3FKWA

Ampc k67r mutant apo structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
353
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSRTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Re-examining the role of Lys67 in class C beta-lactamase catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 116
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fkwA00
2Q9MA 5AQ7A 3IWIA 2H0YA 1WYBA 3BFDA 2IWBA 2X71A 3Q81A 4OPYA 2OSUA 2Y2OA 2ZQDA 4R3BA 4L0LA 3SH9A 4JF4A 1I2SA 4OOMA 2XLNA 5F1GA 1PYYA 4GN2A 3MBZA 3VP0A 2JCHA 4KG5A 5F83A 4UAAA 4KZ5A 2V2FF 4X68A 4JLFA 2ZMAA 5AQBA 3HLWA 2C5WB 4RX2A 4BD0A 3O86A 4LENA 2XFSA 5GLCA 1HTZA 4CPKA 4U0TA 3HLCA 3G32A 4C6YA 1XX2A 4HEFA 3HBRA 3UE3A 3RJUA 1BTLA 1C3BA 2V20A 3N4IA 2WYXA 4KG6A 4DRTA 1L0DA 2H10A 4GD8A 5DVAA 4E3NA 1PI4A 2QZ6A 2ZM2A 1ZG6A 1KGGA 1MWSA 1NZUA 2PBYA 2Y2LA 3AGFA 4H8RA 4OOLA 4OPZA 1LI0A 3WWXA 3IHAA 3I7JA 4ZJ3A 3VMAA 2DCFA 2R9WA 2IWDA 2JE5A 3D4FA 2HPBA 3LY3A 4GOGA 4OOYA 4X55A 5M1AA 4OQGA 4ZJ2A 1K6RA 4E6WA 3SOIA 5FQQA 4DE3A 3BRMA 1K57A 1MWUA 3G35A 4JKTA 3C4OA 2Y2MA 1IYQA 4LCLA 4B4XA 5HL1A 3A3EA 3VFFA 2EFXA 1NJ4A 1PZPA 2XD5A 3BFGA 4JF6A 4KZ6A 4P0MA 2Z2MB 4BQMA 5E2FA 4S2NC 4HBUA 3IF6A 1K25A 1CI9A 4X56A 1PZOA 4E3JA 4IBRA 1XKZA 5FDHA 4C75A 3UDXA 1JTGA 3BLSA 5EOEA 2WAEA 3C5AA 1JWZA 1KDWA 4GDBA 4OH0A 5CEBA 1W8QA 3LY4A 4K0XA 1H5XA 1KE4A 4PM7A 1YLJA 4FSFA 4KQOA 2WZZA 4DKIA 1BLSA 5DF7A 2Y59A 3IXDA 2XDMA 5CEDA 1GHMA 5TFQA 4HBTA 1IYOA 1JWVA 3PAGA 3G34A 3ZG5A 4NK3A 1W7FA 3UPPA 4ID4A 3G31A 5DF9A 1YMXA 3VP4A 5L2FA 1BULA 1ONGA 1L2SA 3M6HA 1LI9A 4P87A 3QHYA 3CZDA 4JXGA 4ZDXA 3RXWA 3GMWA 5I94A 5IHVA 2X02A 2ZQ8A 4FH4A 2JBFA 2ZM8A 3GV9A 1ERQA 2Y55A 3AGEA 3QNCA 4MEZA 1W8YA 1K57C 1N4OA 3IXGA 2WADA 2ZQAA 1E3UA 4EV4A 2E8IA 4M3KA 3PBNA 4UHUA 1WE4A 3DW0A 2G2UA 1XA7A 5E2GA 2Y2NA 2EXBA 3NI9A 4MNRA 4EBNA 3C7VA 5KSHA 1FQGA 1ES2A 1GA9A 2XH9A 3MKFA 5FQ9A 3CMZA 2ZQCA 4QJGA 4S2OA 5EVIB 5CGXA 4OLGA 3FWLA 3OCLA 1G68A 5EVIC 5CGSA 1RP5A 3S4XA 1ES3A 4KENB 4LV0A 2I72A 3DTMA 3OC2A 3Q7VA 3LO7A 3B3XA 4WEKA 2BLSA 1KDSA 5FQIA 5M18A 3E2LA 5GLDA 3HLFA 4LV1A 5CHUA 3CG5A 4BLMA 4JXSA 3ITAA 1K54C 3AGDA 3HL9A 4OKPA 4XXRA 3BFCA 1SDEA 1MXOA 2HP5A 1IKGA 3GVBA 5DTSA 3IH9A 4KZAA 2PU2A 3ZG0A 3C4PA 2WK0A 3IH8A 4PM6A 5F1FA 1K55A 2HDQA 3V3RA 4WM9A 2RCXA 5CXWA 5FA7A 3GTCA 1YT4A 3ZVTA 2J7VA 4DE1A 2WUQA 3W4OA 3PTEA 1FR1A 2WGVA 2Y4AA 2EXAA 4S2KA 5FI7A 1Y54A 3N8SA 5AQ9A 1YLZA 5A92A 4OONA 4O7DA 3GQZA 4KZ8A 4OLDA 5EOOA 3UE0A 4R4SA 2ZC4B 1O07A 5CHJA 1VQQA 3VSKA 5HAIA 1EI5A 2HDRA 3GRJA 3P09A 3ZG9B 3UE1A 1KGEA 4Y0TA 1OMEA 2XD1A 2XR0A 2ZD8A 3HREA 4BL2A 2ZQ9A 3N8LA 3A3FA 2QPNA 1E3UD 1K6SA 4JXWA 1BZAA 3QNBA 4EBLA 5HARA 3PBQA 1G6AA 1S6RA 2P9VB 3V50A 1HZOA 4JF5A 3VOYA 3ZDJA 5BOHA 4GB7A 3HLBA 1LL9A 1XA1A 3EQUA 4MBFA 4QHCA 4DDSA 1K54A 4RVAA 4E3IA 4EUZA 1J9MA 1H8YA 1LL5A 4KZBA 2WKEA 3M6BA 4OVDA 4WYYA 3SS3A 4BENA 5FQJA 1H8ZA 4UA9A 5KZHA 2EX8A 3V3SA 1FSWA 1NYYA 3IF6B 3OPLA 3PAEA 4QB8A 4WZ5C 5E43A 2EX9A 1PIOA 2ZQ7A 2H5SA 3OPHA 4ZTKA 1YLWA 3SS5A 3IF5A 1EROA 2HP9A 4N1XA 2ZC3B 3VP1A 4WZ4A 1TEMA 1LHYA 1MKIA 1MWRA 1KE0A 5HFOA 3FV7A 4GD6A 1FCOA 2G2WA 1ZC2A 1CI8A 3HVFA 1NYMA 4OPQA 2HDUA 4GDNA 3A3IA 4Q8IA 4X6TA 1XGIA 1SCWA 5CHMA 3E2KA 5EUAA 5JYPA 1YLPA 4N9LA 3UDIA 3ZGAB 3BECA 4OPRA 1HVBA 5GHYA 2X01A 3MZDA 3MZEA 3HLEA 3ISGA 1KGFA 3ZVWA 2XK1A 3BYDA 4E3KA 5U47A 1M40A 3LEZA 4JPMA 4ZJ1A 1YMSA 3IXBA 4BJPA 5CTMA 5JYOA 4X69A 3JYIA 4P85A 5M19A 4FH2A 2ZC5B 1MWTA 1DJBA 3O3VA 4Y7PA 4B88A 1L0GA 1CEGA 4MBHA 1K4EA 2A3UA 4PM8A 1XGJA 3A3JA 5DTTA 4OQHA 1KVLA 5EVID 5CECA 2ZJ9A 4N1HA 1NRFA 3ZG7B 2WZXA 1L0EA 4EQIA 5HAQA 5HAPA 5A93A 1M6KA 1TVFA 1LLBA 3PBRA 5DTKA 3IWQA 5D3OA 1I5QA 3NIAA 3IF6C 3Q7VB 1RGYA 3GR2A 2VGJA 5AQAA 4P6BA 5FI2A 4S2PA 1CK3A 3HUMA 5KSCA 3ZG8B 1XP4A 4E6XA 3IXHA 4YINA 3ZNTA 5TGFA 5CGWA 3Q7ZA 4PPRA 2HDSA 4UA6A 3RXXA 3VOZA 3UY6A 3NY4A 1L0FA 3OPRA 1ES5A 4S2JA 3GSGA 1Q2PA 3BEBA 5A90A 4PM9A 3WS0A 2XF3A 3DWZA 4E3LA 1VM1A 3NC8A 4GZBA 2J8YA 5EVIA 1MBLA 1MY8A 1JTDA 2R9XA 3V5MA 1BUEA 4F94A 4NETA 3WRTA 3NBLA 2VGKA 4DE0A 1DJCA 2H0TA 2IWCA 3C7UA 4K0WA 4N92A 4KQQA 4ZBEA 3FYZA 1PWGA 2Y2KA 4S2LA 4RA7A 5DF8A 2CC1A 3TG9A 1NY0A 1ONHA 1IEMA 4QY5A 5FQMA 1FSYA 1K38A 3IT9A 4S2NA 3WS2A 4LCMA 3FKVA 4R1GA 5FSRA 3MFDA 4KQRA 3EQVA 5GLAA 3N8RA 2GDNA 4S2IA 4X53A 3IQAA 2WKHA 1PI5A 4K91A 2J9PA 5J8XA 1K56D 3SH7A 2QMIA 1JVJA 4Y0OA 3G4PA 2JC7A 1BLPA 1SKFA 1ALQA 5FAQA 2J9OA 4IVKA 3MZFA 5GHZA 5FAPA 4LV3A 1XPBA 2Y2HA 4R0QA 2ZC6B 3ITBA 5FASA 3HLGA 1BSGA 4A5RA 4U0XA 4HESA 3BFFA 3WS4A 2V1ZA 4QY6A 1XXMA 4OP8A 4IBXA 3UN7A 4C3QA 2OV5A 1K4FA 1ERMA 1ES4A 1YM1A 2XEPA 5EPHA 4DE2A 3HUOA 2BG1A 2Y2QA 1PWCA 3BM6A 4WEJA 3TSGA 3G2ZA 4KZ4A 1E25A 1SHVA 2Y2GA 3OZHA 4RX3A 2FFFB 3CJMA 1ESIA 4DDYA 1FCNA 4MLLA 4WBGA 4IVIA 5FI6A 4GKUA 3WS5A 3SS4A 3WS1A 3MXSA 4KZ9A 1PW1A 3FZCA 1KE3A 3VSLA 1QMFA 4QU3A 2UWXA 2PU4A 3W4PA 1AXBA 1MPLA 5EECA 1IYPA 3MKEA 4KZ7A 5TR7A 2EFUA 1BT5A 5CERA 3S1YA 4YFMA 4ZAMA 4U3TA 2DNSA 5CTNA 3O87A 2P9VA 1IKIA 2WAFA 4Y0UA 4S2MA 2WGIA 3UPNA 2ZM0A 3G30A 2A49A 1GCEA 3M2JA 1YQSA 2Y2JA 4R23A 3TOIA 1NZOA 3ZNYA 3UPOA 1K55C 2Y2IA 1GHIA 5E2EA 3VP3A 3DWKA 4KZ3A 3HLDA 1FOFA 5CRFA 3IHBA 1GA0A 3PBSA 5E2HA 2WGWA 2ZLYA 4UA7A 1YLYA 3HUNA 1BLHA 5KMWA 1N9BA 3VP2A 3Q07A 1FR6A 3BFEA 3OPPA 1Q2QA 1E4DA 5FAOA 2Z2LB 1DY6A 2Q9NA 4E3MA 4OP5A 4XUZA 1NXYA 5A91A 3UO9A 4CJNA 4OQ0A 5GL9A 1KVMA 4R4RA 1ESUA 4JBFA 4EWFA 4RYEA 4Z9QA 1JWPA 4D2OA 3O88A 3BLMA 4WELA 4QD4A 4GNUA 5FATA 1GHPA 4PM5A 2C6WB 4BD1A 3S22A 1EWZA 4R3JA 1ZKJA 3M2KA 3PBTA 1Z6FA 4DXBA 1TDLA 3ZFZA 1WYCA 1SDNA 1IYSA 3NDGA 4FD8A 3W8KA 1DJAA 2XQZA 4PMAA 4XUXA 1QMEA 3P98A 3N7WA 2Y2PA 1BLCA 2DRWA 4WMCA 3N6IA 5HW3A 3UNWA 2XGNA 4IEDA 3ZCZA 2OLUA 5FQKA 3PBOA 3LCEA 4WZ5A 5F82A 1TDGA 2OLVA 1IELA 1I2WA 1FCMA 3W4QA 4DXCA 2EX6A 3V39A 2EX2A 1W79A 2ZC7A 1PWDA 2WKIA 3FKWA 1HD8A 2P74A 3VFHA 1RCJA 3Q82A 3IWOA 3NCKA 4FCFA 4OQIA 5GHXA 1W5DA 3ZHHA 4B4ZA 1U60A 4EBPA 2WGWB 5G18A 5GLBA 3G2YA 1PW8A 1O7EA 2FFYA 3Q1FA 4BL3A 4DF6A 1YLTA 5HX9A 3OCNA 4E3OA 1S0WA 2Y91A 2HP6A 3SH8A 1CEFA 3A3DA 1K56A 2XFTA 3MXRA 3NDEA 2B5RA 1ZG4A 3UDFA 4JXVA 3WRZA 1RGZA 5EE8A 4MBKA 5EVLA 4WMCD 4N9KA 4LV2A 2RL3A 4KG2A
chains in the Genus database with same CATH superfamily
