  4A7K A;  3NBN A;  2UUS A;  2KLL A;  3BAG A;  1S0L A;  2D24 A;  4J2X A;  4J2Y A;  3HAL A;  3AZV A;  4XFS A;  2Y9W C;  3WO3 A;  4IY8 A;  3H6R A;  3TC2 A;  1J0S A;  4I4Y A;  3BA4 A;  3OBT A;  2VSE A;  5FNW A;  5G00 A;  2ZR1 B;  3VEQ A;  3S8J A;  3UD7 A;  1S0E A;  2FFU A;  4GP0 A;  3WO2 A;  7I1B A;  4H9W A;  3V79 C;  1YF8 B;  3OJM A;  4X3A A;  3VT0 A;  2MIB A;  1DQO A;  2X2S A;  3N7J A;  2VLC A;  3ZX7 A;  1FWU A;  3VT2 A;  3IM6 A;  4END A;  2R9K B;  1D0H A;  4I0Y A;  3CA4 A;  4OEE A;  1HCD A;  1FQ9 A;  1BFB A;  5BQU C;  4PC4 A;  1HIB A;  3QR5 A;  2AAI B;  1DZD A;  1JY0 A;  4WBC A;  1ISW A;  1S0F A;  3BAO A;  1Z2V A;  1SR4 A;  2ZQN A;  4A7Y A;  3BAD A;  4IQP A;  3H6Q A;  3OGF A;  3S8K A;  2E4M C;  3R4U A;  3H6R B;  4AN6 A;  1ILR 1;  4KEK A;  3FJ8 A;  3OJ2 A;  5B2H A;  4HJJ A;  3O5W B;  4P0K A;  2KH2 A;  3OGG A;  4USO A;  3O4A A;  2F2F A;  1WBC A;  1TFM B;  4Q9P A;  4EFQ A;  1M2T B;  2VU9 A;  1TWM A;  4QD2 B;  1G9A A;  3PG0 A;  4JAW A;  2YUG A;  2HWM A;  4GP3 A;  1AVW B;  4JP0 A;  4ZLB B;  1ONK B;  3O4B A;  1P63 A;  9ILB A;  1A8D A;  1AXM A;  4F83 A;  2DS0 A;  1W3F A;  2L5X A;  3POK A;  4ZBV B;  1JT5 A;  4IZX A;  1NZK A;  1RY7 A;  3R4S A;  5EC5 A;  3ILA A;  3SNV A;  3CRH A;  2AXM A;  3JUT A;  3BA7 A;  2KI4 A;  3W9T A;  4D8H A;  1RML A;  4IY9 A;  4GAI A;  1XYF A;  3Q7W A;  3FGM A;  4G1R A;  3Q7X A;  2F2F C;  2ZQO A;  3P53 A;  1OQL B;  3FJC A;  4I4R A;  3IM5 A;  3LLP A;  3KMV A;  3Q7Y A;  4LO1 C;  4R6U B;  5BXT A;  4GOV A;  4ZFW B;  3CAH A;  2HW9 A;  4JRA A;  1V6W A;  4KEI A;  3FFZ A;  2VXT I;  4J23 B;  3N7K A;  3D7W B;  5DSS B;  2GO2 A;  5F90 A;  4I7I A;  5D63 A;  4Z9W B;  3HOM A;  1AVU A;  3I2A A;  1DFC A;  5BP5 C;  3B9U A;  3MAL A;  1GGP B;  1TP0 A;  4ZFU B;  3PME A;  1BAS A;  2FGF A;  1PZZ A;  1RZO B;  3C9Z A;  3A23 A;  4D0T A;  1ITB A;  1JTC A;  4OUJ A;  4QBC A;  1R8O A;  4P0J A;  3FJF A;  4KBB A;  2DRZ A;  2ERM A;  4LO7 B;  5BXR A;  4G9N A;  4P6A A;  3RTJ B;  3HMY A;  4EKX B;  21BI A;  4F34 A;  3OBR A;  1NUN A;  3PHZ A;  1FWV A;  4LO3 A;  3CRG A;  2DRY A;  3UD9 A;  1K5V A;  4JQ0 A;  3FUO A;  4USP A;  2D1Z A;  1K5U A;  3IM7 A;  