3FKWA

Ampc k67r mutant apo structure
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
353
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSRTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Re-examining the role of Lys67 in class C beta-lactamase catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 116
structure length 353
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3fkwA00
1FSWA 3G30A 4KZ3A 2QMIA 1XKZA 4XUXA 3ZNYA 3HBRA 1IEMA 3IF6A 4N9KA 1BSGA 3HVFA 4X6TA 1IYQA 3ZG9B 5EECA 3WS4A 3BFDA 3ITBA 1YLPA 1AXBA 1SDNA 4GNUA 4PM6A 1EROA 4X53A 4OP8A 2WGIA 2ZQ7A 4M3KA 4IVIA 3V3SA 1SDEA 2J9OA 2XDMA 3E2LA 1OMEA 2Y2KA 3DW0A 2WYXA 4JPMA 4R23A 5CTMA 3UO9A 1K55A 2FFYA 1PZOA 4OQGA 1XX2A 2PU4A 1W5DA 3TOIA 2PBYA 2XGNA 2Y4AA 1KGFA 5KSHA 1XA1A 1G68A 1Z6FA 2WZXA 4KG5A 4NETA 5CGXA 1JTGA 2WAFA 1CEFA 4IVKA 4QHCA 2PU2A 5E2EA 5A93A 3SS5A 4GD8A 2Y91A 1PW1A 4GZBA 4WBGA 3BFGA 5FAQA 3G34A 5DTTA 3ZNTA 4KZ7A 3SH9A 2HPBA 4E3KA 3HLDA 5TGFA 5GLDA 2ZQAA 1CEGA 2XEPA 3LEZA 1N4OA 4U3TA 1QMEA 3M2KA 4OOLA 4UA7A 1HTZA 3E2KA 3LY3A 1N9BA 1FR6A 3Q81A 2CC1A 4OQHA 2G2UA 4X55A 2HDRA 3C4OA 4GOGA 4OVDA 2H10A 3G31A 2BG1A 2XD1A 3OCNA 2Q9NA 1K57C 3MBZA 3HLBA 2EX6A 2R9XA 4XUZA 3P98A 3VFHA 1NZUA 5DF7A 4P0MA 3PBTA 4E3OA 4BQMA 5A92A 4JF5A 4S2PA 4JBFA 4JF6A 4OPQA 1BLCA 2JE5A 3VMAA 2WGWB 3O87A 3NBLA 1L0FA 3GVBA 4QD4A 3PBSA 3HUMA 5AQBA 2G2WA 4PM9A 3ZGAB 3M2JA 1WYBA 1KE3A 1ESIA 4K91A 4R4RA 2VGKA 3VSKA 1JWVA 1RP5A 1GHMA 5M18A 3WRTA 2OLUA 1FCNA 3OPHA 4KZAA 2Y2IA 4UHUA 1E25A 1FR1A 4WMCA 3W4OA 5F82A 3ZDJA 3DTMA 4QJGA 1LHYA 3IWQA 4B4XA 3N8RA 4KZBA 1IYSA 3WRZA 3BFFA 3NDGA 3GR2A 3WWXA 4KQRA 4WEJA 3W4PA 1O7EA 3CZDA 2ZM2A 1ALQA 2Y2GA 5AQAA 5HAPA 2ZC5B 1RCJA 2Y2OA 3G35A 3QNCA 5CRFA 3VP4A 4HBTA 5U47A 3I7JA 1NY0A 2IWCA 3UDIA 4PM8A 2X01A 5GHXA 3QNBA 4BJPA 2J8YA 3UPOA 4LV0A 4KZ8A 4WMCD 4DE0A 2JC7A 1DJCA 1TDGA 3PBOA 2WK0A 4P85A 2EX2A 3FKWA 3NY4A 5A90A 1K6SA 4KENB 3M6HA 4DDSA 3A3DA 2VGJA 3BLSA 4S2NA 2WGVA 2IWDA 1K54A 2A49A 1ONGA 1GCEA 3ITAA 1BT5A 1XGIA 4E3LA 5DF9A 2I72A 3HLWA 2C6WB 4Q8IA 4LENA 2DNSA 3S1YA 3ZHHA 2Y59A 4RVAA 1BUEA 1EWZA 5M19A 1PWCA 3MKEA 5DTKA 5HW3A 4PM5A 2RCXA 3GQZA 3ZVWA 3NDEA 2QPNA 4ZAMA 1KDSA 4QY6A 5CGSA 2Y2PA 4FD8A 3V50A 4GN2A 1EI5A 2V1ZA 5CERA 3UNWA 5FI7A 2EXAA 2ZQDA 4X68A 3WS1A 5GL9A 1RGZA 3IXHA 1IYOA 4Y0OA 3Q7VA 3VP3A 3EQVA 1IYPA 4FH2A 3PAGA 4EBLA 1BULA 1JWPA 1GA9A 4BL3A 2J7VA 3FWLA 3A3EA 4C6YA 1ERMA 2WADA 4ZBEA 3RXWA 1DY6A 1K25A 3UE3A 2DCFA 4E6WA 1RGYA 3OPPA 5CEBA 4S2OA 4D2OA 1H8ZA 1MWRA 2ZC7A 4KZ5A 4R0QA 1YLYA 2XFTA 4C75A 2FFFB 3HLGA 3EQUA 3IWOA 3Q1FA 1XA7A 3WS2A 2ZLYA 1MWSA 3AGFA 4EQIA 1LI9A 1YLTA 1KDWA 3HL9A 2ZJ9A 4S2MA 5E2FA 3MXSA 5GLBA 2IWBA 3NCKA 3SS3A 1IELA 1K4EA 3W8KA 2UWXA 5GLCA 4OQIA 4LV2A 1H8YA 5DTSA 5CHUA 3HREA 3IXGA 4YINA 2XD5A 1J9MA 5E2GA 5AQ7A 5F83A 3RXXA 2ZC6B 1PWGA 1BLHA 4DF6A 3BECA 1MWUA 3C4PA 4EBPA 1G6AA 5FDHA 3IH8A 4WZ5A 3IQAA 4C3QA 2WKEA 4KZ4A 4QB8A 3BM6A 4UAAA 5EOEA 4N1XA 5DF8A 2Q9MA 2QZ6A 5EVIC 5IHVA 3MZFA 4KG2A 4LCLA 5FAPA 3C7UA 1HVBA 4B4ZA 3A3IA 1I5QA 2Z2MB 1ZC2A 2H5SA 4R3JA 2JCHA 4EV4A 2OV5A 1IKIA 3UPPA 4MNRA 3IF6B 5EPHA 5J8XA 3NI9A 3A3JA 3N8SA 3ZCZA 3ZG7B 2P9VB 5FSRA 3RJUA 1GHIA 4L0LA 3OPLA 5FI6A 3N6IA 1Q2QA 3S4XA 1MBLA 3HUOA 4JXWA 4BENA 1TEMA 2GDNA 4ZJ1A 1YQSA 2RL3A 1YLWA 1L0EA 4E3IA 4HEFA 4BL2A 4YFMA 3UDFA 3ISGA 4FCFA 3VP1A 4IBXA 3IF6C 1I2WA 1XPBA 1YM1A 2Y2QA 3AGDA 3N7WA 1LL5A 3V39A 3G2YA 1ERQA 4HESA 4RX3A 2ZM0A 2Y55A 1O07A 3FYZA 4HBUA 4DKIA 3OCLA 5F1FA 1ES2A 4GD6A 2ZMAA 2BLSA 4JXSA 4KZ6A 3VP0A 3LO7A 1KE0A 2XK1A 5I94A 4O7DA 2ZQ9A 1MKIA 3S22A 4ZDXA 4BLMA 1K55C 2WKIA 4DE2A 1CK3A 2X71A 4FSFA 4DE1A 4Y0TA 1YLJA 4OPYA 5FI2A 2JBFA 4GKUA 5HX9A 2Z2LB 2WAEA 2Y2JA 4GDBA 4P6BA 1PZPA 5FQ9A 4RA7A 2ZQCA 4KZ9A 3N4IA 1KGEA 2ZC4B 5E43A 3CG5A 5M1AA 1NJ4A 5EVLA 2P74A 3WS0A 4E3NA 1PWDA 2HDSA 3O3VA 4E6XA 4BD0A 2E8IA 4OH0A 4GDNA 3O86A 5EE8A 1XXMA 3GTCA 5HFOA 3G2ZA 1L0GA 5KZHA 3C7VA 4JKTA 4ZTKA 1GA0A 1YLZA 3FKVA 4KQQA 1ES3A 4WZ4A 1E3UA 3WS5A 1K57A 4S2KA 4ZJ3A 2HDUA 5CGWA 3BRMA 4ZJ2A 1FCOA 4R3BA 1Y54A 4PMAA 3FZCA 5DVAA 5HAIA 4A5RA 5CEDA 3SOIA 4UA6A 4JF4A 1DJBA 5TFQA 3ZFZA 4WELA 3SH8A 2Y2MA 4OONA 1IKGA 1NYYA 1TVFA 5FAOA 1E3UD 5CECA 1PI5A 1I2SA 4OPRA 2ZD8A 4DXCA 1KVMA 4Y7PA 4Z9QA 4EBNA 4DDYA 3UPNA 3V3RA 1W7FA 3QHYA 2R9WA 2OLVA 1H5XA 2HDQA 2WGWA 3MXRA 3G32A 1NZOA 3PBRA 1DJAA 2WKHA 3BFEA 2EXBA 1ESUA 1KE4A 1PI4A 3DWKA 3MFDA 4QY5A 3UE0A 4N1HA 2P9VA 2HP5A 1XP4A 2X02A 4MBFA 5EOOA 3VFFA 1LI0A 3CMZA 3PAEA 1ZG4A 5FQIA 3BEBA 3Q82A 3IH9A 4KQOA 3W4QA 1BTLA 2A3UA 4FH4A 4S2LA 1SCWA 1HD8A 1BLSA 2Y2NA 3IHAA 2DRWA 2B5RA 5KSCA 5EVIB 4UA9A 5KMWA 5G18A 1U60A 4MBHA 3HLFA 3GSGA 1ONHA 4RYEA 3VOYA 1W8QA 2XF3A 4X56A 1JTDA 4S2NC 3VSLA 4OPZA 5AQ9A 1K54C 5A91A 5CTNA 2ZM8A 4EUZA 5L2FA 3OZHA 5GHZA 4S2IA 3UY6A 3OPRA 1CI8A 2HP6A 4U0XA 4OP5A 2V20A 3MKFA 4CJNA 4PM7A 2EFXA 1M6KA 3BLMA 4RX2A 4H8RA 4Y0UA 1FOFA 1VM1A 4LV1A 3IT9A 4OKPA 4R4SA 2C5WB 2HP9A 3Q7VB 4XXRA 1ZKJA 3D4FA 3GV9A 3OC2A 1BZAA 1GHPA 1W8YA 1TDLA 4N92A 4QU3A 3IHBA 5FQMA 3IXDA 2XFSA 1PIOA 4MEZA 1FQGA 2EFUA 4BD1A 4MLLA 5FA7A 5TR7A 1S0WA 1MY8A 3ZG8B 4IEDA 1NXYA 1MXOA 1CI9A 2EX9A 3UDXA 4EWFA 3UE1A 1K56A 2XLNA 4LCMA 3ZVTA 4P87A 3ZG5A 3Q7ZA 1MPLA 3P09A 4U0TA 2H0YA 5HAQA 1L0DA 4OLGA 2H0TA 1KVLA 3A3FA 3C5AA 3BYDA 2XQZA 1K6RA 3CJMA 2V2FF 5D3OA 4NK3A 3JYIA 5FQKA 1SHVA 4S2JA 3NC8A 4WEKA 1PYYA 4DXBA 3BFCA 4E3JA 3NIAA 1FCMA 1K56D 3PBNA 1BLPA 1PW8A 3LY4A 3M6BA 5FQJA 1S6RA 5BOHA 5FATA 3MZDA 4DE3A 3HLCA 5E2HA 3UN7A 3V5MA 5HARA 1LLBA 1ES5A 2WUQA 4OQ0A 2XH9A 4OLDA 3PBQA 1C3BA 4JXGA 3FV7A 3HUNA 4OOYA 2EX8A 5F1GA 1K4FA 3TG9A 1NRFA 1WE4A 1XGJA 3O88A 3G4PA 5CXWA 3ZG0A 1VQQA 1JVJA 5JYPA 1KGGA 2OSUA 3GRJA 3VOZA 1ES4A 4K0WA 2ZQ8A 3Q07A 1YMSA 1QMFA 1K38A 2Y2LA 3PTEA 2Y2HA 5GLAA 5EUAA 4KG6A 4CPKA 5FASA 4N9LA 4LV3A 5CHMA 4JXVA 4MBKA 3SS4A 4OOMA 1HZOA 4PPRA 5JYOA 4B88A 1ZG6A 3IWIA 1NYMA 4K0XA 4WZ5C 3HLEA 4IBRA 4E3MA 5EVIA 3MZEA 3B3XA 4X69A 3SH7A 3AGEA 3DWZA 3IXBA 5CHJA 2ZC3B 1M40A 4JLFA 5GHYA 3LCEA 3TSGA 4ID4A 1Q2PA 1SKFA 2XR0A 2J9PA 4DRTA 1YMXA 1W79A 4GB7A 3IF5A 4F94A 3GMWA 2WZZA 1JWZA 4WM9A 1L2SA 5EVID 1E4DA 1YT4A 1LL9A 5FQQA 1MWTA 3VP2A 4R1GA 1FSYA 1WYCA 5HL1A 3N8LA 4WYYA
chains in the Genus database with same CATH superfamily
