3FJKA

Crystal structure of a66c mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
142
structure length
142
Chain Sequence
HHHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLCMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of conserved cysteine in the fibroblast growth factor family: evidence for a vestigial half-cystine.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 36
structure length 142
sequence length 142
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fjkA00
2D23A 1XHBA 4XFSA 5G00A 4A7KA 1PWAA 3MALA 2ZQOA 4ENDA 4JP0A 2VXTI 4I96A 4P0LA 2F2FA 2NM1A 4GAFA 2KKIA 4Z8SB 1XYFA 1Z4SA 5B2HA 3PG0A 1JQZA 2QN4A 3FJBA 1TFMB 4XKIA 1XG6A 1YF8B 2LIEA 3BAGA 4EKXB 4ZFUB 3CA0A 1ILR1 3FUQA 2F2FC 3NBEA 1PUUB 1GGPB 3FJHA 3S8JA 4ZFYB 1YXWA 4I0YA 3FJJA 1S0EA 2DS0A 1HWPB 2LIQA 1IJTA 3E8LC 2Y9XE 1TWEA 3QR5A 3QYDA 5BXTA 3ZX7A 31BIA 1AXMA 3IM7A 2D44A 1VCLA 5DVHA 1T4QA 3BADA 1BARA 3V0BA 1FMMS 4LO7B 3SNVA 4I7IA 4EB2B 2K4AB 4LO0A 2RSTA 3UD8A 4I1EA 5D63A 1NZKA 1JT4A 4Q9GA 1FGAA 1MD6A 2AFGA 3FUOA 5BP5A 1AFCA 1WBCA 2WRYA 3I29B 4LO3A 4I4RA 3RTIB 3BRGC 2GZBA 4LO0C 4G9MA 1JT5A 21BIA 3PHZA 3N7LA 4D8HA 3O4AA 1AVWB 1DFQA 2UUSA 4P0KA 3FGMA 4FGFA 4LO3C 4HA2A 3OJ2A 5EC5A 1FWUA 1BFBA 2YUGA 3CRHA 3ZC9A 3JRRA 2NZ9A 2WBCA 3H6SE 1M2TB 2FDBM 1IHKA 1FV3A 3HALA 5BXRA 3FJKA 4KEIA 2K8RA 4J2KA 2ET2A 1V6VA 4X39A 4XFTA 2AAIB 1RZOB 3N7JA 4LO2A 1V6WA 3AH2A 1BFFA 4OEEA 5F90A 1DQOA 1BLAA 2D24A 1K5UA 1BFCA 3FJFA 2F8XC 1TWMA 1HWNB 4I4OA 4LO2C 2NP0A 4I6IA 4ISQA 5FZUA 2HZ9A 3OJVA 3WO4A 2KI4A 3D7WB 4EFRA 2NVHA 4QD2C 2M49A 9ILBA 1FN0A 1E0OA 1W3AA 1DZCA 2KLLA 3N0KA 3R4UA 4EEEB 3FJ9A 3NBNA 2HW9A 1DIWA 4A7YA 2KI6B 1EPWA 3BRFA 2AXMA 3BTAA 1J0SA 1EVTA 3F1RA 4QKSA 1I1BA 1D0HA 1S0CA 4QBCA 1HKNA 1WD4A 4D0ZA 3WMVA 3OBRA 4ZOTA 3B9UA 4I2SA 2FGFA 3O5WB 5JMCA 4II0A 3V0AA 3H6RA 3IIRA 4QALA 5F8YA 2XOAA 3OGGA 4I4SA 3HMYA 2D1ZA 1HWMB 3UDAA 4I1BA 3UD9A 1JY0A 5BQUA 1UPSA 2E4MA 5D62A 41BIA 3FJ8A 1R8OA 2ESUA 4LO8B 3CA5A 5DUYA 2NTDA 2Q3NB 3CAHA 1N4KA 1Z0HA 5F8WA 2HWAA 4QD2B 1YYNA 4G9NA 1JLXA 4Q9PA 1XZZA 1FMZA 3A21A 4X3AA 4EFQA 5BQUC 3VUOA 2E4MC 3AKFA 3N7MA 3OGFA 1IILA 3CA3A 2HWMA 3Q7XA 4QC4A 1TP0A 3R4SA 3W9TA 1WBAA 4YOLA 2MC2A 3FJIA 4WBCA 3CRGA 1TIEA 3AZWA 3P6JA 1EV2A 4D0TA 1HCEA 4XFUA 1G9DA 1JT3A 3O4CA 1TTUA 3AJ5A 4OUJA 3POKA 4OEFA 4FVVA 3A07A 1YBIA 1IRAX 1DLLA 4I4XA 4EFPA 2VU9A 4HR6C 4I37A 3RMXA 3CRIA 2IWTB 5E24E 3H6RB 2ZQNA 5HPZA 2RG9B 3AH1A 2FFVA 4OWLA 4QKRA 2D7IA 3Q7WA 1Q04A 1FV2A 1F31A 3EF2A 2FO1A 3CA1A 3NBCA 3P53A 3Q7YA 4HJJA 3A23A 1ITBA 4H04A 1V6XA 1PC8B 2Y9WC 1II4A 4KEJA 4OWJA 4ZKTB 1ISZA 1S0DA 4X37A 4R6UB 4F34A 2IHOA 6I1BA 2MLLB 3FJCA 4G1RA 1PZZA 4IY9A 3V0BB 3BAQA 3JUTA 4GP0A 1FQ9A 1HIBA 1K5VA 1ISYA 1EYLA 4KEKA 3ZC8A 2Q9XA 4L4IA 2BEAA 3BX1C 1AVUA 1NUNA 1T9FA 4USPA 3VT0A 3O4OA 1S0BA 2ZR1B 4L4HA 5F8SA 4GAIA 4PC4A 3AJ6A 3BB2A 4J2SA 1AVAC 1HCDA 2QYIB 2KH2A 3PMEA 3HSMA 1QQLA 3I2XA 3OJMA 1ISXA 3LTQA 3UD7A 3VEQA 1G9BA 1RMLA 4OW4A 1WD3A 2DRZA 5EG6C 3FJAA 1BASA 3IM5A 2GO2A 3I2AA 1JT7A 8I1BA 1QXMA 3RTJB 5FZZA 3N7KA 4LO7C 3AZVA 4IQPA 4DEPA 4I4VA 4A7ZA 2Z49A 3CU1B 3TC2A 2Y9FA 3BA7A 3AKHA 3VSZA 1DJSB 3IAGC 3O4DA 3CA4A 2MIBA 4GP3A 1BFGA 1ABRB 1W3GA 4P6AA 3BRDA 1V6UA 4JRAA 3WINA 3HBWA 3NJ5A 5I1BA 4I4PA 4JQ0A 1P63A 3V79C 3CA6A 1IT0A 4TLPA 5DSSB 4IZEA 3FJDA 4I4YA 4QO3A 3WINC 2DREA 3RMYA 4X38A 4GOVA 4I3NA 2P39A 3VWCA 3WO3A 1RY7A 3HN1A 1ISVA 1MC9A 1Q03A 4J23B 1DFCA 1G9CA 4LO1A 1QQKA 4IYBA 3C9ZA 3UJ4A 4IY8A 1AVXB 1ONKB 2VSEA 5GAQA 1Z2VA 3LLPA 3S8KA 3UJ0A 2K43A 3O44A 2Z48A 3A22A 3CQAA 4GOYA 7I1BA 1G82A 2RQ9A 4LO1C 1OQLB 3O49A 3BA4A 4DCKC 4Q91A 5BXSA 1I1EA 2R9KB 1FWVA 3BAOA 1RG8A 3V0AB 3T8SA 5BOWA 1BA7A 4DENA 3OBTA 2BEBA 4ZFWB 2D43A 4JPZA 1SR4A 3NBDA 5BVPI 4P0JA 5D61A 4USOA 3KMVA 2P23A 3P6IA 3ZXDA 1DZDA 3BAVA 1JTCA 3ZXGA 4F83A 5FZYA 3VT1A 3FFZA 1SR4C 