3VE4A 5AQ7A 1WYBA 1T18A 1UGUA 3BFDA 2Y2OA 5HWTA 4I38A 3MFXA 3MBZA 2ZMAA 1TS6A 2C5WB 4CPKA 3E4QA 4HEFA 1C3BA 1W63Q 4KG6A 4DRTA 1PI4A 2CMNA 2QZ6A 1XJ4A 4G3VA 1ZG6A 4OOLA 5HD3A 1CQAA 5AJGA 4ZJ3A 3R4KA 1G28A 3MMHA 3D4FA 2HPBA 4GOGA 3CHWP 4OOYA 3S7QA 1S67L 4B93A 5DJUA 5FQQA 1GSVA 4JKTA 3VFFA 2XD5A 3BFGA 2V8CA 3A0RA 2Z2MB 4BQMA 5K5BA 4P6ZS 5E2FA 5G4ZA 4S2NC 2JHEA 4X56A 1PZOA 1JTGA 5EOEA 1T19A 2WAEA 3LY4A 4K0XA 1H5XA 4PM7A 2O9CA 4KQOA 2WZZA 5HWWA 5DFXA 1IYOA 2PAVP 1W7FA 3UPPA 5HWVA 5DF9A 3W2ZA 3C38A 1YMXA 1F2KA 1L2SA 4P87A 1LI9A 3QP6A 3CZDA 4JXGA 5C5KA 5I94A 5IHVA 2X02A 1K57C 3IXGA 3MQ0A 1E3UA 4M3KA 2M7UA 3DW0A 2G2UA 5E2GA 4EETB 2EXBA 5HDDA 3C7VA 5FQ9A 4QJGA 4S2OA 1LSWA 3S4XA 3OCLA 1RP5A 3HCYA 3B3XA 3K3DA 3T4SA 3E2LA 5GLDA 3HLFA 3CG5A 4BLMA 4JXSA 1K54C 3BFCA 1SDEA 2W1TB 5DTSA 2PU2A 3ZG0A 3IH8A 1K55A 2HDQA 5FA7A 3QP2A 2VGLM 1YT4A 2O99A 3ZVTA 4DE1A 2VZWA 2WUQA 1H8MA 2W3DA 2EXAA 5FI7A 1Y54A 3N8SA 4JGPA 4OONA 2PBDP 1NLYA 1DP6A 4GW9A 1O07A 4Q0JA 1EI5A 2OAP1 1X0OA 4LRYC 2XD1A 2XR0A 1LL8A 4BL2A 3NHQA 3A3FA 5IU1A 1E3UD 3RTYA 3UB6A 2P9VB 5BOHA 3HLBA 1OTBA 4RVAA 1D7EA 1H8YA 1F5MA 3M6BA 4BENA 4UA9A 4QB8A 2ZQ7A 4ZTKA 3KSIA 2HP9A 3QP1A 1FIKA 3VP1A 2MJ6A 4NXBA 2PT7A 3T12B 1MKIA 1KE0A 4GD6A 1CI8A 4GDNA 3DTKA 1YPRA 5EUAA 5JYPA 1YLPA 3RFBA 3TJZC 4N9LA 4F3LB 4GLQA 2XROA 2LB5A 2XK1A 4CLCB 2W3HA 5F68A 4JPMA 4MCWA 1YMSA 4Y3IA 3IXBA 3BW6A 5F5YA 4DN0A 5L8MA 1K0KA 1MWTA 2ZC5B 3CUEC 3KSHA 3R7WA 3RH8B 5EVID 1N9LA 2K2NA 4EQIA 5HAQA 5HAPA 3PBRA 1LLBA 3IWQA 1I5QA 2OWJA 3NIAA 4Y5FA 4NXGA 2O0YA 1CK3A 3ZG8B 4E6XA 1SKOB 2ACGA 5TGFA 4R6LA 3Q7ZA 1GSXA 4S2JA 3GSGA 5TBMB 3EGXC 3BEBA 4CQHA 4GZBA 1MBLA 2PYRA 4I3IA 3V5MA 2I9VA 2J3TC 3WRTA 3K2NA 2VGKA 4DE0A 1Y28A 2H0TA 2IWCA 3LR5A 3T4OA 3MQQA 1NY0A 4IHQA 4QY5A 1XJ3A 4LCMA 3FKVA 4R1GA 3MFDA 3N8RA 4S2IA 4X53A 4Y2FA 1PI5A 4PKYG 2QMIA 1SKFA 3U2AA 3MZFA 2VLGA 1YSQA 3ITBA 5FASA 2V9AA 4U0XA 5I5LA 2D02A 5AVFA 3FG8A 4OP8A 1Y4OA 3UN7A 1K4FA 1ERMA 4DE2A 2L1MA 4Q0IA 3LEQA 3G2ZA 1E25A 1SHVA 3OZHA 4WLAA 3KO6A 3CJMA 1ESIA 3LR0A 1NRJA 3SS4A 1Z09A 4ESPA 4EXOA 3FZCA 4QU3A 1AXBA 1MPLA 1D06A 4Y15A 4HP9A 2P9VA 1IKIA 1DRMA 4Y0UA 3C30A 4S2MA 2ZM0A 4R23A 3ZNYA 3UPOA 4EEPA 5E2EA 3DWKA 2Q0OA 4KZ3A 3E4PA 3PBSA 2B02A 1YLYA 3LR3A 1N9BA 5FAOA 4E3MA 4GCZA 4CJNA 3F1NA 4I5SA 4EWFA 1JWPA 2ZMFA 4GS9B 4QD4A 4GNUA 3H82A 1V9ZA 1EWZA 4R3JA 2JKTI 1ZKJA 3D9YA 3M2KA 4UEYA 2NUPC 4DXBA 3S7NA 5F6AA 4X25A 5EM1A 3ZFZA 1WYCA 3LGOA 1DJAA 4XUXA 3P98A 1VB6A 4WMCA 3N6IA 3ZCZA 2OLUA 5FQKA 3PBOA 1D1JA 3LCEA 4DJ3A 2OLVA 2PHYA 2EX2A 2ZC7A 3FKWA 4EBPA 4B4ZA 4DJ2A 1O7EA 2FFYA 4DF6A 1UWPX 5HX9A 1NLZA 4E3OA 5AVEA 1OJGA 4CLCA 4Y13A 3SZTA 1K56A 4X1MA 5EVLA 4MBKA 1N9NA 1T1CA 2RL3A 4KG2A 4JGQA 3Q81A 4OPYA 2PDRA 2OSUA 4L0LA 3SH9A 4JF4A 4ZRRA 5F1GA 2HV1A 3G6OA 2JCHA 5F83A 4KZ5A 4X68A 3EEHA 4JLFA 3HLWA 4LRXC 5GLCA 1HTZA 2P04A 1BTLA 2YKHA 5KIZA 4EERA 4NEED 1JNUA 1L0DA 3BQAA 3UB8A 4BBUA 2A24B 3AGFA 3WWXA 3CPTA 3I7JA 1VETA 2QHKA 3LY3A 4X55A 4WF0A 5M1AA 4OQGA 3CPTB 3C4OA 1IYQA 4B4XA 5HL1A 3A3EA 2W0NA 2K7SA 2GNXA 4HBUA 1IFQA 1LSVA 3H82B 4FOFA 1XKZA 3SW1A 5IT5A 4JGOA 2W1TA 3PHYA 1KE4A 2PR6A 4BMWA 1P97A 4FSFA 2M7VA 5DF7A 4NXFA 2XDMA 5CEDA 1GHMA 1VEUA 5TFQA 2VX8A 3FPWA 1UWNX 4ID4A 5L2FA 2PD8A 2ZM8A 3GV9A 4MEZA 1S4RA 2Y79A 4EEUA 3GECA 2WADA 1L3LA 4WL9A 4GS9A 4PHTA 4EBNA 5KSHA 3F1OB 1FQGA 1ES2A 1GA9A 3MKFA 3CMZA 1TS7A 5G4YA 5CGXA 3FWLA 1T1AA 1G68A 2GZAA 2ZBBA 3OC2A 4WEKA 3Q7VA 2BLSA 4LV1A 5CHUA 3ITAA 3AGDA 3MR0A 4HI4A 2HP5A 3GVBA 3IH9A 4KZAA 1BYWA 1OJ5A 1FR1A 2Y4AA 2QKPA 5AQ9A 5TBMA 1YLZA 4O7DA 4KZ8A 4OLDA 4R4SA 5HAIA 3GRJA 4HOIA 3UE1A 3HREA 3N8LA 5IS1A 2O9BA 4JXWA 3QNBA 2PD7A 1VHMA 1HZOA 1P0ZA 1XA1A 4DDSA 4MBFA 4QHCA 4EUZA 4OVDA 4WYYA 5KZHA 5FQJA 1H8ZA 1SZVA 2XA7M 3IS2B 4YOFA 5E43A 1F9IA 1EROA 2VJWA 3B42A 3FV7A 5EFWA 1IOUA 2G2WA 1ZC2A 3HVFA 1NYMA 4OPQA 2HDUA 1ZHHB 4Q8IA 4X6TA 1XGIA 1SCWA 4LGWA 3LI8A 3ZGAB 4I3JA 4OPRA 1HVBA 3BQ8A 3ISGA 2XRNA 2JKFA 3D72A 3T4JA 3KSFA 4E3KA 3ZQ5A 5U47A 3LEZA 2YKFA 3T50A 2ZL1B 3PR6A 4X69A 2L4RA 4MBHA 1XGJA 3A3JA 5DTTA 4OQHA 1KVLA 1NRFA 5HSQA 1M6KA 1TVFA 5DTKA 4BBVA 5D3OA 1P9RA 4P6BA 1S4SA 4D60A 2WKPA 3HUMA 3TRCA 3IXHA 5J4EA 3ZNTA 5CGWA 2W1RA 2Z6CA 3UY6A 1L0FA 2H28A 1ES5A 4PM9A 3WS0A 4E3LA 1VM1A 2J8YA 2R9XA 3VE3A 4ZBEA 1LT0A 1PWGA 2Y2KA 4RA7A 3CUEA 4BWIA 4HHDA 4MMNA 4NXEA 3WS2A 1V9YA 2BTFP 2WKHA 3S7OA 4O8GA 2J9PA 2BASA 3SH7A 2HJEA 1JVJA 3G4PA 3R7WB 5FDSA 5DFYA 2JC7A 2OAQ1 3HJKA 1ALQA 5FAPA 3BJNA 4LV3A 4R0QA 2ZC6B 3T1SA 1BSGA 2VV8A 4JGRA 4HESA 1G5UA 2V1ZA 4QY6A 1XXMA 3UMDA 1YKDA 2OV5A 3HUOA 2BG1A 1EW0A 3NULA 4K08A 1S66L 5FI6A 4KZ9A 3GDIA 4BBTA 1QMFA 3JVUA 3MKEA 2D01A 2EFUA 3ICYA 4YFMA 5CTNA 1OTEA 4IUKA 3ULFA 2WAFA 2A49A 1GCEA 5A8BA 1K55C 3VP3A 3HLDA 1GA0A 3IBRA 2WGWA 3HUNA 5KMWA 3LIBA 4OP5A 4XUZA 1OT6A 3PYPA 5GL9A 1KVMA 2A24A 1ESUA 4D2OA 3O88A 1T1BA 4BD1A 2M1CA 3PBTA 1Z6FA 1IYSA 1DP8A 1QMEA 3BY9A 2Y2PA 1BLCA 2XGNA 1XFQA 1TDGA 4DXCA 2EX6A 2WKIA 4FCFA 5GHXA 1U60A 3G2YA 1W63M 2V0UA 3E0YA 2Y91A 2XFTA 3UB9A 3MXRA 1ZG4A 3IX8A 4JXVA 3UDFA 1RGZA 4WMCD 4N9KA 2Q9MA 2ZOIA 2H0YA 2IWBA 3L7HA 3MF0A 1I2SA 2XLNA 3LIEA 1PYYA 4GN2A 3JPUA 4KG5A 2KLIA 2V2FF 4UQIM 4BD0A 2XFSA 1XX2A 3UE3A 3RJUA 3OBFA 5DKLA 2V20A 3N4IA 2WYXA 4GD8A 5DVAA 3F1PB 2ZM2A 2HZ5A 5HZHA 1KGGA 1MWSA 2PBYA 4H8RA 2Y2LA 1OTIA 2DCFA 4M4XA 3EGDC 2XSSA 4FUWA 2JE5A 4MN5A 4F3LA 4ZJ2A 5HDSA 1TS0A 4AFIA 3CLOA 4KUOA 2Y2MA 2EFXA 3T4QA 2J3TD 2EWWA 4KZ6A 4P0MA 3OOVA 3QP4A 2XA7S 2QWSA 3IF6A 2W3FA 2E8JA 4Y17A 3FPVA 1CI9A 4E3JA 4IBRA 4C75A 3C5AA 1JWZA 1KDWA 4GDBA 1YLJA 1A0KA 3A0VA 5J3WA 2KOIA 2Y59A 3IXDA 3LIDA 4ARZA 4HBTA 3ZG5A 4NK3A 3CAXA 3VP4A 1BULA 3M6HA 3QHYA 3KYQA 1YAXA 3GMWA 2VEAA 4L9EA 3B33A 4FH4A 2Y55A 3AGEA 1W8YA 1H0MA 2ZQAA 1CF0A 2V0WA 2E8IA 3PBNA 1WE4A 3NI9A 4MNRA 2ZQCA 2K31A 1ES3A 1YSPA 4KENB 5TJJA 4LV0A 2I72A 3DTMA 3LO7A 1MKMA 5FQIA 5M18A 3A0SA 3VV4A 4HY8A 4OKPA 3K3CA 3DTIA 3C4PA 2WK0A 4WM9A 5CXWA 2HJ9C 3GTCA 2J7VA 4LRZE 4O0PA 5HPIA 3W4OA 3PTEA 2WGVA 4I3AA 5A92A 5J7EA 5CHJA 2J80A 1VQQA 3VSKA 2HDRA 2JKRM 4HJ4A 1J3WA 3T1RA 3ZG9B 1OMEA 2ZD8A 2ZQ9A 3TW8A 1G6OA 1KOUA 2VV7A 2QPNA 1S1YA 2JKGA 1G6AA 1WA9A 1S6RA 3MJQA 1DP9A 3ZDJA 3S7PA 3DTEA 4GB7A 1LL9A 1K54A 4KZBA 4QPRA 2EX8A 1NYYA 3IF6B 3OPHA 3T1QB 1YLWA 3SS5A 4N1XA 5CX7A 5EM0A 4MN7A 3UB5P 2FH5A 5MC7A 1TEMA 1LHYA 1MWRA 5HFOA 1FCOA 3A3IA 3IBJA 3EWKA 3BECA 5F69A 3HLEA 1KGFA 3BYDA 4BJPA 5CTMA 4PKYA 5FEFA 3JYIA 4P85A 4FH2A 5EVEA 4B88A 1DJBA 1CEGA 2A3UA 4PM8A 2KDKA 3QP8A 3NJAA 5CECA 2ZJ9A 4N1HA 4XT2A 4Q0HA 5FEGA 2W3GA 4MN6A 2W3EA 3IF6C 2VGJA 5FI2A 3LYXA 4YINA 3NOTC 3HJIA 4HJ6A 4PPRA 2A2LA 3OPRA 1Q2PA 5A90A 4O01A 2HGVA 2XF3A 3DWZA 1F98A 3LUQA 4L9FA 3KX0X 1PNEA 1JTDA 1BUEA 4NETA 2UV0E 3NBLA 1DJCA 4B9OA 3FYZA 4S2LA 3TG9A 1ONHA 1IEMA 4XT2B 1K38A 3IT9A 4S2NA 4KQRA 3EQVA 4LLOB 4LPZA 1AWIA 2GJ3A 1K56D 4Y0OA 2AVXA 5FAQA 4IVKA 2OWHA 3LIFA 3HLGA 4A5RA 4NKPA 3E4OA 3BFFA 2P7JA 4IBXA 3CI6A 1ES4A 5EPHA 5HPFA 3BM6A 4WEJA 4UQIS 4KZ4A 3MSHA 4RX3A 4WBGA 4IVIA 2VKSA 3WS5A 2W27A 1PW1A 2WKRA 2B18A 2PU4A 3EEAA 1IYPA 4KZ7A 1BT5A 5CERA 4ZAMA 4U3TA 2DNSA 2FZ0A 2WGIA 3G30A 3M2JA 3TOIA 2Y2JA 1NZOA 1GHIA 2LB9A 2O9AA 1FOFA 5E2HA 2ZLYA 4X1LA 2WKQA 3BFEA 1Q2QA 1E4DA 2Z2LB 1H3QA 4QWOA 1DY6A 2Q9NA 4WN5A 1NXYA 1CJFA 4DMZA 3O5YA 4H6JA 2Z6DA 4RYEA 4Z9QA 3T1XA 3BLMA 4WELA 1GHPA 4GJ4A 1TDLA 4YNRA 4FTXA 4FD8A 4PMAA 1NWZA 2INWA 2DRWA 5HW3A 1ODVA 4WZ5A 5F82A 1IELA 3W4QA 3VOLA 3V39A 4HNBA 1PWDA 1HD8A 2P74A 3VFHA 