3FLAA

Rifr - type ii thioesterase from rifamycin nrps/pks biosynthetic pathway - form 1
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
246
structure length
246
Chain Sequence
HRPEAEKWLRRFERAPDARARLVCLPHAGGSASFFFPLAKALAPAVEVLAVQYPGRQDRRHEPPVDSIGGLTNRLLEVLRPFGDRPLALFGHSMGAIIGYELALRMPEAGLPAPVHLFASGRRAPSRYRDDDVRGASDERLVAELRKLGGSDAAMLADPELLAMVLPAIRSDYRAVETYRHEPGRRVDCPVTVFTGDHDPRVSVGEARAWEEHTTGPADLRVLPGGHFFLVDQAAPMIATMTEKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Functional Analysis of RifR, the Type II Thioesterase from the Rifamycin Biosynthetic Pathway.
pubmed doi rcsb
source organism Amycolatopsis mediterranei
molecule tags Hydrolase
molecule keywords RifR
total genus 84
structure length 246
sequence length 246
chains with identical sequence B
ec nomenclature ec 3.1.2.-:
pdb deposition date 2008-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00975 Thioesterase Thioesterase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3flaA00
1X2EA 1AX9A 4PQEA 2XMSA 4DMKA 3I2GA 1QIDA 1UKCA 1CUZA 2PU7A 4UFNA 4Y2RA 1ZGCA 4XX1A 5K3FB 1THGA 2BKLA 4BAGA 1THTA 1E66A 3E1GA 3UUEA 5J3JA 5AOAA 5LZ2A 3QMVA 4FMPA 3E3AA 3M82A 1QFMA 3DS8A 5DYWA 3R0VA 1DTEA 2JF0A 4OSEA 1KEZA 3NGMA 5AP9A 1XZCA 3DQZA 3ZPXA 5E4JA 4ZRDA 1LGYA 4GEGA 1EXWA 2X8BA 2CEKA 1EDDA 4TVKA 2Z3ZA 1LPMA 1QIKA 4OUKX 4BCBA 1RYYA 4ROTA 3T52A 3WKEA 1C7JA 2WFZA 3WK8A 3AZQA 4DIUA 2CKMA 1SFRA 4FOLA 2QKYA 1VA5A 2WM2A 5ALHA 4CCYB 2R8BA 3H2IA 2VAXA 3C8HA 2I3DA 5ALPA 3O95A 4B85A 4H7HA 1XLWA 4ZXFA 5IVDA 2HA3A 2C0PA 5T4EA 4QEKA 4GHWA 2RONA 3C87A 2DCMA 3IUQA 1DU4A 4P08A 1A88A 1EINA 4OD0A 5ALUA 5CURA 3FLAA 5IVHA 2GBFA 1L7AA 1QZ3A 3GBSA 1XQVA 1MNAA 1VE7A 1XZKA 1ZICA 1UOQA 3AZOA 1AQLA 2JGMA 4WDQA 2XUKA 5AICA 3ZLVA 1DX6A 2PUJA 1X2BA 2XQFA 3NUZA 5BV7A 2WIKA 2XE4A 4CG2A 4UHCA 1MU0A 1CFJA 2ZYHA 2HA0A 4BBZA 5KWJA 2G4LA 4CIAA 2RI6A 5AKIA 5ALYA 1CEXA 2QT9A 3W04A 4B83A 5A7HA 4EY4A 4DNOA 3R3ZA 1IZ8A 2HADA 2VTVA 4OB7A 3WZMA 5D3KA 5E4YA 1JI3A 2ZSHA 1EVEA 3AZPA 5ALXA 2JGFA 4KRYA 1RP1A 2HM7A 3E0XA 2O2GA 1TCAA 4BC0A 1UK7A 1CIJA 5ESRA 2XDWA 2QS9A 2YYSA 1VXRA 1JU4A 2OXEA 2Z8XA 2YH2A 2HHAA 5AKKA 2XUOA 4C4XA 3WWEA 4J0GA 4G5XA 4EY5A 4MEAA 