1S0FA 4KC3A 1HWOB 4OEGA 2NYYA 2ERMA 5BP5C 3VSFA 5EHAA 4ZLBB 2VSAA 5BXPA 4ZGRB 4H9WA 4ZBVB 1AF9A 3K1XA 1ISWA 2AQZA 3BAHA 4I4UA 1JLYA 2D7RA 5DZUA 4G6JA 2X2SA 4G6MA 4ZA3B 3H6QA 2VUAA 4I4QA 1W3FA 3O4BA 1A8DA 3ILAA 4OWKA 4ISRA 1DQGA 5FNXA 4J2XA 2DRYA 4JKXB 3O3QA 1Q1UA 3RSJA 2BFHA 1R8NA 3WA1A 3PUBA 1CVSA 1CE7B 4IHZA 1IOBA 4I8MA 2X2TA 1S0LA 2Y9GA 4CJMA 1KNMA 3AH4A 1IRPA 4AN7B 1TOOA 1L2HA 4QBVA 4IONA 1M16A 1SZ6B 2D20A 3IM6A 2L5XA 3WMUA 4J2YA 4IZXA 4KBBA 3FJEA 3AKIA 3AKGA 2D22A 5JLVA 2I1BA 4JAWA 3MPPG 1PUMB 3WO2A 3F62B 3BA5A 4AN6A 1BLDA 2VXRA 4JKQA 3BAUA 1G9AA 3VT2A 2VLCA 5FNWA 1S0GA 2J3PA 4Z9WB 2FFUA 3HOMA 1YTOA
chains in the Genus database with same CATH superfamily
2D23A 1XHBA 4XFSA 5G00A 4A7KA 1PWAA 3MALA 2ZQOA 4ENDA 4JP0A 2VXTI 4I96A 4P0LA 2F2FA 2NM1A 4GAFA 2KKIA 4Z8SB 1XYFA 1Z4SA 5B2HA 3PG0A 1JQZA 2QN4A 3FJBA 1TFMB 4XKIA 1XG6A 1YF8B 2LIEA 3BAGA 4EKXB 4ZFUB 3CA0A 1ILR1 3FUQA 2F2FC 3NBEA 1PUUB 1GGPB 3FJHA 3S8JA 4ZFYB 1YXWA 4MZFB 4I0YA 3FJJA 1S0EA 2DS0A 1HWPB 2LIQA 1IJTA 3E8LC 2Y9XE 1TWEA 3QR5A 3QYDA 5BXTA 3ZX7A 31BIA 1AXMA 3IM7A 2D44A 1VCLA 5DVHA 1T4QA 3BADA 1BARA 3V0BA 1FMMS 4LO7B 3SNVA 4I7IA 4EB2B 2K4AB 4LO0A 2RSTA 3UD8A 4I1EA 5D63A 1NZKA 1JT4A 2NS2A 1FGAA 1MD6A 4Q9GA 2AFGA 3FUOA 5BP5A 1AFCA 1WBCA 2WRYA 3I29B 4LO3A 4I4RA 3RTIB 3BRGC 2GZBA 4LO0C 4G9MA 1JT5A 21BIA 3PHZA 3N7LA 4D8HA 3O4AA 1AVWB 1DFQA 2UUSA 4P0KA 3FGMA 4FGFA 4LO3C 4HA2A 3OJ2A 5EC5A 1FWUA 1BFBA 2YUGA 3CRHA 3ZC9A 3JRRA 2NZ9A 2WBCA 3H6SE 1M2TB 2FDBM 1IHKA 1FV3A 3HALA 5BXRA 3FJKA 4KEIA 2K8RA 4J2KA 2ET2A 1V6VA 4X39A 4XFTA 2AAIB 1RZOB 3N7JA 4LO2A 1V6WA 3AH2A 1BFFA 4OEEA 5F90A 1DQOA 1BLAA 2D24A 1K5UA 1BFCA 3FJFA 2F8XC 1TWMA 1HWNB 4I4OA 4LO2C 2NP0A 4I6IA 4MZGB 4ISQA 5FZUA 2HZ9A 3OJVA 3WO4A 2KI4A 3D7WB 4EFRA 2NVHA 4QD2C 2M49A 9ILBA 1FN0A 1E0OA 1W3AA 1DZCA 2KLLA 3N0KA 3R4UA 4EEEB 3FJ9A 3NBNA 2HW9A 1DIWA 4A7YA 2KI6B 1EPWA 3BRFA 2AXMA 3BTAA 1J0SA 1EVTA 3F1RA 4QKSA 1I1BA 1D0HA 1S0CA 4QBCA 1HKNA 1WD4A 4D0ZA 3WMVA 3OBRA 4ZOTA 3B9UA 4I2SA 2FGFA 3O5WB 5JMCA 4II0A 3V0AA 3H6RA 3IIRA 4QALA 5F8YA 2XOAA 3OGGA 4I4SA 3HMYA 2D1ZA 1HWMB 3UDAA 4I1BA 3UD9A 1JY0A 5BQUA 1UPSA 2E4MA 5D62A 41BIA 3FJ8A 1R8OA 2ESUA 4LO8B 3CA5A 5DUYA 2NTDA 2Q3NB 3CAHA 1N4KA 1Z0HA 5F8WA 2HWAA 4QD2B 1YYNA 4G9NA 1JLXA 4Q9PA 1XZZA 1FMZA 3A21A 4X3AA 4EFQA 5BQUC 3VUOA 2E4MC 3AKFA 3N7MA 3OGFA 1IILA 3CA3A 2HWMA 3Q7XA 4QC4A 1TP0A 3R4SA 3W9TA 1WBAA 4YOLA 2MC2A 3FJIA 4WBCA 3CRGA 1TIEA 3AZWA 3P6JA 1EV2A 4D0TA 1HCEA 4XFUA 1G9DA 1JT3A 3O4CA 1TTUA 3AJ5A 4OUJA 3POKA 4OEFA 4FVVA 3A07A 1YBIA 1IRAX 1DLLA 4I4XA 4EFPA 2VU9A 4HR6C 4I37A 3RMXA 3CRIA 2IWTB 5E24E 3H6RB 2ZQNA 5HPZA 2RG9B 3AH1A 2FFVA 4OWLA 4QKRA 2D7IA 3Q7WA 1Q04A 1FV2A 1F31A 3EF2A 2FO1A 3CA1A 3NBCA 3P53A 3Q7YA 4HJJA 3A23A 1ITBA 4H04A 1V6XA 1PC8B 2Y9WC 1II4A 4KEJA 4OWJA 4ZKTB 1ISZA 1S0DA 4X37A 4R6UB 4F34A 2IHOA 6I1BA 2MLLB 3FJCA 4G1RA 1PZZA 4IY9A 3V0BB 3BAQA 3JUTA 4GP0A 1FQ9A 1HIBA 4UY4A 1K5VA 1ISYA 1EYLA 4KEKA 3ZC8A 2Q9XA 4L4IA 2BEAA 3BX1C 1AVUA 1NUNA 1T9FA 4USPA 3VT0A 3O4OA 1S0BA 2ZR1B 4L4HA 5F8SA 4GAIA 4PC4A 3AJ6A 3BB2A 4J2SA 1AVAC 1HCDA 2QYIB 2KH2A 3PMEA 3HSMA 1QQLA 3I2XA 3OJMA 1ISXA 3LTQA 3UD7A 3VEQA 1G9BA 1RMLA 4OW4A 1WD3A 2DRZA 5EG6C 3FJAA 1BASA 3IM5A 2GO2A 3I2AA 1JT7A 8I1BA 1QXMA 3RTJB 5FZZA 3N7KA 4LO7C 3AZVA 4IQPA 4DEPA 4I4VA 4A7ZA 2Z49A 3CU1B 3TC2A 2Y9FA 3BA7A 3AKHA 3VSZA 1DJSB 3IAGC 3O4DA 3CA4A 2MIBA 4GP3A 1BFGA 1ABRB 1W3GA 4P6AA 3BRDA 1V6UA 4JRAA 3WINA 3HBWA 3NJ5A 5I1BA 4I4PA 4JQ0A 1P63A 3V79C 3CA6A 1IT0A 4TLPA 5DSSB 4IZEA 3FJDA 4I4YA 4QO3A 3WINC 2DREA 3RMYA 4X38A 4GOVA 4I3NA 2P39A 3VWCA 3WO3A 1RY7A 3HN1A 1ISVA 1MC9A 1Q03A 4J23B 1DFCA 1G9CA 4LO1A 1QQKA 4IYBA 3C9ZA 3UJ4A 4IY8A 1AVXB 1ONKB 2VSEA 5GAQA 1Z2VA 3LLPA 3S8KA 3UJ0A 2K43A 3O44A 2Z48A 3A22A 3CQAA 4GOYA 7I1BA 1G82A 2RQ9A 4LO1C 1OQLB 3O49A 3BA4A 4DCKC 4Q91A 5BXSA 1I1EA 2R9KB 1FWVA 