1H8MA 2QMIA 3ZNYA 1IEMA 4N9KA 3BFDA 3ITBA 2K7SA 1EROA 1OMEA 5CTMA 2WYXA 3K2NA 4JGPA 1XX2A 2PBYA 3NHQA 1KGFA 2V8CA 1G68A 2WZXA 2WAFA 5EM1A 2W1TA 4QHCA 2PR6A 5A93A 4GD8A 3QP4A 3C30A 5DTTA 3ZNTA 5TGFA 2HJ9C 1N4OA 4QPRA 3M2KA 3E2KA 5LBRA 3LIEA 1N9BA 3Q81A 2G2UA 3C4OA 4BBUA 1K57C 1OTIA 1CJFA 4XUZA 4P0MA 4HJ3A 5A92A 3CPTB 5DKLA 2OWHA 2WGWB 5F68A 3PBSA 4EXOA 5AQBA 4PM9A 3M2JA 1WYBA 1KE3A 4GCZA 4K91A 4R4RA 3C38A 3WRTA 3OPHA 4KZAA 3S7NA 2PYRA 1E25A 3NDGA 3GR2A 5G4YA 2KLIA 5HDCA 5AQAA 1FILA 1RCJA 2Y2OA 2ZC5B 1F9IA 5U47A 3UDIA 4GLQA 4F3LB 3PBOA 4EQ1A 2OOLA 3OLOA 2WK0A 3T1QB 3FKWA 2BTFP 1K6SA 4KENB 3BLSA 2R78A 5EV0A 4BWIA 1MZUA 1BT5A 5IU1A 3K3DA 3HLWA 4Q8IA 1F98A 2DNSA 1TS7A 2PHYA 2QYBA 2Y59A 3VV4A 1PWCA 3LIAA 5DFYA 4PM5A 2RCXA 3A0SA 3NDEA 2QPNA 4I3AA 4ZAMA 2Y2PA 1EI5A 3UNWA 5FI7A 3NECA 2ZQDA 5A8BA 5GL9A 1RGZA 3MMHA 4Y0OA 3Q7VA 1F2KA 3CAXA 3PAGA 3CUEA 2HZ5A 1S4RA 3A3EA 4C6YA 2WADA 4NXGA 3OPPA 2OWJA 5CX7A 4S2OA 1X0OA 3JVUA 2ZC7A 4R0QA 2XFTA 2FFFB 4ARZA 3IBJA 3HLGA 3EQUA 3IWOA 3Q1FA 5IT5A 3WS2A 2P04A 1OTDA 1OTEA 3W8KA 2UWXA 3S7OA 4LV2A 5EFWA 5CHUA 2XD5A 5AQ7A 3RXXA 2ZC6B 1PWGA 1STZA 4UAAA 1DP8A 1DRMA 4N1XA 3O5YA 5IHVA 4F3LA 4B4ZA 3C7UA 4L9GA 1I5QA 3QP2A 3UPPA 5EPHA 3IBRA 2M7VA 5J8XA 4O8GA 3A3JA 2P9VB 5FSRA 1GHIA 3N6IA 3S4XA 1MBLA 3HUOA 2W3DA 2OAP1 1D06A 4BL2A 3F1OA 3VP1A 1I2WA 1YM1A 3BY8A 1ACFA 2Q0OA 4RX3A 1O07A 3FYZA 3OCLA 4GD6A 2ZMAA 2BLSA 4KZ6A 5I94A 3MR0A 4O7DA 1MKIA 3S22A 3D72A 2FH5A 2WKIA 2W3EA 4WN5A 4DE1A 5FI2A 2Z2LB 2Y2JA 2ZQCA 4KZ9A 3N4IA 2ZC4B 1A0KA 1PWDA 3H7WA 4GDNA 1XXMA 5HFOA 4I3JA 5CGWA 2LB9A 5DFXA 1OJ5A 2JN7A 4G3WA 3OBFA 2L0WA 1IKGA 1TVFA 1PI5A 4MN5A 2ZD8A 4Y7PA 4EBNA 4DDYA 3QHYA 4JGQA 2R9WA 1L3LA 2OLVA 1H5XA 3G32A 3PBRA 3BFEA 1KE4A 3UE0A 2P9VA 3SZTA 4MBFA 1OTAA 3KYQA 4Q0JA 5FQIA 3BEBA 4KQOA 1BTLA 2A3UA 2XROA 1BLSA 1S66L 4JGOA 5EVIB 4UA9A 5EM0A 5HD3A 4MBHA 4HNBA 2XF3A 1JTDA 4OPZA 5AQ9A 3T4JA 2PD8A 2HP6A 1ZHHB 3EOIA 1M6KA 4H8RA 2D01A 4LV1A 4OKPA 2C5WB 5FEFA 1BZAA 1W8YA 1TDLA 3IHBA 2KOIA 2XFSA 4BD1A 4MEZA 1FQGA 1LT0A 1S0WA 1MY8A 1NXYA 1SKOB 1MXOA 1CI9A 1N9NA 2EX9A 3UMEA 3UE1A 4LCMA 3T4TA 5TBMB 3ZG5A 2YKFA 1V9ZA 3CUEC 4LRYC 2W1RA 4NK3A 3JYIA 5HWWA 4E3JA 5FQJA 1S6RA 3MZDA 5HWTA 3V5MA 1LLBA 4OLDA 4KUKA 3FV7A 5FL3A 4QWOA 3MFXA 1VQQA 2INWA 1JVJA 1KGGA 3GRJA 4K0WA 4PAUA 3TRCA 2V0WA 2Y2HA 4KG6A 5F5YA 3MJQA 3SS4A 4LFUA 1ZG6A 1V9YA 5EVIA 2V1AA 4X1MA 3DWZA 1FIKA 1T1BA 1M40A 2V0UA 3IX8A 1JWZA 1F5MA 5EVID 1YT4A 1LL9A 3KSHA 3G30A 4KZ3A 4X25A 3IX3A 2P7JA 2QWSA 1IYQA 3IS2B 1T19A 3WS4A 1SKOA 4X53A 4OP8A 4M3KA 5HD5A 2J9OA 3U2AA 2A24A 4OQGA 1W5DA 5L09A 1Z6FA 1JTGA 1CEFA 4BMWA 2ZOHA 3MQ0A 4WBGA 3BFGA 2VV8A 3G34A 3SH9A 5K5BA 5GLDA 2ZQAA 1CEGA 3S7PA 3LEZA 4U3TA 2PD7A 4HI4A 2UV0E 4OQHA 4X55A 3OCNA 4X1LA 2Q9NA 2EX6A 3P98A 4IHQA 3VFHA 1NZUA 4BQMA 4S2PA 1OT9A 4JBFA 4OPQA 2JE5A 1L0FA 3GVBA 3UB9A 3H82B 4QD4A 4E04A 2G2WA 3ZGAB 4R3AA 2VGKA 2MJ6A 3VSKA 1YSPA 3NULA 3A0VA 1JWVA 1GHMA 5M18A 2OLUA 1FCNA 3W4OA 5F82A 3DTMA 3IWQA 2JKRI 1IYSA 3WRZA 3BFFA 3W4PA 3CZDA 3LIFA 1ALQA 3HJIA 1NY0A 4Q0HA 2X01A 5GHXA 3QNBA 4BJPA 2J8YA 3MS6A 3UPOA 1DJCA 1TDGA 4O0PA 3A0RA 4P85A 2EX2A 3PR6A 5A90A 5DJUA 4S2NA 5IS1A 3IS2A 2A49A 1ONGA 1G5UA 4E3LA 5DF9A 2I72A 4LRZE 2M1CA 4LENA 5HWVA 2ZL1A 4G3KA 3S1YA 4RVAA 5MC7A 3V50A 4FD8A 3DTKA 3BQ8A 2V1ZA 5HDSA 4X68A 3KYEA 3WS1A 2GX5A 3IXHA 1IYOA 2HF6A 3VP3A 3EQVA 1GA9A 4BL3A 5G4ZA 1CF0A 3UB6A 3MF0A 3UB5P 3ULFA 1DY6A 2JKRM 1K25A 2DCFA 2I9VA 2JKGA 5CEBA 4HJ6A 2QJ5A 1MWRA 3QP8A 2HJEA 2GZAA 1YLYA 4C75A 3H82A 5F6AA 3HL9A 4S2MA 3R4KA 4Y15A 5GLBA 3SS3A 1IELA 4OQIA 4GS9B 3IXGA 1LSXA 3D9YA 5F83A 3ZQ5A 3E0YA 4DF6A 1MWUA 3ZYTA 2L4RA 1G6AA 5FDHA 3IH8A 3P01A 4QB8A 5EOEA 2QZ6A 5EVIC 3MZFA 4LCLA 1K0KA 2Z2MB 4NXFA 2ZOIA 4EV4A 3VOLA 3BW6A 1LSWA 3IF6B 3F1PB 3NI9A 3RJUA 3K3CA 5FI6A 2V1BA 2B95A 3PHYA 1YLWA 1L0EA 2KX6A 3E98A 4HHDA 3N7WA 3G2YA 4NXEA 2ZM0A 2Y55A 5F1FA 1ES2A 5HSQA 3MQOA 2W3HA 3BJNA 3LO7A 2EWVA 4BLMA 2E8JA 3V67A 1D1JA 4LPZA 1CK3A 4II7A 4FSFA 4Y0TA 4MCWA 2GNXA 5HX9A 5FQ9A 1EW0A 1NLZA 3T4LA 1KGEA 3CG5A 5M1AA 1NJ4A 3UB8A 2P74A 3O3VA 4BD0A 3E4QA 1GSXA 4OH0A 3O86A 2BASA 3GTCA 4XT2B 1L0GA 1T1CA 4WZ4A 3WS5A 2HDUA 1FCOA 1DP6A 3KSFA 4PMAA 5CEDA 4JF4A 1DJBA 5TFQA 3ZFZA 4WELA 1NYYA 2J80A 3T4QA 5FAOA 1YKDA 2K31A 4HP4A 3R7WB 4OPRA 1KVMA 4Z9QA 3UPNA 1IOUA 1W7FA 3CPTA 2WGWA 1NZOA 1DJAA 2WKHA 2EXBA 1PI4A 3MFDA 4P6ZM 3F1PA 2HP5A 2X02A 3VFFA 3PAEA 1ZG4A 4FH4A 1HD8A 3EWKA 2B5RA 5C5KA 5KMWA 1U60A 4RYEA 1W8QA 4S2NC 5A91A 3OZHA 2W0NA 4U0XA 2V20A 3MKFA 2VKSA 4RX2A 3IT9A 4HH3A 1ZKJA 3D4FA 3GV9A 2W3GA 3IXDA 4UEYA 5FA7A 4GW9A 4EWFA 4G3VA 2W3FA 3LUQA 2O9AA 2H28A 2H0YA 3MXQA 3NOPC 3A3FA 2XQZA 1K6RA 4BBTA 4EETB 5FQKA 3S7QA 3NC8A 1FCMA 3LR4A 3PBNA 1PW8A 1OT6A 3LY4A 3M6BA 5BOHA 3HLCA 3UN7A 5FDSA 5HARA 2Z6DA 1ES5A 2WUQA 3T1XA 5F1GA 3G4PA 5CXWA 1PRQA 1PNEA 3Q07A 5F69A 3CLOA 1QMFA 3PTEA 5KIZA 4JXVA 3T4KA 3HCYA 5HZHA 1HZOA 1G6OA 4B88A 3IWIA 1NYMA 3HLEA 4IBRA 4X69A 5CHJA 2J3TD 2ZC3B 3LCEA 2XR0A 1Y4OA 4GHIB 1W79A 3IF5A 4F94A 3LIBA 1MWTA 4R1GA 4WYYA 3B47A 3KSIA 1XKZA 4B9OA 2O9BA 3HBRA 4ETZA 1OTBA 4X6TA 4MDZA 3ZG9B 1SDNA 4PM6A 2IA2A 2WGIA 2ZQ7A 1Z09A 4IVIA 4NG2A 1SDEA 3E2LA 3UO9A 1K55A 3TOIA 2YKHA 1XA1A 4NETA 4KG5A 1VHMA 2JHEA 3SS5A 3UMDA 1PW1A 2HGVA 4MN7A 3EGDC 4GZBA 1PFLA 1ODVA 4KZ7A 1H3QA 4E3KA 3HLDA 2XEPA 1QMEA 3LY3A 2CC1A 2HDRA 4OVDA 2H10A 2BG1A 3TE8A 2AVXA 1OPXA 3MBZA 2R9XA 4ME4A 5DF7A 4E3OA 1BLCA 4EW7A 3JVVA 3O87A 3NBLA 4NXBA 1ESIA 1P9WA 4UQIS 1RP5A 2HV1A 4WMCA 3ZDJA 1OJGA 4QJGA 1LHYA 4B4XA 4KZBA 4WEJA 1O7EA 4HOIA 2ZM2A 1P97A 3G35A 5CRFA 4PM8A 1DP9A 1UWNX 4LV0A 3LR0A 4KZ8A 4WMCD 4DE0A 2Z6CA 3QP5A 3NY4A 2V8FA 3A3DA 2WGVA 4HIAA 3ITAA 2PAVP 3JPUA 4EESA 1WA9A 2C6WB 4DN0A 4I38A 3LICA 2DMWA 3ZHHA 5M19A 3MKEA 5HPFA 2PT7A 3ZVWA 5CGSA 4GN2A 3RH8B 4FH2A 1JWPA 5HL6A 2J7VA 1S4SA 1ERMA 2K2NA 4ZBEA 3ICYA 3UE3A 4E6WA 1RGYA 3B33A 2WKRA 4D2OA 4KQDA 5TBMA 3LR3A 5L8MA 1XA7A 4R6LA 2ZLYA 1MWSA 3AGFA 4YWZA 1KOUA 1LI9A 1YLTA 4I39A 3KYZA 3NCKA 1K4EA 5GLCA 4HY8A 1P9RA 4HH2A 3HREA 1J3WA 5DTSA 1NLYA 1G28A 1J9MA 1VEUB 1H0MA 1BLHA 2VGLS 3BECA 3TW8A 3IQAA 2WKEA 4KZ4A 2D02A 3BM6A 5DF8A 2Q9MA 2W27A 4H6JB 2H5SA 4R3JA 2A2LA 2OV5A 1IKIA 2JKTM 1N9OA 2QJ7A 4O01A 3N8SA 3LR5A 3ZCZA 3ZG7B 5HPIA 4HQAA 4L0LA 1Q2QA 4JXWA 4Y13A 4ZJ1A 1YQSA 4YFMA 4DJ3A 3VE3A 1N9LA 2NUPC 2Y2QA 2B18A 3AGDA 3HJKA 3V39A 1ERQA 2O9CA 4HESA 2W1TB 4HBUA 4UQIM 2XK1A 2FZ0A 2ZQ9A 3UE6A 1K55C 4DE2A 2X71A 1SZVA 1YLJA 4YNRA 2G7UA 4GKUA 3FPWA 1T18A 4P6BA 4RA7A 5E43A 3WS0A 2PBDP 2PR5A 3W2ZA 3E4OA 1XFNA 5EE8A 3G2ZA 4JKTA 4IUKA 4Y5FA 4ZTKA 3FKVA 1ES3A 3UB7A 4S2KA 4ZJ3A 1TS0A 4R3BA 1Y54A 2WKPA 5DVAA 3SOIA 4UA6A 1VETB 3NOUC 4P6ZS 2VLGA 2WKQA 3SH8A 2Y2MA 4OONA 2VJWA 4B93A 1I2SA 1TF1A 4CQHA 2QKPA 3V3RA 1UGUA 2HDQA 4R38A 3MXRA 1ESUA 4QY5A 5EOOA 4PKYG 3CMZA 1S67L 3W4QA 4NEED 2DRWA 2LB5A 5TJJA 1ONHA 2ZBBA 4X56A 3VSLA 3DTIA 1W63Q 2VX8A 4EUVA 5CTNA 4EUZA 5L2FA 5GHZA 3OPRA 3T1RA 4OP5A 4CJNA 2VK3A 4Y0UA 4R4SA 1MKMA 3Q7VB 4XXRA 3CWFA 1Y28A 2VGLM 3OC2A 1GHPA 4N92A 4QU3A 1PIOA 1NWZA 2PRFA 3ZG8B 4IEDA 3NOTC 2XLNA 4CLCB 3P09A 4U0TA 4OLGA 1KVLA 4ARZB 3C5AA 2V2FF 1SHVA 4WEKA 1PYYA 4BBVA 3BFCA 3NIAA 1BYWA 4EERA 5AVFA 2JKFA 1VETA 2EWWA 2J3WA 5E2HA 4OQ0A 3PBQA 1C3BA 4JXGA 3HUNA 3LFVA 3GDIA 5DKKA 1NRFA 1WE4A 3TG9A 3O88A 2OSUA 1ES4A 2ZQ8A 1YMSA 2Y2LA 3L7HA 4Q0IA 5EUAA 3NJAA 5CHMA 4WLAA 4PPRA 4E3MA 4GS9A 4CLCE 3B3XA 3AGEA 3H9WA 4EU0A 3TSGA 4ID4A 1Q2PA 