3FJH A;  4KEJ A;  5GAQ A;  4YOL A;  1BFG A;  1N4K A;  2Z48 A;  1G9B A;  2FO1 A;  1S0G A;  1T9F A;  4QAL A;  2D43 A;  1QXM A;  3IIR A;  1YBI A;  3AJ5 A;  2F8X C;  4ZOT A;  1FGA A;  4X37 A;  3VT1 A;  3BTA A;  4X38 A;  3A22 A;  2NP0 A;  3VSZ A;  4I8M A;  1KNM A;  1TOO A;  1CE7 B;  4LO3 C;  4OWL A;  2K8R A;  4H04 A;  4II0 A;  4OWK A;  1IRP A;  4OWJ A;  1DQG A;  3K1X A;  1JLX A;  1EYL A;  1YTO A;  4QD2 C;  4I1B A;  4ZKT B;  4OEF A;  2Y9F A;  2KI6 B;  5D62 A;  1BLA A;  3F62 B;  4I2S A;  3O49 A;  2Q9X A;  3HSM A;  2NYY A;  3CA3 A;  1WBA A;  1R8N A;  1DJS B;  3I29 B;  4L4H A;  1TTU A;  1FMM S;  3ZXG A;  4ZA3 B;  5HPZ A;  4QBV A;  3FJ9 A;  1QQK A;  4Q91 A;  3BX1 C;  4ZFY B;  3CRI A;  4I4X A;  3UJ4 A;  1ISY A;  5EG6 C;  1SR4 C;  1S0D A;  4XFT A;  1T4Q A;  5BVP I;  1WD3 A;  2AQZ A;  1G9C A;  3H6S E;  1ISV A;  1PC8 B;  4JKX B;  5DZU A;  1FV2 A;  1S0C A;  3WIN A;  5FZZ A;  3CA0 A;  4G6M A;  4GAF A;  3AKH A;  4XKI A;  1EVT A;  2X2T A;  3NBE A;  2NTD A;  3AJ6 A;  4A7Z A;  3V0B B;  3AKF A;  2NZ9 A;  4LO0 A;  1AFC A;  2QYI B;  2ET2 A;  4I4V A;  1I1B A;  3FJB A;  5I1B A;  5JLV A;  1HCE A;  1EPW A;  5FZU A;  3O4D A;  1BFC A;  2WBC A;  1IRA X;  3CQA A;  1PWA A;  4LO2 A;  5EHA A;  3LTQ A;  3ZC8 A;  1AVX B;  1MC9 A;  4QO3 A;  5F8W A;  1S0B A;  1HKN A;  2D22 A;  2BEB A;  2J3P A;  2RG9 B;  4LO8 B;  3WIN C;  1RG8 A;  3WMV A;  5DVH A;  5FNX A;  4LO7 C;  2ESU A;  4I96 A;  1BA7 A;  3N7M A;  3RMX A;  4I37 A;  2NVH A;  2LIE A;  1JQZ A;  3VWC A;  1W3A A;  4HR6 C;  4TLP A;  1FV3 A;  2IHO A;  4JPZ A;  1SZ6 B;  3CA1 A;  2MLL B;  4AN7 B;  1V6V A;  2D7I A;  2WRY A;  1VCL A;  2P23 A;  3CA6 A;  2HWA A;  4I4U A;  2D20 A;  3I2X A;  2Y9G A;  4I4Q A;  4IHZ A;  4LO2 C;  5D61 A;  41BI A;  2VSA A;  1DFQ A;  3O4O A;  3A07 A;  4D0Z A;  1BFF A;  1Q03 A;  1YYN A;  3UD8 A;  3RSJ A;  1PUU B;  3NBD A;  1HWN B;  1IT0 A;  1FN0 A;  3A21 A;  4I4P A;  3E8L C;  3ZC9 A;  3OJV A;  4I4O A;  1Z4S A;  1Q1U A;  4I1E A;  5E24 E;  4ION A;  3AH1 A;  3BAV A;  3QYD A;  1DIW A;  3V0A A;  3T8S A;  2GZB A;  3NBC A;  1M16 A;  2HZ9 A;  31BI A;  5BQU A;  1CVS A;  2D44 A;  1JLY A;  2D23 A;  3AH4 A;  3FJD