3FKMX

Plasmodium falciparum bromodomain-containing protein pf10_0328
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
120
Chain Sequence
QGNKQWYLLANQLILSLSKYEGGHIFEKLVDCPDYYDVIKNPMSFSCIKTKLKKGQYAYPSEFVKDVQLIFDNCSLYNTSNSVVAITGKNIETYFNNQLIVMGYNNFILKEKKINDMLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signaling protein
publication title Plasmodium falciparum bromodomain-containing protein PF10_0328
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Signaling protein
total genus 40
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3fkmX00
5C8GA 5CY9A 4Z93A 2E7NA 4HBYA 4QSPA 4CURA 3NXBA 4UIUA 5FE6A 4QR5A 5ENEA 5CUDA 4N4GA 4PKLA 3K2JA 5FBXA 5J0DA 5LKZA 5F60A 4BJXA 2I8NA 5E3GA 5E9LA 4HBXA 3O33A 4HXRA 5EI4A 3U5KA 3QZSA 5ETDA 4QR3A 5CQ6A 5L8TA 5CQ7A 5IG6A 5CU8A 2WP2A 4MEPA 5CUCA 5A83A 2FSAA 5D3HA 5FH6A 4O75A 4J1PA 4O76A 3G0LA 4QSSA 5LUUA 3I3JA 4CL9A 5LVQA 5CRMA 4UYHA 4UYGA 3UVXA 2DVRA 5EGUA 2NXBA 4CLBA 5D0CA 5KTUA 4XUBA 5FE2A 4KV4A 3U5OA 4LYWA 4X2IA 4TT6A 4LZRA 5LJ0A 3U5NA 1ZS5A 5CRZA 3ZYUA 5EP7A 5IGNA 4MEQA 4IR6A 5KU3A 4YK0A 4QC1A 2DVVA 4NR5A 2YELA 4TT2A 3JVMA 5C7NA 5LKXA 3UVYA 5H1UA 5LKUA 5A82A 5FH8A 5EWWA 4O77A 5E7DA 3FKMX 5FE3A 5E9KA 4BW2A 5EICA 4A9LA 5CP5A 5FE8A 2DATA 4Y03A 2F6NA 5DW2A 5FG5A 5L97A 1N72A 4UIYA 4NR9A 3JVKA 4KCXA 1E6IA 4NUEA 3O36A 5C4QA 5D3NA 5EU1A 4O74A 5CUBA 5HFQA 5A5QA 5I40A 3LJWA 5HQ6A 4QSQA 5HEMA 4O7AA 2D82A 5H85A 3P1CA 4HXLA 4QYDA 5F25A 5A7CA 5HFRA 4UIXA 4TZ2A 4LZSA 3ONIA 4IR4A 5HRVA 5JI8A 5I86A 4ZQLA 1JSPB 5EV9A 2RNWA 2RNXA 5E73A 5I83A 4UYEA 5EQ1A 5D24A 5HELA 2DWWA 4XUAA 4N4IA 5HCLA 5A81A 4HXNA 5ENFA 4YYIA 5DLXA 5H1TA 4QUTA 5FE0A 5EWDA 4YYKA 2L84A 4MR5A 3MXFA 2WP1A 2OUOA 4QUUA 4HXOA 4ALHA 4CUQA 5EPSA 4QB3A 5HM0A 3AQAA 4PY6A 3U5MA 5L98A 3QZTA 3JVJA 2RO1A 2DVSA 4QYLA 4LDFA 4XYAA 4E96A 3LQIA 4XY9A 5CQAA 5ENIA 4C67A 4YYHA 4HXSA 2DVQA 4O7EA 4OGJA 5I89A 4TTEA 5II1A 4YY4A 3LQJA 2OSSA 5DKHA 2RNYA 5E9YA 4J0SA 3S91A 5E9MA 3G0JA 4QSRA 5LVRA 3MUKA 4MR6A 5CZGA 4A9EA 2R0SA 5BT3A 4ZW1A 4O7BA 3DWYA 4UYFB 3O35A 1EQFA 4N3WA 5D3RA 5EISA 4HBVA 5C85A 5EPBA 3DAIA 5DFDA 5F62A 4DONA 4QY4A 4A9FA 5HRXA 5IBNA 5FH7A 5CFWA 4YBMA 5FE1A 5AD2A 5DYUA 3MULA 5ENBA 5KTWA 5FDZA 3UV2A 4TQNA 4HXMA 4TT4A 4HXPA 5E9VA 5F2PA 4MR3A 2DKWA 5CQ8A 5DKDA 4NQMA 5D7XA 5KHMA 4O7FA 5ENJA 4KV1A 5I1QA 2YEKA 4QSTA 4RVRA 5CGPA 3UV5A 5DBMA 1JM4B 5FG4A 4YAXA 4QZSA 5FE9A 4Z6HA 3U5JA 5G4SA 5A5RA 2L85A 5CQ4A 5FG6A 4QEVA 4UIWA 4BW4A 5I80A 4NR7A 3JVLA 5AD3A 3QZVA 5FE4A 1WUGA 4A9HA 4Q0OA 4Z1SA 4CUTA 4TS8A 4YH3A 2YQDA 5CUAA 5G4RA 4TYLA 5AMEA 4NR8A 4NQNA 4ALGA 4HXKA 4NRCA 5ENCA 4UIZA 3TLPA 5CTLA 5D26A 2N9GA 5I7XA 4YYMA 4IOQA 4MR4A 4NS5A 4IORA 4UITA 5A5NA 3IU5A 5CQ3A 4NXJA 2R10A 3Q2FA 4MEOA 3GG3A 4QEUA 5D3PA 4NYXA 5I29A 2LSPB 5D3LA 3P1FA 2R0VA 2F6JA 5F5ZA 5KO4A 4CUUA 3AADA 5IGMA 5BT4A 5H1VA 4OUFA 3MQMA 3RCWA 4CUPA 5C87A 4QSVA 3SVFA 4YY6A 5F1LA 4BW3A 3U5LA 5DYCA 5F36A 4Z1QA 4O72A 5DKCA 5II2A 4YBSA 4XY8A 5LJ2A 5C89A 5FFWA 3UVWA 2E3KA 4LYSA 4A9KA 4YYNA 4A9IA 3O37A 4QR4A 5EK9A 4J3IA 4NUDA 4O70A 5DFCA 4LR6A 5CUEA 2YDWA 2YEMA 5CS8A 5E74A 5DFBA 3MB4A 4QSXA 5KTXA 4FLPA 4PS5A 2GRCA 5E9IA 2R0YA 1F68A 5F3AA 4YYDA 3P1DA 3O34A 5DYXA 4NR4A 5ENHA 5HENA 5CQTA 3HMEA 2D9EA 4CFKA 4UYDA 2L5EA 5EWCA 4YADA 4OGIA 5TCMA 4QEWA 4PCIA 5D25A 5EWHA 4GPJA 5DX4A 5L96A 4TU4A 4UIVA 5A5OA 5A5SA 5JWMA 2RS9B 4QNSA 1WUMA 5F63A 5EWVA 4QSUA 5CUGA 4LYIA 5EVAA 3MB3A 3D7CA 4CFLA 4PCEA 4UYFA 3P5OA 5LKTA 4NRAA 2OO1A 4YH4A 4QBMA 2YW5A 4NR6A 5HJCA 5D3JA 3HMFA 4A9NA 5BT5A 2H60A 5EPRA 