2J9PA 4DRTA 3QP1A 4LGWA 3F1OB 4WM9A 1L2SA 3LI8A 1E4DA 3CI6A 3VP2A 1FSYA 3E4PA 1FSWA 4XUXA 1CQAA 3IF6A 1BSGA 3HVFA 5EECA 1YLPA 1AXBA 4GNUA 3T4SA 4LLOB 3V3SA 2XDMA 2Y2KA 3DW0A 3T50A 4JPMA 4R23A 4CLCA 2FFYA 1PZOA 4DMZA 1MC0A 2PU4A 5KSHA 2VV7A 2XGNA 2Y4AA 5CGXA 4IVKA 3H7WB 4L9EA 2PU2A 3C8CA 5E2EA 4K08A 1XFQA 3LYXA 1W63M 2Y91A 3TJZC 5FAQA 2VEAA 3LIDA 3EEAA 4CLCD 5I5LA 2HPBA 2Y8HA 2P08A 2OAQ1 4OOLA 4UA7A 1HTZA 1FR6A 4GOGA 3G31A 2XD1A 2KDKA 3HLBA 3MQQA 1XJ4A 3PBTA 4JF5A 4Y3IA 4JF6A 3DAVA 4XT2A 3VMAA 3PXPA 3HUMA 3G6OA 4UHUA 2Y2IA 1T1AA 1FR1A 3N8RA 3F1NB 3WWXA 4ESPA 4KQRA 3SW1A 3R7WA 2Y2GA 5HAPA 3VP4A 1TS6A 3QNCA 4HBTA 4M4XA 3I7JA 2IWCA 3PYPA 4Z1WA 2JC7A 3OOVA 4I5SA 3M6HA 4DDSA 2VGJA 2IWDA 1NRJA 1K54A 4FTXA 5AJGA 1GCEA 3T12B 3KSGA 1XGIA 2EA9A 3BQAA 4WL9A 4KUOA 4YOFA 1BUEA 1EWZA 1YAXA 3BWLA 5DTKA 4EEUA 3DBAA 5HW3A 3GQZA 1KDSA 4QY6A 1LL8A 3FG8A 1D7EA 4PHTA 5EVEA 5CERA 2V9AA 2EXAA 3CITA 1IYPA 1TD5A 4EBLA 1BULA 3FWLA 3T1SA 3RXWA 3U4LP 3IX4A 1H8ZA 1TS8A 4KZ5A 3RTYA 1S1ZA 4EQIA 1KDWA 2ZJ9A 5E2FA 1ZTUA 3MXSA 4LRXC 2VZWA 2IWBA 1YSQA 4DJ2A 1H8YA 3FPVA 4YINA 3F1NA 5E2GA 2ZMVA 3C4PA 4EBPA 1IFQA 4WZ5A 4C3QA 4KG2A 5FAPA 3VE4A 1HVBA 3A3IA 1ZC2A 2JCHA 4MNRA 4FUWA 5L07A 3OPLA 4BENA 1TEMA 2GDNA 2O99A 2M7UA 2RL3A 4GHIA 4E3IA 4HEFA 3UDFA 3ISGA 4FCFA 2A24B 4AFIA 4IBXA 3IF6C 2XA7S 1XPBA 5J7EA 3EEHA 4IJGA 1LL5A 4MN6A 4DKIA 2QHKA 5J4EA 4JXSA 3VP0A 1KE0A 3FC7A 4D60A 4ZDXA 1AWIA 4CLCC 4GJ4A 3T4OA 4IUHA 4OPYA 2VV6A 2JBFA 2WAEA 4GDBA 1LSVA 1PZPA 5EVLA 4E3NA 2HDSA 4E6XA 2E8IA 3GECA 1XJ3A 3LGOA 3RFBA 3C7VA 5KZHA 1GA0A 1YLZA 4KQQA 1E3UA 1K57A 3BRMA 4NKPA 2JKTI 4ZJ2A 5HAIA 3FZCA 4A5RA 5HDDA 4PKYA 1YPRA 1S1YA 1UWPX 1HLUP 1E3UD 5CECA 5AVEA 4DXCA 4WUJA 4JGRA 5DJTA 3LEQA 3DWKA 4N1HA 1XP4A 1LI0A 3Q82A 3IH9A 4S2LA 1SCWA 3IHAA 2Y2NA 5KSCA 5G18A 3HLFA 3GSGA 2J3TC 3DTEA 3VOYA 2XSSA 2ZL1B 2NUTC 3P7NA 4I3IA 1K54C 5L10A 2ZM8A 4S2IA 3UY6A 1CI8A 4FOFA 1XJ2A 1JNUA 4WF0A 4PM7A 2EFXA 3BLMA 4ETXA 1FOFA 1VM1A 2HP9A 4Y2FA 3B42A 4MMNA 5FQMA 1VB6A 3MSHA 2EFUA 3KX0X 3D3OA 4MLLA 5TR7A 2L1MA 1P0ZA 3UDXA 2VA0A 3EGXC 3L9KA 1K56A 3ZVTA 4P87A 3Q7ZA 1MPLA 2PYPA 5HAQA 1L0DA 4HJ4A 2H0TA 5J3WA 2ACGA 2PDRA 3CJMA 3BYDA 1XJ6A 2B02A 5D3OA 4S2JA 4DXBA 3LI9A 1K56D 1BLPA 2O0YA 5FATA 4DE3A 4HP9A 5FEGA 2CMNA 2XA7M 2XH9A 2XRNA 4OOYA 3BY9A 4Y17A 2EX8A 4RQ9A 1K4FA 1XGJA 3ZG0A 2Y79A 5JYPA 3VOZA 3QP6A 1GSVA 3KO6A 4R70A 1K38A 5GLAA 4CPKA 5FASA 4N9LA 4LV3A 4MBKA 4ZRRA 4EEPA 3CHWP 4OOMA 5JYOA 1GSWA 4K0XA 4WZ5C 3MZEA 3SH7A 3IXBA 1VEUA 4JLFA 5GHYA 1SKFA 2ZMFA 1YMXA 4GB7A 3C2WA 3GMWA 4L9FA 2WZZA 2GJ3A 5FQQA 1WYCA 5HL1A 3N8LA 4H6JA
chains in the Genus database with same CATH topology
1FSWA 3G30A 4KZ3A 2QMIA 1XKZA 4XUXA 3ZNYA 3HBRA 1IEMA 3IF6A 4N9KA 1BSGA 3HVFA 4X6TA 1IYQA 3ZG9B 5EECA 3WS4A 3BFDA 3ITBA 1YLPA 1AXBA 1SDNA 4GNUA 4PM6A 1EROA 4X53A 4OP8A 2WGIA 2ZQ7A 4M3KA 4IVIA 3V3SA 1SDEA 2J9OA 2XDMA 3E2LA 1OMEA 2Y2KA 3DW0A 2WYXA 4JPMA 4R23A 5CTMA 3UO9A 1K55A 2FFYA 1PZOA 4OQGA 1XX2A 2PU4A 1W5DA 3TOIA 2PBYA 2XGNA 2Y4AA 1KGFA 5KSHA 1XA1A 1G68A 1Z6FA 2WZXA 4KG5A 4NETA 5CGXA 1JTGA 2WAFA 1CEFA 4IVKA 4QHCA 2PU2A 5E2EA 5A93A 3SS5A 4GD8A 2Y91A 1PW1A 4GZBA 4WBGA 3BFGA 5FAQA 3G34A 5DTTA 3ZNTA 4KZ7A 3SH9A 2HPBA 4E3KA 3HLDA 5TGFA 5GLDA 2ZQAA 1CEGA 2XEPA 3LEZA 1N4OA 4U3TA 1QMEA 3M2KA 4OOLA 4UA7A 1HTZA 3E2KA 3LY3A 1N9BA 1FR6A 3Q81A 2CC1A 4OQHA 2G2UA 4X55A 2HDRA 3C4OA 4GOGA 4OVDA 2H10A 3G31A 2BG1A 2XD1A 3OCNA 2Q9NA 1K57C 3MBZA 3HLBA 2EX6A 2R9XA 4XUZA 3P98A 3VFHA 1NZUA 5DF7A 4P0MA 3PBTA 4E3OA 4BQMA 5A92A 4JF5A 4S2PA 4JBFA 4JF6A 4OPQA 1BLCA 2JE5A 3VMAA 2WGWB 3O87A 3NBLA 1L0FA 3GVBA 4QD4A 3PBSA 3HUMA 5AQBA 2G2WA 4PM9A 3ZGAB 3M2JA 1WYBA 1KE3A 1ESIA 4K91A 4R4RA 2VGKA 3VSKA 1JWVA 1RP5A 1GHMA 5M18A 3WRTA 2OLUA 1FCNA 3OPHA 4KZAA 2Y2IA 4UHUA 1E25A 1FR1A 4WMCA 3W4OA 5F82A 3ZDJA 3DTMA 4QJGA 1LHYA 3IWQA 4B4XA 3N8RA 4KZBA 1IYSA 3WRZA 3BFFA 3NDGA 3GR2A 3WWXA 4KQRA 4WEJA 3W4PA 1O7EA 3CZDA 2ZM2A 1ALQA 2Y2GA 5AQAA 5HAPA 2ZC5B 1RCJA 2Y2OA 3G35A 3QNCA 5CRFA 3VP4A 4HBTA 5U47A 3I7JA 1NY0A 2IWCA 3UDIA 4PM8A 2X01A 5GHXA 3QNBA 4BJPA 2J8YA 3UPOA 4LV0A 4KZ8A 4WMCD 4DE0A 2JC7A 1DJCA 1TDGA 3PBOA 2WK0A 4P85A 2EX2A 3FKWA 3NY4A 5A90A 1K6SA 4KENB 3M6HA 4DDSA 3A3DA 2VGJA 3BLSA 4S2NA 2WGVA 2IWDA 1K54A 2A49A 1ONGA 1GCEA 3ITAA 1BT5A 1XGIA 4E3LA 5DF9A 2I72A 3HLWA 2C6WB 4Q8IA 4LENA 2DNSA 3S1YA 3ZHHA 2Y59A 4RVAA 1BUEA 1EWZA 5M19A 1PWCA 3MKEA 5DTKA 5HW3A 4PM5A 2RCXA 3GQZA 3ZVWA 3NDEA 2QPNA 4ZAMA 1KDSA 4QY6A 5CGSA 2Y2PA 4FD8A 3V50A 4GN2A 1EI5A 2V1ZA 5CERA 3UNWA 5FI7A 2EXAA 2ZQDA 4X68A 3WS1A 5GL9A 1RGZA 3IXHA 1IYOA 4Y0OA 3Q7VA 3VP3A 3EQVA 1IYPA 4FH2A 3PAGA 4EBLA 1BULA 1JWPA 1GA9A 4BL3A 2J7VA 3FWLA 3A3EA 4C6YA 1ERMA 2WADA 4ZBEA 3RXWA 1DY6A 1K25A 3UE3A 2DCFA 4E6WA 1RGYA 3OPPA 5CEBA 4S2OA 4D2OA 1H8ZA 1MWRA 2ZC7A 4KZ5A 4R0QA 1YLYA 2XFTA 4C75A 2FFFB 3HLGA 3EQUA 3IWOA 3Q1FA 1XA7A 3WS2A 2ZLYA 1MWSA 3AGFA 4EQIA 1LI9A 1YLTA 1KDWA 3HL9A 2ZJ9A 4S2MA 5E2FA 3MXSA 5GLBA 2IWBA 3NCKA 3SS3A 1IELA 1K4EA 3W8KA 2UWXA 5GLCA 4OQIA 4LV2A 1H8YA 5DTSA 5CHUA 3HREA 3IXGA 4YINA 2XD5A 1J9MA 5E2GA 5AQ7A 5F83A 3RXXA 2ZC6B 1PWGA 1BLHA 4DF6A 3BECA 1MWUA 3C4PA 4EBPA 1G6AA 5FDHA 3IH8A 4WZ5A 3IQAA 4C3QA 2WKEA 4KZ4A 4QB8A 3BM6A 4UAAA 5EOEA 4N1XA 5DF8A 2Q9MA 2QZ6A 5EVIC 5IHVA 3MZFA 4KG2A 4LCLA 5FAPA 3C7UA 1HVBA 4B4ZA 3A3IA 1I5QA 2Z2MB 1ZC2A 2H5SA 4R3JA 2JCHA 4EV4A 2OV5A 1IKIA 3UPPA 4MNRA 3IF6B 5EPHA 5J8XA 3NI9A 3A3JA 3N8SA 3ZCZA 3ZG7B 2P9VB 5FSRA 3RJUA 1GHIA 4L0LA 3OPLA 5FI6A 3N6IA 1Q2QA 3S4XA 1MBLA 3HUOA 4JXWA 4BENA 1TEMA 2GDNA 4ZJ1A 1YQSA 2RL3A 1YLWA 1L0EA 4E3IA 4HEFA 4BL2A 4YFMA 3UDFA 3ISGA 4FCFA 3VP1A 4IBXA 3IF6C 1I2WA 1XPBA 1YM1A 2Y2QA 3AGDA 3N7WA 1LL5A 3V39A 3G2YA 1ERQA 4HESA 4RX3A 2ZM0A 2Y55A 1O07A 3FYZA 4HBUA 4DKIA 3OCLA 5F1FA 1ES2A 4GD6A 2ZMAA 2BLSA 4JXSA 4KZ6A 3VP0A 3LO7A 1KE0A 2XK1A 5I94A 4O7DA 2ZQ9A 1MKIA 3S22A 4ZDXA 4BLMA 1K55C 2WKIA 4DE2A 1CK3A 2X71A 4FSFA 4DE1A 4Y0TA 1YLJA 4OPYA 5FI2A 2JBFA 4GKUA 5HX9A 2Z2LB 2WAEA 2Y2JA 4GDBA 4P6BA 1PZPA 5FQ9A 4RA7A 2ZQCA 4KZ9A 3N4IA 1KGEA 2ZC4B 5E43A 3CG5A 5M1AA 1NJ4A 5EVLA 2P74A 3WS0A 4E3NA 1PWDA 2HDSA 3O3VA 4E6XA 4BD0A 2E8IA 4OH0A 4GDNA 3O86A 5EE8A 1XXMA 3GTCA 5HFOA 3G2ZA 1L0GA 5KZHA 3C7VA 4JKTA 4ZTKA 1GA0A 1YLZA 3FKVA 4KQQA 1ES3A 4WZ4A 1E3UA 3WS5A 1K57A 4S2KA 4ZJ3A 2HDUA 5CGWA 3BRMA 4ZJ2A 1FCOA 4R3BA 1Y54A 4PMAA 3FZCA 5DVAA 5HAIA 4A5RA 5CEDA 3SOIA 4UA6A 4JF4A 1DJBA 5TFQA 3ZFZA 4WELA 3SH8A 2Y2MA 4OONA 1IKGA 1NYYA 1TVFA 5FAOA 1E3UD 5CECA 1PI5A 1I2SA 4OPRA 2ZD8A 4DXCA 1KVMA 4Y7PA 4Z9QA 4EBNA 4DDYA 3UPNA 3V3RA 1W7FA 3QHYA 2R9WA 2OLVA 1H5XA 2HDQA 2WGWA 3MXRA 3G32A 1NZOA 3PBRA 1DJAA 2WKHA 3BFEA 2EXBA 1ESUA 1KE4A 1PI4A 3DWKA 3MFDA 4QY5A 3UE0A 4N1HA 2P9VA 2HP5A 1XP4A 2X02A 4MBFA 5EOOA 3VFFA 1LI0A 3CMZA 3PAEA 1ZG4A 5FQIA 3BEBA 3Q82A 3IH9A 4KQOA 3W4QA 1BTLA 2A3UA 4FH4A 4S2LA 1SCWA 1HD8A 1BLSA 2Y2NA 