3BAOA 1RG8A 3V0AB 3T8SA 5BOWA 1BA7A 4DENA 3OBTA 2BEBA 4ZFWB 2D43A 4JPZA 1SR4A 3NBDA 5BVPI 4P0JA 5D61A 4USOA 3KMVA 2P23A 3P6IA 3ZXDA 1DZDA 3BAVA 1JTCA 3ZXGA 4F83A 5FZYA 3VT1A 3FFZA 1SR4C 1S0FA 4KC3A 1HWOB 4OEGA 2NYYA 2ERMA 5BP5C 3VSFA 5EHAA 4ZLBB 2VSAA 5BXPA 4ZGRB 4H9WA 4ZBVB 1AF9A 3K1XA 1ISWA 2AQZA 3BAHA 4I4UA 1JLYA 2D7RA 5DZUA 4G6JA 2X2SA 4G6MA 4ZA3B 3H6QA 2VUAA 4I4QA 1W3FA 3O4BA 1A8DA 3ILAA 4OWKA 4H75A 1DQGA 4ISRA 5FNXA 4J2XA 2DRYA 4JKXB 3O3QA 1Q1UA 3RSJA 2BFHA 1R8NA 3WA1A 3PUBA 1CVSA 1CE7B 4IHZA 1IOBA 4I8MA 2X2TA 1S0LA 2Y9GA 4CJMA 1KNMA 3AH4A 1IRPA 4AN7B 1TOOA 1L2HA 4QBVA 4IONA 1M16A 1SZ6B 2D20A 3IM6A 2L5XA 3WMUA 4J2YA 4MZHA 4IZXA 4KBBA 3FJEA 3AKIA 3AKGA 2D22A 5JLVA 2I1BA 4JAWA 3MPPG 1PUMB 3WO2A 3F62B 3BA5A 4AN6A 1BLDA 2VXRA 4JKQA 3BAUA 1G9AA 3VT2A 2VLCA 5FNWA 1S0GA 2J3PA 4Z9WB 2FFUA 3HOMA 1YTOA
chains in the Genus database with same CATH topology
2D23A 1XHBA 4XFSA 5G00A 4A7KA 1PWAA 3MALA 2ZQOA 4ENDA 4JP0A 2VXTI 4I96A 4P0LA 2F2FA 2NM1A 4GAFA 2KKIA 4Z8SB 1XYFA 1Z4SA 5B2HA 3PG0A 1JQZA 2QN4A 3FJBA 1TFMB 4XKIA 1XG6A 1YF8B 2LIEA 3BAGA 4EKXB 4ZFUB 3CA0A 1ILR1 3FUQA 2F2FC 3NBEA 1PUUB 1GGPB 3FJHA 3S8JA 4ZFYB 1YXWA 4MZFB 4I0YA 3FJJA 1S0EA 2DS0A 1HWPB 2LIQA 1IJTA 3E8LC 2Y9XE 1TWEA 3QR5A 3QYDA 5BXTA 3ZX7A 31BIA 1AXMA 3IM7A 2D44A 1VCLA 5DVHA 1T4QA 3BADA 1BARA 3V0BA 1FMMS 4LO7B 3SNVA 4I7IA 4EB2B 2K4AB 4LO0A 2RSTA 3UD8A 4I1EA 5D63A 1NZKA 1JT4A 2NS2A 1FGAA 1MD6A 4Q9GA 2AFGA 3FUOA 5BP5A 1AFCA 1WBCA 2WRYA 3I29B 4LO3A 4I4RA 3RTIB 3BRGC 2GZBA 4LO0C 4G9MA 1JT5A 21BIA 3PHZA 3N7LA 4D8HA 3O4AA 1AVWB 1DFQA 2UUSA 4P0KA 3FGMA 4FGFA 4LO3C 4HA2A 3OJ2A 5EC5A 1FWUA 1BFBA 2YUGA 3CRHA 3ZC9A 3JRRA 2NZ9A 2WBCA 3H6SE 1M2TB 2FDBM 1IHKA 1FV3A 3HALA 5BXRA 3FJKA 4KEIA 2K8RA 4J2KA 2ET2A 1V6VA 4X39A 4XFTA 2AAIB 1RZOB 3N7JA 4LO2A 1V6WA 3AH2A 1BFFA 4OEEA 5F90A 1DQOA 1BLAA 2D24A 1K5UA 1BFCA 3FJFA 2F8XC 1TWMA 1HWNB 4I4OA 4LO2C 2NP0A 4I6IA 4MZGB 4ISQA 5FZUA 2HZ9A 3OJVA 3WO4A 2KI4A 3D7WB 4EFRA 2NVHA 4QD2C 2M49A 9ILBA 1FN0A 1E0OA 1W3AA 1DZCA 2KLLA 3N0KA 3R4UA 4EEEB 3FJ9A 3NBNA 2HW9A 1DIWA 4A7YA 2KI6B 1EPWA 3BRFA 2AXMA 3BTAA 1J0SA 1EVTA 3F1RA 4QKSA 1I1BA 1D0HA 1S0CA 4QBCA 1HKNA 1WD4A 4D0ZA 3WMVA 3OBRA 4ZOTA 3B9UA 4I2SA 2FGFA 3O5WB 5JMCA 4II0A 3V0AA 3H6RA 3IIRA 4QALA 5F8YA 2XOAA 3OGGA 4I4SA 3HMYA 2D1ZA 1HWMB 3UDAA 4I1BA 3UD9A 1JY0A 5BQUA 1UPSA 2E4MA 5D62A 41BIA 3FJ8A 1R8OA 2ESUA 4LO8B 3CA5A 5DUYA 2NTDA 2Q3NB 3CAHA 1N4KA 1Z0HA 5F8WA 2HWAA 4QD2B 1YYNA 4G9NA 1JLXA 4Q9PA 1XZZA 1FMZA 3A21A 4X3AA 4EFQA 5BQUC 3VUOA 2E4MC 3AKFA 3N7MA 3OGFA 1IILA 3CA3A 2HWMA 3Q7XA 4QC4A 1TP0A 3R4SA 3W9TA 1WBAA 4YOLA 2MC2A 3FJIA 4WBCA 3CRGA 1TIEA 3AZWA 3P6JA 1EV2A 4D0TA 1HCEA 4XFUA 1G9DA 1JT3A 3O4CA 1TTUA 3AJ5A 4OUJA 3POKA 4OEFA 4FVVA 3A07A 1YBIA 1IRAX 1DLLA 4I4XA 4EFPA 2VU9A 4HR6C 4I37A 3RMXA 3CRIA 2IWTB 5E24E 3H6RB 2ZQNA 5HPZA 2RG9B 3AH1A 2FFVA 4OWLA 4QKRA 2D7IA 3Q7WA 1Q04A 1FV2A 1F31A 3EF2A 2FO1A 3CA1A 3NBCA 3P53A 3Q7YA 4HJJA 3A23A 1ITBA 4H04A 1V6XA 1PC8B 2Y9WC 1II4A 4KEJA 4OWJA 4ZKTB 1ISZA 1S0DA 4X37A 4R6UB 4F34A 2IHOA 6I1BA 2MLLB 3FJCA 4G1RA 1PZZA 4IY9A 3V0BB 3BAQA 3JUTA 4GP0A 1FQ9A 1HIBA 4UY4A 1K5VA 1ISYA 1EYLA 4KEKA 3ZC8A 2Q9XA 4L4IA 2BEAA 3BX1C 1AVUA 1NUNA 1T9FA 4USPA 3VT0A 3O4OA 1S0BA 2ZR1B 4L4HA 5F8SA 4GAIA 4PC4A 3AJ6A 3BB2A 4J2SA 1AVAC 1HCDA 2QYIB 2KH2A 3PMEA 3HSMA 1QQLA 3I2XA 3OJMA 1ISXA 3LTQA 3UD7A 3VEQA 1G9BA 1RMLA 4OW4A 1WD3A 2DRZA 5EG6C 3FJAA 1BASA 3IM5A 2GO2A 3I2AA 1JT7A 8I1BA 1QXMA 3RTJB 5FZZA 3N7KA 4LO7C 3AZVA 4IQPA 4DEPA 4I4VA 4A7ZA 2Z49A 3CU1B 3TC2A 2Y9FA 3BA7A 3AKHA 3VSZA 1DJSB 3IAGC 3O4DA 3CA4A 2MIBA 4GP3A 1BFGA 1ABRB 1W3GA 4P6AA 3BRDA 1V6UA 4JRAA 3WINA 3HBWA 3NJ5A 5I1BA 4I4PA 4JQ0A 1P63A 3V79C 3CA6A 1IT0A 4TLPA 5DSSB 4IZEA 3FJDA 4I4YA 4QO3A 3WINC 2DREA 3RMYA 4X38A 4GOVA 4I3NA 2P39A 3VWCA 3WO3A 1RY7A 3HN1A 1ISVA 1MC9A 1Q03A 4J23B 1DFCA 