4TU6A 3LXJA 4LC2A 5HQ7A 4HBWA 5A5PA 4TZ8A 4IR3A 5CQ5A 4WHWA 3U5PA 5DLZA 2KTBB 4F3IA 4BW1A 5DYAA 3IU6A 4ZC9A 5FB1A 5I88A 5IGKA 2RFJA 3SVHA 4IR5A 5DY7A 4C66A 5AMFA 4A9JA 4QC3A 5EA1A 5I7YA 5F1HA 5LJ1A 4YYGA 4NRBA 3P1EA 3Q2EA 3UV4A 5HRWA 2E7OA 3LQHA 4Q0NA 5EM3A 5F61A 5TB6A 2YYNA 3S92A 5COIA 4A9OA 2I7KA 4CUSA 4LZ2A 5K29A 4O78A 5L8UA 4YATA 2MJVB 5HQ5A 4Z6IA 5FB0A 4YC9A 5ETBA 4NYWA 4MENA 5A85A 5CPEA 4PTBA 4YYJA 5FFYA 4O7CA 5FE7A 4N4HA 5E0RA 1X0JA 4N4FA 4O71A 5L99A 5ACYA 5IIDA 2G4AA 3UW9A 5IGLA 5FE5A 4IOOA 5HLSA 4AKNA 4WHUA 4NUCA 4J0RA 5FFVA 5DW1A 5D3TA 5D3SA 3SVGA 3HMHA 4WIVA 2RI7A 4BHWA 4QSWA 3UVDA 4YBTA 4A9MA 4LRGA 4YABA 4NYVA 5E3DA 5ENGA
chains in the Genus database with same CATH superfamily
5C8GA 5CY9A 4Z93A 2E7NA 4HBYA 4QSPA 4CURA 3NXBA 4UIUA 4AKHA 5FE6A 4QR5A 5ENEA 5CUDA 4N4GA 4PKLA 3K2JA 5FBXA 5J0DA 5LKZA 5F60A 4BJXA 2I8NA 5E3GA 5E9LA 4HBXA 3O33A 4HXRA 5EI4A 3U5KA 3QZSA 5ETDA 4QR3A 5CQ6A 5L8TA 5CQ7A 5IG6A 5CU8A 2WP2A 4MEPA 5CUCA 5A83A 2FSAA 5D3HA 5FH6A 4O75A 4J1PA 4O76A 3G0LA 4QSSA 5LUUA 3I3JA 4CL9A 5LVQA 5CRMA 4UYHA 4UYGA 3UVXA 2DVRA 5EGUA 2NXBA 4CLBA 5D0CA 5KTUA 4XUBA 5FE2A 4KV4A 3U5OA 4LYWA 4X2IA 4TT6A 4LZRA 5LJ0A 3U5NA 1ZS5A 5CRZA 3ZYUA 5EP7A 5IGNA 4MEQA 4IR6A 5KU3A 4YK0A 4QC1A 2DVVA 4NR5A 2YELA 4TT2A 3JVMA 5C7NA 5LKXA 3UVYA 5H1UA 5LKUA 5A82A 5FH8A 5EWWA 4O77A 5E7DA 3FKMX 5FE3A 5E9KA 4BW2A 5EICA 4A9LA 5CP5A 5FE8A 2DATA 4Y03A 2F6NA 5DW2A 5FG5A 5L97A 1N72A 4UIYA 4NR9A 3JVKA 4KCXA 1E6IA 4NUEA 3O36A 5C4QA 5D3NA 5EU1A 4O74A 5CUBA 5HFQA 5A5QA 5I40A 3LJWA 5HQ6A 4QSQA 5HEMA 4O7AA 2D82A 5H85A 3P1CA 4HXLA 4QYDA 5F25A 5A7CA 5HFRA 4UIXA 4TZ2A 4LZSA 3ONIA 4IR4A 5HRVA 5JI8A 5I86A 4ZQLA 1JSPB 5EV9A 2RNWA 2RNXA 5E73A 5I83A 4UYEA 5EQ1A 5D24A 5HELA 2DWWA 4XUAA 4N4IA 5HCLA 5A81A 4HXNA 5ENFA 4YYIA 5DLXA 5H1TA 4QUTA 5FE0A 5EWDA 4YYKA 2L84A 4MR5A 3MXFA 2WP1A 2OUOA 4QUUA 4HXOA 4ALHA 4CUQA 5EPSA 4QB3A 5HM0A 3AQAA 4PY6A 3U5MA 5L98A 3QZTA 3JVJA 2RO1A 2DVSA 4QYLA 4LDFA 4XYAA 4E96A 3LQIA 4XY9A 5CQAA 5ENIA 4C67A 4YYHA 4HXSA 2DVQA 4O7EA 4OGJA 5I89A 4TTEA 5II1A 4YY4A 3LQJA 2OSSA 5DKHA 2EJNA 2RNYA 5E9YA 4J0SA 3S91A 5E9MA 3G0JA 4QSRA 5LVRA 3MUKA 4MR6A 5CZGA 4A9EA 4AKGA 2R0SA 5BT3A 4ZW1A 4O7BA 3DWYA 4UYFB 3O35A 1EQFA 4N3WA 5D3RA 5EISA 4HBVA 5C85A 5EPBA 3DAIA 5DFDA 5F62A 4DONA 4QY4A 4A9FA 5HRXA 5IBNA 5FH7A 5CFWA 4YBMA 5FE1A 5AD2A 5DYUA 3MULA 5ENBA 5KTWA 5FDZA 3UV2A 4TQNA 4HXMA 4TT4A 4HXPA 5E9VA 5F2PA 4MR3A 2DKWA 5CQ8A 5DKDA 4NQMA 5D7XA 5KHMA 4O7FA 5ENJA 4KV1A 5I1QA 2YEKA 4QSTA 4RVRA 5CGPA 3UV5A 5DBMA 1JM4B 5FG4A 4YAXA 4QZSA 5FE9A 4Z6HA 3U5JA 1ZKRA 5G4SA 5A5RA 2L85A 5CQ4A 5FG6A 4QEVA 4UIWA 4BW4A 5I80A 4NR7A 3JVLA 5AD3A 3QZVA 5FE4A 1WUGA 4A9HA 4Q0OA 4Z1SA 4CUTA 4TS8A 4YH3A 2YQDA 5CUAA 5G4RA 4TYLA 5AMEA 4NR8A 4NQNA 4ALGA 4HXKA 4NRCA 5ENCA 3VKGA 4UIZA 3TLPA 5CTLA 5D26A 2N9GA 5I7XA 4YYMA 4IOQA 4MR4A 4NS5A 4IORA 4UITA 5A5NA 3IU5A 5CQ3A 4NXJA 3D1BA 2R10A 3Q2FA 4MEOA 3GG3A 4QEUA 5D3PA 4NYXA 5I29A 2LSPB 5D3LA 3P1FA 2R0VA 2F6JA 5F5ZA 5KO4A 4CUUA 3AADA 5IGMA 5BT4A 3VKHA 5H1VA 3D1DA 4OUFA 3MQMA 3RCWA 4CUPA 5C87A 4QSVA 3SVFA 4YY6A 5F1LA 4BW3A 3U5LA 5DYCA 5F36A 4Z1QA 4O72A 5DKCA 5II2A 4YBSA 4XY8A 5LJ2A 5C89A 5FFWA 3UVWA 2E3KA 4LYSA 4A9KA 4YYNA 4A9IA 3O37A 4QR4A 5EK9A 4J3IA 4NUDA 4O70A 5DFCA 4LR6A 5CUEA 2YDWA 2YEMA 5CS8A 5E74A 5DFBA 3MB4A 4QSXA 5KTXA 4FLPA 4PS5A 2GRCA 5E9IA 2R0YA 1F68A 5F3AA 4YYDA 3P1DA 3O34A 5DYXA 4NR4A 5ENHA 5HENA 5CQTA 3HMEA 2D9EA 4CFKA 4UYDA 2L5EA 5EWCA 4YADA 4OGIA 5TCMA 4QEWA 4PCIA 5D25A 5EWHA 4GPJA 5DX4A 5L96A 4TU4A 4UIVA 5A5OA 5A5SA 5JWMA 2RS9B 4QNSA 1WUMA 5F63A 5EWVA 4QSUA 5CUGA 4LYIA 5EVAA 4AKIA 3MB3A 3D7CA 4CFLA 4PCEA 4UYFA 3ERRA 3P5OA 5LKTA 4NRAA 2OO1A 4YH4A 4QBMA 2YW5A 4NR6A 5HJCA 5D3JA 3HMFA 4A9NA 5BT5A 2H60A 5EPRA 4TU6A 3LXJA 4LC2A 5HQ7A 4HBWA 5A5PA 4TZ8A 4IR3A 5CQ5A 4WHWA 3U5PA 5DLZA 2KTBB 4F3IA 4BW1A 5DYAA 3IU6A 4ZC9A 5FB1A 5I88A 5IGKA 2RFJA 3SVHA 4IR5A 5DY7A 4C66A 5AMFA 4A9JA 4QC3A 5EA1A 5I7YA 5F1HA 5LJ1A 4YYGA 4NRBA 3P1EA 3Q2EA 3UV4A 5HRWA 2E7OA 3LQHA 4Q0NA 5EM3A 5F61A 5TB6A 2YYNA 3S92A 5COIA 4A9OA 2I7KA 4CUSA 4LZ2A 5K29A 4O78A 5L8UA 4YATA 2MJVB 5HQ5A 4Z6IA 5FB0A 4YC9A 4AI6A 5ETBA 4NYWA 4MENA 5A85A 5CPEA 4PTBA 4YYJA 5FFYA 4O7CA 5FE7A 4N4HA 1PUOA 5E0RA 1X0JA 4N4FA 4O71A 5L99A 5ACYA 5IIDA 2G4AA 3UW9A 5IGLA 5FE5A 4IOOA 5HLSA 4AKNA 4WHUA 4NUCA 4J0RA 5FFVA 5DW1A 5D3TA 5D3SA 3SVGA 3HMHA 4WIVA 2RI7A 4BHWA 4QSWA 3UVDA 4YBTA 4A9MA 4LRGA 4YABA 4NYVA 5E3DA 5ENGA
chains in the Genus database with same CATH topology
5C8GA 5CY9A 4Z93A 2E7NA 4HBYA 4QSPA 4CURA 3NXBA 4UIUA 5FE6A 4QR5A 5ENEA 5CUDA 4N4GA 4PKLA 3K2JA 5FBXA 5J0DA 5LKZA 5F60A 4BJXA 2I8NA 5E3GA 5E9LA 4HBXA 3O33A 4HXRA 5EI4A 3U5KA 3QZSA 5ETDA 4QR3A 5CQ6A 5L8TA 5CQ7A 5IG6A 5CU8A 2WP2A 4MEPA 5CUCA 5A83A 2FSAA 5D3HA 5FH6A 4O75A 4J1PA 4O76A 3G0LA 4QSSA 5LUUA 3I3JA 4CL9A 5LVQA 5CRMA 4UYHA 4UYGA 3UVXA 2DVRA 5EGUA 2NXBA 4CLBA 5D0CA 5KTUA 4XUBA 5FE2A 4KV4A 3U5OA 4LYWA 4X2IA 4TT6A 4LZRA 5LJ0A 3U5NA 1ZS5A 5CRZA 3ZYUA 5EP7A 5IGNA 4MEQA 4IR6A 5KU3A 4YK0A 4QC1A 2DVVA 4NR5A 2YELA 4TT2A 3JVMA 5C7NA 5LKXA 3UVYA 5H1UA 5LKUA 5A82A 5FH8A 5EWWA 4O77A 5E7DA 3FKMX 5FE3A 5E9KA 4BW2A 5EICA 4A9LA 5CP5A 5FE8A 2DATA 4Y03A 2F6NA 5DW2A 5FG5A 5L97A 1N72A 4UIYA 4NR9A 3JVKA 4KCXA 1E6IA 4NUEA 3O36A 5C4QA 5D3NA 5EU1A 4O74A 5CUBA 5HFQA 5A5QA 5I40A 3LJWA 5HQ6A 4QSQA 5HEMA 4O7AA 2D82A 5H85A 3P1CA 4HXLA 4QYDA 5F25A 5A7CA 5HFRA 4UIXA 4TZ2A 4LZSA 3ONIA 4IR4A 5HRVA 5JI8A 5I86A 4ZQLA 1JSPB 5EV9A 2RNWA 2RNXA 5E73A 5I83A 4UYEA 5EQ1A 5D24A 5HELA 2DWWA 4XUAA 4N4IA 5HCLA 5A81A 4HXNA 5ENFA 4YYIA 5DLXA 5H1TA 4QUTA 5FE0A 5EWDA 4YYKA 2L84A 4MR5A 3MXFA 2WP1A 2OUOA 4QUUA 4HXOA 4ALHA 4CUQA 5EPSA 4QB3A 5HM0A 3AQAA 4PY6A 3U5MA 5L98A 3QZTA 3JVJA 2RO1A 2DVSA 4QYLA 4LDFA 4XYAA 4E96A 3LQIA 4XY9A 5CQAA 5ENIA 4C67A 4YYHA 4HXSA 2DVQA 4O7EA 4OGJA 5I89A 4TTEA 5II1A 4YY4A 3LQJA 2OSSA 5DKHA 2RNYA 5E9YA 4J0SA 3S91A 5E9MA 3G0JA 4QSRA 5LVRA 3MUKA 4MR6A 5CZGA 4A9EA 2R0SA 5BT3A 4ZW1A 4O7BA 3DWYA 4UYFB 3O35A 1EQFA 4N3WA 5D3RA 5EISA 4HBVA 5C85A 5EPBA 3DAIA 5DFDA 5F62A 4DONA 4QY4A 4A9FA 5HRXA 5IBNA 5FH7A 5CFWA 4YBMA 5FE1A 5AD2A 5DYUA 3MULA 5ENBA 5KTWA 5FDZA 3UV2A 4TQNA 4HXMA 4TT4A 4HXPA 5E9VA 5F2PA 4MR3A 2DKWA 5CQ8A 5DKDA 4NQMA 5D7XA 5KHMA 4O7FA 5ENJA 4KV1A 5I1QA 2YEKA 4QSTA 4RVRA 5CGPA 3UV5A 5DBMA 1JM4B 5FG4A 4YAXA 4QZSA 5FE9A 4Z6HA 3U5JA 5G4SA 5A5RA 2L85A 5CQ4A 5FG6A 4QEVA 4UIWA 4BW4A 5I80A 4NR7A 3JVLA 5AD3A 3QZVA 5FE4A 1WUGA 4A9HA 4Q0OA 4Z1SA 4CUTA 4TS8A 4YH3A 2YQDA 5CUAA 5G4RA 4TYLA 5AMEA 4NR8A 4NQNA 4ALGA 4HXKA 4NRCA 5ENCA 4UIZA 3TLPA 5CTLA 5D26A 2N9GA 5I7XA 4YYMA 4IOQA 4MR4A 4NS5A 4IORA 4UITA 5A5NA 3IU5A 5CQ3A 4NXJA 2R10A 3Q2FA 4MEOA 3GG3A 4QEUA 5D3PA 4NYXA 5I29A 2LSPB 5D3LA 3P1FA 2R0VA 2F6JA 5F5ZA 5KO4A 4CUUA 3AADA 5IGMA 5BT4A 5H1VA 4OUFA 3MQMA 3RCWA 4CUPA 5C87A 4QSVA 3SVFA 4YY6A 5F1LA 4BW3A 3U5LA 5DYCA 5F36A 4Z1QA 4O72A 5DKCA 5II2A 4YBSA 4XY8A 5LJ2A 5C89A 5FFWA 3UVWA 2E3KA 4LYSA 4A9KA 4YYNA 4A9IA 3O37A 4QR4A 5EK9A 4J3IA 4NUDA 4O70A 5DFCA 4LR6A 5CUEA 2YDWA 2YEMA 5CS8A 5E74A 5DFBA 3MB4A 4QSXA 5KTXA 4FLPA 4PS5A 2GRCA 5E9IA 2R0YA 1F68A 5F3AA 