3Q82A 3IWOA 3NCKA 4EESA 4EUVA 1W5DA 2WGWB 3F1PA 3Q1FA 4BL3A 3IX4A 2HP6A 1CEFA 4MDZA 4Z1WA 3IWIA 3UE6A 2JKTM 3H9WA 2X71A 4R3BA 2ZQDA 3BY8A 3OLOA 5HDCA 4OOMA 1OTAA 3ZYTA 3VP0A 5AQBA 4RX2A 3O86A 4LENA 1HLUP 4HH3A 1OTDA 4U0TA 5EV0A 1S1ZA 3HLCA 3P01A 3G32A 1XJ6A 4R38A 4C6YA 3HBRA 4KQDA 5DKKA 4EQ1A 3LI9A 1TS8A 2G7UA 4EU0A 4ETXA 3DBAA 2H10A 4CLCE 4E3NA 4EW7A 3C8CA 4UAAA 1NZUA 4OPZA 1LI0A 3IHAA 3VMAA 2R9WA 2IWDA 4YWZA 4ETZA 4E6WA 1K6RA 3KYEA 3SOIA 4DE3A 3BRMA 4IUHA 1K57A 1MWUA 3G35A 4II7A 4R3AA 2ZMVA 4LCLA 1NJ4A 1PZPA 4JF6A 2NUTC 4P6ZM 1K25A 3QP5A 4LFUA 2VA0A 5FDHA 2KX6A 3UDXA 3BLSA 4OH0A 5CEBA 1W8QA 2DMWA 3CITA 4DKIA 1BLSA 2JN7A 1XFNA 3JVVA 3PAGA 1JWVA 5HD5A 3G34A 3G31A 1ONGA 1TF1A 4ZDXA 3RXWA 2ZQ8A 2JBFA 1ERQA 3QNCA 1N4OA 3TE8A 4G3KA 5DJTA 3E98A 5HL6A 4EV4A 4UHUA 2V1BA 3V67A 1XA7A 2Y2NA 2QJ5A 3LIAA 2XH9A 2PRFA 4GHIB 4OLGA 5EVIB 2QJ7A 5EVIC 5CGSA 3LFVA 3FC7A 1KDSA 1PRQA 1FILA 4R70A 3C2WA 3HL9A 4XXRA 1MXOA 1IKGA 4PM6A 5F1FA 3V3RA 2RCXA 5LBRA 1SKOA 3NECA 4E04A 1P9WA 2JKRI 4S2KA 1OPXA 3GQZA 3UE0A 5EOOA 2HF6A 2ZC4B 3NOUC 4PAUA 3P09A 1KGEA 4Y0TA 4CLCD 2EWVA 3MS6A 4EBLA 1K6SA 1BZAA 4HH2A 5HARA 3PBQA 3V50A 4JF5A 3VOYA 3KSGA 3EQUA 5FL3A 4E3IA 1J9MA 1LL5A 2WKEA 3SS3A 3V3SA 1FSWA 3OPLA 3PAEA 4WZ5C 4ME4A 2EX9A 1PIOA 2V1AA 2H5SA 3UMEA 1PFLA 3T4KA 3IF5A 2ZC3B 4WZ4A 2R78A 5CHMA 3E2KA 4HJ3A 2L0WA 3UDIA 5GHYA 2X01A 3MZDA 3MZEA 3L9KA 3ZVWA 1M40A 4ZJ1A 1LSXA 3IS2A 4HIAA 5JYOA 5M19A 3O3VA 4Y7PA 1L0GA 1XJ2A 3BWLA 1K4EA 3EOIA 3F1OA 2OOLA 4HP4A 3ZG7B 2WZXA 1L0EA 5A93A 5AQAA 3Q7VB 1RGYA 3GR2A 2GX5A 2J3WA 1VEUB 2VK3A 4S2PA 3NOPC 5KSCA 1XP4A 4G3WA 2HDSA 4UA6A 3RXXA 3VOZA 3T4LA 3NY4A 5L07A 2V8FA 3NC8A 4GHIA 5EVIA 1MY8A 4F94A 3U4LP 3KYZA 3C7UA 4K0WA 4I39A 4N92A 4KQQA 1MZUA 5DF8A 2CC1A 5FQMA 1FSYA 1TD5A 3PXPA 3MXQA 5FSRA 4HQAA 5GLAA 2IA2A 2GDNA 3IQAA 4K91A 5J8XA 1BLPA 2J9OA 5GHZA 1XPBA 2Y2HA 3WS4A 3F1NB 1STZA 5L10A 4C3QA 1YM1A 2XEPA 4CLCC 2Y2QA 2VGLS 4H6JB 1PWCA 3TSGA 2Y2GA 2FFFB 4DDYA 1FCNA 4MLLA 4RQ9A 4GKUA 3WS1A 3MXSA 1KE3A 3VSLA 2UWXA 3W4PA 5EECA 2EA9A 5TR7A 3S1YA 2ZL1A 3O87A 2QYBA 1ACFA 4IJGA 3MQOA 4WUJA 3UPNA 1YQSA 3D3OA 2Y2IA 5CRFA 3IHBA 2P08A 4UA7A 1BLHA 1OT9A 2ZOHA 3VP2A 3Q07A 1FR6A 3OPPA 3IX3A 4ARZB 4KUKA 5A91A 3UO9A 4OQ0A 2VV6A 4R4RA 4JBFA 3P7NA 4L9GA 2Y8HA 3DAVA 1ZTUA 5FATA 4PM5A 2C6WB 3S22A 3CWFA 3T4TA 1GSWA 1SDNA 3NDGA 3W8KA 2XQZA 3LICA 3N7WA 3UNWA 4IEDA 2PYPA 1FCMA 1I2WA 2PR5A 3LR4A 3H7WA 3H7WB 1W79A 1VETB 1RCJA 4OQIA 1MC0A 5L09A 3ZHHA 5G18A 5GLBA 3UB7A 1PW8A 3B47A 4NG2A 1YLTA 3OCNA 1S0WA 3SH8A 2B95A 3A3DA 3NDEA 2B5RA 3WRZA 1N9OA 5EE8A 4LV2A
chains in the Genus database with same CATH topology
2Q9MA 5AQ7A 3IWIA 2H0YA 1WYBA 3BFDA 2IWBA 2X71A 3Q81A 4OPYA 2OSUA 2Y2OA 2ZQDA 4R3BA 4L0LA 3SH9A 4JF4A 1I2SA 4OOMA 2XLNA 5F1GA 1PYYA 4GN2A 3MBZA 3VP0A 2JCHA 4KG5A 5F83A 4UAAA 4KZ5A 2V2FF 4X68A 4JLFA 2ZMAA 5AQBA 3HLWA 2C5WB 4RX2A 4BD0A 3O86A 4LENA 2XFSA 5GLCA 1HTZA 4CPKA 4U0TA 3HLCA 3G32A 4C6YA 1XX2A 4HEFA 3HBRA 3UE3A 3RJUA 1BTLA 1C3BA 2V20A 3N4IA 2WYXA 4KG6A 4DRTA 1L0DA 2H10A 4GD8A 5DVAA 4E3NA 1PI4A 2QZ6A 2ZM2A 1ZG6A 1KGGA 1MWSA 1NZUA 2PBYA 2Y2LA 3AGFA 4H8RA 4OOLA 4OPZA 1LI0A 3WWXA 3IHAA 3I7JA 4ZJ3A 3VMAA 2DCFA 2R9WA 2IWDA 2JE5A 3D4FA 2HPBA 3LY3A 4GOGA 4OOYA 4X55A 5M1AA 4OQGA 4ZJ2A 1K6RA 4E6WA 3SOIA 5FQQA 4DE3A 3BRMA 1K57A 1MWUA 3G35A 4JKTA 3C4OA 2Y2MA 1IYQA 4LCLA 4B4XA 5HL1A 3A3EA 3VFFA 2EFXA 1NJ4A 1PZPA 2XD5A 3BFGA 4JF6A 4KZ6A 4P0MA 2Z2MB 4BQMA 5E2FA 4S2NC 4HBUA 3IF6A 1K25A 1CI9A 4X56A 1PZOA 4E3JA 4IBRA 1XKZA 5FDHA 4C75A 3UDXA 1JTGA 3BLSA 5EOEA 2WAEA 3C5AA 1JWZA 1KDWA 4GDBA 4OH0A 5CEBA 1W8QA 3LY4A 4K0XA 1H5XA 1KE4A 4PM7A 1YLJA 4FSFA 4KQOA 2WZZA 4DKIA 1BLSA 5DF7A 2Y59A 3IXDA 2XDMA 5CEDA 1GHMA 5TFQA 4HBTA 1IYOA 1JWVA 3PAGA 3G34A 3ZG5A 4NK3A 1W7FA 3UPPA 4ID4A 3G31A 5DF9A 1YMXA 3VP4A 5L2FA 1BULA 1ONGA 1L2SA 3M6HA 1LI9A 4P87A 3QHYA 3CZDA 4JXGA 4ZDXA 3RXWA 3GMWA 5I94A 5IHVA 2X02A 2ZQ8A 4FH4A 2JBFA 2ZM8A 3GV9A 1ERQA 2Y55A 3AGEA 3QNCA 4MEZA 1W8YA 1K57C 1N4OA 3IXGA 2WADA 2ZQAA 1E3UA 4EV4A 2E8IA 4M3KA 3PBNA 4UHUA 1WE4A 3DW0A 2G2UA 1XA7A 5E2GA 2Y2NA 2EXBA 3NI9A 4MNRA 4EBNA 3C7VA 5KSHA 1FQGA 1ES2A 1GA9A 2XH9A 3MKFA 5FQ9A 3CMZA 2ZQCA 4QJGA 4S2OA 5EVIB 5CGXA 4OLGA 3FWLA 3OCLA 1G68A 5EVIC 5CGSA 1RP5A 3S4XA 1ES3A 4KENB 4LV0A 2I72A 3DTMA 3OC2A 3Q7VA 3LO7A 3B3XA 4WEKA 2BLSA 1KDSA 5FQIA 5M18A 3E2LA 5GLDA 3HLFA 4LV1A 5CHUA 3CG5A 4BLMA 4JXSA 3ITAA 1K54C 3AGDA 3HL9A 4OKPA 4XXRA 3BFCA 1SDEA 1MXOA 2HP5A 1IKGA 3GVBA 5DTSA 3IH9A 4KZAA 2PU2A 3ZG0A 3C4PA 2WK0A 3IH8A 4PM6A 5F1FA 1K55A 2HDQA 3V3RA 4WM9A 2RCXA 5CXWA 5FA7A 3GTCA 1YT4A 3ZVTA 2J7VA 4DE1A 2WUQA 3W4OA 3PTEA 1FR1A 2WGVA 2Y4AA 2EXAA 4S2KA 5FI7A 1Y54A 3N8SA 5AQ9A 1YLZA 5A92A 4OONA 4O7DA 3GQZA 4KZ8A 4OLDA 5EOOA 3UE0A 4R4SA 2ZC4B 1O07A 5CHJA 1VQQA 3VSKA 5HAIA 1EI5A 2HDRA 3GRJA 3P09A 3ZG9B 3UE1A 1KGEA 4Y0TA 1OMEA 2XD1A 2XR0A 2ZD8A 3HREA 4BL2A 2ZQ9A 3N8LA 3A3FA 2QPNA 1E3UD 1K6SA 4JXWA 1BZAA 3QNBA 4EBLA 5HARA 3PBQA 1G6AA 1S6RA 2P9VB 3V50A 1HZOA 4JF5A 3VOYA 3ZDJA 5BOHA 4GB7A 3HLBA 1LL9A 1XA1A 3EQUA 4MBFA 4QHCA 4DDSA 1K54A 4RVAA 4E3IA 4EUZA 1J9MA 1H8YA 1LL5A 4KZBA 2WKEA 3M6BA 4OVDA 4WYYA 3SS3A 4BENA 5FQJA 1H8ZA 4UA9A 5KZHA 2EX8A 3V3SA 1FSWA 1NYYA 3IF6B 3OPLA 3PAEA 4QB8A 4WZ5C 5E43A 2EX9A 1PIOA 2ZQ7A 2H5SA 3OPHA 4ZTKA 1YLWA 3SS5A 3IF5A 1EROA 2HP9A 4N1XA 2ZC3B 3VP1A 4WZ4A 1TEMA 1LHYA 1MKIA 1MWRA 1KE0A 5HFOA 3FV7A 4GD6A 1FCOA 2G2WA 1ZC2A 1CI8A 3HVFA 1NYMA 4OPQA 2HDUA 4GDNA 3A3IA 4Q8IA 4X6TA 1XGIA 1SCWA 5CHMA 3E2KA 5EUAA 5JYPA 1YLPA 4N9LA 3UDIA 3ZGAB 3BECA 4OPRA 1HVBA 5GHYA 2X01A 3MZDA 3MZEA 3HLEA 3ISGA 1KGFA 3ZVWA 2XK1A 3BYDA 4E3KA 5U47A 1M40A 3LEZA 4JPMA 4ZJ1A 1YMSA 3IXBA 4BJPA 5CTMA 5JYOA 4X69A 3JYIA 4P85A 5M19A 4FH2A 2ZC5B 1MWTA 1DJBA 3O3VA 4Y7PA 4B88A 1L0GA 1CEGA 4MBHA 1K4EA 2A3UA 4PM8A 1XGJA 3A3JA 5DTTA 4OQHA 1KVLA 5EVID 5CECA 2ZJ9A 4N1HA 1NRFA 3ZG7B 2WZXA 1L0EA 4EQIA 5HAQA 5HAPA 5A93A 1M6KA 1TVFA 1LLBA 3PBRA 5DTKA 3IWQA 5D3OA 1I5QA 3NIAA 3IF6C 3Q7VB 1RGYA 3GR2A 2VGJA 5AQAA 4P6BA 5FI2A 4S2PA 1CK3A 3HUMA 5KSCA 3ZG8B 1XP4A 4E6XA 3IXHA 4YINA 3ZNTA 5TGFA 5CGWA 3Q7ZA 4PPRA 2HDSA 4UA6A 3RXXA 3VOZA 3UY6A 3NY4A 1L0FA 3OPRA 1ES5A 4S2JA 3GSGA 1Q2PA 3BEBA 5A90A 4PM9A 3WS0A 2XF3A 3DWZA 4E3LA 1VM1A 3NC8A 4GZBA 2J8YA 5EVIA 1MBLA 1MY8A 1JTDA 2R9XA 3V5MA 1BUEA 4F94A 4NETA 3WRTA 3NBLA 2VGKA 4DE0A 1DJCA 2H0TA 2IWCA 3C7UA 4K0WA 4N92A 4KQQA 4ZBEA 3FYZA 1PWGA 2Y2KA 4S2LA 4RA7A 5DF8A 2CC1A 3TG9A 1NY0A 1ONHA 1IEMA 4QY5A 5FQMA 1FSYA 1K38A 3IT9A 4S2NA 3WS2A 4LCMA 3FKVA 4R1GA 5FSRA 3MFDA 4KQRA 3EQVA 5GLAA 3N8RA 2GDNA 4S2IA 4X53A 3IQAA 2WKHA 1PI5A 4K91A 2J9PA 5J8XA 1K56D 3SH7A 2QMIA 1JVJA 4Y0OA 3G4PA 2JC7A 1BLPA 1SKFA 1ALQA 5FAQA 2J9OA 4IVKA 3MZFA 5GHZA 5FAPA 4LV3A 1XPBA 2Y2HA 4R0QA 2ZC6B 3ITBA 5FASA 3HLGA 1BSGA 4A5RA 4U0XA 4HESA 3BFFA 3WS4A 2V1ZA 4QY6A 1XXMA 4OP8A 4IBXA 3UN7A 