3FKMX

Plasmodium falciparum bromodomain-containing protein pf10_0328
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
125
structure length
120
Chain Sequence
QGNKQWYLLANQLILSLSKYEGGHIFEKLVDCPDYYDVIKNPMSFSCIKTKLKKGQYAYPSEFVKDVQLIFDNCSLYNTSNSVVAITGKNIETYFNNQLIVMGYNNFILKEKKINDMLKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Signaling protein
publication title Plasmodium falciparum bromodomain-containing protein PF10_0328
rcsb
source organism Plasmodium falciparum 3d7
molecule tags Signaling protein
total genus 40
structure length 120
sequence length 125
ec nomenclature
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 3fkmX00
5EPSA 5D25A 5FE3A 5H1UA 5EWWA 2YELA 3S91A 4MEPA 4YH4A 2E7NA 4NUEA 5DBMA 4YABA 5FH6A 4HXNA 1WUGA 3AADA 4TT6A 4HXRA 4J3IA 5FB1A 5DKCA 5ACYA 5F1HA 5IBNA 5D3LA 5L96A 3QZSA 5I29A 5D7XA 5LJ1A 5IGNA 4HBYA 1JM4B 5L99A 4N4GA 5CUCA 4NR6A 5LJ0A 4QNSA 3U5JA 5DFCA 3DWYA 2R0YA 5DYUA 5COIA 5CQ4A 3P5OA 5EK9A 4A9IA 4QEUA 4YY4A 4LZSA 5EWVA 4YYGA 5HLSA 4UIXA 5CQ5A 2G4AA 5KU3A 5CQ7A 4NRAA 4QC1A 5TCMA 5CQ3A 5CQ6A 4XYAA 3G0JA 4QSQA 5FB0A 4XY8A 4CLBA 4RVRA 5IG6A 3JVKA 5C85A 5HJCA 5D3SA 2DATA 4TYLA 4A9JA 5ENEA 4Q0OA 4HXSA 3MULA 5CQAA 5ENJA 5HM0A 5HRWA 4NRCA 2R10A 5CRMA 5E7DA 5LKXA 5DKDA 5HFQA 1JSPB 5FBXA 5JWMA 3P1EA 5HCLA 3O33A 4LR6A 4YYMA 5CGPA 3LXJA 5DFBA 3UVYA 3Q2FA 4O7BA 4HXPA 5EVAA 2OUOA 4F3IA 4UYHA 4UITA 3I3JA 4CUUA 5FE7A 4QSWA 5DYXA 4IR5A 4CURA 3IU6A 5F25A 5CU8A 3Q2EA 4CUPA 4KV1A 5EGUA 5CQ8A 4LYIA 5CP5A 4J0SA 5HQ7A 4A9MA 4NQMA 4MEQA 4N4IA 5DW2A 4A9KA 4YYIA 3O34A 1X0JA 4A9NA 4BHWA 4CFLA 4YAXA 5CUBA 4MR6A 5HEMA 3QZVA 3DAIA 5D26A 3JVMA 4O71A 2R0SA 4TU6A 4CUQA 5CUEA 5DY7A 4QZSA 4ZQLA 4XUBA 3UV4A 4IORA 4TT4A 4QUUA 3LQHA 4O7AA 5HENA 4HBVA 4YH3A 3U5LA 5JI8A 5D3JA 5FH8A 5LKZA 4O76A 4A9EA 4MENA 4XUAA 5A5RA 5AMEA 5BT3A 5LJ2A 5E9VA 3UW9A 5DW1A 4UIWA 4QSXA 3P1FA 3SVHA 4QSUA 3HMFA 5I80A 3HMEA 5CUDA 4TS8A 4UYGA 5A85A 4LRGA 4QR3A 2OSSA 5C7NA 4QB3A 4IR4A 4HXMA 5LUUA 4PS5A 2FSAA 4HXLA 4WHWA 5FE4A 4J1PA 5FE9A 5DKHA 5LKUA 2I8NA 5LVRA 3O35A 5HRXA 5KTXA 5KO4A 5FE0A 2LSPB 2DVSA 5EM3A 4LZ2A 3K2JA 5ENHA 4N3WA 1F68A 5HRVA 2RS9B 5CQTA 5F2PA 4TQNA 5DLZA 5FFWA 4PCEA 4QEVA 4QSPA 3MXFA 4A9FA 4BW3A 4QUTA 5IGKA 2F6JA 4ALGA 2GRCA 4QYLA 4TU4A 4QR4A 2E3KA 5CS8A 5F60A 5EISA 4N4HA 4CUTA 5A81A 5D24A 3RCWA 5A83A 5CTLA 5C89A 4NYXA 4QSRA 4LYWA 4ZW1A 4UIVA 5HFRA 5EPRA 5FE1A 4BW2A 5EWDA 3SVGA 4ZC9A 4O7EA 2RO1A 5A82A 4YYNA 5E0RA 1EQFA 5CRZA 4YBMA 4NR9A 5FH7A 4NR7A 4O70A 4BW1A 5FFVA 5E9KA 3IU5A 4Z6HA 4YYDA 4OUFA 5BT4A 5A5OA 4LYSA 4TTEA 4YC9A 5DYAA 4O74A 5HQ5A 4LDFA 3G0LA 2YDWA 5I40A 4CFKA 2D82A 3MQMA 5DX4A 5F3AA 2RNXA 4E96A 5D0CA 5II2A 4PY6A 3FKMX 3UVWA 4NYVA 5H1VA 2YEMA 5E3GA 1E6IA 5H85A 5CZGA 5G4RA 3GG3A 4AKNA 4UYDA 5LKTA 3U5NA 5FE8A 5KTWA 4LZRA 2I7KA 2RFJA 2RNWA 4PTBA 5AMFA 4Z1QA 5FE6A 2YYNA 5E3DA 3MB3A 5C4QA 2WP1A 4IOQA 4PCIA 5A5PA 4GPJA 5F63A 1ZS5A 2L84A 2R0VA 5IGMA 4Z6IA 4QYDA 5FE5A 5EQ1A 1N72A 4YK0A 5EICA 4CUSA 5BT5A 4IR6A 3UV2A 3LQJA 5I83A 5E9LA 4O77A 5CFWA 5EU1A 4YATA 5I88A 4NYWA 5F62A 4MR5A 4BJXA 3TLPA 2DVRA 5EI4A 4NS5A 2L85A 5L8UA 4QBMA 4UYFA 3UVXA 5FG5A 5A5NA 4X2IA 4NR8A 2N9GA 3MUKA 5D3PA 5C87A 4IOOA 5CUAA 3ONIA 4FLPA 4MR4A 4MEOA 4C66A 3D7CA 3UV5A 5AD3A 4J0RA 4NR4A 5LVQA 5II1A 4OGJA 4NR5A 4C67A 5EWCA 5ENIA 2H60A 2YQDA 3U5MA 5CUGA 4HXOA 5J0DA 4QY4A 4QR5A 5F5ZA 5A5SA 3HMHA 4UIUA 5A7CA 5EV9A 5E9IA 4A9OA 5L8TA 4CL9A 5L97A 5FDZA 2F6NA 4BW4A 3U5KA 3U5OA 5F1LA 2YEKA 3AQAA 4QSTA 3O37A 4TT2A 5FG4A 5G4SA 4O72A 2NXBA 5ENBA 4O78A 5EWHA 5DYCA 