A;  5DUY A;  1DLL A;  4Q9G A;  3RTI B;  1TWE A;  4EFP A;  4OEG A;  2IWT B;  4I4S A;  4Z8S B;  1PUM B;  2NM1 A;  4QKR A;  4DEN A;  2MC2 A;  1DZC A;  1MD6 A;  4ISR A;  2E4M A;  3HBW A;  2K4A B;  2LIQ A;  1XG6 A;  5BXS A;  3ZXD A;  3PUB A;  1JT7 A;  5JMC A;  2BEA A;  1FMZ A;  3BAU A;  3UJ0 A;  2Q3N B;  5F8Y A;  4QC4 A;  4EEE B;  4FVV A;  3CU1 B;  2K43 A;  3V0B A;  3WMU A;  4IYB A;  5F8S A;  1Z0H A;  2VXR A;  4X39 A;  3AH2 A;  2AFG A;  4HA2 A;  3O3Q A;  1ISX A;  1XZZ A;  3VSF A;  4DCK C;  2M49 A;  2KKI A;  4EFR A;  1IIL A;  2FFV A;  3V0A B;  3BA5 A;  4J2S A;  2Y9X E;  2FDB M;  4CJM A;  1IHK A;  4ZGR B;  3P6I A;  2DRE A;  2RST A;  3JRR A;  3FJJ A;  5FZY A;  1YXW A;  3BRG C;  1UPS A;  3NJ5 A;  1G9D A;  5BOW A;  1QQL A;  4GOY A;  2Z49 A;  1V6U A;  5BXP A;  1G82 A;  4LO1 A;  1WD4 A;  1BAR A;  1F31 A; 
#chains in the Genus database with same CATH topology
 4G9M A;  1JT4 A;  4OW4 A;  1ABR B;  3FJA A;  1AF9 A;  4IZE A;  3IAG C;  3CA5 A;  4I6I A;  3EF2 A;  4DEP A;  3HN1 A;  2D7R A;  4FGF A;  4QKS A;  1AVA C;  1V6X A;  1HWM B;  4I3N A;  3AKG A;  4J2K A;  3WA1 A;  5BP5 A;  2I1B A;  4KC3 A;  3P6J A;  3WO4 A;  1XHB A;  4XFU A;  1II4 A;  3VUO A;  1I1E A;  3AZW A;  1BLD A;  1E0O A;  1HWP B;  1W3G A;  6I1B A;  3FJI A;  4L4I A;  1EV2 A;  2XOA A;  3MPP G;  2QN4 A;  3RMY A;  3BRF A;  3FJE A;  3FUQ A;  3BB2 A;  1IOB A;  2P39 A;  4LO0 C;  2RQ9 A;  3O44 A;  4ISQ A;  1L2H A;  2BFH A;  1ISZ A;  3BRD A;  1TIE A;  3BAH A;  3BAQ A;  3F1R A;  4JKQ A;  1IJT A;  4EB2 B;  1Q04 A;  3N7L A;  4G6J A;  8I1B A;  2VUA A;  3FJK A;  3UDA A;  4P0L A;  1HWO B;  3O4C A;  3N0K A;  3AKI A;  1JT3 A;  4A7K A;  3NBN A;  2UUS A;  2KLL A;  3BAG A;  1S0L A;  2D24 A;  4J2X A;  4J2Y A;  3HAL A;  3AZV A;  4XFS A;  2Y9W C;  3WO3 A;  4IY8 A;  3H6R A;  3TC2 A;  1J0S A;  4I4Y A;  3BA4 A;  3OBT A;  2VSE A;  5FNW A;  5G00 A;  2ZR1 B;  3VEQ A;  3S8J A;  3UD7 A;  1S0E A;  2FFU A;  4GP0 A;  3WO2 A;  7I1B A;  4H9W A;  3V79 C;  1YF8 B;  3OJM A;  4X3A A;  3VT0 A;  2MIB A;  1DQO A;  2X2S A;  3N7J A;  2VLC A;  3ZX7 A;  1FWU A;  3VT2 A;  3IM6 A;  4H75 A;  4END A;  2R9K B;  1D0H A;  4I0Y A;  3CA4 