4C3QA 2OV5A 1K4FA 1ERMA 1ES4A 1YM1A 2XEPA 5EPHA 4DE2A 3HUOA 2BG1A 2Y2QA 1PWCA 3BM6A 4WEJA 3TSGA 3G2ZA 4KZ4A 1E25A 1SHVA 2Y2GA 3OZHA 4RX3A 2FFFB 3CJMA 1ESIA 4DDYA 1FCNA 4MLLA 4WBGA 4IVIA 5FI6A 4GKUA 3WS5A 3SS4A 3WS1A 3MXSA 4KZ9A 1PW1A 3FZCA 1KE3A 3VSLA 1QMFA 4QU3A 2UWXA 2PU4A 3W4PA 1AXBA 1MPLA 5EECA 1IYPA 3MKEA 4KZ7A 5TR7A 2EFUA 1BT5A 5CERA 3S1YA 4YFMA 4ZAMA 4U3TA 2DNSA 5CTNA 3O87A 2P9VA 1IKIA 2WAFA 4Y0UA 4S2MA 2WGIA 3UPNA 2ZM0A 3G30A 2A49A 1GCEA 3M2JA 1YQSA 2Y2JA 4R23A 3TOIA 1NZOA 3ZNYA 3UPOA 1K55C 2Y2IA 1GHIA 5E2EA 3VP3A 3DWKA 4KZ3A 3HLDA 1FOFA 5CRFA 3IHBA 1GA0A 3PBSA 5E2HA 2WGWA 2ZLYA 4UA7A 1YLYA 3HUNA 1BLHA 5KMWA 1N9BA 3VP2A 3Q07A 1FR6A 3BFEA 3OPPA 1Q2QA 1E4DA 5FAOA 2Z2LB 1DY6A 2Q9NA 4E3MA 4OP5A 4XUZA 1NXYA 5A91A 3UO9A 4CJNA 4OQ0A 5GL9A 1KVMA 4R4RA 1ESUA 4JBFA 4EWFA 4RYEA 4Z9QA 1JWPA 4D2OA 3O88A 3BLMA 4WELA 4QD4A 4GNUA 5FATA 1GHPA 4PM5A 2C6WB 4BD1A 3S22A 1EWZA 4R3JA 1ZKJA 3M2KA 3PBTA 1Z6FA 4DXBA 1TDLA 3ZFZA 1WYCA 1SDNA 1IYSA 3NDGA 4FD8A 3W8KA 1DJAA 2XQZA 4PMAA 4XUXA 1QMEA 3P98A 3N7WA 2Y2PA 1BLCA 2DRWA 4WMCA 3N6IA 5HW3A 3UNWA 2XGNA 4IEDA 3ZCZA 2OLUA 5FQKA 3PBOA 3LCEA 4WZ5A 5F82A 1TDGA 2OLVA 1IELA 1I2WA 1FCMA 3W4QA 4DXCA 2EX6A 3V39A 2EX2A 1W79A 2ZC7A 1PWDA 2WKIA 3FKWA 1HD8A 2P74A 3VFHA 1RCJA 3Q82A 3IWOA 3NCKA 4FCFA 4OQIA 5GHXA 1W5DA 3ZHHA 4B4ZA 1U60A 4EBPA 2WGWB 5G18A 5GLBA 3G2YA 1PW8A 1O7EA 2FFYA 3Q1FA 4BL3A 4DF6A 1YLTA 5HX9A 3OCNA 4E3OA 1S0WA 2Y91A 2HP6A 3SH8A 1CEFA 3A3DA 1K56A 2XFTA 3MXRA 3NDEA 2B5RA 1ZG4A 3UDFA 4JXVA 3WRZA 1RGZA 5EE8A 4MBKA 5EVLA 4WMCD 4N9KA 4LV2A 2RL3A 4KG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9M A;  5AQ7 A;  3IWI A;  2H0Y A;  1WYB A;  3BFD A;  2IWB A;  2X71 A;  3Q81 A;  4OPY A;  2OSU A;  2Y2O A;  2ZQD A;  4R3B A;  4L0L A;  3SH9 A;  4JF4 A;  1I2S A;  4OOM A;  2XLN A;  5F1G A;  1PYY A;  4GN2 A;  3MBZ A;  3VP0 A;  2JCH A;  4KG5 A;  5F83 A;  4UAA A;  4KZ5 A;  2V2F F;  4X68 A;  4JLF A;  2ZMA A;  5AQB A;  3HLW A;  2C5W B;  4RX2 A;  4BD0 A;  3O86 A;  4LEN A;  2XFS A;  5GLC A;  1HTZ A;  4CPK A;  4U0T A;  3HLC A;  3G32 A;  4C6Y A;  1XX2 A;  4HEF A;  3HBR A;  3UE3 A;  3RJU A;  1BTL A;  1C3B A;  2V20 A;  3N4I A;  2WYX A;  4KG6 A;  4DRT A;  1L0D A;  2H10 A;  4GD8 A;  5DVA A;  4E3N A;  1PI4 A;  2QZ6 A;  2ZM2 A;  1ZG6 A;  1KGG A;  1MWS A;  1NZU A;  2PBY A;  2Y2L A;  3AGF A;  4H8R A;  4OOL A;  4OPZ A;  1LI0 A;  3WWX A;  3IHA A;  3I7J A;  4ZJ3 A;  3VMA A;  2DCF A;  2R9W A;  2IWD A;  2JE5 A;  3D4F A;  2HPB A;  3LY3 A;  4GOG A;  4OOY A;  4X55 A;  5M1A A;  4OQG A;  4ZJ2 A;  1K6R A;  4E6W A;  3SOI A;  5FQQ A;  4DE3 A;  3BRM A;  1K57 A;  1MWU A;  3G35 A;  4JKT A;  3C4O A;  2Y2M A;  1IYQ A;  4LCL A;  4B4X A;  5HL1 A;  3A3E A;  3VFF A;  2EFX A;  1NJ4 A;  1PZP A;  2XD5 A;  3BFG A;  4JF6 A;  4KZ6 A;  4P0M A;  2Z2M B;  4BQM A;  5E2F A;  4S2N C;  4HBU A;  3IF6 A;  1K25 A;  1CI9 A;  4X56 A;  1PZO A;  4E3J A;  4IBR A;  1XKZ A;  5FDH A;  4C75 A;  3UDX A;  1JTG A;  3BLS A;  5EOE A;  2WAE A;  3C5A A;  1JWZ A;  1KDW A;  4GDB A;  4OH0 A;  5CEB A;  1W8Q A;  3LY4 A;  4K0X A;  1H5X A;  1KE4 A;  4PM7 A;  1YLJ A;  4FSF A;  4KQO A;  2WZZ A;  4DKI A;  1BLS A;  5DF7 A;  2Y59 A;  3IXD A;  2XDM A;  5CED A;  1GHM A;  5TFQ A;  4HBT A;  1IYO A;  1JWV A;  3PAG A;  3G34 A;  3ZG5 A;  4NK3 A;  1W7F A;  3UPP A;  4ID4 A;  3G31 A;  5DF9 A;  1YMX A;  3VP4 A;  5L2F A;  1BUL A;  1ONG A;  1L2S A;  3M6H A;  1LI9 A;  4P87 A;  3QHY A;  3CZD A;  4JXG A;  4ZDX A;  3RXW A;  3GMW A;  5I94 A;  5IHV A;  2X02 A;  2ZQ8 A;  4FH4 A;  2JBF A;  2ZM8 A;  3GV9 A;  1ERQ A;  2Y55 A;  3AGE A;  3QNC A;  4MEZ A;  1W8Y A;  1K57 C;  1N4O A;  3IXG A;  2WAD A;  2ZQA A;  1E3U A;  4EV4 A;  2E8I A;  4M3K A;  3PBN A;  4UHU A;  1WE4 A;  3DW0 A;  2G2U A;  1XA7 A;  5E2G A;  2Y2N A;  2EXB A;  3NI9 A;  4MNR A;  4EBN A;  3C7V A;  5KSH A;  1FQG A;  1ES2 A;  1GA9 A;  2XH9 A;  3MKF A;  5FQ9 A;  3CMZ A;  2ZQC A;  4QJG A;  4S2O A;  5EVI B;  5CGX A;  4OLG A;  3FWL A;  3OCL A;  1G68 A;  5EVI C;  5CGS A;  1RP5 A;  3S4X A;  1ES3 A;  4KEN B;  4LV0 A;  2I72 A;  3DTM A;  3OC2 A;  3Q7V A;  3LO7 A;  3B3X A;  4WEK A;  2BLS A;  1KDS A;  5FQI A;  5M18 A;  3E2L A;  5GLD A;  3HLF A;  4LV1 A;  5CHU A;  3CG5 A;  4BLM A;  4JXS A;  3ITA A;  1K54 C;  3AGD A;  3HL9 A;  4OKP A;  4XXR A;  3BFC A;  1SDE A;  1MXO A;  2HP5 A;  1IKG A;  3GVB A;  5DTS A;  3IH9 A;  4KZA A;  2PU2 A;  3ZG0 A;  3C4P A;  2WK0 A;  3IH8 A;  4PM6 A;  5F1F A;  1K55 A;  2HDQ A;  3V3R A;  4WM9 A;  2RCX A;  5CXW A;  5FA7 A;  3GTC A;  1YT4 A;  3ZVT A;  2J7V A;  4DE1 A;  2WUQ A;  3W4O A;  3PTE A;  1FR1 A;  2WGV A;  2Y4A A;  2EXA A;  4S2K A;  5FI7 A;  1Y54 A;  3N8S A;  5AQ9 A;  1YLZ A;  5A92 A;  4OON A;  4O7D A;  3GQZ A;  4KZ8 A;  4OLD A;  5EOO A;  3UE0 A;  4R4S A;  2ZC4 B;  1O07 A;  5CHJ A;  1VQQ A;  3VSK A;  5HAI A;  1EI5 A;  2HDR A;  3GRJ A;  3P09 A;  3ZG9 B;  3UE1 A;  1KGE A;  4Y0T A;  1OME A;  2XD1 A;  2XR0 A;  2ZD8 A;  3HRE A;  4BL2 A;  2ZQ9 A;  3N8L A;  3A3F A;  2QPN A;  1E3U D;  1K6S A;  4JXW A;  1BZA A;  3QNB A;  4EBL A;  5HAR A;  3PBQ A;  1G6A A;  1S6R A;  2P9V B;  3V50 A;  1HZO A;  4JF5 A;  3VOY A;  3ZDJ A;  5BOH A;  4GB7 A;  3HLB A;  1LL9 A;  1XA1 A;  3EQU A;  4MBF A;  4QHC A;  4DDS A;  1K54 A;  4RVA A;  4E3I A;  4EUZ A;  1J9M A;  1H8Y A;  1LL5 A;  4KZB A;  2WKE A;  3M6B A;  4OVD A;  4WYY A;  3SS3 A;  4BEN A;  5FQJ A;  1H8Z A;  4UA9 A;  5KZH A;  2EX8 A;  3V3S A;  1FSW A;  1NYY A;  3IF6 B;  3OPL A;  3PAE A;  4QB8 A;  4WZ5 C;  5E43 A;  2EX9 A;  1PIO A;  2ZQ7 A;  2H5S A;  3OPH A;  4ZTK A;  1YLW A;  3SS5 A;  3IF5 A;  1ERO A;  2HP9 A;  4N1X A;  2ZC3 B;  3VP1 A;  4WZ4 A;  1TEM A;  1LHY A;  1MKI A;  1MWR A;  1KE0 A;  5HFO A;  3FV7 A;  4GD6 A;  1FCO A;  2G2W A;  1ZC2 A;  1CI8 A;  3HVF A;  1NYM A;  4OPQ A;  2HDU A;  4GDN A;  3A3I A;  4Q8I A;  4X6T A;  1XGI A;  1SCW A;  5CHM A;  3E2K A;  5EUA A;  5JYP A;  1YLP A;  4N9L A;  3UDI A;  3ZGA B;  3BEC A;  4OPR A;  1HVB A;  5GHY A;  2X01 A;  3MZD A;  3MZE A;  3HLE A;  3ISG A;  1KGF A;  3ZVW A;  2XK1 A;  3BYD A;  4E3K A;  5U47 A;  1M40 A;  3LEZ A;  4JPM A;  4ZJ1 A;  1YMS A;  3IXB A;  4BJP A;  5CTM A;  5JYO A;  4X69 A;  3JYI A;  4P85 A;  5M19 A;  4FH2 A;  2ZC5 B;  1MWT A;  1DJB A;  3O3V A;  4Y7P A;  4B88 A;  1L0G A;  1CEG A;  4MBH A;  1K4E A;  2A3U A;  4PM8 A;  1XGJ A;  3A3J A;  5DTT A;  4OQH A;  1KVL A;  5EVI D;  5CEC A;  2ZJ9 A;  4N1H A;  1NRF A;  3ZG7 B;  2WZX A;  1L0E A;  4EQI A;  5HAQ A;  5HAP A;  5A93 A;  1M6K A;  1TVF A;  1LLB A;  3PBR A;  5DTK A;  3IWQ A;  5D3O A;  1I5Q A;  3NIA A;  3IF6 C;  3Q7V B;  1RGY A;  3GR2 A;  2VGJ A;  5AQA A;  4P6B A;  5FI2 A;  4S2P A;  1CK3 A;  3HUM A;  5KSC A;  3ZG8 B;  1XP4 A;  4E6X A;  3IXH A;  4YIN A;  3ZNT A;  5TGF A;  5CGW A;  3Q7Z A;  4PPR A;  2HDS A;  4UA6 A;  3RXX A;  3VOZ A;  