5DLXA 3JVLA 4YYHA 3ZYUA 4UIYA 5IIDA 3LQIA 1WUMA 5FE2A 5HQ6A 2L5EA 4YADA 2DWWA 4NUCA 4OGIA 4YBTA 3NXBA 5I7XA 2DVQA 5ENGA 5AD2A 5C8GA 2DKWA 3MB4A 5I86A 4QEWA 4N4FA 5I7YA 2OO1A 4YY6A 3JVJA 4NXJA 5L98A 4UYFB 4O7CA 5DFDA 2KTBB 5EP7A 4PKLA 5ETDA 4A9HA 4WIVA 2E7OA 4HBXA 4O7FA 5E9MA 2WP2A 4YBSA 4QC3A 2YW5A 5D3HA 5KHMA 4HXKA 4KCXA 4TZ8A 4UYEA 3P1CA 5ETBA 3SVFA 5F36A 5K29A 4NRBA 4Y03A 4O75A 5I89A 3LJWA 5FFYA 5D3RA 4QSVA 4YYKA 2DVVA 4NUDA 4UIZA 2MJVB 3U5PA 4TZ2A 4IR3A 4MR3A 5CPEA 4YYJA 5EPBA 5TB6A 5ENFA 4WHUA 5E9YA 4LC2A 2RNYA 3P1DA 2D9EA 5A5QA 5D3TA 5E73A 4Z93A 4A9LA 5HELA 2RI7A 4KV4A 4HBWA 4XY9A 5H1TA 4Q0NA 5F61A 3QZTA 3UVDA 4DONA 4NQNA 5I1QA 4QSSA 5D3NA 5E74A 5CY9A 3O36A 5FG6A 4ALHA 5ENCA 4Z1SA 5KTUA 5IGLA 5EA1A 3S92A
chains in the Genus database with same CATH superfamily
5EPSA 5D25A 5FE3A 5H1UA 5EWWA 2YELA 3S91A 4MEPA 4YH4A 2E7NA 4NUEA 5DBMA 4YABA 5FH6A 4HXNA 1WUGA 3AADA 4TT6A 4HXRA 4J3IA 5FB1A 5DKCA 5ACYA 5F1HA 5IBNA 5D3LA 5L96A 3QZSA 5I29A 5D7XA 5LJ1A 5IGNA 4HBYA 1JM4B 5L99A 4N4GA 5CUCA 4NR6A 5LJ0A 4QNSA 3U5JA 5DFCA 3DWYA 2R0YA 5DYUA 5COIA 5CQ4A 3P5OA 5EK9A 4A9IA 4QEUA 4YY4A 3ERRA 4LZSA 5EWVA 4YYGA 5HLSA 4UIXA 5CQ5A 2G4AA 5KU3A 5CQ7A 4NRAA 4QC1A 5TCMA 5CQ3A 5CQ6A 4XYAA 3G0JA 4QSQA 5FB0A 4XY8A 4CLBA 4RVRA 5IG6A 3JVKA 5C85A 5HJCA 5D3SA 2DATA 4TYLA 4A9JA 5ENEA 4Q0OA 4HXSA 3MULA 5CQAA 5ENJA 5HM0A 5HRWA 4NRCA 4AKHA 2R10A 5CRMA 5E7DA 5LKXA 5DKDA 5HFQA 1JSPB 5FBXA 5JWMA 3P1EA 5HCLA 3O33A 4LR6A 4YYMA 5CGPA 3LXJA 5DFBA 3UVYA 3Q2FA 4O7BA 4HXPA 5EVAA 2OUOA 4F3IA 4UYHA 4UITA 3I3JA 3D1DA 4CUUA 5FE7A 4QSWA 5DYXA 4IR5A 4CURA 3IU6A 5F25A 5CU8A 3Q2EA 4CUPA 4KV1A 5EGUA 5CQ8A 4AKGA 4LYIA 5CP5A 4J0SA 5HQ7A 4A9MA 4NQMA 4MEQA 4N4IA 5DW2A 4A9KA 4YYIA 3O34A 1X0JA 4A9NA 4BHWA 4CFLA 4YAXA 4AKIA 5CUBA 4MR6A 5HEMA 3QZVA 3DAIA 5D26A 3JVMA 2EJNA 4O71A 2R0SA 4TU6A 4CUQA 5CUEA 5DY7A 4QZSA 4ZQLA 4XUBA 3UV4A 4IORA 4TT4A 4QUUA 3LQHA 4O7AA 5HENA 4HBVA 4YH3A 3U5LA 5JI8A 5D3JA 5FH8A 5LKZA 4O76A 4A9EA 4MENA 4XUAA 5A5RA 5AMEA 5BT3A 5LJ2A 5E9VA 3UW9A 5DW1A 4UIWA 4QSXA 3P1FA 3SVHA 4QSUA 3HMFA 5I80A 3HMEA 5CUDA 4TS8A 4UYGA 5A85A 4LRGA 4QR3A 2OSSA 5C7NA 4QB3A 4IR4A 4HXMA 5LUUA 4PS5A 2FSAA 4HXLA 4WHWA 5FE4A 4J1PA 5FE9A 5DKHA 5LKUA 2I8NA 5LVRA 3O35A 5HRXA 5KTXA 5KO4A 5FE0A 2LSPB 2DVSA 5EM3A 4LZ2A 3K2JA 5ENHA 4N3WA 1F68A 5HRVA 2RS9B 5CQTA 5F2PA 4TQNA 5DLZA 5FFWA 4PCEA 4QEVA 4QSPA 3MXFA 4A9FA 4BW3A 4QUTA 5IGKA 2F6JA 4ALGA 2GRCA 4QYLA 4TU4A 4QR4A 2E3KA 5CS8A 5F60A 5EISA 4N4HA 4CUTA 5A81A 5D24A 3RCWA 5A83A 5CTLA 5C89A 4NYXA 4QSRA 4LYWA 4ZW1A 4UIVA 5HFRA 5EPRA 5FE1A 4BW2A 5EWDA 3SVGA 4ZC9A 1PUOA 4O7EA 2RO1A 5A82A 4YYNA 5E0RA 1EQFA 5CRZA 4YBMA 4NR9A 5FH7A 4NR7A 4O70A 4BW1A 5FFVA 5E9KA 3IU5A 4Z6HA 4YYDA 4OUFA 5BT4A 5A5OA 4LYSA 4TTEA 4YC9A 5DYAA 3VKGA 4O74A 5HQ5A 4LDFA 3G0LA 2YDWA 5I40A 4CFKA 2D82A 3MQMA 5DX4A 5F3AA 2RNXA 4E96A 5D0CA 5II2A 4PY6A 3FKMX 3UVWA 4NYVA 5H1VA 2YEMA 5E3GA 1E6IA 5H85A 5CZGA 5G4RA 3GG3A 1ZKRA 4AKNA 4UYDA 5LKTA 3U5NA 5FE8A 5KTWA 3VKHA 4LZRA 2I7KA 2RFJA 2RNWA 4PTBA 5AMFA 4Z1QA 5FE6A 2YYNA 5E3DA 3MB3A 5C4QA 2WP1A 4IOQA 4PCIA 5A5PA 4GPJA 5F63A 1ZS5A 2L84A 2R0VA 5IGMA 4Z6IA 4QYDA 5FE5A 5EQ1A 1N72A 4YK0A 5EICA 4CUSA 5BT5A 4IR6A 3UV2A 3LQJA 5I83A 5E9LA 4O77A 5CFWA 5EU1A 4YATA 5I88A 4NYWA 5F62A 4MR5A 4BJXA 3TLPA 2DVRA 5EI4A 4NS5A 2L85A 5L8UA 4QBMA 4UYFA 3UVXA 5FG5A 5A5NA 4X2IA 4NR8A 2N9GA 3MUKA 5D3PA 5C87A 4IOOA 5CUAA 3ONIA 4FLPA 4MR4A 4MEOA 4C66A 3D7CA 3UV5A 5AD3A 4J0RA 4NR4A 5LVQA 5II1A 4OGJA 4NR5A 4C67A 5EWCA 5ENIA 2H60A 2YQDA 3U5MA 5CUGA 4HXOA 5J0DA 4QY4A 