4YYDA 3P1DA 3O34A 5DYXA 4NR4A 5ENHA 5HENA 5CQTA 3HMEA 2D9EA 4CFKA 4UYDA 2L5EA 5EWCA 4YADA 4OGIA 5TCMA 4QEWA 4PCIA 5D25A 5EWHA 4GPJA 5DX4A 5L96A 4TU4A 4UIVA 5A5OA 5A5SA 5JWMA 2RS9B 4QNSA 1WUMA 5F63A 5EWVA 4QSUA 5CUGA 4LYIA 5EVAA 3MB3A 3D7CA 4CFLA 4PCEA 4UYFA 3P5OA 5LKTA 4NRAA 2OO1A 4YH4A 4QBMA 2YW5A 4NR6A 5HJCA 5D3JA 3HMFA 4A9NA 5BT5A 2H60A 5EPRA 4TU6A 3LXJA 4LC2A 5HQ7A 4HBWA 5A5PA 4TZ8A 4IR3A 5CQ5A 4WHWA 3U5PA 5DLZA 2KTBB 4F3IA 4BW1A 5DYAA 3IU6A 4ZC9A 5FB1A 5I88A 5IGKA 2RFJA 3SVHA 4IR5A 5DY7A 4C66A 5AMFA 4A9JA 4QC3A 5EA1A 5I7YA 5F1HA 5LJ1A 4YYGA 4NRBA 3P1EA 3Q2EA 3UV4A 5HRWA 2E7OA 3LQHA 4Q0NA 5EM3A 5F61A 5TB6A 2YYNA 3S92A 5COIA 4A9OA 2I7KA 4CUSA 4LZ2A 5K29A 4O78A 5L8UA 4YATA 2MJVB 5HQ5A 4Z6IA 5FB0A 4YC9A 5ETBA 4NYWA 4MENA 5A85A 5CPEA 4PTBA 4YYJA 5FFYA 4O7CA 5FE7A 4N4HA 5E0RA 1X0JA 4N4FA 4O71A 5L99A 5ACYA 5IIDA 2G4AA 3UW9A 5IGLA 5FE5A 4IOOA 5HLSA 4AKNA 4WHUA 4NUCA 4J0RA 5FFVA 5DW1A 5D3TA 5D3SA 3SVGA 3HMHA 4WIVA 2RI7A 4BHWA 4QSWA 3UVDA 4YBTA 4A9MA 4LRGA 4YABA 4NYVA 5E3DA 5ENGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C8G A;  5CY9 A;  4Z93 A;  2E7N A;  4HBY A;  4QSP A;  4CUR A;  3NXB A;  4UIU A;  5FE6 A;  4QR5 A;  5ENE A;  5CUD A;  4N4G A;  4PKL A;  3K2J A;  5FBX A;  5J0D A;  5LKZ A;  5F60 A;  4BJX A;  2I8N A;  5E3G A;  5E9L A;  4HBX A;  3O33 A;  4HXR A;  5EI4 A;  3U5K A;  3QZS A;  5ETD A;  4QR3 A;  5CQ6 A;  5L8T A;  5CQ7 A;  5IG6 A;  5CU8 A;  2WP2 A;  4MEP A;  5CUC A;  5A83 A;  2FSA A;  5D3H A;  5FH6 A;  4O75 A;  4J1P A;  4O76 A;  3G0L A;  4QSS A;  5LUU A;  3I3J A;  4CL9 A;  5LVQ A;  5CRM A;  4UYH A;  4UYG A;  3UVX A;  2DVR A;  5EGU A;  2NXB A;  4CLB A;  5D0C A;  5KTU A;  4XUB A;  5FE2 A;  4KV4 A;  3U5O A;  4LYW A;  4X2I A;  4TT6 A;  4LZR A;  5LJ0 A;  3U5N A;  1ZS5 A;  5CRZ A;  3ZYU A;  5EP7 A;  5IGN A;  4MEQ A;  4IR6 A;  5KU3 A;  4YK0 A;  4QC1 A;  2DVV A;  4NR5 A;  2YEL A;  4TT2 A;  3JVM A;  5C7N A;  5LKX A;  3UVY A;  5H1U A;  5LKU A;  5A82 A;  5FH8 A;  5EWW A;  4O77 A;  5E7D A;  3FKM X;  5FE3 A;  5E9K A;  4BW2 A;  5EIC A;  4A9L A;  5CP5 A;  5FE8 A;  2DAT A;  4Y03 A;  2F6N A;  5DW2 A;  5FG5 A;  5L97 A;  1N72 A;  4UIY A;  4NR9 A;  3JVK A;  4KCX A;  1E6I A;  4NUE A;  3O36 A;  5C4Q A;  5D3N A;  5EU1 A;  4O74 A;  5CUB A;  5HFQ A;  5A5Q A;  5I40 A;  3LJW A;  5HQ6 A;  4QSQ A;  5HEM A;  4O7A A;  2D82 A;  5H85 A;  3P1C A;  4HXL A;  4QYD A;  5F25 A;  5A7C A;  5HFR A;  4UIX A;  4TZ2 A;  4LZS A;  3ONI A;  4IR4 A;  5HRV A;  5JI8 A;  5I86 A;  4ZQL A;  1JSP B;  5EV9 A;  2RNW A;  2RNX A;  5E73 A;  5I83 A;  4UYE A;  5EQ1 A;  5D24 A;  5HEL A;  2DWW A;  4XUA A;  4N4I A;  5HCL A;  5A81 A;  4HXN A;  5ENF A;  4YYI A;  5DLX A;  5H1T A;  4QUT A;  5FE0 A;  5EWD A;  4YYK A;  2L84 A;  4MR5 A;  3MXF A;  2WP1 A;  2OUO A;  4QUU A;  4HXO A;  4ALH A;  4CUQ A;  5EPS A;  4QB3 A;  5HM0 A;  3AQA A;  4PY6 A;  3U5M A;  5L98 A;  3QZT A;  3JVJ A;  2RO1 A;  2DVS A;  4QYL A;  4LDF A;  4XYA A;  4E96 A;  3LQI A;  4XY9 A;  5CQA A;  5ENI A;  4C67 A;  4YYH A;  4HXS A;  2DVQ A;  4O7E A;  4OGJ A;  5I89 A;  4TTE A;  5II1 A;  4YY4 A;  3LQJ A;  2OSS A;  5DKH A;  2RNY A;  5E9Y A;  4J0S A;  3S91 A;  5E9M A;  3G0J A;  4QSR A;  5LVR A;  3MUK A;  4MR6 A;  5CZG A;  4A9E A;  2R0S A;  5BT3 A;  4ZW1 A;  4O7B A;  3DWY A;  4UYF B;  3O35 A;  1EQF A;  4N3W A;  5D3R A;  5EIS A;  4HBV A;  5C85 A;  5EPB A;  3DAI A;  5DFD A;  5F62 A;  4DON A;  4QY4 A;  4A9F A;  5HRX A;  5IBN A;  5FH7 A;  5CFW A;  4YBM A;  5FE1 A;  5AD2 A;  5DYU A;  3MUL A;  5ENB A;  5KTW A;  5FDZ A;  3UV2 A;  4TQN A;  4HXM A;  4TT4 A;  4HXP A;  5E9V A;  5F2P A;  4MR3 A;  2DKW A;  5CQ8 A;  5DKD A;  4NQM A;  5D7X A;  5KHM A;  4O7F A;  5ENJ A;  4KV1 A;  5I1Q A;  2YEK A;  4QST A;  4RVR A;  5CGP A;  3UV5 A;  5DBM A;  1JM4 B;  5FG4 A;  4YAX A;  4QZS A;  5FE9 A;  4Z6H A;  3U5J A;  5G4S A;  5A5R A;  2L85 A;  5CQ4 A;  5FG6 A;  4QEV A;  4UIW A;  4BW4 A;  5I80 A;  4NR7 A;  3JVL A;  5AD3 A;  3QZV A;  5FE4 A;  1WUG A;  4A9H A;  4Q0O A;  4Z1S A;  4CUT A;  4TS8 A;  4YH3 A;  2YQD A;  5CUA A;  5G4R A;  4TYL A;  5AME A;  4NR8 A;  4NQN A;  4ALG A;  4HXK A;  4NRC A;  5ENC A;  4UIZ A;  3TLP A;  5CTL A;  5D26 A;  2N9G A;  5I7X A;  4YYM A;  4IOQ A;  4MR4 A;  4NS5 A;  4IOR A;  4UIT A;  5A5N A;  3IU5 A;  5CQ3 A;  4NXJ A;  2R10 A;  3Q2F A;  4MEO A;  3GG3 A;  4QEU A;  5D3P A;  4NYX A;  5I29 A;  2LSP B;  5D3L A;  3P1F A;  2R0V A;  2F6J A;  5F5Z A;  5KO4 A;  4CUU A;  3AAD A;  5IGM A;  5BT4 A;  5H1V A;  4OUF A;  3MQM A;  3RCW A;  4CUP A;  5C87 A;  4QSV A;  3SVF A;  4YY6 A;  5F1L A;  4BW3 A;  3U5L A;  5DYC A;  5F36 A;  4Z1Q A;  4O72 A;  5DKC A;  5II2 A;  4YBS A;  4XY8 A;  5LJ2 A;  5C89 A;  5FFW A;  3UVW A;  2E3K A;  4LYS A;  4A9K A;  4YYN A;  4A9I A;  3O37 A;  4QR4 A;  5EK9 A;  4J3I A;  4NUD A;  4O70 A;  5DFC A;  4LR6 A;  5CUE A;  2YDW A;  2YEM A;  5CS8 A;  5E74 A;  5DFB A;  3MB4 A;  4QSX A;  5KTX A;  4FLP A;  4PS5 A;  2GRC A;  5E9I A;  2R0Y A;  1F68 A;  5F3A A;  4YYD A;  3P1D A;  3O34 A;  5DYX A;  4NR4 A;  5ENH A;  5HEN A;  5CQT A;  3HME A;  2D9E A;  4CFK A;  4UYD A;  2L5E A;  5EWC A;  4YAD A;  4OGI A;  5TCM A;  4QEW A;  4PCI A;  5D25 A;  5EWH A;  4GPJ A;  5DX4 A;  5L96 A;  4TU4 A;  4UIV A;  5A5O A;  5A5S A;  5JWM A;  2RS9 B;  4QNS A;  1WUM A;  5F63 A;  5EWV A;  4QSU A;  5CUG A;  4LYI A;  5EVA A;  3MB3 A;  3D7C A;  4CFL A;  4PCE A;  4UYF A;  3P5O A;  5LKT A;  4NRA A;  2OO1 A;  4YH4 A;  4QBM A;  2YW5 A;  4NR6 A;  5HJC A;  5D3J A;  3HMF A;  4A9N A;  5BT5 A;  2H60 A;  5EPR A;  4TU6 A;  3LXJ A;  4LC2 A;  5HQ7 A;  4HBW A;  5A5P A;  4TZ8 A;  4IR3 A;  5CQ5 A;  4WHW A;  3U5P A;  5DLZ A;  2KTB B;  4F3I A;  4BW1 A;  5DYA A;  3IU6 A;  4ZC9 A;  5FB1 A;  5I88 A;  5IGK A;  2RFJ A;  3SVH A;  4IR5 A;  5DY7 A;  4C66 A;  5AMF A;  4A9J A;  4QC3 A;  5EA1 A;  5I7Y A;  5F1H A;  5LJ1 A;  4YYG A;  4NRB A;  3P1E A;  3Q2E A;  3UV4 A;  5HRW A;  2E7O A;  3LQH A;  4Q0N A;  5EM3 A;  5F61 A;  5TB6 A;  2YYN A;  3S92 A;  5COI A;  4A9O A;  2I7K A;  4CUS A;  4LZ2 A;  5K29 A;  4O78 A;  5L8U A;  4YAT A;  2MJV B;  5HQ5 A;  4Z6I A;  5FB0 A;  4YC9 A;  5ETB A;  4NYW A;  4MEN A;  5A85 A;  5CPE A;  4PTB A;  4YYJ A;  5FFY A;  4O7C A;  5FE7 A;  4N4H A;  5E0R A;  1X0J A;  4N4F A;  4O71 A;  5L99 A;  5ACY A;  5IID A;  2G4A A;  3UW9 A;  5IGL A;  5FE5 A;  4IOO A;  5HLS A;  4AKN A;  4WHU A;  4NUC A;  4J0R A;  5FFV A;  5DW1 A;  5D3T A;  5D3S A;  3SVG A;  3HMH A;  4WIV A;  2RI7 A;  4BHW A;  4QSW A;  3UVD A;  4YBT A;  4A9M A;  4LRG A;  4YAB A;  4NYV A;  5E3D A;  5ENG A; 
#chains in the Genus database with same CATH topology