3UY6 A;  3NY4 A;  1L0F A;  3OPR A;  1ES5 A;  4S2J A;  3GSG A;  1Q2P A;  3BEB A;  5A90 A;  4PM9 A;  3WS0 A;  2XF3 A;  3DWZ A;  4E3L A;  1VM1 A;  3NC8 A;  4GZB A;  2J8Y A;  5EVI A;  1MBL A;  1MY8 A;  1JTD A;  2R9X A;  3V5M A;  1BUE A;  4F94 A;  4NET A;  3WRT A;  3NBL A;  2VGK A;  4DE0 A;  1DJC A;  2H0T A;  2IWC A;  3C7U A;  4K0W A;  4N92 A;  4KQQ A;  4ZBE A;  3FYZ A;  1PWG A;  2Y2K A;  4S2L A;  4RA7 A;  5DF8 A;  2CC1 A;  3TG9 A;  1NY0 A;  1ONH A;  1IEM A;  4QY5 A;  5FQM A;  1FSY A;  1K38 A;  3IT9 A;  4S2N A;  3WS2 A;  4LCM A;  3FKV A;  4R1G A;  5FSR A;  3MFD A;  4KQR A;  3EQV A;  5GLA A;  3N8R A;  2GDN A;  4S2I A;  4X53 A;  3IQA A;  2WKH A;  1PI5 A;  4K91 A;  2J9P A;  5J8X A;  1K56 D;  3SH7 A;  2QMI A;  1JVJ A;  4Y0O A;  3G4P A;  2JC7 A;  1BLP A;  1SKF A;  1ALQ A;  5FAQ A;  2J9O A;  4IVK A;  3MZF A;  5GHZ A;  5FAP A;  4LV3 A;  1XPB A;  2Y2H A;  4R0Q A;  2ZC6 B;  3ITB A;  5FAS A;  3HLG A;  1BSG A;  4A5R A;  4U0X A;  4HES A;  3BFF A;  3WS4 A;  2V1Z A;  4QY6 A;  1XXM A;  4OP8 A;  4IBX A;  3UN7 A;  4C3Q A;  2OV5 A;  1K4F A;  1ERM A;  1ES4 A;  1YM1 A;  2XEP A;  5EPH A;  4DE2 A;  3HUO A;  2BG1 A;  2Y2Q A;  1PWC A;  3BM6 A;  4WEJ A;  3TSG A;  3G2Z A;  4KZ4 A;  1E25 A;  1SHV A;  2Y2G A;  3OZH A;  4RX3 A;  2FFF B;  3CJM A;  1ESI A;  4DDY A;  1FCN A;  4MLL A;  4WBG A;  4IVI A;  5FI6 A;  4GKU A;  3WS5 A;  3SS4 A;  3WS1 A;  3MXS A;  4KZ9 A;  1PW1 A;  3FZC A;  1KE3 A;  3VSL A;  1QMF A;  4QU3 A;  2UWX A;  2PU4 A;  3W4P A;  1AXB A;  1MPL A;  5EEC A;  1IYP A;  3MKE A;  4KZ7 A;  5TR7 A;  2EFU A;  1BT5 A;  5CER A;  3S1Y A;  4YFM A;  4ZAM A;  4U3T A;  2DNS A;  5CTN A;  3O87 A;  2P9V A;  1IKI A;  2WAF A;  4Y0U A;  4S2M A;  2WGI A;  3UPN A;  2ZM0 A;  3G30 A;  2A49 A;  1GCE A;  3M2J A;  1YQS A;  2Y2J A;  4R23 A;  3TOI A;  1NZO A;  3ZNY A;  3UPO A;  1K55 C;  2Y2I A;  1GHI A;  5E2E A;  3VP3 A;  3DWK A;  4KZ3 A;  3HLD A;  1FOF A;  5CRF A;  3IHB A;  1GA0 A;  3PBS A;  5E2H A;  2WGW A;  2ZLY A;  4UA7 A;  1YLY A;  3HUN A;  1BLH A;  5KMW A;  1N9B A;  3VP2 A;  3Q07 A;  1FR6 A;  3BFE A;  3OPP A;  1Q2Q A;  1E4D A;  5FAO A;  2Z2L B;  1DY6 A;  2Q9N A;  4E3M A;  4OP5 A;  4XUZ A;  1NXY A;  5A91 A;  3UO9 A;  4CJN A;  4OQ0 A;  5GL9 A;  1KVM A;  4R4R A;  1ESU A;  4JBF A;  4EWF A;  4RYE A;  4Z9Q A;  1JWP A;  4D2O A;  3O88 A;  3BLM A;  4WEL A;  4QD4 A;  4GNU A;  5FAT A;  1GHP A;  4PM5 A;  2C6W B;  4BD1 A;  3S22 A;  1EWZ A;  4R3J A;  1ZKJ A;  3M2K A;  3PBT A;  1Z6F A;  4DXB A;  1TDL A;  3ZFZ A;  1WYC A;  1SDN A;  1IYS A;  3NDG A;  4FD8 A;  3W8K A;  1DJA A;  2XQZ A;  4PMA A;  4XUX A;  1QME A;  3P98 A;  3N7W A;  2Y2P A;  1BLC A;  2DRW A;  4WMC A;  3N6I A;  5HW3 A;  3UNW A;  2XGN A;  4IED A;  3ZCZ A;  2OLU A;  5FQK A;  3PBO A;  3LCE A;  4WZ5 A;  5F82 A;  1TDG A;  2OLV A;  1IEL A;  1I2W A;  1FCM A;  3W4Q A;  4DXC A;  2EX6 A;  3V39 A;  2EX2 A;  1W79 A;  2ZC7 A;  1PWD A;  2WKI A;  3FKW A;  1HD8 A;  2P74 A;  3VFH A;  1RCJ A;  3Q82 A;  3IWO A;  3NCK A;  4FCF A;  4OQI A;  5GHX A;  1W5D A;  3ZHH A;  4B4Z A;  1U60 A;  4EBP A;  2WGW B;  5G18 A;  5GLB A;  3G2Y A;  1PW8 A;  1O7E A;  2FFY A;  3Q1F A;  4BL3 A;  4DF6 A;  1YLT A;  5HX9 A;  3OCN A;  4E3O A;  1S0W A;  2Y91 A;  2HP6 A;  3SH8 A;  1CEF A;  3A3D A;  1K56 A;  2XFT A;  3MXR A;  3NDE A;  2B5R A;  1ZG4 A;  3UDF A;  4JXV A;  3WRZ A;  1RGZ A;  5EE8 A;  4MBK A;  5EVL A;  4WMC D;  4N9K A;  4LV2 A;  2RL3 A;  4KG2 A; 
#chains in the Genus database with same CATH topology
 3VE4 A;  5AQ7 A;  1WYB A;  1T18 A;  1UGU A;  3BFD A;  2Y2O A;  5HWT A;  4I38 A;  3MFX A;  3MBZ A;  2ZMA A;  1TS6 A;  2C5W B;  4CPK A;  3E4Q A;  4HEF A;  1C3B A;  1W63 Q;  4KG6 A;  4DRT A;  1PI4 A;  2CMN A;  2QZ6 A;  1XJ4 A;  4G3V A;  1ZG6 A;  4OOL A;  5HD3 A;  1CQA A;  5AJG A;  4ZJ3 A;  3R4K A;  1G28 A;  3MMH A;  3D4F A;  2HPB A;  4GOG A;  3CHW P;  4OOY A;  3S7Q A;  1S67 L;  4B93 A;  5DJU A;  5FQQ A;  1GSV A;  4JKT A;  3VFF A;  2XD5 A;  3BFG A;  2V8C A;  3A0R A;  2Z2M B;  4BQM A;  5K5B A;  4P6Z S;  5E2F A;  5G4Z A;  4S2N C;  2JHE A;  4X56 A;  1PZO A;  1JTG A;  5EOE A;  1T19 A;  2WAE A;  3LY4 A;  4K0X A;  1H5X A;  4PM7 A;  2O9C A;  4KQO A;  2WZZ A;  5HWW A;  5DFX A;  1IYO A;  2PAV P;  1W7F A;  3UPP A;  5HWV A;  5DF9 A;  3W2Z A;  3C38 A;  1YMX A;  1F2K A;  1L2S A;  4P87 A;  1LI9 A;  3QP6 A;  3CZD A;  4JXG A;  5C5K A;  5I94 A;  5IHV A;  2X02 A;  1K57 C;  3IXG A;  3MQ0 A;  1E3U A;  4M3K A;  2M7U A;  3DW0 A;  2G2U A;  5E2G A;  4EET B;  2EXB A;  5HDD A;  3C7V A;  5FQ9 A;  4QJG A;  4S2O A;  1LSW A;  3S4X A;  3OCL A;  1RP5 A;  3HCY A;  3B3X A;  3K3D A;  3T4S A;  3E2L A;  5GLD A;  3HLF A;  3CG5 A;  4BLM A;  4JXS A;  1K54 C;  3BFC A;  1SDE A;  2W1T B;  5DTS A;  2PU2 A;  3ZG0 A;  3IH8 A;  1K55 A;  2HDQ A;  5FA7 A;  3QP2 A;  2VGL M;  1YT4 A;  2O99 A;  3ZVT A;  4DE1 A;  2VZW A;  2WUQ A;  1H8M A;  2W3D A;  2EXA A;  5FI7 A;  1Y54 A;  3N8S A;  4JGP A;  4OON A;  2PBD P;  1NLY A;  1DP6 A;  4GW9 A;  1O07 A;  4Q0J A;  1EI5 A;  2OAP 1;  1X0O A;  4LRY C;  2XD1 A;  2XR0 A;  1LL8 A;  4BL2 A;  3NHQ A;  3A3F A;  5IU1 A;  1E3U D;  3RTY A;  3UB6 A;  2P9V B;  5BOH A;  3HLB A;  1OTB A;  4RVA A;  1D7E A;  1H8Y A;  1F5M A;  3M6B A;  4BEN A;  4UA9 A;  4QB8 A;  2ZQ7 A;  4ZTK A;  3KSI A;  2HP9 A;  3QP1 A;  1FIK A;  3VP1 A;  2MJ6 A;  4NXB A;  2PT7 A;  3T12 B;  1MKI A;  1KE0 A;  4GD6 A;  1CI8 A;  4GDN A;  3DTK A;  1YPR A;  5EUA A;  5JYP A;  1YLP A;  3RFB A;  3TJZ C;  4N9L A;  4F3L B;  4GLQ A;  2XRO A;  2LB5 A;  2XK1 A;  4CLC B;  2W3H A;  5F68 A;  4JPM A;  4MCW A;  1YMS A;  4Y3I A;  3IXB A;  3BW6 A;  5F5Y A;  4DN0 A;  5L8M A;  1K0K A;  1MWT A;  2ZC5 B;  3CUE C;  3KSH A;  3R7W A;  3RH8 B;  5EVI D;  1N9L A;  2K2N A;  4EQI A;  5HAQ A;  5HAP A;  3PBR A;  1LLB A;  3IWQ A;  1I5Q A;  2OWJ A;  3NIA A;  4Y5F A;  4NXG A;  2O0Y A;  1CK3 A;  3ZG8 B;  4E6X A;  1SKO B;  2ACG A;  5TGF A;  4R6L A;  3Q7Z A;  1GSX A;  4S2J A;  3GSG A;  5TBM B;  3EGX C;  3BEB A;  4CQH A;  4GZB A;  1MBL A;  2PYR A;  4I3I A;  3V5M A;  2I9V A;  2J3T C;  3WRT A;  3K2N A;  2VGK A;  4DE0 A;  1Y28 A;  2H0T A;  2IWC A;  3LR5 A;  3T4O A;  3MQQ A;  1NY0 A;  4IHQ A;  4QY5 A;  1XJ3 A;  4LCM A;  3FKV A;  4R1G A;  3MFD A;  3N8R A;  4S2I A;  4X53 A;  4Y2F A;  1PI5 A;  4PKY G;  2QMI A;  1SKF A;  3U2A A;  3MZF A;  2VLG A;  1YSQ A;  3ITB A;  5FAS A;  2V9A A;  4U0X A;  5I5L A;  2D02 A;  5AVF A;  3FG8 A;  4OP8 A;  1Y4O A;  3UN7 A;  1K4F A;  1ERM A;  4DE2 A;  2L1M A;  4Q0I A;  3LEQ A;  3G2Z A;  1E25 A;  1SHV A;  3OZH A;  4WLA A;  3KO6 A;  3CJM A;  1ESI A;  3LR0 A;  1NRJ A;  3SS4 A;  1Z09 A;  4ESP A;  4EXO A;  3FZC A;  4QU3 A;  1AXB A;  1MPL A;  1D06 A;  4Y15 A;  4HP9 A;  2P9V A;  1IKI A;  1DRM A;  4Y0U A;  3C30 A;  4S2M A;  2ZM0 A;  4R23 A;  3ZNY A;  3UPO A;  4EEP A;  5E2E A;  3DWK A;  