A;  4OEE A;  4UY4 A;  1HCD A;  1FQ9 A;  1BFB A;  5BQU C;  4PC4 A;  1HIB A;  3QR5 A;  2AAI B;  1DZD A;  1JY0 A;  4WBC A;  1ISW A;  1S0F A;  3BAO A;  1Z2V A;  1SR4 A;  2ZQN A;  4A7Y A;  3BAD A;  4IQP A;  3H6Q A;  3OGF A;  3S8K A;  2E4M C;  3R4U A;  3H6R B;  4AN6 A;  1ILR 1;  4KEK A;  3FJ8 A;  3OJ2 A;  5B2H A;  4HJJ A;  3O5W B;  4P0K A;  2KH2 A;  3OGG A;  4USO A;  3O4A A;  2F2F A;  1WBC A;  1TFM B;  4Q9P A;  4EFQ A;  1M2T B;  2VU9 A;  1TWM A;  4QD2 B;  1G9A A;  3PG0 A;  4JAW A;  2YUG A;  2HWM A;  4GP3 A;  1AVW B;  4JP0 A;  4ZLB B;  1ONK B;  3O4B A;  1P63 A;  9ILB A;  1A8D A;  1AXM A;  4F83 A;  2DS0 A;  1W3F A;  2L5X A;  3POK A;  4ZBV B;  1JT5 A;  4IZX A;  1NZK A;  1RY7 A;  3R4S A;  5EC5 A;  3ILA A;  3SNV A;  3CRH A;  2AXM A;  3JUT A;  3BA7 A;  2KI4 A;  3W9T A;  4D8H A;  1RML A;  4IY9 A;  4GAI A;  1XYF A;  3Q7W A;  3FGM A;  4G1R A;  3Q7X A;  2F2F C;  2ZQO A;  3P53 A;  1OQL B;  3FJC A;  4I4R A;  3IM5 A;  3LLP A;  3KMV A;  3Q7Y A;  4LO1 C;  4R6U B;  5BXT A;  4GOV A;  4ZFW B;  3CAH A;  2HW9 A;  4JRA A;  1V6W A;  4KEI A;  3FFZ A;  2VXT I;  4J23 B;  3N7K A;  3D7W B;  5DSS B;  2GO2 A;  5F90 A;  4I7I A;  5D63 A;  4Z9W B;  3HOM A;  1AVU A;  3I2A A;  1DFC A;  5BP5 C;  3B9U A;  3MAL A;  1GGP B;  1TP0 A;  4ZFU B;  3PME A;  1BAS A;  2FGF A;  1PZZ A;  1RZO B;  3C9Z A;  3A23 A;  4D0T A;  1ITB A;  1JTC A;  4OUJ A;  4QBC A;  1R8O A;  4P0J A;  3FJF A;  4KBB A;  2DRZ A;  2ERM A;  4LO7 B;  5BXR A;  4G9N A;  4P6A A;  3RTJ B;  3HMY A;  4EKX B;  21BI A;  4F34 A;  3OBR A;  1NUN A;  3PHZ A;  1FWV A;  4LO3 A;  3CRG A;  2DRY A;  3UD9 A;  1K5V A;  4JQ0 A;  3FUO A;  4USP A;  2D1Z A;  1K5U A;  3IM7 A;  3FJH A;  4KEJ A;  5GAQ A;  4YOL A;  1BFG A;  1N4K A;  2Z48 A;  1G9B A;  2FO1 A;  1S0G A;  1T9F A;  4QAL A;  2D43 A;  1QXM A;  3IIR A;  1YBI A;  3AJ5 A;  2F8X C;  4ZOT A;  1FGA A;  4X37 A;  3VT1 A;  3BTA A;  4X38 A;  3A22 A;  2NP0 A;  3VSZ A;  4I8M A;  1KNM A;  1TOO A;  1CE7 B;  4LO3 C;  4OWL A;  2K8R A;  4H04 A;  4II0 A;  4OWK A;  1IRP A;  4OWJ A;  1DQG A;  3K1X A;  1JLX A;  1EYL A;  1YTO A;  4QD2 C;  4I1B A;  4ZKT B;  4OEF A;  2Y9F A;  2KI6 B;  5D62 A;  1BLA