1G9CA 4LO1A 1QQKA 4IYBA 3C9ZA 3UJ4A 4IY8A 1AVXB 1ONKB 2VSEA 5GAQA 1Z2VA 3LLPA 3S8KA 3UJ0A 2K43A 3O44A 2Z48A 3A22A 3CQAA 4GOYA 7I1BA 1G82A 2RQ9A 4LO1C 1OQLB 3O49A 3BA4A 4DCKC 4Q91A 5BXSA 1I1EA 2R9KB 1FWVA 3BAOA 1RG8A 3V0AB 3T8SA 5BOWA 1BA7A 4DENA 3OBTA 2BEBA 4ZFWB 2D43A 4JPZA 1SR4A 3NBDA 5BVPI 4P0JA 5D61A 4USOA 3KMVA 2P23A 3P6IA 3ZXDA 1DZDA 3BAVA 1JTCA 3ZXGA 4F83A 5FZYA 3VT1A 3FFZA 1SR4C 1S0FA 4KC3A 1HWOB 4OEGA 2NYYA 2ERMA 5BP5C 3VSFA 5EHAA 4ZLBB 2VSAA 5BXPA 4ZGRB 4H9WA 4ZBVB 1AF9A 3K1XA 1ISWA 2AQZA 3BAHA 4I4UA 1JLYA 2D7RA 5DZUA 4G6JA 2X2SA 4G6MA 4ZA3B 3H6QA 2VUAA 4I4QA 1W3FA 3O4BA 1A8DA 3ILAA 4OWKA 4H75A 1DQGA 4ISRA 5FNXA 4J2XA 2DRYA 4JKXB 3O3QA 1Q1UA 3RSJA 2BFHA 1R8NA 3WA1A 3PUBA 1CVSA 1CE7B 4IHZA 1IOBA 4I8MA 2X2TA 1S0LA 2Y9GA 4CJMA 1KNMA 3AH4A 1IRPA 4AN7B 1TOOA 1L2HA 4QBVA 4IONA 1M16A 1SZ6B 2D20A 3IM6A 2L5XA 3WMUA 4J2YA 4MZHA 4IZXA 4KBBA 3FJEA 3AKIA 3AKGA 2D22A 5JLVA 2I1BA 4JAWA 3MPPG 1PUMB 3WO2A 3F62B 3BA5A 4AN6A 1BLDA 2VXRA 4JKQA 3BAUA 1G9AA 3VT2A 2VLCA 5FNWA 1S0GA 2J3PA 4Z9WB 2FFUA 3HOMA 1YTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D23 A;  1XHB A;  4XFS A;  5G00 A;  4A7K A;  1PWA A;  3MAL A;  2ZQO A;  4END A;  4JP0 A;  2VXT I;  4I96 A;  4P0L A;  2F2F A;  2NM1 A;  4GAF A;  2KKI A;  4Z8S B;  1XYF A;  1Z4S A;  5B2H A;  3PG0 A;  1JQZ A;  2QN4 A;  3FJB A;  1TFM B;  4XKI A;  1XG6 A;  1YF8 B;  2LIE A;  3BAG A;  4EKX B;  4ZFU B;  3CA0 A;  1ILR 1;  3FUQ A;  2F2F C;  3NBE A;  1PUU B;  1GGP B;  3FJH A;  3S8J A;  4ZFY B;  1YXW A;  4I0Y A;  3FJJ A;  1S0E A;  2DS0 A;  1HWP B;  2LIQ A;  1IJT A;  3E8L C;  2Y9X E;  1TWE A;  3QR5 A;  3QYD A;  5BXT A;  3ZX7 A;  31BI A;  1AXM A;  3IM7 A;  2D44 A;  1VCL A;  5DVH A;  1T4Q A;  3BAD A;  1BAR A;  3V0B A;  1FMM S;  4LO7 B;  3SNV A;  4I7I A;  4EB2 B;  2K4A B;  4LO0 A;  2RST A;  3UD8 A;  4I1E A;  5D63 A;  1NZK A;  1JT4 A;  4Q9G A;  1FGA A;  1MD6 A;  2AFG A;  3FUO A;  5BP5 A;  1AFC A;  1WBC A;  2WRY A;  3I29 B;  4LO3 A;  4I4R A;  3RTI B;  3BRG C;  2GZB A;  4LO0 C;  4G9M A;  1JT5 A;  21BI A;  3PHZ A;  3N7L A;  4D8H A;  3O4A A;  1AVW B;  1DFQ A;  2UUS A;  4P0K A;  3FGM A;  4FGF A;  4LO3 C;  4HA2 A;  3OJ2 A;  5EC5 A;  1FWU A;  1BFB A;  2YUG A;  3CRH A;  3ZC9 A;  3JRR A;  2NZ9 A;  2WBC A;  3H6S E;  1M2T B;  2FDB M;  1IHK A;  1FV3 A;  3HAL A;  5BXR A;  3FJK A;  4KEI A;  2K8R A;  4J2K A;  2ET2 A;  1V6V A;  4X39 A;  4XFT A;  2AAI B;  1RZO B;  3N7J A;  4LO2 A;  1V6W A;  3AH2 A;  1BFF A;  4OEE A;  5F90 A;  1DQO A;  1BLA A;  2D24 A;  1K5U A;  1BFC A;  3FJF A;  2F8X C;  1TWM A;  1HWN B;  4I4O A;  4LO2 C;  2NP0 A;  4I6I A;  4ISQ A;  5FZU A;  2HZ9 A;  3OJV A;  3WO4 A;  2KI4 A;  3D7W B;  4EFR A;  2NVH A;  4QD2 C;  2M49 A;  9ILB A;  1FN0 A;  1E0O A;  1W3A A;  1DZC A;  2KLL A;  3N0K A;  3R4U A;  4EEE B;  3FJ9 A;  3NBN A;  2HW9 A;  1DIW A;  4A7Y A;  2KI6 B;  1EPW A;  3BRF A;  2AXM A;  3BTA A;  1J0S A;  1EVT A;  3F1R A;  4QKS A;  1I1B A;  1D0H A;  1S0C A;  4QBC A;  1HKN A;  1WD4 A;  4D0Z A;  3WMV A;  3OBR A;  4ZOT A;  3B9U A;  4I2S A;  2FGF A;  3O5W B;  5JMC A;  4II0 A;  3V0A A;  3H6R A;  3IIR A;  4QAL A;  5F8Y A;  2XOA A;  3OGG A;  4I4S A;  3HMY A;  2D1Z A;  1HWM B;  3UDA A;  4I1B A;  3UD9 A;  1JY0 A;  5BQU A;  1UPS A;  2E4M A;  5D62 A;  41BI A;  3FJ8 A;  1R8O A;  2ESU A;  4LO8 B;  3CA5 A;  5DUY A;  2NTD A;  2Q3N B;  3CAH A;  1N4K A;  1Z0H A;  5F8W A;  2HWA A;  4QD2 B;  1YYN A;  4G9N A;  1JLX A;  4Q9P A;  1XZZ A;  1FMZ A;  3A21 A;  4X3A A;  4EFQ A;  5BQU C;  3VUO A;  2E4M C;  3AKF A;  3N7M A;  3OGF A;  1IIL A;  3CA3 A;  2HWM A;  3Q7X A;  4QC4 A;  1TP0 A;  3R4S A;  3W9T A;  1WBA A;  4YOL A;  2MC2 A;  3FJI A;  4WBC A;  3CRG A;  1TIE A;  3AZW A;  3P6J A;  1EV2 A;  4D0T A;  1HCE A;  4XFU A;  1G9D A;  1JT3 A;  3O4C A;  1TTU A;  3AJ5 A;  4OUJ A;  3POK A;  4OEF A;  4FVV A;  3A07 