2Q0O A;  4KZ3 A;  3E4P A;  3PBS A;  2B02 A;  1YLY A;  3LR3 A;  1N9B A;  5FAO A;  4E3M A;  4GCZ A;  4CJN A;  3F1N A;  4I5S A;  4EWF A;  1JWP A;  2ZMF A;  4GS9 B;  4QD4 A;  4GNU A;  3H82 A;  1V9Z A;  1EWZ A;  4R3J A;  2JKT I;  1ZKJ A;  3D9Y A;  3M2K A;  4UEY A;  2NUP C;  4DXB A;  3S7N A;  5F6A A;  4X25 A;  5EM1 A;  3ZFZ A;  1WYC A;  3LGO A;  1DJA A;  4XUX A;  3P98 A;  1VB6 A;  4WMC A;  3N6I A;  3ZCZ A;  2OLU A;  5FQK A;  3PBO A;  1D1J A;  3LCE A;  4DJ3 A;  2OLV A;  2PHY A;  2EX2 A;  2ZC7 A;  3FKW A;  4EBP A;  4B4Z A;  4DJ2 A;  1O7E A;  2FFY A;  4DF6 A;  1UWP X;  5HX9 A;  1NLZ A;  4E3O A;  5AVE A;  1OJG A;  4CLC A;  4Y13 A;  3SZT A;  1K56 A;  4X1M A;  5EVL A;  4MBK A;  1N9N A;  1T1C A;  2RL3 A;  4KG2 A;  4JGQ A;  3Q81 A;  4OPY A;  2PDR A;  2OSU A;  4L0L A;  3SH9 A;  4JF4 A;  4ZRR A;  5F1G A;  2HV1 A;  3G6O A;  2JCH A;  5F83 A;  4KZ5 A;  4X68 A;  3EEH A;  4JLF A;  3HLW A;  4LRX C;  5GLC A;  1HTZ A;  2P04 A;  1BTL A;  2YKH A;  5KIZ A;  4EER A;  4NEE D;  1JNU A;  1L0D A;  3BQA A;  3UB8 A;  4BBU A;  2A24 B;  3AGF A;  3WWX A;  3CPT A;  3I7J A;  1VET A;  2QHK A;  3LY3 A;  4X55 A;  4WF0 A;  5M1A A;  4OQG A;  3CPT B;  3C4O A;  1IYQ A;  4B4X A;  5HL1 A;  3A3E A;  2W0N A;  2K7S A;  2GNX A;  4HBU A;  1IFQ A;  1LSV A;  3H82 B;  4FOF A;  1XKZ A;  3SW1 A;  5IT5 A;  4JGO A;  2W1T A;  3PHY A;  1KE4 A;  2PR6 A;  4BMW A;  1P97 A;  4FSF A;  2M7V A;  5DF7 A;  4NXF A;  2XDM A;  5CED A;  1GHM A;  1VEU A;  5TFQ A;  2VX8 A;  3FPW A;  1UWN X;  4ID4 A;  5L2F A;  2PD8 A;  2ZM8 A;  3GV9 A;  4MEZ A;  1S4R A;  2Y79 A;  4EEU A;  3GEC A;  2WAD A;  1L3L A;  4WL9 A;  4GS9 A;  4PHT A;  4EBN A;  5KSH A;  3F1O B;  1FQG A;  1ES2 A;  1GA9 A;  3MKF A;  3CMZ A;  1TS7 A;  5G4Y A;  5CGX A;  3FWL A;  1T1A A;  1G68 A;  2GZA A;  2ZBB A;  3OC2 A;  4WEK A;  3Q7V A;  2BLS A;  4LV1 A;  5CHU A;  3ITA A;  3AGD A;  3MR0 A;  4HI4 A;  2HP5 A;  3GVB A;  3IH9 A;  4KZA A;  1BYW A;  1OJ5 A;  1FR1 A;  2Y4A A;  2QKP A;  5AQ9 A;  5TBM A;  1YLZ A;  4O7D A;  4KZ8 A;  4OLD A;  4R4S A;  5HAI A;  3GRJ A;  4HOI A;  3UE1 A;  3HRE A;  3N8L A;  5IS1 A;  2O9B A;  4JXW A;  3QNB A;  2PD7 A;  1VHM A;  1HZO A;  1P0Z A;  1XA1 A;  4DDS A;  4MBF A;  4QHC A;  4EUZ A;  4OVD A;  4WYY A;  5KZH A;  5FQJ A;  1H8Z A;  1SZV A;  2XA7 M;  3IS2 B;  4YOF A;  5E43 A;  1F9I A;  1ERO A;  2VJW A;  3B42 A;  3FV7 A;  5EFW A;  1IOU A;  2G2W A;  1ZC2 A;  3HVF A;  1NYM A;  4OPQ A;  2HDU A;  1ZHH B;  4Q8I A;  4X6T A;  1XGI A;  1SCW A;  4LGW A;  3LI8 A;  3ZGA B;  4I3J A;  4OPR A;  1HVB A;  3BQ8 A;  3ISG A;  2XRN A;  2JKF A;  3D72 A;  3T4J A;  3KSF A;  4E3K A;  3ZQ5 A;  5U47 A;  3LEZ A;  2YKF A;  3T50 A;  2ZL1 B;  3PR6 A;  4X69 A;  2L4R A;  4MBH A;  1XGJ A;  3A3J A;  5DTT A;  4OQH A;  1KVL A;  1NRF A;  5HSQ A;  1M6K A;  1TVF A;  5DTK A;  4BBV A;  5D3O A;  1P9R A;  4P6B A;  1S4S A;  4D60 A;  2WKP A;  3HUM A;  3TRC A;  3IXH A;  5J4E A;  3ZNT A;  5CGW A;  2W1R A;  2Z6C A;  3UY6 A;  1L0F A;  2H28 A;  1ES5 A;  4PM9 A;  3WS0 A;  4E3L A;  1VM1 A;  2J8Y A;  2R9X A;  3VE3 A;  4ZBE A;  1LT0 A;  1PWG A;  2Y2K A;  4RA7 A;  3CUE A;  4BWI A;  4HHD A;  4MMN A;  4NXE A;  3WS2 A;  1V9Y A;  2BTF P;  2WKH A;  3S7O A;  4O8G A;  2J9P A;  2BAS A;  3SH7 A;  2HJE A;  1JVJ A;  3G4P A;  3R7W B;  5FDS A;  5DFY A;  2JC7 A;  2OAQ 1;  3HJK A;  1ALQ A;  5FAP A;  3BJN A;  4LV3 A;  4R0Q A;  2ZC6 B;  3T1S A;  1BSG A;  2VV8 A;  4JGR A;  4HES A;  1G5U A;  2V1Z A;  4QY6 A;  1XXM A;  3UMD A;  1YKD A;  2OV5 A;  3HUO A;  2BG1 A;  1EW0 A;  3NUL A;  4K08 A;  1S66 L;  5FI6 A;  4KZ9 A;  3GDI A;  4BBT A;  1QMF A;  3JVU A;  3MKE A;  2D01 A;  2EFU A;  3ICY A;  4YFM A;  5CTN A;  1OTE A;  4IUK A;  3ULF A;  2WAF A;  2A49 A;  1GCE A;  5A8B A;  1K55 C;  3VP3 A;  3HLD A;  1GA0 A;  3IBR A;  2WGW A;  3HUN A;  5KMW A;  3LIB A;  4OP5 A;  4XUZ A;  1OT6 A;  3PYP A;  5GL9 A;  1KVM A;  2A24 A;  1ESU A;  4D2O A;  3O88 A;  1T1B A;  4BD1 A;  2M1C A;  3PBT A;  1Z6F A;  1IYS A;  1DP8 A;  1QME A;  3BY9 A;  2Y2P A;  1BLC A;  2XGN A;  1XFQ A;  1TDG A;  4DXC A;  2EX6 A;  2WKI A;  4FCF A;  5GHX A;  1U60 A;  3G2Y A;  1W63 M;  2V0U A;  3E0Y A;  2Y91 A;  2XFT A;  3UB9 A;  3MXR A;  1ZG4 A;  3IX8 A;  4JXV A;  3UDF A;  1RGZ A;  4WMC D;  4N9K A;  2Q9M A;  2ZOI A;  2H0Y A;  2IWB A;  3L7H A;  3MF0 A;  1I2S A;  2XLN A;  3LIE A;  1PYY A;  4GN2 A;  3JPU A;  4KG5 A;  2KLI A;  2V2F F;  4UQI M;  4BD0 A;  2XFS A;  1XX2 A;  3UE3 A;  3RJU A;  3OBF A;  5DKL A;  2V20 A;  3N4I A;  2WYX A;  4GD8 A;  5DVA A;  3F1P B;  2ZM2 A;  2HZ5 A;  5HZH A;  1KGG A;  1MWS A;  2PBY A;  4H8R A;  2Y2L A;  1OTI A;  2DCF A;  4M4X A;  3EGD C;  2XSS A;  4FUW A;  2JE5 A;  4MN5 A;  4F3L A;  4ZJ2 A;  5HDS A;  1TS0 A;  4AFI A;  3CLO A;  4KUO A;  2Y2M A;  2EFX A;  3T4Q A;  2J3T D;  2EWW A;  4KZ6 A;  4P0M A;  3OOV A;  3QP4 A;  2XA7 S;  2QWS A;  3IF6 A;  2W3F A;  2E8J A;  4Y17 A;  3FPV A;  1CI9 A;  4E3J A;  4IBR A;  4C75 A;  3C5A A;  1JWZ A;  1KDW A;  4GDB A;  1YLJ A;  1A0K A;  3A0V A;  5J3W A;  2KOI A;  2Y59 A;  3IXD A;  3LID A;  4ARZ A;  4HBT A;  3ZG5 A;  4NK3 A;  3CAX A;  3VP4 A;  1BUL A;  3M6H A;  3QHY A;  3KYQ A;  1YAX A;  3GMW A;  2VEA A;  4L9E A;  3B33 A;  4FH4 A;  2Y55 A;  3AGE A;  1W8Y A;  1H0M A;  2ZQA A;  1CF0 A;  2V0W A;  2E8I A;  3PBN A;  1WE4 A;  3NI9 A;  4MNR A;  2ZQC A;  2K31 A;  1ES3 A;  1YSP A;  4KEN B;  5TJJ A;  4LV0 A;  2I72 A;  3DTM A;  3LO7 A;  1MKM A;  5FQI A;  5M18 A;  3A0S A;  3VV4 A;  4HY8 A;  4OKP A;  3K3C A;  3DTI A;  3C4P A;  2WK0 A;  4WM9 A;  5CXW A;  2HJ9 C;  3GTC A;  2J7V A;  4LRZ E;  4O0P A;  5HPI A;  3W4O A;  3PTE A;  2WGV A;  4I3A A;  5A92 A;  5J7E A;  5CHJ A;  2J80 A;  1VQQ A;  3VSK A;  2HDR A;  2JKR M;  4HJ4 A;  1J3W A;  3T1R A;  3ZG9 B;  1OME A;  2ZD8 A;  2ZQ9 A;  3TW8 A;  1G6O A;  1KOU A;  2VV7 A;  2QPN A;  1S1Y A;  2JKG A;  1G6A A;  1WA9 A;  1S6R A;  3MJQ A;  1DP9 A;  3ZDJ A;  3S7P A;  3DTE A;  4GB7 A;  1LL9 A;  1K54 A;  4KZB A;  4QPR A;  2EX8 A;  1NYY A;  3IF6 B;  3OPH A;  3T1Q B;  1YLW A;  3SS5 A;  4N1X A;  5CX7 A;  5EM0 A;  4MN7 A;  3UB5 P;  2FH5 A;  5MC7 A;  1TEM A;  1LHY A;  1MWR A;  5HFO A;  1FCO A;  3A3I A;  3IBJ A;  3EWK A;  3BEC A;  5F69 A;  3HLE A;  1KGF A;  3BYD A;  4BJP A;  5CTM A;  4PKY A;  5FEF A;  3JYI A;  4P85 A;  4FH2 A;  5EVE A;  4B88 A;  1DJB A;  1CEG A;  2A3U A;  4PM8 A;  2KDK A;  3QP8 A;  3NJA A;  5CEC A;  2ZJ9 A;  4N1H A;  4XT2 A;  4Q0H A;  5FEG A;  2W3G A;  4MN6 A;  2W3E A;  3IF6 C;  2VGJ A;  5FI2 A;  3LYX A;  4YIN A;  3NOT C;  3HJI A;  4HJ6 A;  4PPR A;  2A2L A;  3OPR A;  1Q2P A;  5A90 A;  4O01 A;  2HGV A;  2XF3 A;  3DWZ A;  1F98 A;  3LUQ A;  4L9F A;  3KX0 X;  1PNE A;  1JTD A;  1BUE A;  4NET A;  2UV0 E;  3NBL A;  1DJC A;  4B9O A;  3FYZ A;  4S2L A;  3TG9 A;  1ONH A;  1IEM A;  4XT2 B;  1K38 A;  3IT9 A;  4S2N