4QR5A 5F5ZA 5A5SA 3HMHA 4UIUA 5A7CA 5EV9A 5E9IA 4A9OA 5L8TA 4CL9A 5L97A 5FDZA 2F6NA 4BW4A 3U5KA 3U5OA 5F1LA 2YEKA 3AQAA 4QSTA 3O37A 4TT2A 5FG4A 5G4SA 4O72A 4AI6A 2NXBA 5ENBA 4O78A 5EWHA 5DYCA 5DLXA 3JVLA 4YYHA 3ZYUA 4UIYA 5IIDA 3LQIA 1WUMA 5FE2A 5HQ6A 2L5EA 4YADA 2DWWA 4NUCA 4OGIA 4YBTA 3NXBA 5I7XA 2DVQA 5ENGA 5AD2A 5C8GA 2DKWA 3MB4A 5I86A 4QEWA 4N4FA 5I7YA 2OO1A 4YY6A 3JVJA 4NXJA 5L98A 4UYFB 4O7CA 5DFDA 2KTBB 5EP7A 4PKLA 5ETDA 4A9HA 4WIVA 2E7OA 4HBXA 4O7FA 5E9MA 2WP2A 4YBSA 4QC3A 2YW5A 5D3HA 5KHMA 4HXKA 4KCXA 4TZ8A 3D1BA 4UYEA 3P1CA 5ETBA 3SVFA 5F36A 5K29A 4NRBA 4Y03A 4O75A 5I89A 3LJWA 5FFYA 5D3RA 4QSVA 4YYKA 2DVVA 4NUDA 4UIZA 2MJVB 3U5PA 4TZ2A 4IR3A 4MR3A 5CPEA 4YYJA 5EPBA 5TB6A 5ENFA 4WHUA 5E9YA 4LC2A 2RNYA 3P1DA 2D9EA 5A5QA 5D3TA 5E73A 4Z93A 4A9LA 5HELA 2RI7A 4KV4A 4HBWA 4XY9A 5H1TA 4Q0NA 5F61A 3QZTA 3UVDA 4DONA 4NQNA 5I1QA 4QSSA 5D3NA 5E74A 5CY9A 3O36A 5FG6A 4ALHA 5ENCA 4Z1SA 5KTUA 5IGLA 5EA1A 3S92A
chains in the Genus database with same CATH topology
5EPSA 5D25A 5FE3A 5H1UA 5EWWA 2YELA 3S91A 4MEPA 4YH4A 2E7NA 4NUEA 5DBMA 4YABA 5FH6A 4HXNA 1WUGA 3AADA 4TT6A 4HXRA 4J3IA 5FB1A 5DKCA 5ACYA 5F1HA 5IBNA 5D3LA 5L96A 3QZSA 5I29A 5D7XA 5LJ1A 5IGNA 4HBYA 1JM4B 5L99A 4N4GA 5CUCA 4NR6A 5LJ0A 4QNSA 3U5JA 5DFCA 3DWYA 2R0YA 5DYUA 5COIA 5CQ4A 3P5OA 5EK9A 4A9IA 4QEUA 4YY4A 4LZSA 5EWVA 4YYGA 5HLSA 4UIXA 5CQ5A 2G4AA 5KU3A 5CQ7A 4NRAA 4QC1A 5TCMA 5CQ3A 5CQ6A 4XYAA 3G0JA 4QSQA 5FB0A 4XY8A 4CLBA 4RVRA 5IG6A 3JVKA 5C85A 5HJCA 5D3SA 2DATA 4TYLA 4A9JA 5ENEA 4Q0OA 4HXSA 3MULA 5CQAA 5ENJA 5HM0A 5HRWA 4NRCA 2R10A 5CRMA 5E7DA 5LKXA 5DKDA 5HFQA 1JSPB 5FBXA 5JWMA 3P1EA 5HCLA 3O33A 4LR6A 4YYMA 5CGPA 3LXJA 5DFBA 3UVYA 3Q2FA 4O7BA 4HXPA 5EVAA 2OUOA 4F3IA 4UYHA 4UITA 3I3JA 4CUUA 5FE7A 4QSWA 5DYXA 4IR5A 4CURA 3IU6A 5F25A 5CU8A 3Q2EA 4CUPA 4KV1A 5EGUA 5CQ8A 4LYIA 5CP5A 4J0SA 5HQ7A 4A9MA 4NQMA 4MEQA 4N4IA 5DW2A 4A9KA 4YYIA 3O34A 1X0JA 4A9NA 4BHWA 4CFLA 4YAXA 5CUBA 4MR6A 5HEMA 3QZVA 3DAIA 5D26A 3JVMA 4O71A 2R0SA 4TU6A 4CUQA 5CUEA 5DY7A 4QZSA 4ZQLA 4XUBA 3UV4A 4IORA 4TT4A 4QUUA 3LQHA 4O7AA 5HENA 4HBVA 4YH3A 3U5LA 5JI8A 5D3JA 5FH8A 5LKZA 4O76A 4A9EA 4MENA 4XUAA 5A5RA 5AMEA 5BT3A 5LJ2A 5E9VA 3UW9A 5DW1A 4UIWA 4QSXA 3P1FA 3SVHA 4QSUA 3HMFA 5I80A 3HMEA 5CUDA 4TS8A 4UYGA 5A85A 4LRGA 4QR3A 2OSSA 5C7NA 4QB3A 4IR4A 4HXMA 5LUUA 4PS5A 2FSAA 4HXLA 4WHWA 5FE4A 4J1PA 5FE9A 5DKHA 5LKUA 2I8NA 5LVRA 3O35A 5HRXA 5KTXA 5KO4A 5FE0A 2LSPB 2DVSA 5EM3A 4LZ2A 3K2JA 5ENHA 4N3WA 1F68A 5HRVA 2RS9B 5CQTA 5F2PA 4TQNA 5DLZA 5FFWA 4PCEA 4QEVA 4QSPA 3MXFA 4A9FA 4BW3A 4QUTA 5IGKA 2F6JA 4ALGA 2GRCA 4QYLA 4TU4A 4QR4A 2E3KA 5CS8A 5F60A 5EISA 4N4HA 4CUTA 5A81A 5D24A 3RCWA 5A83A 5CTLA 5C89A 4NYXA 4QSRA 4LYWA 4ZW1A 4UIVA 5HFRA 5EPRA 5FE1A 4BW2A 5EWDA 3SVGA 4ZC9A 4O7EA 2RO1A 5A82A 4YYNA 5E0RA 1EQFA 5CRZA 4YBMA 4NR9A 5FH7A 4NR7A 4O70A 4BW1A 5FFVA 5E9KA 3IU5A 4Z6HA 4YYDA 4OUFA 5BT4A 5A5OA 4LYSA 4TTEA 4YC9A 5DYAA 4O74A 5HQ5A 4LDFA 3G0LA 2YDWA 5I40A 4CFKA 2D82A 3MQMA 5DX4A 5F3AA 2RNXA 4E96A 5D0CA 5II2A 4PY6A 3FKMX 3UVWA 4NYVA 5H1VA 2YEMA 5E3GA 1E6IA 5H85A 5CZGA 5G4RA 3GG3A 4AKNA 4UYDA 5LKTA 3U5NA 5FE8A 5KTWA 4LZRA 2I7KA 2RFJA 2RNWA 4PTBA 5AMFA 4Z1QA 5FE6A 2YYNA 5E3DA 3MB3A 5C4QA 2WP1A 4IOQA 4PCIA 5A5PA 4GPJA 5F63A 1ZS5A 2L84A 2R0VA 5IGMA 4Z6IA 4QYDA 5FE5A 5EQ1A 1N72A 4YK0A 5EICA 4CUSA 5BT5A 4IR6A 3UV2A 3LQJA 5I83A 5E9LA 4O77A 5CFWA 5EU1A 4YATA 5I88A 4NYWA 5F62A 4MR5A 4BJXA 3TLPA 2DVRA 5EI4A 4NS5A 2L85A 5L8UA 4QBMA 4UYFA 3UVXA 5FG5A 5A5NA 4X2IA 4NR8A 2N9GA 3MUKA 5D3PA 5C87A 4IOOA 5CUAA 3ONIA 4FLPA 4MR4A 4MEOA 4C66A 3D7CA 3UV5A 5AD3A 4J0RA 4NR4A 5LVQA 5II1A 4OGJA 4NR5A 4C67A 5EWCA 5ENIA 2H60A 2YQDA 3U5MA 5CUGA 4HXOA 5J0DA 4QY4A 4QR5A 5F5ZA 5A5SA 3HMHA 4UIUA 5A7CA 5EV9A 5E9IA 4A9OA 5L8TA 4CL9A 5L97A 5FDZA 2F6NA 4BW4A 3U5KA 3U5OA 5F1LA 2YEKA 3AQAA 4QSTA 3O37A 4TT2A 5FG4A 5G4SA 4O72A 2NXBA 5ENBA 4O78A 5EWHA 5DYCA 5DLXA 3JVLA 4YYHA 3ZYUA 4UIYA 5IIDA 3LQIA 1WUMA 5FE2A 5HQ6A 2L5EA 4YADA 2DWWA 4NUCA 4OGIA 4YBTA 3NXBA 5I7XA 2DVQA 5ENGA 5AD2A 5C8GA 2DKWA 3MB4A 5I86A 4QEWA 4N4FA 5I7YA 2OO1A 4YY6A 3JVJA 4NXJA 5L98A 4UYFB 4O7CA 5DFDA 2KTBB 5EP7A 4PKLA 5ETDA 4A9HA 4WIVA 2E7OA 4HBXA 4O7FA 5E9MA 2WP2A 4YBSA 4QC3A 2YW5A 5D3HA 5KHMA 4HXKA 4KCXA 4TZ8A 4UYEA 3P1CA 5ETBA 3SVFA 5F36A 5K29A 4NRBA 4Y03A 4O75A 5I89A 3LJWA 5FFYA 5D3RA 4QSVA 4YYKA 2DVVA 4NUDA 4UIZA 2MJVB 3U5PA 4TZ2A 4IR3A 4MR3A 5CPEA 4YYJA 5EPBA 5TB6A 5ENFA 4WHUA 5E9YA 4LC2A 2RNYA 3P1DA 2D9EA 5A5QA 5D3TA 5E73A 4Z93A 4A9LA 5HELA 2RI7A 4KV4A 4HBWA 4XY9A 5H1TA 4Q0NA 5F61A 3QZTA 3UVDA 4DONA 4NQNA 5I1QA 4QSSA 5D3NA 5E74A 5CY9A 3O36A 5FG6A 4ALHA 5ENCA 4Z1SA 5KTUA 5IGLA 5EA1A 3S92A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EPS A;  5D25 A;  5FE3 A;  5H1U A;  5EWW A;  2YEL A;  3S91 A;  4MEP A;  4YH4 A;  2E7N A;  4NUE A;  5DBM A;  4YAB A;  5FH6 A;  4HXN A;  1WUG A;  3AAD A;  4TT6 A;  4HXR A;  4J3I A;  5FB1 A;  5DKC A;  5ACY A;  5F1H A;  5IBN A;  5D3L A;  5L96 A;  3QZS A;  5I29 A;  5D7X A;  5LJ1 A;  5IGN A;  4HBY A;  1JM4 B;  5L99 A;  4N4G A;  5CUC A;  4NR6 A;  5LJ0 A;  4QNS A;  3U5J A;  5DFC A;  3DWY A;  2R0Y A;  5DYU A;  5COI A;  5CQ4 A;  3P5O A;  5EK9 A;  4A9I A;  4QEU A;  4YY4 A;  4LZS A;  5EWV A;  4YYG A;  5HLS A;  4UIX A;  5CQ5 A;  2G4A A;  5KU3 A;  5CQ7 A;  4NRA A;  4QC1 A;  5TCM A;  5CQ3 A;  5CQ6 A;  4XYA A;  3G0J A;  4QSQ A;  5FB0 A;  4XY8 A;  4CLB A;  4RVR A;  5IG6 A;  3JVK A;  5C85 A;  5HJC A;  5D3S A;  2DAT A;  4TYL A;  4A9J A;  5ENE A;  4Q0O A;  4HXS A;  3MUL A;  5CQA A;  5ENJ A;  5HM0 A;  5HRW A;  4NRC A;  2R10 A;  5CRM A;  5E7D A;  5LKX A;  5DKD A;  5HFQ A;  1JSP B;  5FBX A;  5JWM A;  3P1E A;  5HCL A;  3O33 A;  4LR6 A;  4YYM A;  5CGP A;  3LXJ A;  5DFB A;  3UVY A;  3Q2F A;  4O7B A;  4HXP A;  5EVA A;  2OUO A;  4F3I A;  4UYH A;  4UIT A;  3I3J A;  4CUU A;  5FE7 A;  4QSW A;  5DYX A;  4IR5 A;  4CUR A;  3IU6 A;  5F25 A;  5CU8 A;  3Q2E A;  4CUP A;  4KV1 A;  5EGU A;  5CQ8 A;  4LYI A;  5CP5 A;  4J0S A;  5HQ7 A;  4A9M A;  4NQM A;  4MEQ A;  4N4I A;  5DW2 A;  4A9K A;  4YYI A;  3O34 A;  1X0J A;  4A9N A;  4BHW A;  4CFL A;  4YAX A;  5CUB A;  4MR6 A;  5HEM A;  3QZV A;  3DAI A;  5D26 A;  3JVM A;  4O71 A;  2R0S A;  4TU6 A;  4CUQ A;  5CUE A;  5DY7 A;  4QZS A;  4ZQL A;  4XUB A;  3UV4 A;  4IOR A;  4TT4 A;  4QUU A;  3LQH A;  4O7A A;  5HEN A;  4HBV A;  4YH3 A;  3U5L A;  5JI8 A;  5D3J A;  5FH8 A;  5LKZ A;  4O76 A;  4A9E A;  4MEN A;  4XUA A;  5A5R A;  5AME A;  5BT3 A;  5LJ2 A;  5E9V A;  3UW9 A;  5DW1 A;  4UIW A;  4QSX A;  3P1F A;  3SVH A;  4QSU A;  3HMF A;  5I80 A;  3HME A;  5CUD A;  4TS8 A;  4UYG A;  5A85 A;  4LRG A;  4QR3 A;  2OSS A;  5C7N A;  4QB3 A;  4IR4 A;  4HXM A;  5LUU A;  4PS5 A;  2FSA A;  4HXL A;  4WHW A;  5FE4 A;  4J1P A;  5FE9 A;  5DKH A;  5LKU A;  2I8N A;  5LVR A;  3O35 A;  5HRX A;  5KTX A;  5KO4 A;  5FE0 A;  2LSP B;  2DVS A;  5EM3 A;  4LZ2 A;  3K2J A;  5ENH A;  4N3W A;  1F68 A;  5HRV A;  2RS9 B;  5CQT A;  5F2P A;  4TQN A;  5DLZ A;  5FFW A;  4PCE A;  4QEV A;  4QSP A;  3MXF A;  4A9F A;  4BW3 A;  4QUT A;  5IGK A;  2F6J A;  4ALG A;  2GRC A;  4QYL A;  4TU4 A;  4QR4 