3IHAA 2DRWA 2B5RA 5KSCA 5EVIB 4UA9A 5KMWA 5G18A 1U60A 4MBHA 3HLFA 3GSGA 1ONHA 4RYEA 3VOYA 1W8QA 2XF3A 4X56A 1JTDA 4S2NC 3VSLA 4OPZA 5AQ9A 1K54C 5A91A 5CTNA 2ZM8A 4EUZA 5L2FA 3OZHA 5GHZA 4S2IA 3UY6A 3OPRA 1CI8A 2HP6A 4U0XA 4OP5A 2V20A 3MKFA 4CJNA 4PM7A 2EFXA 1M6KA 3BLMA 4RX2A 4H8RA 4Y0UA 1FOFA 1VM1A 4LV1A 3IT9A 4OKPA 4R4SA 2C5WB 2HP9A 3Q7VB 4XXRA 1ZKJA 3D4FA 3GV9A 3OC2A 1BZAA 1GHPA 1W8YA 1TDLA 4N92A 4QU3A 3IHBA 5FQMA 3IXDA 2XFSA 1PIOA 4MEZA 1FQGA 2EFUA 4BD1A 4MLLA 5FA7A 5TR7A 1S0WA 1MY8A 3ZG8B 4IEDA 1NXYA 1MXOA 1CI9A 2EX9A 3UDXA 4EWFA 3UE1A 1K56A 2XLNA 4LCMA 3ZVTA 4P87A 3ZG5A 3Q7ZA 1MPLA 3P09A 4U0TA 2H0YA 5HAQA 1L0DA 4OLGA 2H0TA 1KVLA 3A3FA 3C5AA 3BYDA 2XQZA 1K6RA 3CJMA 2V2FF 5D3OA 4NK3A 3JYIA 5FQKA 1SHVA 4S2JA 3NC8A 4WEKA 1PYYA 4DXBA 3BFCA 4E3JA 3NIAA 1FCMA 1K56D 3PBNA 1BLPA 1PW8A 3LY4A 3M6BA 5FQJA 1S6RA 5BOHA 5FATA 3MZDA 4DE3A 3HLCA 5E2HA 3UN7A 3V5MA 5HARA 1LLBA 1ES5A 2WUQA 4OQ0A 2XH9A 4OLDA 3PBQA 1C3BA 4JXGA 3FV7A 3HUNA 4OOYA 2EX8A 5F1GA 1K4FA 3TG9A 1NRFA 1WE4A 1XGJA 3O88A 3G4PA 5CXWA 3ZG0A 1VQQA 1JVJA 5JYPA 1KGGA 2OSUA 3GRJA 3VOZA 1ES4A 4K0WA 2ZQ8A 3Q07A 1YMSA 1QMFA 1K38A 2Y2LA 3PTEA 2Y2HA 5GLAA 5EUAA 4KG6A 4CPKA 5FASA 4N9LA 4LV3A 5CHMA 4JXVA 4MBKA 3SS4A 4OOMA 1HZOA 4PPRA 5JYOA 4B88A 1ZG6A 3IWIA 1NYMA 4K0XA 4WZ5C 3HLEA 4IBRA 4E3MA 5EVIA 3MZEA 3B3XA 4X69A 3SH7A 3AGEA 3DWZA 3IXBA 5CHJA 2ZC3B 1M40A 4JLFA 5GHYA 3LCEA 3TSGA 4ID4A 1Q2PA 1SKFA 2XR0A 2J9PA 4DRTA 1YMXA 1W79A 4GB7A 3IF5A 4F94A 3GMWA 2WZZA 1JWZA 4WM9A 1L2SA 5EVID 1E4DA 1YT4A 1LL9A 5FQQA 1MWTA 3VP2A 4R1GA 1FSYA 1WYCA 5HL1A 3N8LA 4WYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSW A;  3G30 A;  4KZ3 A;  2QMI A;  1XKZ A;  4XUX A;  3ZNY A;  3HBR A;  1IEM A;  3IF6 A;  4N9K A;  1BSG A;  3HVF A;  4X6T A;  1IYQ A;  3ZG9 B;  5EEC A;  3WS4 A;  3BFD A;  3ITB A;  1YLP A;  1AXB A;  1SDN A;  4GNU A;  4PM6 A;  1ERO A;  4X53 A;  4OP8 A;  2WGI A;  2ZQ7 A;  4M3K A;  4IVI A;  3V3S A;  1SDE A;  2J9O A;  2XDM A;  3E2L A;  1OME A;  2Y2K A;  3DW0 A;  2WYX A;  4JPM A;  4R23 A;  5CTM A;  3UO9 A;  1K55 A;  2FFY A;  1PZO A;  4OQG A;  1XX2 A;  2PU4 A;  1W5D A;  3TOI A;  2PBY A;  2XGN A;  2Y4A A;  1KGF A;  5KSH A;  1XA1 A;  1G68 A;  1Z6F A;  2WZX A;  4KG5 A;  4NET A;  5CGX A;  1JTG A;  2WAF A;  1CEF A;  4IVK A;  4QHC A;  2PU2 A;  5E2E A;  5A93 A;  3SS5 A;  4GD8 A;  2Y91 A;  1PW1 A;  4GZB A;  4WBG A;  3BFG A;  5FAQ A;  3G34 A;  5DTT A;  3ZNT A;  4KZ7 A;  3SH9 A;  2HPB A;  4E3K A;  3HLD A;  5TGF A;  5GLD A;  2ZQA A;  1CEG A;  2XEP A;  3LEZ A;  1N4O A;  4U3T A;  1QME A;  3M2K A;  4OOL A;  4UA7 A;  1HTZ A;  3E2K A;  3LY3 A;  1N9B A;  1FR6 A;  3Q81 A;  2CC1 A;  4OQH A;  2G2U A;  4X55 A;  2HDR A;  3C4O A;  4GOG A;  4OVD A;  2H10 A;  3G31 A;  2BG1 A;  2XD1 A;  3OCN A;  2Q9N A;  1K57 C;  3MBZ A;  3HLB A;  2EX6 A;  2R9X A;  4XUZ A;  3P98 A;  3VFH A;  1NZU A;  5DF7 A;  4P0M A;  3PBT A;  4E3O A;  4BQM A;  5A92 A;  4JF5 A;  4S2P A;  4JBF A;  4JF6 A;  4OPQ A;  1BLC A;  2JE5 A;  3VMA A;  2WGW B;  3O87 A;  3NBL A;  1L0F A;  3GVB A;  4QD4 A;  3PBS A;  3HUM A;  5AQB A;  2G2W A;  4PM9 A;  3ZGA B;  3M2J A;  1WYB A;  1KE3 A;  1ESI A;  4K91 A;  4R4R A;  2VGK A;  3VSK A;  1JWV A;  1RP5 A;  1GHM A;  5M18 A;  3WRT A;  2OLU A;  1FCN A;  3OPH A;  4KZA A;  2Y2I A;  4UHU A;  1E25 A;  1FR1 A;  4WMC A;  3W4O A;  5F82 A;  3ZDJ A;  3DTM A;  4QJG A;  1LHY A;  3IWQ A;  4B4X A;  3N8R A;  4KZB A;  1IYS A;  3WRZ A;  3BFF A;  3NDG A;  3GR2 A;  3WWX A;  4KQR A;  4WEJ A;  3W4P A;  1O7E A;  3CZD A;  2ZM2 A;  1ALQ A;  2Y2G A;  5AQA A;  5HAP A;  2ZC5 B;  1RCJ A;  2Y2O A;  3G35 A;  3QNC A;  5CRF A;  3VP4 A;  4HBT A;  5U47 A;  3I7J A;  1NY0 A;  2IWC A;  3UDI A;  4PM8 A;  2X01 A;  5GHX A;  3QNB A;  4BJP A;  2J8Y A;  3UPO A;  4LV0 A;  4KZ8 A;  4WMC D;  4DE0 A;  2JC7 A;  1DJC A;  1TDG A;  3PBO A;  2WK0 A;  4P85 A;  2EX2 A;  3FKW A;  3NY4 A;  5A90 A;  1K6S A;  4KEN B;  3M6H A;  4DDS A;  3A3D A;  2VGJ A;  3BLS A;  4S2N A;  2WGV A;  2IWD A;  1K54 A;  2A49 A;  1ONG A;  1GCE A;  3ITA A;  1BT5 A;  1XGI A;  4E3L A;  5DF9 A;  2I72 A;  3HLW A;  2C6W B;  4Q8I A;  4LEN A;  2DNS A;  3S1Y A;  3ZHH A;  2Y59 A;  4RVA A;  1BUE A;  1EWZ A;  5M19 A;  1PWC A;  3MKE A;  5DTK A;  5HW3 A;  4PM5 A;  2RCX A;  3GQZ A;  3ZVW A;  3NDE A;  2QPN A;  4ZAM A;  1KDS A;  4QY6 A;  5CGS A;  2Y2P A;  4FD8 A;  3V50 A;  4GN2 A;  1EI5 A;  2V1Z A;  5CER A;  3UNW A;  5FI7 A;  2EXA A;  2ZQD A;  4X68 A;  3WS1 A;  5GL9 A;  1RGZ A;  3IXH A;  1IYO A;  4Y0O A;  3Q7V A;  3VP3 A;  3EQV A;  1IYP A;  4FH2 A;  3PAG A;  4EBL A;  1BUL A;  1JWP A;  1GA9 A;  4BL3 A;  2J7V A;  3FWL A;  3A3E A;  4C6Y A;  1ERM A;  2WAD A;  4ZBE A;  3RXW A;  1DY6 A;  1K25 A;  3UE3 A;  2DCF A;  4E6W A;  1RGY A;  3OPP A;  5CEB A;  4S2O A;  4D2O A;  1H8Z A;  1MWR A;  2ZC7 A;  4KZ5 A;  4R0Q A;  1YLY A;  2XFT A;  4C75 A;  2FFF B;  3HLG A;  3EQU A;  3IWO A;  3Q1F A;  1XA7 A;  3WS2 A;  2ZLY A;  1MWS A;  3AGF A;  4EQI A;  1LI9 A;  1YLT A;  1KDW A;  3HL9 A;  2ZJ9 A;  4S2M A;  5E2F A;  3MXS A;  5GLB A;  2IWB A;  3NCK A;  3SS3 A;  1IEL A;  1K4E A;  3W8K A;  2UWX A;  5GLC A;  4OQI A;  4LV2 A;  1H8Y A;  5DTS A;  5CHU A;  3HRE A;  3IXG A;  4YIN A;  2XD5 A;  1J9M A;  5E2G A;  5AQ7 A;  5F83 A;  3RXX A;  2ZC6 B;  1PWG A;  1BLH A;  4DF6 A;  3BEC A;  1MWU A;  3C4P A;  4EBP A;  1G6A A;  5FDH A;  3IH8 A;  4WZ5 A;  3IQA A;  4C3Q A;  2WKE A;  4KZ4 A;  4QB8 A;  3BM6 A;  4UAA A;  5EOE A;  4N1X A;  5DF8 A;  2Q9M A;  2QZ6 A;  5EVI C;  5IHV A;  3MZF A;  4KG2 A;  4LCL A;  5FAP A;  3C7U A;  1HVB A;  4B4Z A;  3A3I A;  1I5Q A;  2Z2M B;  1ZC2 A;  2H5S A;  4R3J A;  2JCH A;  4EV4 A;  2OV5 A;  1IKI A;  3UPP A;  4MNR A;  3IF6 B;  5EPH A;  5J8X A;  3NI9 A;  3A3J A;  3N8S A;  3ZCZ A;  3ZG7 B;  2P9V B;  5FSR A;  3RJU A;  1GHI A;  4L0L A;  3OPL A;  5FI6 A;  3N6I A;  1Q2Q A;  3S4X A;  1MBL A;  3HUO A;  4JXW A;  4BEN A;  1TEM A;  2GDN A;  4ZJ1 A;  1YQS A;  2RL3 A;  1YLW A;  1L0E A;  4E3I A;  4HEF A;  4BL2 A;  4YFM A;  3UDF A;  3ISG A;  4FCF A;  3VP1 A;  4IBX A;  3IF6 C;  1I2W A;  1XPB A;  1YM1 A;  2Y2Q A;  3AGD A;  3N7W A;  1LL5 A;  3V39 A;  3G2Y A;  1ERQ A;  4HES A;  4RX3 A;  2ZM0 A;  2Y55 A;  1O07 A;  3FYZ A;  4HBU A;  4DKI A;  3OCL A;  5F1F A;  1ES2 A;  4GD6 A;  2ZMA A;  2BLS A;  4JXS A;  4KZ6 A;  3VP0 A;  3LO7 A;  1KE0 A;  2XK1 A;  5I94 A;  4O7D A;  2ZQ9 A;  1MKI A;  3S22 A;  4ZDX A;  4BLM A;  1K55 C;  2WKI A;  4DE2 A;  1CK3 A;  2X71 A;  4FSF A;  4DE1 A;  4Y0T A;  1YLJ A;  4OPY A;  5FI2 A;  2JBF A;  4GKU A;  5HX9 A;  2Z2L B;  2WAE A;  2Y2J A;  4GDB A;  4P6B A;  1PZP A;  5FQ9 A;  4RA7 A;  2ZQC A;  4KZ9 A;  3N4I A;  1KGE A;  2ZC4 B;  5E43 A;  3CG5 A;  5M1A A;  1NJ4 A;  5EVL A;  2P74 A;  3WS0 A;  4E3N A;  1PWD A;  2HDS A;  3O3V A;  4E6X A;  4BD0 A;  2E8I A;  4OH0 A;  4GDN A;  