A;  1YBI A;  1IRA X;  1DLL A;  4I4X A;  4EFP A;  2VU9 A;  4HR6 C;  4I37 A;  3RMX A;  3CRI A;  2IWT B;  5E24 E;  3H6R B;  2ZQN A;  5HPZ A;  2RG9 B;  3AH1 A;  2FFV A;  4OWL A;  4QKR A;  2D7I A;  3Q7W A;  1Q04 A;  1FV2 A;  1F31 A;  3EF2 A;  2FO1 A;  3CA1 A;  3NBC A;  3P53 A;  3Q7Y A;  4HJJ A;  3A23 A;  1ITB A;  4H04 A;  1V6X A;  1PC8 B;  2Y9W C;  1II4 A;  4KEJ A;  4OWJ A;  4ZKT B;  1ISZ A;  1S0D A;  4X37 A;  4R6U B;  4F34 A;  2IHO A;  6I1B A;  2MLL B;  3FJC A;  4G1R A;  1PZZ A;  4IY9 A;  3V0B B;  3BAQ A;  3JUT A;  4GP0 A;  1FQ9 A;  1HIB A;  1K5V A;  1ISY A;  1EYL A;  4KEK A;  3ZC8 A;  2Q9X A;  4L4I A;  2BEA A;  3BX1 C;  1AVU A;  1NUN A;  1T9F A;  4USP A;  3VT0 A;  3O4O A;  1S0B A;  2ZR1 B;  4L4H A;  5F8S A;  4GAI A;  4PC4 A;  3AJ6 A;  3BB2 A;  4J2S A;  1AVA C;  1HCD A;  2QYI B;  2KH2 A;  3PME A;  3HSM A;  1QQL A;  3I2X A;  3OJM A;  1ISX A;  3LTQ A;  3UD7 A;  3VEQ A;  1G9B A;  1RML A;  4OW4 A;  1WD3 A;  2DRZ A;  5EG6 C;  3FJA A;  1BAS A;  3IM5 A;  2GO2 A;  3I2A A;  1JT7 A;  8I1B A;  1QXM A;  3RTJ B;  5FZZ A;  3N7K A;  4LO7 C;  3AZV A;  4IQP A;  4DEP A;  4I4V A;  4A7Z A;  2Z49 A;  3CU1 B;  3TC2 A;  2Y9F A;  3BA7 A;  3AKH A;  3VSZ A;  1DJS B;  3IAG C;  3O4D A;  3CA4 A;  2MIB A;  4GP3 A;  1BFG A;  1ABR B;  1W3G A;  4P6A A;  3BRD A;  1V6U A;  4JRA A;  3WIN A;  3HBW A;  3NJ5 A;  5I1B A;  4I4P A;  4JQ0 A;  1P63 A;  3V79 C;  3CA6 A;  1IT0 A;  4TLP A;  5DSS B;  4IZE A;  3FJD A;  4I4Y A;  4QO3 A;  3WIN C;  2DRE A;  3RMY A;  4X38 A;  4GOV A;  4I3N A;  2P39 A;  3VWC A;  3WO3 A;  1RY7 A;  3HN1 A;  1ISV A;  1MC9 A;  1Q03 A;  4J23 B;  1DFC A;  1G9C A;  4LO1 A;  1QQK A;  4IYB A;  3C9Z A;  3UJ4 A;  4IY8 A;  1AVX B;  1ONK B;  2VSE A;  5GAQ A;  1Z2V A;  3LLP A;  3S8K A;  3UJ0 A;  2K43 A;  3O44 A;  2Z48 A;  3A22 A;  3CQA A;  4GOY A;  7I1B A;  1G82 A;  2RQ9 A;  4LO1 C;  1OQL B;  3O49 A;  3BA4 A;  4DCK C;  4Q91 A;  5BXS A;  1I1E A;  2R9K B;  1FWV A;  3BAO A;  1RG8 A;  3V0A B;  3T8S A;  5BOW A;  1BA7 A;  4DEN A;  3OBT A;  2BEB A;  4ZFW B;  2D43 A;  4JPZ A;  1SR4 A;  3NBD A;  5BVP I;  4P0J A;  5D61 A;  4USO A;  3KMV A;  2P23 A;  3P6I A;  3ZXD A;  1DZD A;  3BAV A;  1JTC A;  3ZXG A;  4F83 A;  5FZY A;  3VT1 A;  3FFZ A;  1SR4 C;  1S0F A;  4KC3 A;  1HWO B;  4OEG A;  2NYY A;  2ERM A;  5BP5 C;  3VSF A;  5EHA A;  4ZLB B;  2VSA A;  5BXP A;  4ZGR B;  4H9W A;  4ZBV B;  1AF9 A;  3K1X A;  1ISW A;  2AQZ A;  3BAH A;  4I4U A;  1JLY A;  2D7R A;  5DZU A;  4G6J A;  2X2S A;  4G6M A;  4ZA3 B;  3H6Q A;  2VUA A;  4I4Q A;  1W3F A;  3O4B A;  1A8D A;  3ILA A;  4OWK A;  4ISR A;  1DQG A;  5FNX A;  4J2X A;  2DRY A;  4JKX B;  3O3Q A;  1Q1U A;  3RSJ A;  2BFH A;  1R8N A;  3WA1 A;  3PUB A;  1CVS A;  1CE7 B;  4IHZ A;  1IOB A;  4I8M A;  2X2T A;  1S0L A;  2Y9G A;  4CJM A;  1KNM A;  3AH4 A;  1IRP A;  4AN7 B;  1TOO A;  1L2H A;  4QBV A;  4ION A;  1M16 A;  1SZ6 B;  2D20 A;  3IM6 A;  2L5X A;  3WMU A;  4J2Y A;  4IZX A;  4KBB A;  3FJE A;  3AKI A;  3AKG A;  2D22 A;  5JLV A;  2I1B A;  4JAW A;  3MPP G;  1PUM B;  3WO2 A;  3F62 B;  3BA5 A;  4AN6 A;  1BLD A;  2VXR A;  4JKQ A;  3BAU A;  1G9A A;  3VT2 A;  2VLC A;  5FNW A;  1S0G A;  2J3P A;  4Z9W B;  2FFU A;  3HOM A;  1YTO A; 
#chains in the Genus database with same CATH topology