A;  2E3K A;  5CS8 A;  5F60 A;  5EIS A;  4N4H A;  4CUT A;  5A81 A;  5D24 A;  3RCW A;  5A83 A;  5CTL A;  5C89 A;  4NYX A;  4QSR A;  4LYW A;  4ZW1 A;  4UIV A;  5HFR A;  5EPR A;  5FE1 A;  4BW2 A;  5EWD A;  3SVG A;  4ZC9 A;  4O7E A;  2RO1 A;  5A82 A;  4YYN A;  5E0R A;  1EQF A;  5CRZ A;  4YBM A;  4NR9 A;  5FH7 A;  4NR7 A;  4O70 A;  4BW1 A;  5FFV A;  5E9K A;  3IU5 A;  4Z6H A;  4YYD A;  4OUF A;  5BT4 A;  5A5O A;  4LYS A;  4TTE A;  4YC9 A;  5DYA A;  4O74 A;  5HQ5 A;  4LDF A;  3G0L A;  2YDW A;  5I40 A;  4CFK A;  2D82 A;  3MQM A;  5DX4 A;  5F3A A;  2RNX A;  4E96 A;  5D0C A;  5II2 A;  4PY6 A;  3FKM X;  3UVW A;  4NYV A;  5H1V A;  2YEM A;  5E3G A;  1E6I A;  5H85 A;  5CZG A;  5G4R A;  3GG3 A;  4AKN A;  4UYD A;  5LKT A;  3U5N A;  5FE8 A;  5KTW A;  4LZR A;  2I7K A;  2RFJ A;  2RNW A;  4PTB A;  5AMF A;  4Z1Q A;  5FE6 A;  2YYN A;  5E3D A;  3MB3 A;  5C4Q A;  2WP1 A;  4IOQ A;  4PCI A;  5A5P A;  4GPJ A;  5F63 A;  1ZS5 A;  2L84 A;  2R0V A;  5IGM A;  4Z6I A;  4QYD A;  5FE5 A;  5EQ1 A;  1N72 A;  4YK0 A;  5EIC A;  4CUS A;  5BT5 A;  4IR6 A;  3UV2 A;  3LQJ A;  5I83 A;  5E9L A;  4O77 A;  5CFW A;  5EU1 A;  4YAT A;  5I88 A;  4NYW A;  5F62 A;  4MR5 A;  4BJX A;  3TLP A;  2DVR A;  5EI4 A;  4NS5 A;  2L85 A;  5L8U A;  4QBM A;  4UYF A;  3UVX A;  5FG5 A;  5A5N A;  4X2I A;  4NR8 A;  2N9G A;  3MUK A;  5D3P A;  5C87 A;  4IOO A;  5CUA A;  3ONI A;  4FLP A;  4MR4 A;  4MEO A;  4C66 A;  3D7C A;  3UV5 A;  5AD3 A;  4J0R A;  4NR4 A;  5LVQ A;  5II1 A;  4OGJ A;  4NR5 A;  4C67 A;  5EWC A;  5ENI A;  2H60 A;  2YQD A;  3U5M A;  5CUG A;  4HXO A;  5J0D A;  4QY4 A;  4QR5 A;  5F5Z A;  5A5S A;  3HMH A;  4UIU A;  5A7C A;  5EV9 A;  5E9I A;  4A9O A;  5L8T A;  4CL9 A;  5L97 A;  5FDZ A;  2F6N A;  4BW4 A;  3U5K A;  3U5O A;  5F1L A;  2YEK A;  3AQA A;  4QST A;  3O37 A;  4TT2 A;  5FG4 A;  5G4S A;  4O72 A;  2NXB A;  5ENB A;  4O78 A;  5EWH A;  5DYC A;  5DLX A;  3JVL A;  4YYH A;  3ZYU A;  4UIY A;  5IID A;  3LQI A;  1WUM A;  5FE2 A;  5HQ6 A;  2L5E A;  4YAD A;  2DWW A;  4NUC A;  4OGI A;  4YBT A;  3NXB A;  5I7X A;  2DVQ A;  5ENG A;  5AD2 A;  5C8G A;  2DKW A;  3MB4 A;  5I86 A;  4QEW A;  4N4F A;  5I7Y A;  2OO1 A;  4YY6 A;  3JVJ A;  4NXJ A;  5L98 A;  4UYF B;  4O7C A;  5DFD A;  2KTB B;  5EP7 A;  4PKL A;  5ETD A;  4A9H A;  4WIV A;  2E7O A;  4HBX A;  4O7F A;  5E9M A;  2WP2 A;  4YBS A;  4QC3 A;  2YW5 A;  5D3H A;  5KHM A;  4HXK A;  4KCX A;  4TZ8 A;  4UYE A;  3P1C A;  5ETB A;  3SVF A;  5F36 A;  5K29 A;  4NRB A;  4Y03 A;  4O75 A;  5I89 A;  3LJW A;  5FFY A;  5D3R A;  4QSV A;  4YYK A;  2DVV A;  4NUD A;  4UIZ A;  2MJV B;  3U5P A;  4TZ2 A;  4IR3 A;  4MR3 A;  5CPE A;  4YYJ A;  5EPB A;  5TB6 A;  5ENF A;  4WHU A;  5E9Y A;  4LC2 A;  2RNY A;  3P1D A;  2D9E A;  5A5Q A;  5D3T A;  5E73 A;  4Z93 A;  4A9L A;  5HEL A;  2RI7 A;  4KV4 A;  4HBW A;  4XY9 A;  5H1T A;  4Q0N A;  5F61 A;  3QZT A;  3UVD A;  4DON A;  4NQN A;  5I1Q A;  4QSS A;  5D3N A;  5E74 A;  5CY9 A;  3O36 A;  5FG6 A;  4ALH A;  5ENC A;  4Z1S A;  5KTU A;  5IGL A;  5EA1 A;  3S92 A; 
#chains in the Genus database with same CATH topology