A;  3F62 B;  4I2S A;  3O49 A;  2Q9X A;  3HSM A;  2NYY A;  3CA3 A;  1WBA A;  1R8N A;  1DJS B;  3I29 B;  4L4H A;  1TTU A;  1FMM S;  3ZXG A;  4ZA3 B;  5HPZ A;  4QBV A;  4MZG B;  3FJ9 A;  1QQK A;  4Q91 A;  3BX1 C;  4ZFY B;  3CRI A;  4I4X A;  3UJ4 A;  1ISY A;  5EG6 C;  1SR4 C;  1S0D A;  4XFT A;  1T4Q A;  5BVP I;  1WD3 A;  2AQZ A;  1G9C A;  3H6S E;  1ISV A;  1PC8 B;  4JKX B;  5DZU A;  1FV2 A;  1S0C A;  3WIN A;  5FZZ A;  3CA0 A;  4G6M A;  4GAF A;  3AKH A;  4XKI A;  1EVT A;  2X2T A;  3NBE A;  2NTD A;  3AJ6 A;  4A7Z A;  3V0B B;  3AKF A;  2NZ9 A;  4LO0 A;  1AFC A;  2QYI B;  2ET2 A;  4I4V A;  1I1B A;  3FJB A;  5I1B A;  5JLV A;  1HCE A;  1EPW A;  5FZU A;  3O4D A;  1BFC A;  2WBC A;  1IRA X;  3CQA A;  1PWA A;  4LO2 A;  5EHA A;  3LTQ A;  3ZC8 A;  1AVX B;  1MC9 A;  4MZF B;  4QO3 A;  5F8W A;  1S0B A;  1HKN A;  2D22 A;  2BEB A;  2J3P A;  2RG9 B;  4LO8 B;  3WIN C;  1RG8 A;  3WMV A;  5DVH A;  5FNX A;  4LO7 C;  2ESU A;  4I96 A;  1BA7 A;  3N7M A;  3RMX A;  4I37 A;  2NVH A;  2LIE A;  1JQZ A;  3VWC A;  1W3A A;  4HR6 C;  4TLP A;  1FV3 A;  2IHO A;  4JPZ A;  1SZ6 B;  3CA1 A;  2MLL B;  4AN7 B;  1V6V A;  2D7I A;  2WRY A;  1VCL A;  2P23 A;  3CA6 A;  2HWA A;  4I4U A;  2D20 A;  3I2X A;  2Y9G A;  4I4Q A;  4IHZ A;  4LO2 C;  5D61 A;  41BI A;  2VSA A;  1DFQ A;  3O4O A;  3A07 A;  4D0Z A;  1BFF A;  1Q03 A;  1YYN A;  3UD8 A;  3RSJ A;  1PUU B;  3NBD A;  1HWN B;  1IT0 A;  1FN0 A;  3A21 A;  4I4P A;  3E8L C;  3ZC9 A;  3OJV A;  4I4O A;  1Z4S A;  1Q1U A;  4I1E A;  5E24 E;  4ION A;  3AH1 A;  3BAV A;  3QYD A;  1DIW A;  3V0A A;  3T8S A;  2GZB A;  3NBC A;  1M16 A;  2HZ9 A;  31BI A;  5BQU A;  4MZH A;  1CVS A;  2D44 A;  1JLY A;  2D23 A;  3AH4 A;  3FJD A;  5DUY A;  1DLL A;  4Q9G A;  3RTI B;  1TWE A;  4EFP A;  4OEG A;  2IWT B;  4I4S A;  4Z8S B;  1PUM B;  2NM1 A;  4QKR A;  4DEN A;  2MC2 A;  1DZC A;  1MD6 A;  4ISR A;  2E4M A;  3HBW A;  2K4A B;  2LIQ A;  2NS2 A;  1XG6 A;  5BXS A;  3ZXD A;  3PUB A;  1JT7 A;  5JMC A;  2BEA A;  1FMZ A;  3BAU A;  3UJ0 A;  2Q3N B;  5F8Y A;  4QC4 A;  4EEE B;  4FVV A;  3CU1 B;  2K43 A;  3V0B A;  3WMU A;  4IYB A;  5F8S A;  1Z0H A;  2VXR A;  4X39 A;  3AH2 A;  