 5C8G A;  5CY9 A;  4Z93 A;  2E7N A;  4HBY A;  4QSP A;  4CUR A;  3NXB A;  4UIU A;  4AKH A;  5FE6 A;  4QR5 A;  5ENE A;  5CUD A;  4N4G A;  4PKL A;  3K2J A;  5FBX A;  5J0D A;  5LKZ A;  5F60 A;  4BJX A;  2I8N A;  5E3G A;  5E9L A;  4HBX A;  3O33 A;  4HXR A;  5EI4 A;  3U5K A;  3QZS A;  5ETD A;  4QR3 A;  5CQ6 A;  5L8T A;  5CQ7 A;  5IG6 A;  5CU8 A;  2WP2 A;  4MEP A;  5CUC A;  5A83 A;  2FSA A;  5D3H A;  5FH6 A;  4O75 A;  4J1P A;  4O76 A;  3G0L A;  4QSS A;  5LUU A;  3I3J A;  4CL9 A;  5LVQ A;  5CRM A;  4UYH A;  4UYG A;  3UVX A;  2DVR A;  5EGU A;  2NXB A;  4CLB A;  5D0C A;  5KTU A;  4XUB A;  5FE2 A;  4KV4 A;  3U5O A;  4LYW A;  4X2I A;  4TT6 A;  4LZR A;  5LJ0 A;  3U5N A;  1ZS5 A;  5CRZ A;  3ZYU A;  5EP7 A;  5IGN A;  4MEQ A;  4IR6 A;  5KU3 A;  4YK0 A;  4QC1 A;  2DVV A;  4NR5 A;  2YEL A;  4TT2 A;  3JVM A;  5C7N A;  5LKX A;  3UVY A;  5H1U A;  5LKU A;  5A82 A;  5FH8 A;  5EWW A;  4O77 A;  5E7D A;  3FKM X;  5FE3 A;  5E9K A;  4BW2 A;  5EIC A;  4A9L A;  5CP5 A;  5FE8 A;  2DAT A;  4Y03 A;  2F6N A;  5DW2 A;  5FG5 A;  5L97 A;  1N72 A;  4UIY A;  4NR9 A;  3JVK A;  4KCX A;  1E6I A;  4NUE A;  3O36 A;  5C4Q A;  5D3N A;  5EU1 A;  4O74 A;  5CUB A;  5HFQ A;  5A5Q A;  5I40 A;  3LJW A;  5HQ6 A;  4QSQ A;  5HEM A;  4O7A A;  2D82 A;  5H85 A;  3P1C A;  4HXL A;  4QYD A;  5F25 A;  5A7C A;  5HFR A;  4UIX A;  4TZ2 A;  4LZS A;  3ONI A;  4IR4 A;  5HRV A;  5JI8 A;  5I86 A;  4ZQL A;  1JSP B;  5EV9 A;  2RNW A;  2RNX A;  5E73 A;  5I83 A;  4UYE A;  5EQ1 A;  5D24 A;  5HEL A;  2DWW A;  4XUA A;  4N4I A;  5HCL A;  5A81 A;  4HXN A;  5ENF A;  4YYI A;  5DLX A;  5H1T A;  4QUT A;  5FE0 A;  5EWD A;  4YYK A;  2L84 A;  4MR5 A;  3MXF A;  2WP1 A;  2OUO A;  4QUU A;  4HXO A;  4ALH A;  4CUQ A;  5EPS A;  4QB3 A;  5HM0 A;  3AQA A;  4PY6 A;  3U5M A;  5L98 A;  3QZT A;  3JVJ A;  2RO1 A;  2DVS A;  4QYL A;  4LDF A;  4XYA A;  4E96 A;  3LQI A;  4XY9 A;  5CQA A;  5ENI A;  4C67 A;  4YYH A;  4HXS A;  2DVQ A;  4O7E A;  4OGJ A;  5I89 A;  4TTE A;  5II1 A;  4YY4 A;  3LQJ A;  2OSS A;  5DKH A;  2EJN A;  2RNY A;  5E9Y A;  4J0S A;  3S91 A;  5E9M A;  3G0J A;  4QSR A;  5LVR A;  3MUK A;  4MR6 A;  5CZG A;  4A9E A;  4AKG A;  2R0S A;  5BT3 A;  4ZW1 A;  4O7B A;  3DWY A;  4UYF B;  3O35 A;  1EQF A;  4N3W A;  5D3R A;  5EIS A;  4HBV A;  5C85 A;  5EPB A;  3DAI A;  5DFD A;  5F62 A;  4DON A;  4QY4 A;  4A9F A;  5HRX A;  5IBN A;  5FH7 A;  5CFW A;  4YBM A;  5FE1 A;  5AD2 A;  5DYU A;  3MUL A;  5ENB A;  5KTW A;  5FDZ A;  3UV2 A;  4TQN A;  4HXM A;  4TT4 A;  4HXP A;  5E9V A;  5F2P A;  4MR3 A;  2DKW A;  5CQ8 A;  5DKD A;  4NQM A;  5D7X A;  5KHM A;  4O7F A;  5ENJ A;  4KV1 A;  5I1Q A;  2YEK A;  4QST A;  4RVR A;  5CGP A;  3UV5 A;  5DBM A;  1JM4 B;  5FG4 A;  4YAX A;  4QZS A;  5FE9 A;  4Z6H A;  3U5J A;  1ZKR A;  5G4S A;  5A5R A;  2L85 A;  5CQ4 A;  5FG6 A;  4QEV A;  4UIW A;  4BW4 A;  5I80 A;  4NR7 A;  3JVL A;  5AD3 A;  3QZV A;  5FE4 A;  1WUG A;  4A9H A;  4Q0O A;  4Z1S A;  4CUT A;  4TS8 A;  4YH3 A;  2YQD A;  5CUA A;  5G4R A;  4TYL A;  5AME A;  4NR8 A;  4NQN A;  4ALG A;  4HXK A;  4NRC A;  5ENC A;  3VKG A;  4UIZ A;  3TLP A;  5CTL A;  5D26 A;  2N9G A;  5I7X A;  4YYM A;  4IOQ A;  4MR4 A;  4NS5 A;  4IOR A;  4UIT A;  5A5N A;  3IU5 A;  5CQ3 A;  4NXJ A;  3D1B A;  2R10 A;  3Q2F A;  4MEO A;  3GG3 A;  4QEU A;  5D3P A;  4NYX A;  5I29 A;  2LSP B;  5D3L A;  3P1F A;  2R0V A;  2F6J A;  5F5Z A;  5KO4 A;  4CUU A;  3AAD A;  5IGM A;  5BT4 A;  3VKH A;  5H1V A;  3D1D A;  4OUF A;  3MQM A;  3RCW A;  4CUP A;  5C87 A;  4QSV A;  3SVF A;  4YY6 A;  5F1L A;  4BW3 A;  3U5L A;  5DYC A;  5F36 A;  4Z1Q A;  4O72 A;  5DKC A;  5II2 A;  4YBS A;  4XY8 A;  5LJ2 A;  5C89 A;  5FFW A;  3UVW A;  2E3K A;  4LYS A;  4A9K A;  4YYN A;  4A9I A;  3O37 A;  4QR4 A;  5EK9 A;  4J3I A;  4NUD A;  4O70 A;  5DFC A;  4LR6 A;  5CUE A;  2YDW A;  2YEM A;  5CS8 A;  5E74 A;  5DFB A;  3MB4 A;  4QSX A;  5KTX A;  4FLP A;  4PS5 A;  2GRC A;  5E9I A;  2R0Y A;  1F68 A;  5F3A A;  4YYD A;  3P1D A;  3O34 A;  5DYX A;  4NR4 A;  5ENH A;  5HEN A;  5CQT