 5EPS A;  5D25 A;  5FE3 A;  5H1U A;  5EWW A;  2YEL A;  3S91 A;  4MEP A;  4YH4 A;  2E7N A;  4NUE A;  5DBM A;  4YAB A;  5FH6 A;  4HXN A;  1WUG A;  3AAD A;  4TT6 A;  4HXR A;  4J3I A;  5FB1 A;  5DKC A;  5ACY A;  5F1H A;  5IBN A;  5D3L A;  5L96 A;  3QZS A;  5I29 A;  5D7X A;  5LJ1 A;  5IGN A;  4HBY A;  1JM4 B;  5L99 A;  4N4G A;  5CUC A;  4NR6 A;  5LJ0 A;  4QNS A;  3U5J A;  5DFC A;  3DWY A;  2R0Y A;  5DYU A;  5COI A;  5CQ4 A;  3P5O A;  5EK9 A;  4A9I A;  4QEU A;  4YY4 A;  3ERR A;  4LZS A;  5EWV A;  4YYG A;  5HLS A;  4UIX A;  5CQ5 A;  2G4A A;  5KU3 A;  5CQ7 A;  4NRA A;  4QC1 A;  5TCM A;  5CQ3 A;  5CQ6 A;  4XYA A;  3G0J A;  4QSQ A;  5FB0 A;  4XY8 A;  4CLB A;  4RVR A;  5IG6 A;  3JVK A;  5C85 A;  5HJC A;  5D3S A;  2DAT A;  4TYL A;  4A9J A;  5ENE A;  4Q0O A;  4HXS A;  3MUL A;  5CQA A;  5ENJ A;  5HM0 A;  5HRW A;  4NRC A;  4AKH A;  2R10 A;  5CRM A;  5E7D A;  5LKX A;  5DKD A;  5HFQ A;  1JSP B;  5FBX A;  5JWM A;  3P1E A;  5HCL A;  3O33 A;  4LR6 A;  4YYM A;  5CGP A;  3LXJ A;  5DFB A;  3UVY A;  3Q2F A;  4O7B A;  4HXP A;  5EVA A;  2OUO A;  4F3I A;  4UYH A;  4UIT A;  3I3J A;  3D1D A;  4CUU A;  5FE7 A;  4QSW A;  5DYX A;  4IR5 A;  4CUR A;  3IU6 A;  5F25 A;  5CU8 A;  3Q2E A;  4CUP A;  4KV1 A;  5EGU A;  5CQ8 A;  4AKG A;  4LYI A;  5CP5 A;  4J0S A;  5HQ7 A;  4A9M A;  4NQM A;  4MEQ A;  4N4I A;  5DW2 A;  4A9K A;  4YYI A;  3O34 A;  1X0J A;  4A9N A;  4BHW A;  4CFL A;  4YAX A;  4AKI A;  5CUB A;  4MR6 A;  5HEM A;  3QZV A;  3DAI A;  5D26 A;  3JVM A;  2EJN A;  4O71 A;  2R0S A;  4TU6 A;  4CUQ A;  5CUE A;  5DY7 A;  4QZS A;  4ZQL A;  4XUB A;  3UV4 A;  4IOR A;  4TT4 A;  4QUU A;  3LQH A;  4O7A A;  5HEN A;  4HBV A;  4YH3 A;  3U5L A;  5JI8 A;  5D3J A;  5FH8 A;  5LKZ A;  4O76 A;  4A9E A;  4MEN A;  4XUA A;  5A5R A;  5AME A;  5BT3 A;  5LJ2 A;  5E9V A;  3UW9 A;  5DW1 A;  4UIW A;  4QSX A;  3P1F A;  3SVH A;  4QSU A;  3HMF A;  5I80 A;  3HME A;  5CUD A;  4TS8 A;  4UYG A;  5A85 A;  4LRG A;  4QR3 A;  2OSS A;  5C7N A;  4QB3 A;  4IR4 A;  4HXM A;  5LUU A;  4PS5 A;  2FSA A;  4HXL A;  4WHW A;  5FE4 A;  4J1P A;  5FE9 A;  5DKH A;  5LKU A;  2I8N A;  5LVR A;  3O35 A;  5HRX A;  5KTX A;  5KO4 A;  5FE0 A;  2LSP B;  2DVS A;  5EM3 A;  4LZ2 A;  3K2J A;  5ENH A;  4N3W A;  1F68 A;  5HRV A;  2RS9 B;  5CQT A;  5F2P A;  4TQN A;  5DLZ A;  5FFW A;  4PCE A;  4QEV A;  4QSP A;  3MXF A;  4A9F A;  4BW3 A;  4QUT A;  5IGK A;  2F6J A;  4ALG A;  2GRC A;  4QYL A;  4TU4 A;  4QR4 A;  2E3K A;  5CS8 A;  5F60 A;  5EIS A;  4N4H A;  4CUT A;  5A81 A;  5D24 A;  3RCW A;  5A83 A;  5CTL A;  5C89 A;  4NYX A;  4QSR A;  4LYW A;  4ZW1 A;  4UIV A;  5HFR A;  5EPR A;  5FE1 A;  4BW2 A;  5EWD A;  3SVG A;  4ZC9 A;  1PUO A;  4O7E A;  2RO1 A;  5A82 A;  4YYN A;  5E0R A;  1EQF A;  5CRZ A;  4YBM A;  4NR9 A;  5FH7 A;  4NR7 A;  4O70 A;  4BW1 A;  5FFV A;  5E9K A;  3IU5 A;  4Z6H A;  4YYD A;  4OUF A;  5BT4 A;  5A5O A;  4LYS A;  4TTE A;  4YC9 A;  5DYA A;  3VKG A;  4O74 A;  5HQ5 A;  4LDF A;  3G0L A;  2YDW A;  5I40 A;  4CFK A;  2D82 A;  3MQM A;  5DX4 A;  5F3A A;  2RNX A;  4E96 A;  5D0C A;  5II2 A;  4PY6 A;  3FKM X;  3UVW A;  4NYV A;  5H1V A;  2YEM A;  5E3G A;  1E6I A;  5H85 A;  5CZG A;  5G4R A;  3GG3 A;  1ZKR A;  4AKN A;  4UYD A;  5LKT A;  3U5N A;  5FE8 A;  5KTW A;  3VKH A;  4LZR A;  2I7K A;  2RFJ A;  2RNW A;  4PTB A;  5AMF A;  4Z1Q A;  5FE6 A;  2YYN A;  5E3D A;  3MB3 A;  5C4Q A;  2WP1 A;  4IOQ A;  4PCI A;  5A5P A;  4GPJ A;  5F63 A;  1ZS5 A;  2L84 A;  2R0V A;  5IGM A;  4Z6I A;  4QYD A;  5FE5 A;  5EQ1 A;  1N72 A;  4YK0 A;  5EIC A;  4CUS A;  5BT5 A;  4IR6 A;  3UV2 A;  3LQJ A;  5I83 A;  5E9L A;  4O77 A;  5CFW A;  5EU1 A;  4YAT A;  5I88 A;  4NYW A;  5F62 A;  4MR5 A;  4BJX A;  3TLP A;  2DVR A;  5EI4 A;  4NS5 A;  2L85 A;  5L8U A;  4QBM A;  4UYF A;  3UVX A;  5FG5 A;  5A5N A;  4X2I A;  4NR8 A;  2N9G A;  3MUK A;  5D3P A;  5C87 A;  4IOO A;  5CUA A;  3ONI A;  4FLP A;  4MR4 A;  4MEO A;  4C66 A;  3D7C A;  3UV5 A;  5AD3 A;  4J0R A;  4NR4 A;  5LVQ A;  5II1 A;  4OGJ A;  