 2D23 A;  1XHB A;  4XFS A;  5G00 A;  4A7K A;  1PWA A;  3MAL A;  2ZQO A;  4END A;  4JP0 A;  2VXT I;  4I96 A;  4P0L A;  2F2F A;  2NM1 A;  4GAF A;  2KKI A;  4Z8S B;  1XYF A;  1Z4S A;  5B2H A;  3PG0 A;  1JQZ A;  2QN4 A;  3FJB A;  1TFM B;  4XKI A;  1XG6 A;  1YF8 B;  2LIE A;  3BAG A;  4EKX B;  4ZFU B;  3CA0 A;  1ILR 1;  3FUQ A;  2F2F C;  3NBE A;  1PUU B;  1GGP B;  3FJH A;  3S8J A;  4ZFY B;  1YXW A;  4MZF B;  4I0Y A;  3FJJ A;  1S0E A;  2DS0 A;  1HWP B;  2LIQ A;  1IJT A;  3E8L C;  2Y9X E;  1TWE A;  3QR5 A;  3QYD A;  5BXT A;  3ZX7 A;  31BI A;  1AXM A;  3IM7 A;  2D44 A;  1VCL A;  5DVH A;  1T4Q A;  3BAD A;  1BAR A;  3V0B A;  1FMM S;  4LO7 B;  3SNV A;  4I7I A;  4EB2 B;  2K4A B;  4LO0 A;  2RST A;  3UD8 A;  4I1E A;  5D63 A;  1NZK A;  1JT4 A;  2NS2 A;  1FGA A;  1MD6 A;  4Q9G A;  2AFG A;  3FUO A;  5BP5 A;  1AFC A;  1WBC A;  2WRY A;  3I29 B;  4LO3 A;  4I4R A;  3RTI B;  3BRG C;  2GZB A;  4LO0 C;  4G9M A;  1JT5 A;  21BI A;  3PHZ A;  3N7L A;  4D8H A;  3O4A A;  1AVW B;  1DFQ A;  2UUS A;  4P0K A;  3FGM A;  4FGF A;  4LO3 C;  4HA2 A;  3OJ2 A;  5EC5 A;  1FWU A;  1BFB A;  2YUG A;  3CRH A;  3ZC9 A;  3JRR A;  2NZ9 A;  2WBC A;  3H6S E;  1M2T B;  2FDB M;  1IHK A;  1FV3 A;  3HAL A;  5BXR A;  3FJK A;  4KEI A;  2K8R A;  4J2K A;  2ET2 A;  1V6V A;  4X39 A;  4XFT A;  2AAI B;  1RZO B;  3N7J A;  4LO2 A;  1V6W A;  3AH2 A;  1BFF A;  4OEE A;  5F90 A;  1DQO A;  1BLA A;  2D24 A;  1K5U A;  1BFC A;  3FJF A;  2F8X C;  1TWM A;  1HWN B;  4I4O A;  4LO2 C;  2NP0 A;  4I6I A;  4MZG B;  4ISQ A;  5FZU A;  2HZ9 A;  3OJV A;  3WO4 A;  2KI4 A;  3D7W B;  4EFR A;  2NVH A;  4QD2 C;  2M49 A;  9ILB A;  1FN0 A;  1E0O A;  1W3A A;  1DZC A;  2KLL A;  3N0K A;  3R4U A;  4EEE B;  3FJ9 A;  3NBN A;  2HW9 A;  1DIW A;  4A7Y A;  2KI6 B;  1EPW A;  3BRF A;  2AXM A;  3BTA A;  1J0S A;  1EVT A;  3F1R A;  4QKS A;  1I1B A;  1D0H A;  1S0C A;  4QBC A;  1HKN A;  1WD4 A;  4D0Z A;  3WMV A;  3OBR A;  4ZOT A;  3B9U A;  4I2S A;  2FGF A;  3O5W B;  5JMC A;  4II0 A;  3V0A A;  3H6R A;  3IIR A;  4QAL A;  5F8Y A;  2XOA A;  3OGG A;  4I4S A;  3HMY A;  2D1Z A;  1HWM B;  3UDA A;  4I1B A;  3UD9 A;  1JY0 A;  5BQU A;  1UPS A;  2E4M A;  5D62 A;  41BI A;  3FJ8 A;  1R8O A;  2ESU A;  4LO8 B;  3CA5 A;  5DUY A;  2NTD A;  2Q3N B;  3CAH A;  1N4K A;  1Z0H A;  5F8W A;  2HWA A;  4QD2 B;  1YYN A;  4G9N A;  1JLX A;  4Q9P A;  1XZZ A;  1FMZ A;  3A21 A;  4X3A A;  4EFQ A;  5BQU C;  3VUO A;  2E4M C;  3AKF A;  3N7M A;  3OGF A;  1IIL A;  3CA3 A;  2HWM A;  3Q7X A;  4QC4 A;  1TP0 A;  3R4S A;  3W9T A;  1WBA A;  4YOL A;  2MC2 A;  3FJI A;  4WBC A;  3CRG A;  1TIE A;  3AZW A;  3P6J A;  1EV2 A;  4D0T A;  1HCE A;  4XFU A;  1G9D A;  1JT3 A;  3O4C A;  1TTU A;  3AJ5 A;  4OUJ A;  3POK A;  4OEF A;  4FVV A;  3A07 A;  1YBI A;  1IRA X;  1DLL A;  4I4X A;  4EFP A;  2VU9 A;  4HR6 C;  4I37 A;  3RMX A;  3CRI A;  2IWT B;  5E24 E;  3H6R B;  2ZQN A;  5HPZ A;  2RG9 B;  3AH1 A;  2FFV A;  4OWL A;  4QKR A;  2D7I A;  3Q7W A;  1Q04 A;  1FV2 A;  1F31 A;  3EF2 A;  2FO1 A;  3CA1 A;  3NBC A;  3P53 A;  3Q7Y A;  4HJJ A;  3A23 A;  1ITB A;  4H04 A;  1V6X A;  1PC8 B;  2Y9W C;  1II4 A;  4KEJ A;  4OWJ A;  4ZKT B;  1ISZ A;  1S0D A;  4X37 A;  4R6U B;  4F34 A;  2IHO A;  6I1B A;  2MLL B;  3FJC A;  4G1R A;  1PZZ A;  4IY9 A;  3V0B B;  3BAQ A;  3JUT A;  4GP0 A;  1FQ9 A;  1HIB A;  4UY4 A;  1K5V A;  1ISY A;  1EYL A;  4KEK A;  3ZC8 A;  2Q9X A;  4L4I A;  2BEA A;  3BX1 C;  1AVU A;  1NUN A;  1T9F A;  4USP A;  3VT0 A;  3O4O A;  1S0B A;  2ZR1 B;  4L4H A;  5F8S A;  4GAI A;  4PC4 A;  3AJ6 A;  3BB2 A;  4J2S A;  1AVA C;  1HCD A;  2QYI B;  2KH2 A;  3PME A;  3HSM A;  1QQL A;  3I2X A;  3OJM A;  1ISX A;  3LTQ A;  3UD7 A;  3VEQ A;  1G9B A;  1RML A;  4OW4 A;  1WD3 A;  2DRZ A;  5EG6 C;  3FJA A;  1BAS A;  3IM5 A;  2GO2 A;  3I2A A;  1JT7 A;  8I1B A;  1QXM A;  3RTJ B;  5FZZ A;  3N7K A;  4LO7 C;  3AZV A;  4IQP A;  4DEP A;  4I4V A;  4A7Z A;  2Z49 A;  3CU1 B;  3TC2 A;  2Y9F A;  3BA7 A;  3AKH A;  3VSZ A;  1DJS B;  3IAG C;  3O4D A;  3CA4 A;  2MIB A;  4GP3 A;  1BFG A;  1ABR B;  1W3G A;  4P6A A;  3BRD A;  1V6U A;  4JRA A;  3WIN A;  3HBW A;  3NJ5 A;  5I1B A;  4I4P A;  4JQ0 A;  1P63 A;  3V79 C;  3CA6 A;  1IT0 A;  4TLP A;  5DSS B;  4IZE A;  3FJD A;  4I4Y A;  4QO3 A;  3WIN C;  2DRE A;  3RMY A;  4X38 A;  4GOV A;  4I3N A;  2P39 A;  3VWC A;  3WO3 A;  1RY7 A;  3HN1 A;  1ISV A;  1MC9 A;  1Q03 A;  4J23 B;  1DFC A;  1G9C A;  4LO1 A;  