2AFG A;  4HA2 A;  3O3Q A;  1ISX A;  1XZZ A;  3VSF A;  4DCK C;  2M49 A;  2KKI A;  4EFR A;  1IIL A;  2FFV A;  3V0A B;  3BA5 A;  4J2S A;  2Y9X E;  2FDB M;  4CJM A;  1IHK A;  4ZGR B;  3P6I A;  2DRE A;  2RST A;  3JRR A;  3FJJ A;  5FZY A;  1YXW A;  3BRG C;  1UPS A;  3NJ5 A;  1G9D A;  5BOW A;  1QQL A;  4GOY A;  2Z49 A;  1V6U A;  5BXP A;  1G82 A;  4LO1 A;  1WD4 A;  1BAR A;  1F31 A; 
#chains in the Genus database with same CATH homology
 4G9M A;  1JT4 A;  4OW4 A;  1ABR B;  3FJA A;  1AF9 A;  4IZE A;  3IAG C;  3CA5 A;  4I6I A;  3EF2 A;  4DEP A;  3HN1 A;  2D7R A;  4FGF A;  4QKS A;  1AVA C;  1V6X A;  1HWM B;  4I3N A;  3AKG A;  4J2K A;  3WA1 A;  5BP5 A;  2I1B A;  4KC3 A;  3P6J A;  3WO4 A;  1XHB A;  4XFU A;  1II4 A;  3VUO A;  1I1E A;  3AZW A;  1BLD A;  1E0O A;  1HWP B;  1W3G A;  6I1B A;  3FJI A;  4L4I A;  1EV2 A;  2XOA A;  3MPP G;  2QN4 A;  3RMY A;  3BRF A;  3FJE A;  3FUQ A;  3BB2 A;  1IOB A;  2P39 A;  4LO0 C;  2RQ9 A;  3O44 A;  4ISQ A;  1L2H A;  2BFH A;  1ISZ A;  3BRD A;  1TIE A;  3BAH A;  3BAQ A;  3F1R A;  4JKQ A;  1IJT A;  4EB2 B;  1Q04 A;  3N7L A;  4G6J A;  8I1B A;  2VUA A;  3FJK A;  3UDA A;  4P0L A;  1HWO B;  3O4C A;  3N0K A;  3AKI A;  1JT3 A;  4A7K A;  3NBN A;  2UUS A;  2KLL A;  3BAG A;  1S0L A;  2D24 A;  4J2X A;  4J2Y A;  3HAL A;  3AZV A;  4XFS A;  2Y9W C;  3WO3 A;  4IY8 A;  3H6R A;  3TC2 A;  1J0S A;  4I4Y A;  3BA4 A;  3OBT A;  2VSE A;  5FNW A;  5G00 A;  2ZR1 B;  3VEQ A;  3S8J A;  3UD7 A;  1S0E A;  2FFU A;  4GP0 A;  3WO2 A;  7I1B A;  4H9W A;  3V79 C;  1YF8 B;  3OJM A;  4X3A A;  3VT0 A;  2MIB A;  1DQO A;  2X2S A;  3N7J A;  2VLC A;  3ZX7 A;  1FWU A;  3VT2 A;  3IM6 A;  4H75 A;  4END A;  2R9K B;  1D0H A;  4I0Y A;  3CA4 A;  4OEE A;  4UY4 A;  1HCD A;  1FQ9 A;  1BFB A;  5BQU C;  4PC4 A;  1HIB A;  3QR5 A;  2AAI B;  1DZD A;  1JY0 A;  4WBC A;  1ISW A;  1S0F A;  3BAO A;  1Z2V A;  1SR4 A;  2ZQN A;  4A7Y A;  3BAD A;  4IQP A;  3H6Q A;  3OGF A;  3S8K A;  2E4M C;  3R4U A;  3H6R B;  4AN6 A;  1ILR 1;  4KEK A;  3FJ8 A;  3OJ2 A;  5B2H A;  4HJJ A;  3O5W B;  4P0K A;  2KH2 A;  3OGG A;  4USO A;  3O4A A;  2F2F A;  1WBC A;  1TFM B;  4Q9P A;  4EFQ A;  1M2T B;  2VU9 A;  1TWM A;  4QD2 B;  1G9A A;  3PG0 A;  4JAW A;  2YUG A;  2HWM A;  4GP3 A;  1AVW B;  4JP0 A;  4ZLB B;  1ONK B;  3O4B A;  1P63 A;  9ILB A;  1A8D A;  1AXM A;  4F83 A;  2DS0 A;  1W3F A;  2L5X A;  3POK A;  4ZBV B;  1JT5 A;  4IZX A;  1NZK A;  1RY7 A;  3R4S A;  5EC5 A;  3ILA A;  3SNV A;  3CRH A;  2AXM A;  3JUT A;  3BA7 A;  2KI4 A;  3W9T A;  4D8H A;  1RML A;  4IY9 A;  4GAI A;  1XYF A;  3Q7W A;  3FGM A;  4G1R A;  3Q7X A;  2F2F C;  2ZQO A;  3P53 A;  1OQL B;  3FJC A;  4I4R A;  3IM5 A;  3LLP A;  3KMV A;  3Q7Y A;  4LO1 C;  4R6U B;  5BXT A;  4GOV A;  4ZFW B;  3CAH A;  2HW9 A;  4JRA A;  1V6W A;  4KEI A;  3FFZ A;  2VXT I;  4J23 B;  3N7K A;  3D7W B;  5DSS B;  2GO2 A;  5F90 A;  4I7I A;  5D63 A;  4Z9W B;  3HOM A;  1AVU A;  3I2A A;  1DFC A;  5BP5 C;  3B9U A;  3MAL A;  1GGP B;  1TP0 A;  4ZFU B;  3PME A;  1BAS A;  2FGF A;  1PZZ A;  1RZO B;  3C9Z A;  3A23 A;  4D0T A;  1ITB A;  1JTC A;  4OUJ A;  4QBC A;  1R8O A;  4P0J A;  3FJF A;  4KBB A;  2DRZ A;  2ERM A;  4LO7 B;  5BXR A;  4G9N A;  4P6A A;  3RTJ B;  3HMY A;  4EKX B;  21BI A;  4F34 A;  3OBR A;  1NUN A;  3PHZ A;  1FWV A;  4LO3 A;  3CRG A;  2DRY A;  3UD9 A;  1K5V A;  4JQ0 A;  3FUO A;  4USP A;  2D1Z A;  1K5U A;  3IM7 A;  3FJH A;  4KEJ A;  5GAQ A;  4YOL A;  1BFG A;  1N4K A;  2Z48 A;  1G9B A;  2FO1 A;  1S0G A;  1T9F A;  4QAL A;  2D43 A;  1QXM A;  3IIR A;  1YBI A;  3AJ5 A;  2F8X C;  4ZOT A;  1FGA A;  4X37 A;  3VT1 A;  3BTA A;  4X38 A;  3A22 A;  2NP0 A;  3VSZ A;  4I8M A;  1KNM A;  1TOO A;  1CE7 B;  4LO3 C;  4OWL A;  2K8R A;  4H04 A;  4II0 A;  4OWK A;  1IRP A;  4OWJ A;  1DQG A;  3K1X A;  1JLX A;  1EYL A;  1YTO A;  4QD2 C;  4I1B A;  4ZKT B;  4OEF A;  2Y9F A;  2KI6 B;  5D62 A;  1BLA A;  3F62 B;  4I2S A;  3O49 A;  2Q9X A;  3HSM A;  2NYY A;  3CA3 A;  1WBA A;  1R8N A;  1DJS B;  3I29 B;  4L4H A;  1TTU A;  1FMM S;  3ZXG A;  4ZA3 B;  5HPZ A;  4QBV A;  4MZG B;  3FJ9 A;  1QQK A;  4Q91 A;  3BX1 C;  4ZFY B;  3CRI A;  4I4X A;  3UJ4 A;  1ISY A;  5EG6 C;  1SR4 C;  1S0D A;  4XFT A;  1T4Q A;  5BVP I;  1WD3 A;  2AQZ A;  1G9C A;  3H6S E;  1ISV A;  1PC8 B;  4JKX B;  5DZU A;  1FV2 A;  1S0C A;  3WIN A;  5FZZ A;  3CA0 A;  4G6M