A;  3HME A;  2D9E A;  4CFK A;  4UYD A;  2L5E A;  5EWC A;  4YAD A;  4OGI A;  5TCM A;  4QEW A;  4PCI A;  5D25 A;  5EWH A;  4GPJ A;  5DX4 A;  5L96 A;  4TU4 A;  4UIV A;  5A5O A;  5A5S A;  5JWM A;  2RS9 B;  4QNS A;  1WUM A;  5F63 A;  5EWV A;  4QSU A;  5CUG A;  4LYI A;  5EVA A;  4AKI A;  3MB3 A;  3D7C A;  4CFL A;  4PCE A;  4UYF A;  3ERR A;  3P5O A;  5LKT A;  4NRA A;  2OO1 A;  4YH4 A;  4QBM A;  2YW5 A;  4NR6 A;  5HJC A;  5D3J A;  3HMF A;  4A9N A;  5BT5 A;  2H60 A;  5EPR A;  4TU6 A;  3LXJ A;  4LC2 A;  5HQ7 A;  4HBW A;  5A5P A;  4TZ8 A;  4IR3 A;  5CQ5 A;  4WHW A;  3U5P A;  5DLZ A;  2KTB B;  4F3I A;  4BW1 A;  5DYA A;  3IU6 A;  4ZC9 A;  5FB1 A;  5I88 A;  5IGK A;  2RFJ A;  3SVH A;  4IR5 A;  5DY7 A;  4C66 A;  5AMF A;  4A9J A;  4QC3 A;  5EA1 A;  5I7Y A;  5F1H A;  5LJ1 A;  4YYG A;  4NRB A;  3P1E A;  3Q2E A;  3UV4 A;  5HRW A;  2E7O A;  3LQH A;  4Q0N A;  5EM3 A;  5F61 A;  5TB6 A;  2YYN A;  3S92 A;  5COI A;  4A9O A;  2I7K A;  4CUS A;  4LZ2 A;  5K29 A;  4O78 A;  5L8U A;  4YAT A;  2MJV B;  5HQ5 A;  4Z6I A;  5FB0 A;  4YC9 A;  4AI6 A;  5ETB A;  4NYW A;  4MEN A;  5A85 A;  5CPE A;  4PTB A;  4YYJ A;  5FFY A;  4O7C A;  5FE7 A;  4N4H A;  1PUO A;  5E0R A;  1X0J A;  4N4F A;  4O71 A;  5L99 A;  5ACY A;  5IID A;  2G4A A;  3UW9 A;  5IGL A;  5FE5 A;  4IOO A;  5HLS A;  4AKN A;  4WHU A;  4NUC A;  4J0R A;  5FFV A;  5DW1 A;  5D3T A;  5D3S A;  3SVG A;  3HMH A;  4WIV A;  2RI7 A;  4BHW A;  4QSW A;  3UVD A;  4YBT A;  4A9M A;  4LRG A;  4YAB A;  4NYV A;  5E3D A;  5ENG A; 
#chains in the Genus database with same CATH homology
 5C8G A;  5CY9 A;  4Z93 A;  2E7N A;  4HBY A;  4QSP A;  4CUR A;  3NXB A;  4UIU A;  5FE6 A;  4QR5 A;  5ENE A;  5CUD A;  4N4G A;  4PKL A;  3K2J A;  5FBX A;  5J0D A;  5LKZ A;  5F60 A;  4BJX A;  2I8N A;  5E3G A;  5E9L A;  4HBX A;  3O33 A;  4HXR A;  5EI4 A;  3U5K A;  3QZS A;  5ETD A;  4QR3 A;  5CQ6 A;  5L8T A;  5CQ7 A;  5IG6 A;  5CU8 A;  2WP2 A;  4MEP A;  5CUC A;  5A83 A;  2FSA A;  5D3H A;  5FH6 A;  4O75 A;  4J1P A;  4O76 A;  3G0L A;  4QSS A;  5LUU A;  3I3J A;  4CL9 A;  5LVQ A;  5CRM A;  4UYH A;  4UYG A;  3UVX A;  2DVR A;  5EGU A;  2NXB A;  4CLB A;  5D0C A;  5KTU A;  4XUB A;  5FE2 A;  4KV4 A;  3U5O A;  4LYW A;  4X2I A;  4TT6 A;  4LZR A;  5LJ0 A;  3U5N A;  1ZS5 A;  5CRZ A;  3ZYU A;  5EP7 A;  5IGN A;  4MEQ A;  4IR6 A;  5KU3 A;  4YK0 A;  4QC1 A;  2DVV A;  4NR5 A;  2YEL A;  4TT2 A;  3JVM A;  5C7N A;  5LKX A;  3UVY A;  5H1U A;  5LKU A;  5A82 A;  5FH8 A;  5EWW A;  4O77 A;  5E7D A;  3FKM X;  5FE3 A;  5E9K A;  4BW2 A;  5EIC A;  4A9L A;  5CP5 A;  5FE8 A;  2DAT A;  4Y03 A;  2F6N A;  5DW2 A;  5FG5 A;  5L97 A;  1N72 A;  4UIY A;  4NR9 A;  3JVK A;  4KCX A;  1E6I A;  4NUE A;  3O36 A;  5C4Q A;  5D3N A;  5EU1 A;  4O74 A;  5CUB A;  5HFQ A;  5A5Q A;  5I40 A;  3LJW A;  5HQ6 A;  4QSQ A;  5HEM A;  4O7A A;  2D82 A;  5H85 A;  3P1C A;  4HXL A;  4QYD A;  5F25 A;  5A7C A;  5HFR A;  4UIX A;  4TZ2 A;  4LZS A;  3ONI A;  4IR4 A;  5HRV A;  5JI8 A;  5I86 A;  4ZQL A;  1JSP B;  5EV9 A;  2RNW A;  2RNX A;  5E73 A;  5I83 A;  4UYE A;  5EQ1 A;  5D24 A;  5HEL A;  2DWW A;  4XUA A;  4N4I A;  5HCL A;  5A81 A;  4HXN A;  5ENF A;  4YYI A;  5DLX A;  5H1T A;  4QUT A;  5FE0 A;  5EWD A;  4YYK A;  2L84 A;  4MR5 A;  3MXF A;  2WP1 A;  2OUO A;  4QUU A;  4HXO A;  4ALH A;  4CUQ A;  5EPS A;  4QB3 A;  5HM0 A;  3AQA A;  4PY6 A;  3U5M A;  5L98 A;  3QZT A;  3JVJ A;  2RO1 A;  2DVS A;  4QYL A;  4LDF A;  4XYA A;  4E96 A;  3LQI A;  4XY9 A;  5CQA A;  5ENI A;  4C67 A;  4YYH A;  4HXS A;  2DVQ A;  4O7E