4NR5 A;  4C67 A;  5EWC A;  5ENI A;  2H60 A;  2YQD A;  3U5M A;  5CUG A;  4HXO A;  5J0D A;  4QY4 A;  4QR5 A;  5F5Z A;  5A5S A;  3HMH A;  4UIU A;  5A7C A;  5EV9 A;  5E9I A;  4A9O A;  5L8T A;  4CL9 A;  5L97 A;  5FDZ A;  2F6N A;  4BW4 A;  3U5K A;  3U5O A;  5F1L A;  2YEK A;  3AQA A;  4QST A;  3O37 A;  4TT2 A;  5FG4 A;  5G4S A;  4O72 A;  4AI6 A;  2NXB A;  5ENB A;  4O78 A;  5EWH A;  5DYC A;  5DLX A;  3JVL A;  4YYH A;  3ZYU A;  4UIY A;  5IID A;  3LQI A;  1WUM A;  5FE2 A;  5HQ6 A;  2L5E A;  4YAD A;  2DWW A;  4NUC A;  4OGI A;  4YBT A;  3NXB A;  5I7X A;  2DVQ A;  5ENG A;  5AD2 A;  5C8G A;  2DKW A;  3MB4 A;  5I86 A;  4QEW A;  4N4F A;  5I7Y A;  2OO1 A;  4YY6 A;  3JVJ A;  4NXJ A;  5L98 A;  4UYF B;  4O7C A;  5DFD A;  2KTB B;  5EP7 A;  4PKL A;  5ETD A;  4A9H A;  4WIV A;  2E7O A;  4HBX A;  4O7F A;  5E9M A;  2WP2 A;  4YBS A;  4QC3 A;  2YW5 A;  5D3H A;  5KHM A;  4HXK A;  4KCX A;  4TZ8 A;  3D1B A;  4UYE A;  3P1C A;  5ETB A;  3SVF A;  5F36 A;  5K29 A;  4NRB A;  4Y03 A;  4O75 A;  5I89 A;  3LJW A;  5FFY A;  5D3R A;  4QSV A;  4YYK A;  2DVV A;  4NUD A;  4UIZ A;  2MJV B;  3U5P A;  4TZ2 A;  4IR3 A;  4MR3 A;  5CPE A;  4YYJ A;  5EPB A;  5TB6 A;  5ENF A;  4WHU A;  5E9Y A;  4LC2 A;  2RNY A;  3P1D A;  2D9E A;  5A5Q A;  5D3T A;  5E73 A;  4Z93 A;  4A9L A;  5HEL A;  2RI7 A;  4KV4 A;  4HBW A;  4XY9 A;  5H1T A;  4Q0N A;  5F61 A;  3QZT A;  3UVD A;  4DON A;  4NQN A;  5I1Q A;  4QSS A;  5D3N A;  5E74 A;  5CY9 A;  3O36 A;  5FG6 A;  4ALH A;  5ENC A;  4Z1S A;  5KTU A;  5IGL A;  5EA1 A;  3S92 A; 
#chains in the Genus database with same CATH homology
 5EPS A;  5D25 A;  5FE3 A;  5H1U A;  5EWW A;  2YEL A;  3S91 A;  4MEP A;  4YH4 A;  2E7N A;  4NUE A;  5DBM A;  4YAB A;  5FH6 A;  4HXN A;  1WUG A;  3AAD A;  4TT6 A;  4HXR A;  4J3I A;  5FB1 A;  5DKC A;  5ACY A;  5F1H A;  5IBN A;  5D3L A;  5L96 A;  3QZS A;  5I29 A;  5D7X A;  5LJ1 A;  5IGN A;  4HBY A;  1JM4 B;  5L99 A;  4N4G A;  5CUC A;  4NR6 A;  5LJ0 A;  4QNS A;  3U5J A;  5DFC A;  3DWY A;  2R0Y A;  5DYU A;  5COI A;  5CQ4 A;  3P5O A;  5EK9 A;  4A9I A;  4QEU A;  4YY4 A;  4LZS A;  5EWV A;  4YYG A;  5HLS A;  4UIX A;  5CQ5 A;  2G4A A;  5KU3 A;  5CQ7 A;  4NRA A;  4QC1 A;  5TCM A;  5CQ3 A;  5CQ6 A;  4XYA A;  3G0J A;  4QSQ A;  5FB0 A;  4XY8 A;  4CLB A;  4RVR A;  5IG6 A;  3JVK A;  5C85 A;  5HJC A;  5D3S A;  2DAT A;  4TYL A;  4A9J A;  5ENE A;  4Q0O A;  4HXS A;  3MUL A;  5CQA A;  5ENJ A;  5HM0 A;  5HRW A;  4NRC A;  2R10 A;  5CRM A;  5E7D A;  5LKX A;  5DKD A;  5HFQ A;  1JSP B;  5FBX A;  5JWM A;  3P1E A;  5HCL A;  3O33 A;  4LR6 A;  4YYM A;  5CGP A;  3LXJ A;  5DFB A;  3UVY A;  3Q2F A;  4O7B A;  4HXP A;  5EVA A;  2OUO A;  4F3I A;  4UYH A;  4UIT A;  3I3J A;  4CUU A;  5FE7 A;  4QSW A;  5DYX A;  4IR5 A;  4CUR A;  3IU6 A;  5F25 A;  5CU8 A;  3Q2E A;  4CUP A;  4KV1 A;  5EGU A;  5CQ8 A;  4LYI A;  5CP5 A;  4J0S A;  5HQ7 A;  4A9M A;  4NQM A;  4MEQ A;  4N4I A;  5DW2 A;  4A9K A;  4YYI A;  3O34 A;  1X0J A;  4A9N A;  4BHW A;  4CFL A;  4YAX A;  5CUB A;  4MR6 A;  5HEM A;  3QZV A;  3DAI A;  5D26 A;  3JVM A;  4O71 A;  2R0S A;  4TU6 A;  4CUQ A;  5CUE A;  5DY7 A;  4QZS A;  4ZQL A;  4XUB A;  3UV4 A;  4IOR A;  4TT4 A;  4QUU A;  3LQH A;  4O7A A;  5HEN A;  4HBV A;  4YH3 A;  3U5L A;  5JI8 A;  5D3J A;  5FH8 A;  5LKZ A;  4O76 A;  4A9E A;  4MEN A;  4XUA A;  5A5R A;  5AME A;  5BT3 A;  5LJ2 A;  5E9V A;  3UW9 A;  5DW1 A;  4UIW A;  4QSX A;  3P1F A;  3SVH A;  4QSU A;  3HMF A;  5I80 A;  3HME A;  5CUD A;  4TS8 A;  4UYG A;  5A85 A;  4LRG A;  4QR3 A;  2OSS A;  5C7N A;  4QB3 