A;  4GAF A;  3AKH A;  4XKI A;  1EVT A;  2X2T A;  3NBE A;  2NTD A;  3AJ6 A;  4A7Z A;  3V0B B;  3AKF A;  2NZ9 A;  4LO0 A;  1AFC A;  2QYI B;  2ET2 A;  4I4V A;  1I1B A;  3FJB A;  5I1B A;  5JLV A;  1HCE A;  1EPW A;  5FZU A;  3O4D A;  1BFC A;  2WBC A;  1IRA X;  3CQA A;  1PWA A;  4LO2 A;  5EHA A;  3LTQ A;  3ZC8 A;  1AVX B;  1MC9 A;  4MZF B;  4QO3 A;  5F8W A;  1S0B A;  1HKN A;  2D22 A;  2BEB A;  2J3P A;  2RG9 B;  4LO8 B;  3WIN C;  1RG8 A;  3WMV A;  5DVH A;  5FNX A;  4LO7 C;  2ESU A;  4I96 A;  1BA7 A;  3N7M A;  3RMX A;  4I37 A;  2NVH A;  2LIE A;  1JQZ A;  3VWC A;  1W3A A;  4HR6 C;  4TLP A;  1FV3 A;  2IHO A;  4JPZ A;  1SZ6 B;  3CA1 A;  2MLL B;  4AN7 B;  1V6V A;  2D7I A;  2WRY A;  1VCL A;  2P23 A;  3CA6 A;  2HWA A;  4I4U A;  2D20 A;  3I2X A;  2Y9G A;  4I4Q A;  4IHZ A;  4LO2 C;  5D61 A;  41BI A;  2VSA A;  1DFQ A;  3O4O A;  3A07 A;  4D0Z A;  1BFF A;  1Q03 A;  1YYN A;  3UD8 A;  3RSJ A;  1PUU B;  3NBD A;  1HWN B;  1IT0 A;  1FN0 A;  3A21 A;  4I4P A;  3E8L C;  3ZC9 A;  3OJV A;  4I4O A;  1Z4S A;  1Q1U A;  4I1E A;  5E24 E;  4ION A;  3AH1 A;  3BAV A;  3QYD A;  1DIW A;  3V0A A;  3T8S A;  2GZB A;  3NBC A;  1M16 A;  2HZ9 A;  31BI A;  5BQU A;  4MZH A;  1CVS A;  2D44 A;  1JLY A;  2D23 A;  3AH4 A;  3FJD A;  5DUY A;  1DLL A;  4Q9G A;  3RTI B;  1TWE A;  4EFP A;  4OEG A;  2IWT B;  4I4S A;  4Z8S B;  1PUM B;  2NM1 A;  4QKR A;  4DEN A;  2MC2 A;  1DZC A;  1MD6 A;  4ISR A;  2E4M A;  3HBW A;  2K4A B;  2LIQ A;  2NS2 A;  1XG6 A;  5BXS A;  3ZXD A;  3PUB A;  1JT7 A;  5JMC A;  2BEA A;  1FMZ A;  3BAU A;  3UJ0 A;  2Q3N B;  5F8Y A;  4QC4 A;  4EEE B;  4FVV A;  3CU1 B;  2K43 A;  3V0B A;  3WMU A;  4IYB A;  5F8S A;  1Z0H A;  2VXR A;  4X39 A;  3AH2 A;  2AFG A;  4HA2 A;  3O3Q A;  1ISX A;  1XZZ A;  3VSF A;  4DCK C;  2M49 A;  2KKI A;  4EFR A;  1IIL A;  2FFV A;  3V0A B;  3BA5 A;  4J2S A;  2Y9X E;  2FDB M;  4CJM A;  1IHK A;  4ZGR B;  3P6I A;  2DRE A;  2RST A;  3JRR A;  3FJJ A;  5FZY A;  1YXW A;  3BRG C;  1UPS A;  3NJ5 A;  1G9D A;  5BOW A;  1QQL A;  4GOY A;  2Z49 A;  1V6U A;  5BXP A;  1G82 A;  4LO1 A;  1WD4 A;  1BAR A;  1F31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...