A;  4KQR A;  3EQV A;  4LLO B;  4LPZ A;  1AWI A;  2GJ3 A;  1K56 D;  4Y0O A;  2AVX A;  5FAQ A;  4IVK A;  2OWH A;  3LIF A;  3HLG A;  4A5R A;  4NKP A;  3E4O A;  3BFF A;  2P7J A;  4IBX A;  3CI6 A;  1ES4 A;  5EPH A;  5HPF A;  3BM6 A;  4WEJ A;  4UQI S;  4KZ4 A;  3MSH A;  4RX3 A;  4WBG A;  4IVI A;  2VKS A;  3WS5 A;  2W27 A;  1PW1 A;  2WKR A;  2B18 A;  2PU4 A;  3EEA A;  1IYP A;  4KZ7 A;  1BT5 A;  5CER A;  4ZAM A;  4U3T A;  2DNS A;  2FZ0 A;  2WGI A;  3G30 A;  3M2J A;  3TOI A;  2Y2J A;  1NZO A;  1GHI A;  2LB9 A;  2O9A A;  1FOF A;  5E2H A;  2ZLY A;  4X1L A;  2WKQ A;  3BFE A;  1Q2Q A;  1E4D A;  2Z2L B;  1H3Q A;  4QWO A;  1DY6 A;  2Q9N A;  4WN5 A;  1NXY A;  1CJF A;  4DMZ A;  3O5Y A;  4H6J A;  2Z6D A;  4RYE A;  4Z9Q A;  3T1X A;  3BLM A;  4WEL A;  1GHP A;  4GJ4 A;  1TDL A;  4YNR A;  4FTX A;  4FD8 A;  4PMA A;  1NWZ A;  2INW A;  2DRW A;  5HW3 A;  1ODV A;  4WZ5 A;  5F82 A;  1IEL A;  3W4Q A;  3VOL A;  3V39 A;  4HNB A;  1PWD A;  1HD8 A;  2P74 A;  3VFH A;  3Q82 A;  3IWO A;  3NCK A;  4EES A;  4EUV A;  1W5D A;  2WGW B;  3F1P A;  3Q1F A;  4BL3 A;  3IX4 A;  2HP6 A;  1CEF A;  4MDZ A;  4Z1W A;  3IWI A;  3UE6 A;  2JKT M;  3H9W A;  2X71 A;  4R3B A;  2ZQD A;  3BY8 A;  3OLO A;  5HDC A;  4OOM A;  1OTA A;  3ZYT A;  3VP0 A;  5AQB A;  4RX2 A;  3O86 A;  4LEN A;  1HLU P;  4HH3 A;  1OTD A;  4U0T A;  5EV0 A;  1S1Z A;  3HLC A;  3P01 A;  3G32 A;  1XJ6 A;  4R38 A;  4C6Y A;  3HBR A;  4KQD A;  5DKK A;  4EQ1 A;  3LI9 A;  1TS8 A;  2G7U A;  4EU0 A;  4ETX A;  3DBA A;  2H10 A;  4CLC E;  4E3N A;  4EW7 A;  3C8C A;  4UAA A;  1NZU A;  4OPZ A;  1LI0 A;  3IHA A;  3VMA A;  2R9W A;  2IWD A;  4YWZ A;  4ETZ A;  4E6W A;  1K6R A;  3KYE A;  3SOI A;  4DE3 A;  3BRM A;  4IUH A;  1K57 A;  1MWU A;  3G35 A;  4II7 A;  4R3A A;  2ZMV A;  4LCL A;  1NJ4 A;  1PZP A;  4JF6 A;  2NUT C;  4P6Z M;  1K25 A;  3QP5 A;  4LFU A;  2VA0 A;  5FDH A;  2KX6 A;  3UDX A;  3BLS A;  4OH0 A;  5CEB A;  1W8Q A;  2DMW A;  3CIT A;  4DKI A;  1BLS A;  2JN7 A;  1XFN A;  3JVV A;  3PAG A;  1JWV A;  5HD5 A;  3G34 A;  3G31 A;  1ONG A;  1TF1 A;  4ZDX A;  3RXW A;  2ZQ8 A;  2JBF A;  1ERQ A;  3QNC A;  1N4O A;  3TE8 A;  4G3K A;  5DJT A;  3E98 A;  5HL6 A;  4EV4 A;  4UHU A;  2V1B A;  3V67 A;  1XA7 A;  2Y2N A;  2QJ5 A;  3LIA A;  2XH9 A;  2PRF A;  4GHI B;  4OLG A;  5EVI B;  2QJ7 A;  5EVI C;  5CGS A;  3LFV A;  3FC7 A;  1KDS A;  1PRQ A;  1FIL A;  4R70 A;  3C2W A;  3HL9 A;  4XXR A;  1MXO A;  1IKG A;  4PM6 A;  5F1F A;  3V3R A;  2RCX A;  5LBR A;  1SKO A;  3NEC A;  4E04 A;  1P9W A;  2JKR I;  4S2K A;  1OPX A;  3GQZ A;  3UE0 A;  5EOO A;  2HF6 A;  2ZC4 B;  3NOU C;  4PAU A;  3P09 A;  1KGE A;  4Y0T A;  4CLC D;  2EWV A;  3MS6 A;  4EBL A;  1K6S A;  1BZA A;  4HH2 A;  5HAR A;  3PBQ A;  3V50 A;  4JF5 A;  3VOY A;  3KSG A;  3EQU A;  5FL3 A;  4E3I A;  1J9M A;  1LL5 A;  2WKE A;  3SS3 A;  3V3S A;  1FSW A;  3OPL A;  3PAE A;  4WZ5 C;  4ME4 A;  2EX9 A;  1PIO A;  2V1A A;  2H5S A;  3UME A;  1PFL A;  3T4K A;  3IF5 A;  2ZC3 B;  4WZ4 A;  2R78 A;  5CHM A;  3E2K A;  4HJ3 A;  2L0W A;  3UDI A;  5GHY A;  2X01 A;  3MZD A;  3MZE A;  3L9K A;  3ZVW A;  1M40 A;  4ZJ1 A;  1LSX A;  3IS2 A;  4HIA A;  5JYO A;  5M19 A;  3O3V A;  4Y7P A;  1L0G A;  1XJ2 A;  3BWL A;  1K4E A;  3EOI A;  3F1O A;  2OOL A;  4HP4 A;  3ZG7 B;  2WZX A;  1L0E A;  5A93 A;  5AQA A;  3Q7V B;  1RGY A;  3GR2 A;  2GX5 A;  2J3W A;  1VEU B;  2VK3 A;  4S2P A;  3NOP C;  5KSC A;  1XP4 A;  4G3W A;  2HDS A;  4UA6 A;  3RXX A;  3VOZ A;  3T4L A;  3NY4 A;  5L07 A;  2V8F A;  3NC8 A;  4GHI A;  5EVI A;  1MY8 A;  4F94 A;  3U4L P;  3KYZ A;  3C7U A;  4K0W A;  4I39 A;  4N92 A;  4KQQ A;  1MZU A;  5DF8 A;  2CC1 A;  5FQM A;  1FSY A;  1TD5 A;  3PXP A;  3MXQ A;  5FSR A;  4HQA A;  5GLA A;  2IA2 A;  2GDN A;  3IQA A;  4K91 A;  5J8X A;  1BLP A;  2J9O A;  5GHZ A;  1XPB A;  2Y2H A;  3WS4 A;  3F1N B;  1STZ A;  5L10 A;  4C3Q A;  1YM1 A;  2XEP A;  4CLC C;  2Y2Q A;  2VGL S;  4H6J B;  1PWC A;  3TSG A;  2Y2G A;  2FFF B;  4DDY A;  1FCN A;  4MLL A;  4RQ9 A;  4GKU A;  3WS1 A;  3MXS A;  1KE3 A;  3VSL A;  2UWX A;  3W4P A;  5EEC A;  2EA9 A;  5TR7 A;  3S1Y A;  2ZL1 A;  3O87 A;  2QYB A;  1ACF A;  4IJG A;  3MQO A;  4WUJ A;  3UPN A;  1YQS A;  3D3O A;  2Y2I A;  5CRF A;  3IHB A;  2P08 A;  4UA7 A;  1BLH A;  1OT9 A;  2ZOH A;  3VP2 A;  3Q07 A;  1FR6 A;  3OPP A;  3IX3 A;  4ARZ B;  4KUK A;  5A91 A;  3UO9 A;  4OQ0 A;  2VV6 A;  4R4R A;  4JBF A;  3P7N A;  4L9G A;  2Y8H A;  3DAV A;  1ZTU A;  5FAT A;  4PM5 A;  2C6W B;  3S22 A;  3CWF A;  3T4T A;  1GSW A;  1SDN A;  3NDG A;  3W8K A;  2XQZ A;  3LIC A;  3N7W A;  3UNW A;  4IED A;  2PYP A;  1FCM A;  1I2W A;  2PR5 A;  3LR4 A;  3H7W A;  3H7W B;  1W79 A;  1VET B;  1RCJ A;  4OQI A;  1MC0 A;  5L09 A;  3ZHH A;  5G18 A;  5GLB A;  3UB7 A;  1PW8 A;  3B47 A;  4NG2 A;  1YLT A;  3OCN A;  1S0W A;  3SH8 A;  2B95 A;  3A3D A;  3NDE A;  2B5R A;  3WRZ A;  1N9O A;  5EE8 A;  4LV2 A; 
#chains in the Genus database with same CATH homology
 2Q9M A;  5AQ7 A;  3IWI A;  2H0Y A;  1WYB A;  3BFD A;  2IWB A;  2X71 A;  3Q81 A;  4OPY A;  2OSU A;  2Y2O A;  2ZQD A;  4R3B A;  4L0L A;  3SH9 A;  4JF4 A;  1I2S A;  4OOM A;  2XLN A;  5F1G A;  1PYY A;  4GN2 A;  3MBZ A;  3VP0 A;  2JCH A;  4KG5 A;  5F83 A;  4UAA A;  4KZ5 A;  2V2F F;  4X68 A;  4JLF A;  2ZMA A;  5AQB A;  3HLW A;  2C5W B;  4RX2 A;  4BD0 A;  3O86 A;  4LEN A;  2XFS A;  5GLC A;  1HTZ A;  4CPK A;  4U0T A;  3HLC A;  3G32 A;  4C6Y A;  1XX2 A;  4HEF A;  3HBR A;  3UE3 A;  3RJU A;  1BTL A;  1C3B A;  2V20 A;  3N4I A;  2WYX A;  4KG6 A;  4DRT A;  1L0D A;  2H10 A;  4GD8 A;  5DVA A;  4E3N A;  1PI4 A;  2QZ6 A;  2ZM2 A;  1ZG6 A;  1KGG A;  1MWS A;  1NZU A;  2PBY A;  2Y2L A;  3AGF A;  4H8R A;  4OOL A;  4OPZ A;  1LI0 A;  3WWX A;  3IHA A;  3I7J A;  4ZJ3 A;  3VMA A;  2DCF A;  2R9W A;  2IWD A;  2JE5 A;  3D4F A;  2HPB A;  3LY3 A;  4GOG A;  4OOY A;  4X55 A;  5M1A A;  4OQG A;  4ZJ2 A;  1K6R A;  4E6W A;  3SOI A;  5FQQ A;  4DE3 A;  3BRM A;  1K57 A;  1MWU A;  3G35 A;  4JKT A;  3C4O A;  2Y2M A;  1IYQ A;  4LCL A;  4B4X A;  5HL1 A;  3A3E A;  3VFF A;  2EFX A;  1NJ4 A;  1PZP A;  2XD5 A;  3BFG A;  4JF6 A;  4KZ6 A;  4P0M A;  2Z2M B;  4BQM A;  5E2F A;  4S2N C;  4HBU A;  3IF6 A;  1K25 A;  1CI9 A;  4X56 A;  1PZO A;  4E3J A;  4IBR A;  1XKZ A;  5FDH A;  4C75 A;  3UDX A;  1JTG A;  3BLS A;  5EOE A;  2WAE A;  3C5A A;  1JWZ A;  1KDW A;  4GDB A;  4OH0 A;  5CEB A;  1W8Q A;  3LY4 A;  4K0X A;  1H5X A;  1KE4 A;  4PM7 A;  1YLJ A;  4FSF A;  4KQO A;  2WZZ A;  4DKI A;  1BLS A;  5DF7 A;  2Y59 A;  3IXD A;  2XDM A;  5CED A;  1GHM A;  5TFQ A;  4HBT A;  1IYO A;  1JWV A;  3PAG A;  3G34 A;  3ZG5 A;  4NK3 A;  1W7F A;  3UPP A;  4ID4 A;  3G31 A;  5DF9 A;  1YMX A;  3VP4 A;  5L2F A;  1BUL A;  1ONG A;  1L2S A;  3M6H A;  1LI9 A;  4P87 A;  3QHY A;  3CZD A;  4JXG A;  4ZDX A;  3RXW A;  3GMW A;  