3O86 A;  5EE8 A;  1XXM A;  3GTC A;  5HFO A;  3G2Z A;  1L0G A;  5KZH A;  3C7V A;  4JKT A;  4ZTK A;  1GA0 A;  1YLZ A;  3FKV A;  4KQQ A;  1ES3 A;  4WZ4 A;  1E3U A;  3WS5 A;  1K57 A;  4S2K A;  4ZJ3 A;  2HDU A;  5CGW A;  3BRM A;  4ZJ2 A;  1FCO A;  4R3B A;  1Y54 A;  4PMA A;  3FZC A;  5DVA A;  5HAI A;  4A5R A;  5CED A;  3SOI A;  4UA6 A;  4JF4 A;  1DJB A;  5TFQ A;  3ZFZ A;  4WEL A;  3SH8 A;  2Y2M A;  4OON A;  1IKG A;  1NYY A;  1TVF A;  5FAO A;  1E3U D;  5CEC A;  1PI5 A;  1I2S A;  4OPR A;  2ZD8 A;  4DXC A;  1KVM A;  4Y7P A;  4Z9Q A;  4EBN A;  4DDY A;  3UPN A;  3V3R A;  1W7F A;  3QHY A;  2R9W A;  2OLV A;  1H5X A;  2HDQ A;  2WGW A;  3MXR A;  3G32 A;  1NZO A;  3PBR A;  1DJA A;  2WKH A;  3BFE A;  2EXB A;  1ESU A;  1KE4 A;  1PI4 A;  3DWK A;  3MFD A;  4QY5 A;  3UE0 A;  4N1H A;  2P9V A;  2HP5 A;  1XP4 A;  2X02 A;  4MBF A;  5EOO A;  3VFF A;  1LI0 A;  3CMZ A;  3PAE A;  1ZG4 A;  5FQI A;  3BEB A;  3Q82 A;  3IH9 A;  4KQO A;  3W4Q A;  1BTL A;  2A3U A;  4FH4 A;  4S2L A;  1SCW A;  1HD8 A;  1BLS A;  2Y2N A;  3IHA A;  2DRW A;  2B5R A;  5KSC A;  5EVI B;  4UA9 A;  5KMW A;  5G18 A;  1U60 A;  4MBH A;  3HLF A;  3GSG A;  1ONH A;  4RYE A;  3VOY A;  1W8Q A;  2XF3 A;  4X56 A;  1JTD A;  4S2N C;  3VSL A;  4OPZ A;  5AQ9 A;  1K54 C;  5A91 A;  5CTN A;  2ZM8 A;  4EUZ A;  5L2F A;  3OZH A;  5GHZ A;  4S2I A;  3UY6 A;  3OPR A;  1CI8 A;  2HP6 A;  4U0X A;  4OP5 A;  2V20 A;  3MKF A;  4CJN A;  4PM7 A;  2EFX A;  1M6K A;  3BLM A;  4RX2 A;  4H8R A;  4Y0U A;  1FOF A;  1VM1 A;  4LV1 A;  3IT9 A;  4OKP A;  4R4S A;  2C5W B;  2HP9 A;  3Q7V B;  4XXR A;  1ZKJ A;  3D4F A;  3GV9 A;  3OC2 A;  1BZA A;  1GHP A;  1W8Y A;  1TDL A;  4N92 A;  4QU3 A;  3IHB A;  5FQM A;  3IXD A;  2XFS A;  1PIO A;  4MEZ A;  1FQG A;  2EFU A;  4BD1 A;  4MLL A;  5FA7 A;  5TR7 A;  1S0W A;  1MY8 A;  3ZG8 B;  4IED A;  1NXY A;  1MXO A;  1CI9 A;  2EX9 A;  3UDX A;  4EWF A;  3UE1 A;  1K56 A;  2XLN A;  4LCM A;  3ZVT A;  4P87 A;  3ZG5 A;  3Q7Z A;  1MPL A;  3P09 A;  4U0T A;  2H0Y A;  5HAQ A;  1L0D A;  4OLG A;  2H0T A;  1KVL A;  3A3F A;  3C5A A;  3BYD A;  2XQZ A;  1K6R A;  3CJM A;  2V2F F;  5D3O A;  4NK3 A;  3JYI A;  5FQK A;  1SHV A;  4S2J A;  3NC8 A;  4WEK A;  1PYY A;  4DXB A;  3BFC A;  4E3J A;  3NIA A;  1FCM A;  1K56 D;  3PBN A;  1BLP A;  1PW8 A;  3LY4 A;  3M6B A;  5FQJ A;  1S6R A;  5BOH A;  5FAT A;  3MZD A;  4DE3 A;  3HLC A;  5E2H A;  3UN7 A;  3V5M A;  5HAR A;  1LLB A;  1ES5 A;  2WUQ A;  4OQ0 A;  2XH9 A;  4OLD A;  3PBQ A;  1C3B A;  4JXG A;  3FV7 A;  3HUN A;  4OOY A;  2EX8 A;  5F1G A;  1K4F A;  3TG9 A;  1NRF A;  1WE4 A;  1XGJ A;  3O88 A;  3G4P A;  5CXW A;  3ZG0 A;  1VQQ A;  1JVJ A;  5JYP A;  1KGG A;  2OSU A;  3GRJ A;  3VOZ A;  1ES4 A;  4K0W A;  2ZQ8 A;  3Q07 A;  1YMS A;  1QMF A;  1K38 A;  2Y2L A;  3PTE A;  2Y2H A;  5GLA A;  5EUA A;  4KG6 A;  4CPK A;  5FAS A;  4N9L A;  4LV3 A;  5CHM A;  4JXV A;  4MBK A;  3SS4 A;  4OOM A;  1HZO A;  4PPR A;  5JYO A;  4B88 A;  1ZG6 A;  3IWI A;  1NYM A;  4K0X A;  4WZ5 C;  3HLE A;  4IBR A;  4E3M A;  5EVI A;  3MZE A;  3B3X A;  4X69 A;  3SH7 A;  3AGE A;  3DWZ A;  3IXB A;  5CHJ A;  2ZC3 B;  1M40 A;  4JLF A;  5GHY A;  3LCE A;  3TSG A;  4ID4 A;  1Q2P A;  1SKF A;  2XR0 A;  2J9P A;  4DRT A;  1YMX A;  1W79 A;  4GB7 A;  3IF5 A;  4F94 A;  3GMW A;  2WZZ A;  1JWZ A;  4WM9 A;  1L2S A;  5EVI D;  1E4D A;  1YT4 A;  1LL9 A;  5FQQ A;  1MWT A;  3VP2 A;  4R1G A;  1FSY A;  1WYC A;  5HL1 A;  3N8L A;  4WYY A; 
#chains in the Genus database with same CATH topology
 1H8M A;  2QMI A;  3ZNY A;  1IEM A;  4N9K A;  3BFD A;  3ITB A;  2K7S A;  1ERO A;  1OME A;  5CTM A;  2WYX A;  3K2N A;  4JGP A;  1XX2 A;  2PBY A;  3NHQ A;  1KGF A;  2V8C A;  1G68 A;  2WZX A;  2WAF A;  5EM1 A;  2W1T A;  4QHC A;  2PR6 A;  5A93 A;  4GD8 A;  3QP4 A;  3C30 A;  5DTT A;  3ZNT A;  5TGF A;  2HJ9 C;  1N4O A;  4QPR A;  3M2K A;  3E2K A;  5LBR A;  3LIE A;  1N9B A;  3Q81 A;  2G2U A;  3C4O A;  4BBU A;  1K57 C;  1OTI A;  1CJF A;  4XUZ A;  4P0M A;  4HJ3 A;  5A92 A;  3CPT B;  5DKL A;  2OWH A;  2WGW B;  5F68 A;  3PBS A;  4EXO A;  5AQB A;  4PM9 A;  3M2J A;  1WYB A;  1KE3 A;  4GCZ A;  4K91 A;  4R4R A;  3C38 A;  3WRT A;  3OPH A;  4KZA A;  3S7N A;  2PYR A;  1E25 A;  3NDG A;  3GR2 A;  5G4Y A;  2KLI A;  5HDC A;  5AQA A;  1FIL A;  1RCJ A;  2Y2O A;  2ZC5 B;  1F9I A;  5U47 A;  3UDI A;  4GLQ A;  4F3L B;  3PBO A;  4EQ1 A;  2OOL A;  3OLO A;  2WK0 A;  3T1Q B;  3FKW A;  2BTF P;  1K6S A;  4KEN B;  3BLS A;  2R78 A;  5EV0 A;  4BWI A;  1MZU A;  1BT5 A;  5IU1 A;  3K3D A;  3HLW A;  4Q8I A;  1F98 A;  2DNS A;  1TS7 A;  2PHY A;  2QYB A;  2Y59 A;  3VV4 A;  1PWC A;  3LIA A;  5DFY A;  4PM5 A;  2RCX A;  3A0S A;  3NDE A;  2QPN A;  4I3A A;  4ZAM A;  2Y2P A;  1EI5 A;  3UNW A;  5FI7 A;  3NEC A;  2ZQD A;  5A8B A;  5GL9 A;  1RGZ A;  3MMH A;  4Y0O A;  3Q7V A;  1F2K A;  3CAX A;  3PAG A;  3CUE A;  2HZ5 A;  1S4R A;  3A3E A;  4C6Y A;  2WAD A;  4NXG A;  3OPP A;  2OWJ A;  5CX7 A;  4S2O A;  1X0O A;  3JVU A;  2ZC7 A;  4R0Q A;  2XFT A;  2FFF B;  4ARZ A;  3IBJ A;  3HLG A;  3EQU A;  3IWO A;  3Q1F A;  5IT5 A;  3WS2 A;  2P04 A;  1OTD A;  1OTE A;  3W8K A;  2UWX A;  3S7O A;  4LV2 A;  5EFW A;  5CHU A;  2XD5 A;  5AQ7 A;  3RXX A;  2ZC6 B;  1PWG A;  1STZ A;  4UAA A;  1DP8 A;  1DRM A;  4N1X A;  3O5Y A;  5IHV A;  4F3L A;  4B4Z A;  3C7U A;  4L9G A;  1I5Q A;  3QP2 A;  3UPP A;  5EPH A;  3IBR A;  2M7V A;  5J8X A;  4O8G A;  3A3J A;  2P9V B;  5FSR A;  1GHI A;  3N6I A;  3S4X A;  1MBL A;  3HUO A;  2W3D A;  2OAP 1;  1D06 A;  4BL2 A;  3F1O A;  3VP1 A;  1I2W A;  1YM1 A;  3BY8 A;  1ACF A;  2Q0O A;  4RX3 A;  1O07 A;  3FYZ A;  3OCL A;  4GD6 A;  2ZMA A;  2BLS A;  4KZ6 A;  5I94 A;  3MR0 A;  4O7D A;  1MKI A;  3S22 A;  3D72 A;  2FH5 A;  2WKI A;  2W3E A;  4WN5 A;  4DE1 A;  5FI2 A;  2Z2L B;  2Y2J A;  2ZQC A;  4KZ9 A;  3N4I A;  2ZC4 B;  1A0K A;  1PWD A;  3H7W A;  4GDN A;  1XXM A;  5HFO A;  4I3J A;  5CGW A;  2LB9 A;  5DFX A;  1OJ5 A;  2JN7 A;  4G3W A;  3OBF A;  2L0W A;  1IKG A;  1TVF A;  1PI5 A;  4MN5 A;  2ZD8 A;  4Y7P A;  4EBN A;  4DDY A;  3QHY A;  4JGQ A;  2R9W A;  1L3L A;  2OLV A;  1H5X A;  3G32 A;  3PBR A;  3BFE A;  1KE4 A;  3UE0 A;  2P9V A;  3SZT A;  4MBF A;  1OTA A;  3KYQ A;  4Q0J A;  5FQI A;  3BEB A;  4KQO A;  1BTL A;  2A3U A;  2XRO A;  1BLS A;  1S66 L;  4JGO A;  5EVI B;  4UA9 A;  5EM0 A;  5HD3 A;  4MBH A;  4HNB A;  2XF3 A;  1JTD A;  4OPZ A;  5AQ9 A;  3T4J A;  2PD8 A;  2HP6 A;  1ZHH B;  3EOI A;  1M6K A;  4H8R A;  2D01 A;  4LV1 A;  4OKP A;  2C5W B;  5FEF A;  1BZA A;  1W8Y A;  1TDL A;  3IHB A;  2KOI A;  2XFS A;  4BD1 A;  4MEZ A;  1FQG A;  1LT0 A;  1S0W A;  1MY8 A;  1NXY A;  1SKO B;  1MXO A;  1CI9 A;  1N9N A;  2EX9 A;  3UME A;  3UE1 A;  4LCM A;  3T4T A;  5TBM B;  3ZG5 A;  2YKF A;  1V9Z A;  3CUE C;  4LRY C;  2W1R A;  4NK3 A;  3JYI A;  5HWW A;  4E3J A;  5FQJ A;  1S6R A;  3MZD A;  5HWT A;  3V5M A;  1LLB A;  4OLD A;  4KUK A;  3FV7 A;  5FL3 A;  4QWO A;  3MFX A;  1VQQ A;  2INW A;  1JVJ A;  1KGG A;  3GRJ A;  4K0W A;  4PAU A;  3TRC A;  2V0W A;  2Y2H A;  4KG6 A;  5F5Y A;  3MJQ A;  3SS4 A;  4LFU A;  1ZG6 A;  1V9Y A;  5EVI A;  2V1A A;  4X1M A;  3DWZ A;  1FIK A;  1T1B A;  1M40 A;  2V0U A;  3IX8 A;  1JWZ A;  1F5M A;  5EVI D;  1YT4 A;  1LL9 A;  3KSH A;  3G30 A;  4KZ3 A;  4X25 A;  3IX3 A;  2P7J A;  2QWS A;  1IYQ A;  3IS2 B;  1T19 A;  3WS4 A;  1SKO A;  4X53 A;  4OP8 A;  4M3K A;  5HD5 A;  2J9O A;  3U2A A;  2A24 A;  4OQG A;  1W5D A;  5L09 A;  1Z6F A;  1JTG A;  1CEF A;  4BMW A;  2ZOH A;  3MQ0 A;  4WBG A;  3BFG A;  2VV8 A;  3G34 A;  3SH9 A;  5K5B A;  5GLD A;  2ZQA A;  1CEG A;  3S7P A;  3LEZ A;  4U3T A;  2PD7 A;  4HI4 A;  2UV0 E;  4OQH A;  4X55 A;  3OCN A;  4X1L A;  2Q9N A;  2EX6 A;  3P98 A;  4IHQ A;  3VFH A;  1NZU A;  4BQM A;  4S2P A;  1OT9 A;  4JBF A;  4OPQ A;  2JE5 A;  1L0F A;  3GVB A;  3UB9 A;  3H82 B;  4QD4 A;  4E04 A;  2G2W A;  3ZGA B;  4R3A A;  2VGK A;  2MJ6 A;  3VSK A;  1YSP A;  3NUL A;  3A0V A;  1JWV A;  1GHM A;  5M18 A;  2OLU A;  1FCN A;  3W4O A;  5F82 A;  3DTM A;  3IWQ A;  2JKR I;  1IYS A;  3WRZ A;  3BFF A;  3W4P A;  3CZD A;  3LIF A;  1ALQ A;  3HJI A;  1NY0 A;  4Q0H A;  2X01 A;  5GHX A;  3QNB A;  4BJP A;  2J8Y A;  3MS6 A;  3UPO A;  1DJC A;  1TDG A;  4O0P A;  3A0R A;  4P85 A;  2EX2 A;  3PR6 A;  5A90 A;  5DJU A;  4S2N A;  5IS1 A;  3IS2 A;  2A49 A;  1ONG A;  1G5U A;  4E3L A;  5DF9 A;  2I72 A;  4LRZ E;  2M1C A;  4LEN A;  5HWV A;  2ZL1 A;  4G3K A;  3S1Y A;  4RVA A;  5MC7 A;  3V50 A;  4FD8 A;  3DTK A;  3BQ8 A;  2V1Z A;  5HDS A;  4X68 A;  3KYE A;  3WS1 A;  2GX5 A;  3IXH A;  1IYO A;  2HF6 A;  3VP3 A;  3EQV A;  1GA9 A;  4BL3 A;  5G4Z A;  1CF0 A;  3UB6 A;  3MF0 A;  3UB5 P;  3ULF A;  1DY6 A;  2JKR M;  1K25 A;  2DCF A;  2I9V A;  2JKG A;  5CEB A;  4HJ6 A;  2QJ5 A;  1MWR A;  3QP8 A;  2HJE A;  2GZA A;  1YLY A;  4C75 A;  3H82 A;  5F6A A;  3HL9 A;  4S2M A;  3R4K A;  4Y15 A;  5GLB A;  3SS3 A;  1IEL A;  4OQI A;  4GS9 B;  3IXG A;  1LSX A;  3D9Y A;  5F83 A;  3ZQ5 A;  3E0Y A;  4DF6 A;  1MWU A;  3ZYT A;  2L4R A;  1G6A A;  5FDH A;  3IH8 A;  3P01 A;  4QB8 A;  5EOE A;  2QZ6 A;  5EVI C;  3MZF A;  4LCL A;  1K0K A;  2Z2M B;  4NXF A;  2ZOI A;  4EV4 A;  3VOL A;  3BW6 A;  1LSW A;  3IF6 B;  3F1P B;  3NI9 A;  3RJU A;  3K3C A;  5FI6 A;  2V1B A;  2B95 A;  3PHY A;  1YLW A;  1L0E A;  2KX6 A;  3E98 A;  4HHD A;  3N7W A;  3G2Y A;  4NXE A;  2ZM0 A;  2Y55 A;  5F1F A;  1ES2 A;  5HSQ A;  3MQO A;  2W3H A;  3BJN A;  3LO7 A;  2EWV A;  4BLM A;  2E8J A;  3V67 A;  1D1J A;  4LPZ A;  1CK3 A;  4II7 A;  4FSF A;  4Y0T A;  4MCW A;  2GNX A;  5HX9 A;  5FQ9 A;  1EW0 A;  1NLZ A;  3T4L A;  1KGE A;  3CG5 A;  5M1A A;  1NJ4 A;  3UB8 A;  2P74 A;  3O3V A;  4BD0 A;  3E4Q A;  1GSX A;  4OH0 A;  3O86 A;  2BAS A;  3GTC A;  4XT2 B;  1L0G A;  1T1C A;  4WZ4 A;  3WS5 A;  2HDU A;  1FCO A;  1DP6 A;  3KSF A;  4PMA A;  5CED A;  4JF4 A;  1DJB A;  5TFQ A;  3ZFZ A;  4WEL A;  1NYY A;  2J80 A;  3T4Q A;  5FAO A;  1YKD A;  2K31 A;  4HP4 A;  3R7W B;  4OPR A;  1KVM A;  4Z9Q A;  3UPN A;  1IOU A;  1W7F A;  3CPT A;  2WGW A;  1NZO A;  1DJA A;  2WKH A;  2EXB A;  1PI4 A;  3MFD A;  4P6Z M;  3F1P A;  2HP5 A;  2X02 A;  3VFF A;  3PAE A;  1ZG4 A;  4FH4 A;  1HD8 A;  3EWK A;  2B5R A;  5C5K A;  5KMW A;  1U60 A;  4RYE A;  1W8Q A;  4S2N C;  5A91 A;  3OZH A;  2W0N A;  4U0X A;  2V20 A;  3MKF A;  2VKS A;  4RX2 A;  3IT9 A;  4HH3 A;  1ZKJ A;  3D4F A;  3GV9 A;  2W3G A;  3IXD A;  4UEY A;  5FA7 A;  4GW9 A;  4EWF A;  4G3V A;  2W3F A;  3LUQ A;  2O9A A;  2H28 A;  2H0Y A;  3MXQ A;  3NOP C;  3A3F A;  2XQZ A;  1K6R A;  4BBT A;  4EET B;  5FQK A;  3S7Q A;  3NC8 A;  1FCM A;  3LR4 A;  3PBN A;  1PW8 A;  1OT6 A;  3LY4 A;  3M6B A;  5BOH A;  3HLC A;  3UN7 A;  5FDS A;  5HAR A;  2Z6D A;  1ES5 A;  2WUQ A;  3T1X A;  5F1G A;  3G4P A;  5CXW A;  1PRQ A;  1PNE A;  3Q07 A;  5F69 A;  3CLO A;  1QMF A;  3PTE A;  5KIZ A;  4JXV A;  3T4K A;  3HCY A;  5HZH A;  1HZO A;  1G6O A;  4B88 A;  3IWI A;  1NYM A;  3HLE A;  4IBR A;  4X69 A;  5CHJ A;  2J3T D;  2ZC3 B;  3LCE A;  2XR0 A;  1Y4O A;  4GHI B;  1W79 A;  3IF5 A;  4F94 A;  3LIB A;  1MWT A;  4R1G A;  4WYY A;  3B47 A;  3KSI A;  1XKZ A;  4B9O A;  2O9B A;  3HBR A;  4ETZ A;  1OTB A;  4X6T A;  4MDZ A;  3ZG9 B;  1SDN A;  4PM6 A;  2IA2 A;  2WGI A;  2ZQ7 A;  1Z09 A;  4IVI A;  4NG2 A;  1SDE A;  3E2L A;  3UO9 A;  1K55 A;  3TOI A;  2YKH A;  1XA1 A;  4NET A;  4KG5 A;  1VHM A;  2JHE A;  3SS5 A;  3UMD A;  1PW1 A;  2HGV A;  4MN7 A;  3EGD C;  4GZB A;  1PFL A;  1ODV A;  4KZ7 A;  1H3Q A;  4E3K A;  3HLD A;  2XEP A;  1QME A;  3LY3 A;  2CC1 A;  2HDR A;  4OVD A;  2H10 A;  2BG1 A;  3TE8 A;  2AVX A;  1OPX A;  3MBZ A;  2R9X A;  4ME4 A;  5DF7 A;  4E3O A;  1BLC A;  4EW7 A;  3JVV A;  3O87 A;  3NBL A;  4NXB A;  1ESI A;  1P9W A;  4UQI S;  1RP5 A;  2HV1 A;  4WMC A;  3ZDJ A;  1OJG A;  4QJG A;  1LHY A;  4B4X A;  4KZB A;  4WEJ A;  1O7E A;  4HOI A;  2ZM2 A;  1P97 A;  3G35 A;  5CRF A;  4PM8 A;  1DP9 A;  1UWN X;  4LV0 A;  3LR0 A;  4KZ8 A;  4WMC D;  4DE0 A;  2Z6C A;  3QP5 A;  3NY4 A;  2V8F A;  3A3D A;  2WGV A;  4HIA A;  3ITA A;  2PAV P;  3JPU A;  4EES A;  1WA9 A;  2C6W B;  4DN0 A;  4I38 A;  3LIC A;  2DMW A;  3ZHH A;  5M19 A;  3MKE A;  5HPF A;  2PT7 A;  3ZVW A;  5CGS A;  4GN2 A;  3RH8 B;  4FH2 A;  1JWP A;  5HL6 A;  2J7V A;  1S4S A;  1ERM A;  2K2N A;  4ZBE A;  3ICY A;  3UE3 A;  4E6W A;  1RGY A;  3B33 A;  2WKR A;  4D2O A;  4KQD A;  5TBM A;  3LR3 A;  5L8M A;  1XA7 A;  4R6L A;  2ZLY A;  1MWS A;  3AGF A;  4YWZ A;  1KOU A;  1LI9 A;  1YLT A;  4I39 A;  3KYZ A;  3NCK A;  1K4E A;  5GLC A;  4HY8 A;  1P9R A;  4HH2 A;  3HRE A;  1J3W A;  5DTS A;  1NLY A;  1G28 A;  1J9M A;  1VEU B;  1H0M A;  1BLH A;  2VGL S;  3BEC A;  3TW8 A;  3IQA A;  2WKE A;  4KZ4 A;  2D02 A;  3BM6 A;  5DF8 A;  2Q9M A;  2W27 A;  4H6J B;  2H5S A;  4R3J A;  2A2L A;  2OV5 A;  1IKI A;  2JKT M;  1N9O A;  2QJ7 A;  4O01 A;  3N8S A;  3LR5 A;  3ZCZ A;  3ZG7 B;  5HPI A;  4HQA A;  4L0L A;  1Q2Q A;  4JXW A;  4Y13 A;  4ZJ1 A;  1YQS A;  4YFM A;  4DJ3 A;  3VE3 A;  1N9L A;  2NUP C;  2Y2Q A;  2B18 A;  3AGD A;  3HJK A;  3V39 A;  1ERQ A;  2O9C A;  4HES A;  2W1T B;  4HBU A;  4UQI M;  2XK1 A;  2FZ0 A;  2ZQ9 A;  3UE6 A;  1K55 C;  4DE2 A;  2X71 A;  1SZV A;  1YLJ A;  4YNR A;  2G7U A;  4GKU A;  3FPW A;  1T18 A;  4P6B A;  4RA7 A;  5E43 A;  3WS0 A;  2PBD P;  2PR5 A;  3W2Z A;  3E4O A;  1XFN A;  5EE8 A;  3G2Z A;  4JKT A;  4IUK A;  4Y5F A;  4ZTK A;  3FKV A;  1ES3 A;  3UB7 A;  4S2K A;  4ZJ3 A;  1TS0 A;  4R3B A;  1Y54 A;  2WKP A;  5DVA A;  3SOI A;  4UA6 A;  1VET B;  3NOU C;  4P6Z S;  2VLG A;  2WKQ A;  3SH8 A;  2Y2M A;  4OON A;  2VJW A;  4B93 A;  1I2S A;  1TF1 A;  4CQH A;  2QKP A;  3V3R A;  1UGU A;  2HDQ A;  4R38 A;  3MXR