1QQK A;  4IYB A;  3C9Z A;  3UJ4 A;  4IY8 A;  1AVX B;  1ONK B;  2VSE A;  5GAQ A;  1Z2V A;  3LLP A;  3S8K A;  3UJ0 A;  2K43 A;  3O44 A;  2Z48 A;  3A22 A;  3CQA A;  4GOY A;  7I1B A;  1G82 A;  2RQ9 A;  4LO1 C;  1OQL B;  3O49 A;  3BA4 A;  4DCK C;  4Q91 A;  5BXS A;  1I1E A;  2R9K B;  1FWV A;  3BAO A;  1RG8 A;  3V0A B;  3T8S A;  5BOW A;  1BA7 A;  4DEN A;  3OBT A;  2BEB A;  4ZFW B;  2D43 A;  4JPZ A;  1SR4 A;  3NBD A;  5BVP I;  4P0J A;  5D61 A;  4USO A;  3KMV A;  2P23 A;  3P6I A;  3ZXD A;  1DZD A;  3BAV A;  1JTC A;  3ZXG A;  4F83 A;  5FZY A;  3VT1 A;  3FFZ A;  1SR4 C;  1S0F A;  4KC3 A;  1HWO B;  4OEG A;  2NYY A;  2ERM A;  5BP5 C;  3VSF A;  5EHA A;  4ZLB B;  2VSA A;  5BXP A;  4ZGR B;  4H9W A;  4ZBV B;  1AF9 A;  3K1X A;  1ISW A;  2AQZ A;  3BAH A;  4I4U A;  1JLY A;  2D7R A;  5DZU A;  4G6J A;  2X2S A;  4G6M A;  4ZA3 B;  3H6Q A;  2VUA A;  4I4Q A;  1W3F A;  3O4B A;  1A8D A;  3ILA A;  4OWK A;  4H75 A;  1DQG A;  4ISR A;  5FNX A;  4J2X A;  2DRY A;  4JKX B;  3O3Q A;  1Q1U A;  3RSJ A;  2BFH A;  1R8N A;  3WA1 A;  3PUB A;  1CVS A;  1CE7 B;  4IHZ A;  1IOB A;  4I8M A;  2X2T A;  1S0L A;  2Y9G A;  4CJM A;  1KNM A;  3AH4 A;  1IRP A;  4AN7 B;  1TOO A;  1L2H A;  4QBV A;  4ION A;  1M16 A;  1SZ6 B;  2D20 A;  3IM6 A;  2L5X A;  3WMU A;  4J2Y A;  4MZH A;  4IZX A;  4KBB A;  3FJE A;  3AKI A;  3AKG A;  2D22 A;  5JLV A;  2I1B A;  4JAW A;  3MPP G;  1PUM B;  3WO2 A;  3F62 B;  3BA5 A;  4AN6 A;  1BLD A;  2VXR A;  4JKQ A;  3BAU A;  1G9A A;  3VT2 A;  2VLC A;  5FNW A;  1S0G A;  2J3P A;  4Z9W B;  2FFU A;  3HOM A;  1YTO A; 
#chains in the Genus database with same CATH homology
 2D23 A;  1XHB A;  4XFS A;  5G00 A;  4A7K A;  1PWA A;  3MAL A;  2ZQO A;  4END A;  4JP0 A;  2VXT I;  4I96 A;  4P0L A;  2F2F A;  2NM1 A;  4GAF A;  2KKI A;  4Z8S B;  1XYF A;  1Z4S A;  5B2H A;  3PG0 A;  1JQZ A;  2QN4 A;  3FJB A;  1TFM B;  4XKI A;  1XG6 A;  1YF8 B;  2LIE A;  3BAG A;  4EKX B;  4ZFU B;  3CA0 A;  1ILR 1;  3FUQ A;  2F2F C;  3NBE A;  1PUU B;  1GGP B;  3FJH A;  3S8J A;  4ZFY B;  1YXW A;  4MZF B;  4I0Y A;  3FJJ A;  1S0E A;  2DS0 A;  1HWP B;  2LIQ A;  1IJT A;  3E8L C;  2Y9X E;  1TWE A;  3QR5 A;  3QYD A;  5BXT A;  3ZX7 A;  31BI A;  1AXM A;  3IM7 A;  2D44 A;  1VCL A;  5DVH A;  1T4Q A;  3BAD A;  1BAR A;  3V0B A;  1FMM S;  4LO7 B;  3SNV A;  4I7I A;  4EB2 B;  2K4A B;  4LO0 A;  2RST A;  3UD8 A;  4I1E A;  5D63 A;  1NZK A;  1JT4 A;  2NS2 A;  1FGA A;  1MD6 A;  4Q9G A;  2AFG A;  3FUO A;  5BP5 A;  1AFC A;  1WBC A;  2WRY A;  3I29 B;  4LO3 A;  4I4R A;  3RTI B;  3BRG C;  2GZB A;  4LO0 C;  4G9M A;  1JT5 A;  21BI A;  3PHZ A;  3N7L A;  4D8H A;  3O4A A;  1AVW B;  1DFQ A;  2UUS A;  4P0K A;  3FGM A;  4FGF A;  4LO3 C;  4HA2 A;  3OJ2 A;  5EC5 A;  1FWU A;  1BFB A;  2YUG A;  3CRH A;  3ZC9 A;  3JRR A;  2NZ9 A;  2WBC A;  3H6S E;  1M2T B;  2FDB M;  1IHK A;  1FV3 A;  3HAL A;  5BXR A;  3FJK A;  4KEI A;  2K8R A;  4J2K A;  2ET2 A;  1V6V A;  4X39 A;  4XFT A;  2AAI B;  1RZO B;  3N7J A;  4LO2 A;  1V6W A;  3AH2 A;  1BFF A;  4OEE A;  5F90 A;  1DQO A;  1BLA A;  2D24 A;  1K5U A;  1BFC A;  3FJF A;  2F8X C;  1TWM A;  1HWN B;  4I4O A;  4LO2 C;  2NP0 A;  4I6I A;  4MZG B;  4ISQ A;  5FZU A;  2HZ9 A;  3OJV A;  3WO4 A;  2KI4 A;  3D7W B;  4EFR A;  2NVH A;  4QD2 C;  2M49 A;  9ILB A;  1FN0 A;  1E0O A;  1W3A A;  1DZC A;  2KLL A;  3N0K A;  3R4U A;  4EEE B;  3FJ9 A;  3NBN A;  2HW9 A;  1DIW A;  4A7Y A;  2KI6 B;  1EPW A;  3BRF A;  2AXM A;  3BTA A;  1J0S A;  1EVT A;  3F1R A;  4QKS A;  1I1B A;  1D0H A;  1S0C A;  4QBC A;  1HKN A;  1WD4 A;  4D0Z A;  3WMV A;  3OBR A;  4ZOT A;  3B9U A;  4I2S A;  2FGF A;  3O5W B;  5JMC A;  4II0 A;  3V0A A;  3H6R A;  3IIR A;  4QAL A;  5F8Y A;  2XOA A;  3OGG A;  4I4S A;  3HMY A;  2D1Z A;  1HWM B;  3UDA A;  4I1B A;  3UD9 A;  1JY0 A;  5BQU A;  1UPS A;  2E4M A;  5D62 A;  41BI A;  3FJ8 A;  