A;  4OGJ A;  5I89 A;  4TTE A;  5II1 A;  4YY4 A;  3LQJ A;  2OSS A;  5DKH A;  2RNY A;  5E9Y A;  4J0S A;  3S91 A;  5E9M A;  3G0J A;  4QSR A;  5LVR A;  3MUK A;  4MR6 A;  5CZG A;  4A9E A;  2R0S A;  5BT3 A;  4ZW1 A;  4O7B A;  3DWY A;  4UYF B;  3O35 A;  1EQF A;  4N3W A;  5D3R A;  5EIS A;  4HBV A;  5C85 A;  5EPB A;  3DAI A;  5DFD A;  5F62 A;  4DON A;  4QY4 A;  4A9F A;  5HRX A;  5IBN A;  5FH7 A;  5CFW A;  4YBM A;  5FE1 A;  5AD2 A;  5DYU A;  3MUL A;  5ENB A;  5KTW A;  5FDZ A;  3UV2 A;  4TQN A;  4HXM A;  4TT4 A;  4HXP A;  5E9V A;  5F2P A;  4MR3 A;  2DKW A;  5CQ8 A;  5DKD A;  4NQM A;  5D7X A;  5KHM A;  4O7F A;  5ENJ A;  4KV1 A;  5I1Q A;  2YEK A;  4QST A;  4RVR A;  5CGP A;  3UV5 A;  5DBM A;  1JM4 B;  5FG4 A;  4YAX A;  4QZS A;  5FE9 A;  4Z6H A;  3U5J A;  5G4S A;  5A5R A;  2L85 A;  5CQ4 A;  5FG6 A;  4QEV A;  4UIW A;  4BW4 A;  5I80 A;  4NR7 A;  3JVL A;  5AD3 A;  3QZV A;  5FE4 A;  1WUG A;  4A9H A;  4Q0O A;  4Z1S A;  4CUT A;  4TS8 A;  4YH3 A;  2YQD A;  5CUA A;  5G4R A;  4TYL A;  5AME A;  4NR8 A;  4NQN A;  4ALG A;  4HXK A;  4NRC A;  5ENC A;  4UIZ A;  3TLP A;  5CTL A;  5D26 A;  2N9G A;  5I7X A;  4YYM A;  4IOQ A;  4MR4 A;  4NS5 A;  4IOR A;  4UIT A;  5A5N A;  3IU5 A;  5CQ3 A;  4NXJ A;  2R10 A;  3Q2F A;  4MEO A;  3GG3 A;  4QEU A;  5D3P A;  4NYX A;  5I29 A;  2LSP B;  5D3L A;  3P1F A;  2R0V A;  2F6J A;  5F5Z A;  5KO4 A;  4CUU A;  3AAD A;  5IGM A;  5BT4 A;  5H1V A;  4OUF A;  3MQM A;  3RCW A;  4CUP A;  5C87 A;  4QSV A;  3SVF A;  4YY6 A;  5F1L A;  4BW3 A;  3U5L A;  5DYC A;  5F36 A;  4Z1Q A;  4O72 A;  5DKC A;  5II2 A;  4YBS A;  4XY8 A;  5LJ2 A;  5C89 A;  5FFW A;  3UVW A;  2E3K A;  4LYS A;  4A9K A;  4YYN A;  4A9I A;  3O37 A;  4QR4 A;  5EK9 A;  4J3I A;  4NUD A;  4O70 A;  5DFC A;  4LR6 A;  5CUE A;  2YDW A;  2YEM A;  5CS8 A;  5E74 A;  5DFB A;  3MB4 A;  4QSX A;  5KTX A;  4FLP A;  4PS5 A;  2GRC A;  5E9I A;  2R0Y A;  1F68 A;  5F3A A;  4YYD A;  3P1D A;  3O34 A;  5DYX A;  4NR4 A;  5ENH A;  5HEN A;  5CQT A;  3HME A;  2D9E A;  4CFK A;  4UYD A;  2L5E A;  5EWC A;  4YAD A;  4OGI A;  5TCM A;  4QEW A;  4PCI A;  5D25 A;  5EWH A;  4GPJ A;  5DX4 A;  5L96 A;  4TU4 A;  4UIV A;  5A5O A;  5A5S A;  5JWM A;  2RS9 B;  4QNS A;  1WUM A;  5F63 A;  5EWV A;  4QSU A;  5CUG A;  4LYI A;  5EVA A;  3MB3 A;  3D7C A;  4CFL A;  4PCE A;  4UYF A;  3P5O A;  5LKT A;  4NRA A;  2OO1 A;  4YH4 A;  4QBM A;  2YW5 A;  4NR6 A;  5HJC A;  5D3J A;  3HMF A;  4A9N A;  5BT5 A;  2H60 A;  5EPR A;  4TU6 A;  3LXJ A;  4LC2 A;  5HQ7 A;  4HBW A;  5A5P A;  4TZ8 A;  4IR3 A;  5CQ5 A;  4WHW A;  3U5P A;  5DLZ A;  2KTB B;  4F3I A;  4BW1 A;  5DYA A;  3IU6 A;  4ZC9 A;  5FB1 A;  5I88 A;  5IGK A;  2RFJ A;  3SVH A;  4IR5 A;  5DY7 A;  4C66 A;  5AMF A;  4A9J A;  4QC3 A;  5EA1 A;  5I7Y A;  5F1H A;  5LJ1 A;  4YYG A;  4NRB A;  3P1E A;  3Q2E A;  3UV4 A;  5HRW A;  2E7O A;  3LQH A;  4Q0N A;  5EM3 A;  5F61 A;  5TB6 A;  2YYN A;  3S92 A;  5COI A;  4A9O A;  2I7K A;  4CUS A;  4LZ2 A;  5K29 A;  4O78 A;  5L8U A;  4YAT A;  2MJV B;  5HQ5 A;  4Z6I A;  5FB0 A;  4YC9 A;  5ETB A;  4NYW A;  4MEN A;  5A85 A;  5CPE A;  4PTB A;  4YYJ A;  5FFY A;  4O7C A;  5FE7 A;  4N4H A;  5E0R A;  1X0J A;  4N4F A;  4O71 A;  5L99 A;  5ACY A;  5IID A;  2G4A A;  3UW9 A;  5IGL A;  5FE5 A;  4IOO A;  5HLS A;  4AKN A;  4WHU A;  4NUC A;  4J0R A;  5FFV A;  5DW1 A;  5D3T A;  5D3S A;  3SVG A;  3HMH A;  4WIV A;  2RI7 A;  4BHW A;  4QSW A;  3UVD A;  4YBT A;  4A9M A;  4LRG A;  4YAB A;  4NYV A;  5E3D A;  5ENG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...