5I94 A;  5IHV A;  2X02 A;  2ZQ8 A;  4FH4 A;  2JBF A;  2ZM8 A;  3GV9 A;  1ERQ A;  2Y55 A;  3AGE A;  3QNC A;  4MEZ A;  1W8Y A;  1K57 C;  1N4O A;  3IXG A;  2WAD A;  2ZQA A;  1E3U A;  4EV4 A;  2E8I A;  4M3K A;  3PBN A;  4UHU A;  1WE4 A;  3DW0 A;  2G2U A;  1XA7 A;  5E2G A;  2Y2N A;  2EXB A;  3NI9 A;  4MNR A;  4EBN A;  3C7V A;  5KSH A;  1FQG A;  1ES2 A;  1GA9 A;  2XH9 A;  3MKF A;  5FQ9 A;  3CMZ A;  2ZQC A;  4QJG A;  4S2O A;  5EVI B;  5CGX A;  4OLG A;  3FWL A;  3OCL A;  1G68 A;  5EVI C;  5CGS A;  1RP5 A;  3S4X A;  1ES3 A;  4KEN B;  4LV0 A;  2I72 A;  3DTM A;  3OC2 A;  3Q7V A;  3LO7 A;  3B3X A;  4WEK A;  2BLS A;  1KDS A;  5FQI A;  5M18 A;  3E2L A;  5GLD A;  3HLF A;  4LV1 A;  5CHU A;  3CG5 A;  4BLM A;  4JXS A;  3ITA A;  1K54 C;  3AGD A;  3HL9 A;  4OKP A;  4XXR A;  3BFC A;  1SDE A;  1MXO A;  2HP5 A;  1IKG A;  3GVB A;  5DTS A;  3IH9 A;  4KZA A;  2PU2 A;  3ZG0 A;  3C4P A;  2WK0 A;  3IH8 A;  4PM6 A;  5F1F A;  1K55 A;  2HDQ A;  3V3R A;  4WM9 A;  2RCX A;  5CXW A;  5FA7 A;  3GTC A;  1YT4 A;  3ZVT A;  2J7V A;  4DE1 A;  2WUQ A;  3W4O A;  3PTE A;  1FR1 A;  2WGV A;  2Y4A A;  2EXA A;  4S2K A;  5FI7 A;  1Y54 A;  3N8S A;  5AQ9 A;  1YLZ A;  5A92 A;  4OON A;  4O7D A;  3GQZ A;  4KZ8 A;  4OLD A;  5EOO A;  3UE0 A;  4R4S A;  2ZC4 B;  1O07 A;  5CHJ A;  1VQQ A;  3VSK A;  5HAI A;  1EI5 A;  2HDR A;  3GRJ A;  3P09 A;  3ZG9 B;  3UE1 A;  1KGE A;  4Y0T A;  1OME A;  2XD1 A;  2XR0 A;  2ZD8 A;  3HRE A;  4BL2 A;  2ZQ9 A;  3N8L A;  3A3F A;  2QPN A;  1E3U D;  1K6S A;  4JXW A;  1BZA A;  3QNB A;  4EBL A;  5HAR A;  3PBQ A;  1G6A A;  1S6R A;  2P9V B;  3V50 A;  1HZO A;  4JF5 A;  3VOY A;  3ZDJ A;  5BOH A;  4GB7 A;  3HLB A;  1LL9 A;  1XA1 A;  3EQU A;  4MBF A;  4QHC A;  4DDS A;  1K54 A;  4RVA A;  4E3I A;  4EUZ A;  1J9M A;  1H8Y A;  1LL5 A;  4KZB A;  2WKE A;  3M6B A;  4OVD A;  4WYY A;  3SS3 A;  4BEN A;  5FQJ A;  1H8Z A;  4UA9 A;  5KZH A;  2EX8 A;  3V3S A;  1FSW A;  1NYY A;  3IF6 B;  3OPL A;  3PAE A;  4QB8 A;  4WZ5 C;  5E43 A;  2EX9 A;  1PIO A;  2ZQ7 A;  2H5S A;  3OPH A;  4ZTK A;  1YLW A;  3SS5 A;  3IF5 A;  1ERO A;  2HP9 A;  4N1X A;  2ZC3 B;  3VP1 A;  4WZ4 A;  1TEM A;  1LHY A;  1MKI A;  1MWR A;  1KE0 A;  5HFO A;  3FV7 A;  4GD6 A;  1FCO A;  2G2W A;  1ZC2 A;  1CI8 A;  3HVF A;  1NYM A;  4OPQ A;  2HDU A;  4GDN A;  3A3I A;  4Q8I A;  4X6T A;  1XGI A;  1SCW A;  5CHM A;  3E2K A;  5EUA A;  5JYP A;  1YLP A;  4N9L A;  3UDI A;  3ZGA B;  3BEC A;  4OPR A;  1HVB A;  5GHY A;  2X01 A;  3MZD A;  3MZE A;  3HLE A;  3ISG A;  1KGF A;  3ZVW A;  2XK1 A;  3BYD A;  4E3K A;  5U47 A;  1M40 A;  3LEZ A;  4JPM A;  4ZJ1 A;  1YMS A;  3IXB A;  4BJP A;  5CTM A;  5JYO A;  4X69 A;  3JYI A;  4P85 A;  5M19 A;  4FH2 A;  2ZC5 B;  1MWT A;  1DJB A;  3O3V A;  4Y7P A;  4B88 A;  1L0G A;  1CEG A;  4MBH A;  1K4E A;  2A3U A;  4PM8 A;  1XGJ A;  3A3J A;  5DTT A;  4OQH A;  1KVL A;  5EVI D;  5CEC A;  2ZJ9 A;  4N1H A;  1NRF A;  3ZG7 B;  2WZX A;  1L0E A;  4EQI A;  5HAQ A;  5HAP A;  5A93 A;  1M6K A;  1TVF A;  1LLB A;  3PBR A;  5DTK A;  3IWQ A;  5D3O A;  1I5Q A;  3NIA A;  3IF6 C;  3Q7V B;  1RGY A;  3GR2 A;  2VGJ A;  5AQA A;  4P6B A;  5FI2 A;  4S2P A;  1CK3 A;  3HUM A;  5KSC A;  3ZG8 B;  1XP4 A;  4E6X A;  3IXH A;  4YIN A;  3ZNT A;  5TGF A;  5CGW A;  3Q7Z A;  4PPR A;  2HDS A;  4UA6 A;  3RXX A;  3VOZ A;  3UY6 A;  3NY4 A;  1L0F A;  3OPR A;  1ES5 A;  4S2J A;  3GSG A;  1Q2P A;  3BEB A;  5A90 A;  4PM9 A;  3WS0 A;  2XF3 A;  3DWZ A;  4E3L A;  1VM1 A;  3NC8 A;  4GZB A;  2J8Y A;  5EVI A;  1MBL A;  1MY8 A;  1JTD A;  2R9X A;  3V5M A;  1BUE A;  4F94 A;  4NET A;  3WRT A;  3NBL A;  2VGK A;  4DE0 A;  1DJC A;  2H0T A;  2IWC A;  3C7U A;  4K0W A;  4N92 A;  4KQQ A;  4ZBE A;  3FYZ A;  1PWG A;  2Y2K A;  4S2L A;  4RA7 A;  5DF8 A;  2CC1 A;  3TG9 A;  1NY0 A;  1ONH A;  1IEM A;  4QY5 A;  5FQM A;  1FSY A;  1K38 A;  3IT9 A;  4S2N A;  3WS2 A;  4LCM A;  3FKV A;  4R1G A;  5FSR A;  3MFD A;  4KQR A;  3EQV A;  5GLA A;  3N8R A;  2GDN A;  4S2I A;  4X53 A;  3IQA A;  2WKH A;  1PI5 A;  4K91 A;  2J9P A;  5J8X A;  1K56 D;  3SH7 A;  2QMI A;  1JVJ A;  4Y0O A;  3G4P A;  2JC7 A;  1BLP A;  1SKF A;  1ALQ A;  5FAQ A;  2J9O A;  4IVK A;  3MZF A;  5GHZ A;  5FAP A;  4LV3 A;  1XPB A;  2Y2H A;  4R0Q A;  2ZC6 B;  3ITB A;  5FAS A;  3HLG A;  1BSG A;  4A5R A;  4U0X A;  4HES A;  3BFF A;  3WS4 A;  2V1Z A;  4QY6 A;  1XXM A;  4OP8 A;  4IBX A;  3UN7 A;  4C3Q A;  2OV5 A;  1K4F A;  1ERM A;  1ES4 A;  1YM1 A;  2XEP A;  5EPH A;  4DE2 A;  3HUO A;  2BG1 A;  2Y2Q A;  1PWC A;  3BM6 A;  4WEJ A;  3TSG A;  3G2Z A;  4KZ4 A;  1E25 A;  1SHV A;  2Y2G A;  3OZH A;  4RX3 A;  2FFF B;  3CJM A;  1ESI A;  4DDY A;  1FCN A;  4MLL A;  4WBG A;  4IVI A;  5FI6 A;  4GKU A;  3WS5 A;  3SS4 A;  3WS1 A;  3MXS A;  4KZ9 A;  1PW1 A;  3FZC A;  1KE3 A;  3VSL A;  1QMF A;  4QU3 A;  2UWX A;  2PU4 A;  3W4P A;  1AXB A;  1MPL A;  5EEC A;  1IYP A;  3MKE A;  4KZ7 A;  5TR7 A;  2EFU A;  1BT5 A;  5CER A;  3S1Y A;  4YFM A;  4ZAM A;  4U3T A;  2DNS A;  5CTN A;  3O87 A;  2P9V A;  1IKI A;  2WAF A;  4Y0U A;  4S2M A;  2WGI A;  3UPN A;  2ZM0 A;  3G30 A;  2A49 A;  1GCE A;  3M2J A;  1YQS A;  2Y2J A;  4R23 A;  3TOI A;  1NZO A;  3ZNY A;  3UPO A;  1K55 C;  2Y2I A;  1GHI A;  5E2E A;  3VP3 A;  3DWK A;  4KZ3 A;  3HLD A;  1FOF A;  5CRF A;  3IHB A;  1GA0 A;  3PBS A;  5E2H A;  2WGW A;  2ZLY A;  4UA7 A;  1YLY A;  3HUN A;  1BLH A;  5KMW A;  1N9B A;  3VP2 A;  3Q07 A;  1FR6 A;  3BFE A;  3OPP A;  1Q2Q A;  1E4D A;  5FAO A;  2Z2L B;  1DY6 A;  2Q9N A;  4E3M A;  4OP5 A;  4XUZ A;  1NXY A;  5A91 A;  3UO9 A;  4CJN A;  4OQ0 A;  5GL9 A;  1KVM A;  4R4R A;  1ESU A;  4JBF A;  4EWF A;  4RYE A;  4Z9Q A;  1JWP A;  4D2O A;  3O88 A;  3BLM A;  4WEL A;  4QD4 A;  4GNU A;  5FAT A;  1GHP A;  4PM5 A;  2C6W B;  4BD1 A;  3S22 A;  1EWZ A;  4R3J A;  1ZKJ A;  3M2K A;  3PBT A;  1Z6F A;  4DXB A;  1TDL A;  3ZFZ A;  1WYC A;  1SDN A;  1IYS A;  3NDG A;  4FD8 A;  3W8K A;  1DJA A;  2XQZ A;  4PMA A;  4XUX A;  1QME A;  3P98 A;  3N7W A;  2Y2P A;  1BLC A;  2DRW A;  4WMC A;  3N6I A;  5HW3 A;  3UNW A;  2XGN A;  4IED A;  3ZCZ A;  2OLU A;  5FQK A;  3PBO A;  3LCE A;  4WZ5 A;  5F82 A;  1TDG A;  2OLV A;  1IEL A;  1I2W A;  1FCM A;  3W4Q A;  4DXC A;  2EX6 A;  3V39 A;  2EX2 A;  1W79 A;  2ZC7 A;  1PWD A;  2WKI A;  3FKW A;  1HD8 A;  2P74 A;  3VFH A;  1RCJ A;  3Q82 A;  3IWO A;  3NCK A;  4FCF A;  4OQI A;  5GHX A;  1W5D A;  3ZHH A;  4B4Z A;  1U60 A;  4EBP A;  2WGW B;  5G18 A;  5GLB A;  3G2Y A;  1PW8 A;  1O7E A;  2FFY A;  3Q1F A;  4BL3 A;  4DF6 A;  1YLT A;  5HX9 A;  3OCN A;  4E3O A;  1S0W A;  2Y91 A;  2HP6 A;  3SH8 A;  1CEF A;  3A3D A;  1K56 A;  2XFT A;  3MXR A;  3NDE A;  2B5R A;  1ZG4 A;  3UDF A;  4JXV A;  3WRZ A;  1RGZ A;  5EE8 A;  4MBK A;  5EVL A;  4WMC D;  4N9K A;  4LV2 A;  2RL3 A;  4KG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...