A;  1ESU A;  4QY5 A;  5EOO A;  4PKY G;  3CMZ A;  1S67 L;  3W4Q A;  4NEE D;  2DRW A;  2LB5 A;  5TJJ A;  1ONH A;  2ZBB A;  4X56 A;  3VSL A;  3DTI A;  1W63 Q;  2VX8 A;  4EUV A;  5CTN A;  4EUZ A;  5L2F A;  5GHZ A;  3OPR A;  3T1R A;  4OP5 A;  4CJN A;  2VK3 A;  4Y0U A;  4R4S A;  1MKM A;  3Q7V B;  4XXR A;  3CWF A;  1Y28 A;  2VGL M;  3OC2 A;  1GHP A;  4N92 A;  4QU3 A;  1PIO A;  1NWZ A;  2PRF A;  3ZG8 B;  4IED A;  3NOT C;  2XLN A;  4CLC B;  3P09 A;  4U0T A;  4OLG A;  1KVL A;  4ARZ B;  3C5A A;  2V2F F;  1SHV A;  4WEK A;  1PYY A;  4BBV A;  3BFC A;  3NIA A;  1BYW A;  4EER A;  5AVF A;  2JKF A;  1VET A;  2EWW A;  2J3W A;  5E2H A;  4OQ0 A;  3PBQ A;  1C3B A;  4JXG A;  3HUN A;  3LFV A;  3GDI A;  5DKK A;  1NRF A;  1WE4 A;  3TG9 A;  3O88 A;  2OSU A;  1ES4 A;  2ZQ8 A;  1YMS A;  2Y2L A;  3L7H A;  4Q0I A;  5EUA A;  3NJA A;  5CHM A;  4WLA A;  4PPR A;  4E3M A;  4GS9 A;  4CLC E;  3B3X A;  3AGE A;  3H9W A;  4EU0 A;  3TSG A;  4ID4 A;  1Q2P A;  2J9P A;  4DRT A;  3QP1 A;  4LGW A;  3F1O B;  4WM9 A;  1L2S A;  3LI8 A;  1E4D A;  3CI6 A;  3VP2 A;  1FSY A;  3E4P A;  1FSW A;  4XUX A;  1CQA A;  3IF6 A;  1BSG A;  3HVF A;  5EEC A;  1YLP A;  1AXB A;  4GNU A;  3T4S A;  4LLO B;  3V3S A;  2XDM A;  2Y2K A;  3DW0 A;  3T50 A;  4JPM A;  4R23 A;  4CLC A;  2FFY A;  1PZO A;  4DMZ A;  1MC0 A;  2PU4 A;  5KSH A;  2VV7 A;  2XGN A;  2Y4A A;  5CGX A;  4IVK A;  3H7W B;  4L9E A;  2PU2 A;  3C8C A;  5E2E A;  4K08 A;  1XFQ A;  3LYX A;  1W63 M;  2Y91 A;  3TJZ C;  5FAQ A;  2VEA A;  3LID A;  3EEA A;  4CLC D;  5I5L A;  2HPB A;  2Y8H A;  2P08 A;  2OAQ 1;  4OOL A;  4UA7 A;  1HTZ A;  1FR6 A;  4GOG A;  3G31 A;  2XD1 A;  2KDK A;  3HLB A;  3MQQ A;  1XJ4 A;  3PBT A;  4JF5 A;  4Y3I A;  4JF6 A;  3DAV A;  4XT2 A;  3VMA A;  3PXP A;  3HUM A;  3G6O A;  4UHU A;  2Y2I A;  1T1A A;  1FR1 A;  3N8R A;  3F1N B;  3WWX A;  4ESP A;  4KQR A;  3SW1 A;  3R7W A;  2Y2G A;  5HAP A;  3VP4 A;  1TS6 A;  3QNC A;  4HBT A;  4M4X A;  3I7J A;  2IWC A;  3PYP A;  4Z1W A;  2JC7 A;  3OOV A;  4I5S A;  3M6H A;  4DDS A;  2VGJ A;  2IWD A;  1NRJ A;  1K54 A;  4FTX A;  5AJG A;  1GCE A;  3T12 B;  3KSG A;  1XGI A;  2EA9 A;  3BQA A;  4WL9 A;  4KUO A;  4YOF A;  1BUE A;  1EWZ A;  1YAX A;  3BWL A;  5DTK A;  4EEU A;  3DBA A;  5HW3 A;  3GQZ A;  1KDS A;  4QY6 A;  1LL8 A;  3FG8 A;  1D7E A;  4PHT A;  5EVE A;  5CER A;  2V9A A;  2EXA A;  3CIT A;  1IYP A;  1TD5 A;  4EBL A;  1BUL A;  3FWL A;  3T1S A;  3RXW A;  3U4L P;  3IX4 A;  1H8Z A;  1TS8 A;  4KZ5 A;  3RTY A;  1S1Z A;  4EQI A;  1KDW A;  2ZJ9 A;  5E2F A;  1ZTU A;  3MXS A;  4LRX C;  2VZW A;  2IWB A;  1YSQ A;  4DJ2 A;  1H8Y A;  3FPV A;  4YIN A;  3F1N A;  5E2G A;  2ZMV A;  3C4P A;  4EBP A;  1IFQ A;  4WZ5 A;  4C3Q A;  4KG2 A;  5FAP A;  3VE4 A;  1HVB A;  3A3I A;  1ZC2 A;  2JCH A;  4MNR A;  4FUW A;  5L07 A;  3OPL A;  4BEN A;  1TEM A;  2GDN A;  2O99 A;  2M7U A;  2RL3 A;  4GHI A;  4E3I A;  4HEF A;  3UDF A;  3ISG A;  4FCF A;  2A24 B;  4AFI A;  4IBX A;  3IF6 C;  2XA7 S;  1XPB A;  5J7E A;  3EEH A;  4IJG A;  1LL5 A;  4MN6 A;  4DKI A;  2QHK A;  5J4E A;  4JXS A;  3VP0 A;  1KE0 A;  3FC7 A;  4D60 A;  4ZDX A;  1AWI A;  4CLC C;  4GJ4 A;  3T4O A;  4IUH A;  4OPY A;  2VV6 A;  2JBF A;  2WAE A;  4GDB A;  1LSV A;  1PZP A;  5EVL A;  4E3N A;  2HDS A;  4E6X A;  2E8I A;  3GEC A;  1XJ3 A;  3LGO A;  3RFB A;  3C7V A;  5KZH A;  1GA0 A;  1YLZ A;  4KQQ A;  1E3U A;  1K57 A;  3BRM A;  4NKP A;  2JKT I;  4ZJ2 A;  5HAI A;  3FZC A;  4A5R A;  5HDD A;  4PKY A;  1YPR A;  1S1Y A;  1UWP X;  1HLU P;  1E3U D;  5CEC A;  5AVE A;  4DXC A;  4WUJ A;  4JGR A;  5DJT A;  3LEQ A;  3DWK A;  4N1H A;  1XP4 A;  1LI0 A;  3Q82 A;  3IH9 A;  4S2L A;  1SCW A;  3IHA A;  2Y2N A;  5KSC A;  5G18 A;  3HLF A;  3GSG A;  2J3T C;  3DTE A;  3VOY A;  2XSS A;  2ZL1 B;  2NUT C;  3P7N A;  4I3I A;  1K54 C;  5L10 A;  2ZM8 A;  4S2I A;  3UY6 A;  1CI8 A;  4FOF A;  1XJ2 A;  1JNU A;  4WF0 A;  4PM7 A;  2EFX A;  3BLM A;  4ETX A;  1FOF A;  1VM1 A;  2HP9 A;  4Y2F A;  3B42 A;  4MMN A;  5FQM A;  1VB6 A;  3MSH A;  2EFU A;  3KX0 X;  3D3O A;  4MLL A;  5TR7 A;  2L1M A;  1P0Z A;  3UDX A;  2VA0 A;  3EGX C;  3L9K A;  1K56 A;  3ZVT A;  4P87 A;  3Q7Z A;  1MPL A;  2PYP A;  5HAQ A;  1L0D A;  4HJ4 A;  2H0T A;  5J3W A;  2ACG A;  2PDR A;  3CJM A;  3BYD A;  1XJ6 A;  2B02 A;  5D3O A;  4S2J A;  4DXB A;  3LI9 A;  1K56 D;  1BLP A;  2O0Y A;  5FAT A;  4DE3 A;  4HP9 A;  5FEG A;  2CMN A;  2XA7 M;  2XH9 A;  2XRN A;  4OOY A;  3BY9 A;  4Y17 A;  2EX8 A;  4RQ9 A;  1K4F A;  1XGJ A;  3ZG0 A;  2Y79 A;  5JYP A;  3VOZ A;  3QP6 A;  1GSV A;  3KO6 A;  4R70 A;  1K38 A;  5GLA A;  4CPK A;  5FAS A;  4N9L A;  4LV3 A;  4MBK A;  4ZRR A;  4EEP A;  3CHW P;  4OOM A;  5JYO A;  1GSW A;  4K0X A;  4WZ5 C;  3MZE A;  3SH7 A;  3IXB A;  1VEU A;  4JLF A;  5GHY A;  1SKF A;  2ZMF A;  1YMX A;  4GB7 A;  3C2W A;  3GMW A;  4L9F A;  2WZZ A;  2GJ3 A;  5FQQ A;  1WYC A;  5HL1 A;  3N8L A;  4H6J A; 
#chains in the Genus database with same CATH homology
 1FSW A;  3G30 A;  4KZ3 A;  2QMI A;  1XKZ A;  4XUX A;  3ZNY A;  3HBR A;  1IEM A;  3IF6 A;  4N9K A;  1BSG A;  3HVF A;  4X6T A;  1IYQ A;  3ZG9 B;  5EEC A;  3WS4 A;  3BFD A;  3ITB A;  1YLP A;  1AXB A;  1SDN A;  4GNU A;  4PM6 A;  1ERO A;  4X53 A;  4OP8 A;  2WGI A;  2ZQ7 A;  4M3K A;  4IVI A;  3V3S A;  1SDE A;  2J9O A;  2XDM A;  3E2L A;  1OME A;  2Y2K A;  3DW0 A;  2WYX A;  4JPM A;  4R23 A;  5CTM A;  3UO9 A;  1K55 A;  2FFY A;  1PZO A;  4OQG A;  1XX2 A;  2PU4 A;  1W5D A;  3TOI A;  2PBY A;  2XGN A;  2Y4A A;  1KGF A;  5KSH A;  1XA1 A;  1G68 A;  1Z6F A;  2WZX A;  4KG5 A;  4NET A;  5CGX A;  1JTG A;  2WAF A;  1CEF A;  4IVK A;  4QHC A;  2PU2 A;  5E2E A;  5A93 A;  3SS5 A;  4GD8 A;  2Y91 A;  1PW1 A;  4GZB A;  4WBG A;  3BFG A;  5FAQ A;  3G34 A;  5DTT A;  3ZNT A;  4KZ7 A;  3SH9 A;  2HPB A;  4E3K A;  3HLD A;  5TGF A;  5GLD A;  2ZQA A;  1CEG A;  2XEP A;  3LEZ A;  1N4O A;  4U3T A;  1QME A;  3M2K A;  4OOL A;  4UA7 A;  1HTZ A;  3E2K A;  3LY3 A;  1N9B A;  1FR6 A;  3Q81 A;  2CC1 A;  4OQH A;  2G2U A;  4X55 A;  2HDR A;  3C4O A;  4GOG A;  4OVD A;  2H10 A;  3G31 A;  2BG1 A;  2XD1 A;  3OCN A;  2Q9N A;  1K57 C;  3MBZ A;  3HLB A;  2EX6 A;  2R9X A;  4XUZ A;  3P98 A;  3VFH A;  1NZU A;  5DF7 A;  4P0M A;  3PBT A;  4E3O A;  4BQM A;  5A92 A;  4JF5 A;  4S2P A;  4JBF A;  4JF6 A;  4OPQ A;  1BLC A;  2JE5 A;  3VMA A;  2WGW B;  3O87 A;  3NBL A;  1L0F A;  3GVB A;  4QD4 A;  3PBS A;  3HUM A;  5AQB A;  2G2W A;  4PM9 A;  3ZGA B;  3M2J A;  1WYB A;  1KE3 A;  1ESI A;  4K91 A;  4R4R A;  2VGK A;  3VSK A;  1JWV A;  1RP5 A;  1GHM A;  5M18 A;  3WRT A;  2OLU A;  1FCN A;  3OPH A;  4KZA A;  2Y2I A;  4UHU A;  1E25 A;  1FR1 A;  4WMC A;  3W4O A;  5F82 A;  3ZDJ A;  3DTM A;  4QJG A;  1LHY A;  3IWQ A;  4B4X A;  3N8R A;  4KZB A;  1IYS A;  3WRZ A;  3BFF A;  3NDG A;  3GR2 A;  3WWX A;  4KQR A;  4WEJ A;  3W4P A;  1O7E A;  3CZD A;  2ZM2 A;  1ALQ A;  2Y2G A;  5AQA A;  5HAP A;  2ZC5 B;  1RCJ A;  2Y2O A;  3G35 A;  3QNC A;  5CRF A;  3VP4 A;  4HBT A;  5U47 A;  3I7J A;  1NY0 A;  2IWC A;  3UDI A;  4PM8 A;  2X01 A;  5GHX A;  3QNB A;  4BJP A;  2J8Y A;  3UPO A;  4LV0 A;  4KZ8 A;  4WMC D;  4DE0 A;  2JC7 A;  1DJC A;  1TDG A;  3PBO A;  2WK0 A;  4P85 A;  2EX2 A;  3FKW A;  3NY4 A;  5A90 A;  1K6S A;  4KEN B;  3M6H A;  4DDS A;  3A3D A;  2VGJ A;  3BLS A;  4S2N A;  2WGV A;  2IWD A;  1K54 A;  2A49 A;  1ONG A;  1GCE A;  3ITA A;  1BT5 A;  1XGI A;  4E3L A;  5DF9 A;  2I72 A;  3HLW A;  2C6W B;  4Q8I A;  4LEN A;  2DNS A;  3S1Y A;  3ZHH A;  2Y59 A;  4RVA A;  1BUE A;  1EWZ A;  5M19 A;  1PWC A;  3MKE A;  5DTK A;  5HW3 A;  4PM5 A;  2RCX A;  3GQZ A;  3ZVW A;  3NDE A;  2QPN A;  4ZAM A;  1KDS A;  4QY6 A;  5CGS A;  2Y2P A;  4FD8 A;  3V50 A;  4GN2 A;  1EI5 A;  2V1Z A;  5CER A;  3UNW A;  5FI7 A;  2EXA A;  2ZQD A;  4X68 A;  3WS1 A;  5GL9 A;  1RGZ A;  3IXH A;  1IYO A;  4Y0O A;  3Q7V A;  3VP3 A;  3EQV A;  1IYP A;  4FH2 A;  3PAG A;  4EBL A;  1BUL A;  1JWP A;  1GA9 A;  4BL3 A;  2J7V A;  3FWL A;  3A3E A;  4C6Y A;  1ERM A;  2WAD A;  4ZBE A;  3RXW A;  1DY6 A;  1K25 A;  3UE3 A;  2DCF A;  4E6W A;  1RGY A;  3OPP A;  5CEB A;  4S2O A;  4D2O A;  1H8Z A;  1MWR A;  2ZC7 A;  4KZ5 A;  4R0Q A;  1YLY A;  2XFT A;  4C75 A;  2FFF B;  3HLG A;  3EQU A;  3IWO A;  3Q1F A;  1XA7 A;  3WS2 A;  2ZLY A;  1MWS A;  3AGF A;  4EQI A;  1LI9 A;  1YLT A;  1KDW A;  3HL9 A;  2ZJ9 A;  4S2M A;  5E2F A;  3MXS A;  5GLB A;  2IWB A;  3NCK A;  3SS3 A;  1IEL A;  1K4E A;  3W8K A;  2UWX A;  5GLC A;  4OQI A;  4LV2 A;  1H8Y A;  5DTS A;  5CHU A;  3HRE A;  3IXG A;  4YIN A;  2XD5 A;  1J9M A;  5E2G A;  5AQ7 A;  5F83 A;  3RXX A;  2ZC6 B;  1PWG A;  1BLH A;  4DF6 A;  3BEC A;  1MWU A;  3C4P A;  4EBP A;  1G6A A;  5FDH A;  3IH8 A;  4WZ5 A;  3IQA A;  4C3Q A;  2WKE A;  4KZ4 A;  4QB8 A;  3BM6 A;  4UAA A;  5EOE A;  4N1X A;  5DF8 A;  2Q9M A;  2QZ6 A;  5EVI C;  5IHV A;  3MZF A;  4KG2 A;  4LCL A;  5FAP A;  3C7U A;  1HVB A;  4B4Z A;  3A3I A;  1I5Q A;  2Z2M B;  1ZC2 A;  2H5S A;  4R3J A;  2JCH A;  4EV4 A;  2OV5 A;  1IKI A;  3UPP A;  4MNR A;  3IF6 B;  5EPH A;  5J8X A;  3NI9 A;  3A3J A;  3N8S A;  3ZCZ A;  3ZG7 B;  2P9V B;  5FSR A;  3RJU A;  1GHI A;  4L0L A;  3OPL A;  5FI6 A;  3N6I A;  1Q2Q A;  3S4X A;  1MBL A;  3HUO A;  4JXW A;  4BEN A;  1TEM A;  2GDN A;  4ZJ1 A;  1YQS A;  2RL3 A;  1YLW A;  1L0E A;  4E3I A;  4HEF A;  4BL2 A;  4YFM A;  3UDF A;  3ISG A;  4FCF A;  3VP1 A;  4IBX A;  3IF6 C;  1I2W A;  1XPB A;  1YM1 A;  2Y2Q A;  3AGD A;  3N7W A;  1LL5 A;  3V39 A;  3G2Y A;  1ERQ A;  4HES A;  4RX3 A;  2ZM0 A;  2Y55 A;  1O07 A;  3FYZ A;  4HBU A;  4DKI A;  3OCL A;  5F1F A;  1ES2 A;  4GD6 A;  2ZMA A;  2BLS A;  4JXS A;  4KZ6 A;  3VP0 A;  3LO7 A;  1KE0 A;  2XK1 A;  5I94 A;  4O7D A;  2ZQ9 A;  1MKI A;  3S22 A;  4ZDX A;  4BLM A;  1K55 C;  2WKI A;  4DE2 A;  1CK3 A;  2X71 A;  4FSF A;  4DE1 A;  4Y0T A;  1YLJ A;  4OPY A;  5FI2 A;  2JBF A;  4GKU A;  5HX9 A;  2Z2L B;  2WAE A;  2Y2J A;  4GDB A;  4P6B A;  1PZP A;  5FQ9 A;  4RA7 A;  2ZQC A;  4KZ9 A;  3N4I A;  1KGE A;  2ZC4 B;  5E43 A;  3CG5 A;  5M1A A;  1NJ4 A;  5EVL A;  2P74 A;  3WS0 A;  4E3N A;  1PWD A;  2HDS A;  3O3V A;  4E6X A;  4BD0 A;  2E8I A;  4OH0 A;  4GDN A;  3O86 A;  5EE8 A;  1XXM A;  3GTC A;  5HFO A;  3G2Z A;  1L0G A;  5KZH A;  3C7V A;  4JKT A;  4ZTK A;  1GA0 A;  1YLZ A;  3FKV A;  4KQQ A;  1ES3 A;  4WZ4 A;  1E3U A;  3WS5 A;  1K57 A;  4S2K A;  4ZJ3 A;  2HDU A;  5CGW A;  3BRM A;  4ZJ2 A;  1FCO A;  4R3B A;  1Y54 A;  4PMA A;  3FZC A;  5DVA A;  5HAI A;  4A5R A;  5CED A;  3SOI A;  4UA6 A;  4JF4 A;  1DJB A;  5TFQ A;  3ZFZ A;  4WEL A;  3SH8 A;  2Y2M A;  4OON A;  1IKG A;  1NYY A;  1TVF A;  5FAO A;  1E3U D;  5CEC A;  1PI5 A;  1I2S A;  4OPR A;  2ZD8 A;  4DXC A;  1KVM A;  4Y7P A;  4Z9Q A;  4EBN A;  4DDY A;  3UPN A;  3V3R A;  1W7F A;  3QHY A;  2R9W A;  2OLV A;  1H5X A;  2HDQ A;  2WGW A;  3MXR A;  3G32 A;  1NZO A;  3PBR A;  1DJA A;  2WKH A;  3BFE A;  2EXB A;  1ESU A;  1KE4 A;  1PI4 A;  3DWK A;  3MFD A;  4QY5 A;  3UE0 A;  4N1H A;  2P9V A;  2HP5 A;  1XP4 A;  2X02 A;  4MBF A;  5EOO A;  3VFF A;  1LI0 A;  3CMZ A;  3PAE A;  1ZG4 A;  5FQI A;  3BEB A;  3Q82 A;  3IH9 A;  4KQO A;  3W4Q A;  1BTL A;  2A3U A;  4FH4 A;  4S2L A;  1SCW A;  1HD8 A;  1BLS A;  2Y2N A;  3IHA A;  2DRW A;  2B5R A;  5KSC A;  5EVI B;  4UA9 A;  5KMW A;  5G18 A;  1U60 A;  4MBH A;  3HLF A;  3GSG A;  1ONH A;  4RYE A;  3VOY A;  1W8Q A;  2XF3 A;  4X56 A;  1JTD A;  4S2N C;  3VSL A;  4OPZ A;  5AQ9 A;  1K54 C;  5A91 A;  5CTN A;  2ZM8 A;  4EUZ A;  5L2F A;  3OZH A;  5GHZ A;  4S2I A;  3UY6 A;  3OPR A;  1CI8 A;  2HP6 A;  4U0X A;  4OP5 A;  2V20 A;  3MKF A;  4CJN A;  4PM7 A;  2EFX A;  1M6K A;  3BLM A;  4RX2 A;  4H8R A;  4Y0U A;  1FOF A;  1VM1 A;  4LV1 A;  3IT9 A;  4OKP A;  4R4S A;  2C5W B;  2HP9 A;  3Q7V B;  4XXR A;  1ZKJ A;  3D4F A;  3GV9 A;  3OC2 A;  1BZA A;  1GHP A;  1W8Y A;  1TDL A;  4N92 A;  4QU3 A;  3IHB A;  5FQM A;  3IXD A;  2XFS A;  1PIO A;  4MEZ A;  1FQG A;  2EFU A;  4BD1 A;  4MLL A;  5FA7 A;  5TR7 A;  1S0W A;  1MY8 A;  3ZG8 B;  4IED A;  1NXY A;  1MXO A;  1CI9 A;  2EX9 A;  3UDX A;  4EWF A;  3UE1 A;  1K56 A;  2XLN A;  4LCM A;  3ZVT A;  4P87 A;  3ZG5 A;  3Q7Z A;  1MPL A;  3P09 A;  4U0T A;  2H0Y A;  5HAQ A;  1L0D A;  4OLG A;  2H0T A;  1KVL A;  3A3F A;  3C5A A;  3BYD A;  2XQZ A;  1K6R A;  3CJM A;  2V2F F;  5D3O A;  4NK3 A;  3JYI A;  5FQK A;  1SHV A;  4S2J A;  3NC8 A;  4WEK A;  1PYY A;  4DXB A;  3BFC A;  4E3J A;  3NIA A;  1FCM A;  1K56 D;  3PBN A;  1BLP A;  1PW8 A;  3LY4 A;  3M6B A;  5FQJ A;  1S6R A;  5BOH A;  5FAT A;  3MZD A;  4DE3 A;  3HLC A;  5E2H A;  3UN7 A;  3V5M A;  5HAR A;  1LLB A;  1ES5 A;  2WUQ A;  4OQ0 A;  2XH9 A;  4OLD A;  3PBQ A;  1C3B A;  4JXG A;  3FV7 A;  3HUN A;  4OOY A;  2EX8 A;  5F1G A;  1K4F A;  3TG9 A;  1NRF A;  1WE4 A;  1XGJ A;  3O88 A;  3G4P A;  5CXW A;  3ZG0 A;  1VQQ A;  1JVJ A;  5JYP A;  1KGG A;  2OSU A;  3GRJ A;  3VOZ A;  1ES4 A;  4K0W A;  2ZQ8 A;  3Q07 A;  1YMS A;  1QMF A;  1K38 A;  2Y2L A;  3PTE A;  2Y2H A;  5GLA A;  5EUA A;  4KG6 A;  4CPK A;  5FAS A;  4N9L A;  4LV3 A;  5CHM A;  4JXV A;  4MBK A;  3SS4 A;  4OOM A;  1HZO A;  4PPR A;  5JYO A;  4B88 A;  1ZG6 A;  3IWI A;  1NYM A;  4K0X A;  4WZ5 C;  3HLE A;  4IBR A;  4E3M A;  5EVI A;  3MZE A;  3B3X A;  4X69 A;  3SH7 A;  3AGE A;  3DWZ A;  3IXB A;  5CHJ A;  2ZC3 B;  1M40 A;  4JLF A;  5GHY A;  3LCE A;  3TSG A;  4ID4 A;  1Q2P A;  1SKF A;  2XR0 A;  2J9P A;  4DRT A;  1YMX A;  1W79 A;  4GB7 A;  3IF5 A;  4F94 A;  3GMW A;  2WZZ A;  1JWZ A;  4WM9 A;  1L2S A;  5EVI D;  1E4D A;  1YT4 A;  1LL9 A;  5FQQ A;  1MWT A;  3VP2 A;  4R1G A;  1FSY A;  1WYC A;  5HL1 A;  3N8L A;  4WYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...