1R8O A;  2ESU A;  4LO8 B;  3CA5 A;  5DUY A;  2NTD A;  2Q3N B;  3CAH A;  1N4K A;  1Z0H A;  5F8W A;  2HWA A;  4QD2 B;  1YYN A;  4G9N A;  1JLX A;  4Q9P A;  1XZZ A;  1FMZ A;  3A21 A;  4X3A A;  4EFQ A;  5BQU C;  3VUO A;  2E4M C;  3AKF A;  3N7M A;  3OGF A;  1IIL A;  3CA3 A;  2HWM A;  3Q7X A;  4QC4 A;  1TP0 A;  3R4S A;  3W9T A;  1WBA A;  4YOL A;  2MC2 A;  3FJI A;  4WBC A;  3CRG A;  1TIE A;  3AZW A;  3P6J A;  1EV2 A;  4D0T A;  1HCE A;  4XFU A;  1G9D A;  1JT3 A;  3O4C A;  1TTU A;  3AJ5 A;  4OUJ A;  3POK A;  4OEF A;  4FVV A;  3A07 A;  1YBI A;  1IRA X;  1DLL A;  4I4X A;  4EFP A;  2VU9 A;  4HR6 C;  4I37 A;  3RMX A;  3CRI A;  2IWT B;  5E24 E;  3H6R B;  2ZQN A;  5HPZ A;  2RG9 B;  3AH1 A;  2FFV A;  4OWL A;  4QKR A;  2D7I A;  3Q7W A;  1Q04 A;  1FV2 A;  1F31 A;  3EF2 A;  2FO1 A;  3CA1 A;  3NBC A;  3P53 A;  3Q7Y A;  4HJJ A;  3A23 A;  1ITB A;  4H04 A;  1V6X A;  1PC8 B;  2Y9W C;  1II4 A;  4KEJ A;  4OWJ A;  4ZKT B;  1ISZ A;  1S0D A;  4X37 A;  4R6U B;  4F34 A;  2IHO A;  6I1B A;  2MLL B;  3FJC A;  4G1R A;  1PZZ A;  4IY9 A;  3V0B B;  3BAQ A;  3JUT A;  4GP0 A;  1FQ9 A;  1HIB A;  4UY4 A;  1K5V A;  1ISY A;  1EYL A;  4KEK A;  3ZC8 A;  2Q9X A;  4L4I A;  2BEA A;  3BX1 C;  1AVU A;  1NUN A;  1T9F A;  4USP A;  3VT0 A;  3O4O A;  1S0B A;  2ZR1 B;  4L4H A;  5F8S A;  4GAI A;  4PC4 A;  3AJ6 A;  3BB2 A;  4J2S A;  1AVA C;  1HCD A;  2QYI B;  2KH2 A;  3PME A;  3HSM A;  1QQL A;  3I2X A;  3OJM A;  1ISX A;  3LTQ A;  3UD7 A;  3VEQ A;  1G9B A;  1RML A;  4OW4 A;  1WD3 A;  2DRZ A;  5EG6 C;  3FJA A;  1BAS A;  3IM5 A;  2GO2 A;  3I2A A;  1JT7 A;  8I1B A;  1QXM A;  3RTJ B;  5FZZ A;  3N7K A;  4LO7 C;  3AZV A;  4IQP A;  4DEP A;  4I4V A;  4A7Z A;  2Z49 A;  3CU1 B;  3TC2 A;  2Y9F A;  3BA7 A;  3AKH A;  3VSZ A;  1DJS B;  3IAG C;  3O4D A;  3CA4 A;  2MIB A;  4GP3 A;  1BFG A;  1ABR B;  1W3G A;  4P6A A;  3BRD A;  1V6U A;  4JRA A;  3WIN A;  3HBW A;  3NJ5 A;  5I1B A;  4I4P A;  4JQ0 A;  1P63 A;  3V79 C;  3CA6 A;  1IT0 A;  4TLP A;  5DSS B;  4IZE A;  3FJD A;  4I4Y A;  4QO3 A;  3WIN C;  2DRE A;  3RMY A;  4X38 A;  4GOV A;  4I3N A;  2P39 A;  3VWC A;  3WO3 A;  1RY7 A;  3HN1 A;  1ISV A;  1MC9 A;  1Q03 A;  4J23 B;  1DFC A;  1G9C A;  4LO1 A;  1QQK A;  4IYB A;  3C9Z A;  3UJ4 A;  4IY8 A;  1AVX B;  1ONK B;  2VSE A;  5GAQ A;  1Z2V A;  3LLP A;  3S8K A;  3UJ0 A;  2K43 A;  3O44 A;  2Z48 A;  3A22 A;  3CQA A;  4GOY A;  7I1B A;  1G82 A;  2RQ9 A;  4LO1 C;  1OQL B;  3O49 A;  3BA4 A;  4DCK C;  4Q91 A;  5BXS A;  1I1E A;  2R9K B;  1FWV A;  3BAO A;  1RG8 A;  3V0A B;  3T8S A;  5BOW A;  1BA7 A;  4DEN A;  3OBT A;  2BEB A;  4ZFW B;  2D43 A;  4JPZ A;  1SR4 A;  3NBD A;  5BVP I;  4P0J A;  5D61 A;  4USO A;  3KMV A;  2P23 A;  3P6I A;  3ZXD A;  1DZD A;  3BAV A;  1JTC A;  3ZXG A;  4F83 A;  5FZY A;  3VT1 A;  3FFZ A;  1SR4 C;  1S0F A;  4KC3 A;  1HWO B;  4OEG A;  2NYY A;  2ERM A;  5BP5 C;  3VSF A;  5EHA A;  4ZLB B;  2VSA A;  5BXP A;  4ZGR B;  4H9W A;  4ZBV B;  1AF9 A;  3K1X A;  1ISW A;  2AQZ A;  3BAH A;  4I4U A;  1JLY A;  2D7R A;  5DZU A;  4G6J A;  2X2S A;  4G6M A;  4ZA3 B;  3H6Q A;  2VUA A;  4I4Q A;  1W3F A;  3O4B A;  1A8D A;  3ILA A;  4OWK A;  4H75 A;  1DQG A;  4ISR A;  5FNX A;  4J2X A;  2DRY A;  4JKX B;  3O3Q A;  1Q1U A;  3RSJ A;  2BFH A;  1R8N A;  3WA1 A;  3PUB A;  1CVS A;  1CE7 B;  4IHZ A;  1IOB A;  4I8M A;  2X2T A;  1S0L A;  2Y9G A;  4CJM A;  1KNM A;  3AH4 A;  1IRP A;  4AN7 B;  1TOO A;  1L2H A;  4QBV A;  4ION A;  1M16 A;  1SZ6 B;  2D20 A;  3IM6 A;  2L5X A;  3WMU A;  4J2Y A;  4MZH A;  4IZX A;  4KBB A;  3FJE A;  3AKI A;  3AKG A;  2D22 A;  5JLV A;  2I1B A;  4JAW A;  3MPP G;  1PUM B;  3WO2 A;  3F62 B;  3BA5 A;  4AN6 A;  1BLD A;  2VXR A;  4JKQ A;  3BAU A;  1G9A A;  3VT2 A;  2VLC A;  5FNW A;  1S0G A;  2J3P A;  4Z9W B;  2FFU A;  3HOM A;  1YTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...