A;  4IR4 A;  4HXM A;  5LUU A;  4PS5 A;  2FSA A;  4HXL A;  4WHW A;  5FE4 A;  4J1P A;  5FE9 A;  5DKH A;  5LKU A;  2I8N A;  5LVR A;  3O35 A;  5HRX A;  5KTX A;  5KO4 A;  5FE0 A;  2LSP B;  2DVS A;  5EM3 A;  4LZ2 A;  3K2J A;  5ENH A;  4N3W A;  1F68 A;  5HRV A;  2RS9 B;  5CQT A;  5F2P A;  4TQN A;  5DLZ A;  5FFW A;  4PCE A;  4QEV A;  4QSP A;  3MXF A;  4A9F A;  4BW3 A;  4QUT A;  5IGK A;  2F6J A;  4ALG A;  2GRC A;  4QYL A;  4TU4 A;  4QR4 A;  2E3K A;  5CS8 A;  5F60 A;  5EIS A;  4N4H A;  4CUT A;  5A81 A;  5D24 A;  3RCW A;  5A83 A;  5CTL A;  5C89 A;  4NYX A;  4QSR A;  4LYW A;  4ZW1 A;  4UIV A;  5HFR A;  5EPR A;  5FE1 A;  4BW2 A;  5EWD A;  3SVG A;  4ZC9 A;  4O7E A;  2RO1 A;  5A82 A;  4YYN A;  5E0R A;  1EQF A;  5CRZ A;  4YBM A;  4NR9 A;  5FH7 A;  4NR7 A;  4O70 A;  4BW1 A;  5FFV A;  5E9K A;  3IU5 A;  4Z6H A;  4YYD A;  4OUF A;  5BT4 A;  5A5O A;  4LYS A;  4TTE A;  4YC9 A;  5DYA A;  4O74 A;  5HQ5 A;  4LDF A;  3G0L A;  2YDW A;  5I40 A;  4CFK A;  2D82 A;  3MQM A;  5DX4 A;  5F3A A;  2RNX A;  4E96 A;  5D0C A;  5II2 A;  4PY6 A;  3FKM X;  3UVW A;  4NYV A;  5H1V A;  2YEM A;  5E3G A;  1E6I A;  5H85 A;  5CZG A;  5G4R A;  3GG3 A;  4AKN A;  4UYD A;  5LKT A;  3U5N A;  5FE8 A;  5KTW A;  4LZR A;  2I7K A;  2RFJ A;  2RNW A;  4PTB A;  5AMF A;  4Z1Q A;  5FE6 A;  2YYN A;  5E3D A;  3MB3 A;  5C4Q A;  2WP1 A;  4IOQ A;  4PCI A;  5A5P A;  4GPJ A;  5F63 A;  1ZS5 A;  2L84 A;  2R0V A;  5IGM A;  4Z6I A;  4QYD A;  5FE5 A;  5EQ1 A;  1N72 A;  4YK0 A;  5EIC A;  4CUS A;  5BT5 A;  4IR6 A;  3UV2 A;  3LQJ A;  5I83 A;  5E9L A;  4O77 A;  5CFW A;  5EU1 A;  4YAT A;  5I88 A;  4NYW A;  5F62 A;  4MR5 A;  4BJX A;  3TLP A;  2DVR A;  5EI4 A;  4NS5 A;  2L85 A;  5L8U A;  4QBM A;  4UYF A;  3UVX A;  5FG5 A;  5A5N A;  4X2I A;  4NR8 A;  2N9G A;  3MUK A;  5D3P A;  5C87 A;  4IOO A;  5CUA A;  3ONI A;  4FLP A;  4MR4 A;  4MEO A;  4C66 A;  3D7C A;  3UV5 A;  5AD3 A;  4J0R A;  4NR4 A;  5LVQ A;  5II1 A;  4OGJ A;  4NR5 A;  4C67 A;  5EWC A;  5ENI A;  2H60 A;  2YQD A;  3U5M A;  5CUG A;  4HXO A;  5J0D A;  4QY4 A;  4QR5 A;  5F5Z A;  5A5S A;  3HMH A;  4UIU A;  5A7C A;  5EV9 A;  5E9I A;  4A9O A;  5L8T A;  4CL9 A;  5L97 A;  5FDZ A;  2F6N A;  4BW4 A;  3U5K A;  3U5O A;  5F1L A;  2YEK A;  3AQA A;  4QST A;  3O37 A;  4TT2 A;  5FG4 A;  5G4S A;  4O72 A;  2NXB A;  5ENB A;  4O78 A;  5EWH A;  5DYC A;  5DLX A;  3JVL A;  4YYH A;  3ZYU A;  4UIY A;  5IID A;  3LQI A;  1WUM A;  5FE2 A;  5HQ6 A;  2L5E A;  4YAD A;  2DWW A;  4NUC A;  4OGI A;  4YBT A;  3NXB A;  5I7X A;  2DVQ A;  5ENG A;  5AD2 A;  5C8G A;  2DKW A;  3MB4 A;  5I86 A;  4QEW A;  4N4F A;  5I7Y A;  2OO1 A;  4YY6 A;  3JVJ A;  4NXJ A;  5L98 A;  4UYF B;  4O7C A;  5DFD A;  2KTB B;  5EP7 A;  4PKL A;  5ETD A;  4A9H A;  4WIV A;  2E7O A;  4HBX A;  4O7F A;  5E9M A;  2WP2 A;  4YBS A;  4QC3 A;  2YW5 A;  5D3H A;  5KHM A;  4HXK A;  4KCX A;  4TZ8 A;  4UYE A;  3P1C A;  5ETB A;  3SVF A;  5F36 A;  5K29 A;  4NRB A;  4Y03 A;  4O75 A;  5I89 A;  3LJW A;  5FFY A;  5D3R A;  4QSV A;  4YYK A;  2DVV A;  4NUD A;  4UIZ A;  2MJV B;  3U5P A;  4TZ2 A;  4IR3 A;  4MR3 A;  5CPE A;  4YYJ A;  5EPB A;  5TB6 A;  5ENF A;  4WHU A;  5E9Y A;  4LC2 A;  2RNY A;  3P1D A;  2D9E A;  5A5Q A;  5D3T A;  5E73 A;  4Z93 A;  4A9L A;  5HEL A;  2RI7 A;  4KV4 A;  4HBW A;  4XY9 A;  5H1T A;  4Q0N A;  5F61 A;  3QZT A;  3UVD A;  4DON A;  4NQN A;  5I1Q A;  4QSS A;  5D3N A;  5E74 A;  5CY9 A;  3O36 A;  5FG6 A;  4ALH A;  5ENC A;  4Z1S A;  5KTU A;  5IGL A;  5EA1 A;  3S92 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...