3WA6A 4J0JA 5LP1A 1LBSA 3TRDA 1IMJA 2ECFA 1MJ5A 2O7RA 3VKFA 4GWLA 5AM1A 3QITA 2XUGA 1ORVA 4J0KA 4QLOA 2ZJFA 4WY5A 1QIGA 4ZV7A 3QVMA 4J0IA 3ANSA 1AC5A 4BAUA 2VJAA 5T4FA 3V1KA 3IVMA 1XZGA 5BOVA 3L1HA 5AK4A 1UOOA 3RLIA 3W05A 4S0XA 1R88A 4BB0A 3OURA 1MX9A 4DGQA 3PDCA 1YAJA 4DMFA 1P0IA 2OCKA 4DNPA 3H2HA 3D7RA 4GXNA 1YS1X 1CRLA 4N8SA 3HC7A 1BS9A 5FKJA 2Z8ZA 4X6YA 5JATA 1DX4A 3FCYA 1OILA 1A7UA 2OQIA 4BVJA 3LIIA 4KE8A 1O6FA 5AM0A 3B5EA 1ETHA 2PM8A 1BCSA 4KYVA 4NZZA 7YASA 4MWSA 3V1MA 3UMJA 5DYTA 1DT3A 1QFSA 2E3JA 3AIMA 4BTLA 2Q0XA 3BJMA 5DYYA 3ESAA 5K3CA 2PSJA 2H7YA 3IUMA 4B0PA 1Q83A 2WHRA 1A8SA 2Z3WA 1AZWA 2OGSA 4LHEA 4ZWNA 3ED1A 3OG9A 3HYSA 3X3HA 2RAUA 1UK6A 3VXKA 1HL7A 1UOPA 2HA7A 5T4BA 1NU8A 4CI9A 2B20A 3G9TA 4BCCA 4KEAA 3S2ZA 4Y2TA 2XUIA 3HZOA 2X5XA 4U2BA 4P93A 2O7VA 4X90A 1I6WA 5JD5A 1C4XA 3WQHA 1XZEA 1GPLA 3BL8A 4IH4A 1HBJA 3T4UA 5C7YA 3G7NA 2VT7A 4OCZA 2HA4A 2AJDA 3HI4A 3DKRA 4HRYA 1WHSA 3FCXA 1Y37A 3IDAA 2WJ4A 2O2IA 4KAJA 4PSCA 1HQDA 5CH5A 3DCNA 1CUXA 5JAOA 1LPOA 5ALQA 3V1LA 5AIAA 3L1IA 1VJ5A 1W52X 3I2HA 4Y9SA 4OU4A 1CUHA 2WIFA 2WUEA 4EBBA 1HKHA 1P0PA 3G8YA 5ALOA 1K4YA 2GZRA 1JJIA 1N1MA 2XLCA 3WKCA 1FFBA 1W76A 2J3DA 5HF5A 3MGAA 3WK6A 5LYYA 2VA9A 3BIXA 4C87A 2BCEA 5AH0A 2Y6VA 4KRXA 2FX5A 3F97A 2G5TA 4B80A 1ORWA 5AI6A 1U2EA 2QR5A 3R3XA 4HAIA 4DSZA 3LP5A 3OC0A 3H1AA 3WKAA 4WFKA 1ZD3A 3R3UA 5A7FA 1R50A 1K6EA 5CXUA 1XZJA 3WZLA 4H7FA 4Q82A 4KR0A 2AJCA 2WLSA 1CUBA 5AK3A 2QM0A 2ACEA 5HFNA 3AJAA 1EB8A 5CH3A 5AKYA 5H3HA 3L1JA 5C8XA 4BRSA 4J03A 2DQZA 3AFIA 3DL7A 2QJRA 4DYHA 1QIJA 5LKAA 2ES4A 4ZREA 3G9XA 2WFMA 3R3YA 4FLFA 3ZWQA 2YXPX 4QWMA 1QJ4A 1MX1A 4EY8A 1CUVA 1UKBA 4YASA 3DLTA 2VATA 5ALFA 4H18A 3FLEA 2BGNA 1YASA 1EDEA 2GZSA 1U65A 4DM7A 1IUOA 2D5LA 4BDSA 4E14A 5T4HA 3DL4A 3RARA 1BU8A 2ACKA 2UZ0A 1JJBA 4CG3A 5AHXA 1BEEA 4PO3X 3OPMA 4UHHA 4Q3KA 4ZV9A 1XZLA 4E46A 4Z49A 2PVSA 3MUOA 1EK2A 3D2BA 3I2IA 1YCDA 1GQSA 4TPKA 4F21A 5ALNA 5HK9A 3R3WA 1SCQA 5LZ5A 1L7QA 5DNWA 1VZ2A 5HQ3B 1DWQA 4KJXA 4QDUA 5AKXA 2PSDA 4H35A 4UBLA 1CUJA 1KU6A 4AN1A 5CXXA 1GXSA 1XKTA 1Q84A 1ZOIA 4KE6A 1TKRA 4UBOA 5JD6A 2H9YA 2HU8A 3FYTA 1CQWA 2WHPB 4BCDA 3K6KA 3E4DA 2QMQA 4K6KA 2IITA 3ZV7A 1CUIA 3W06A 2OAEA 5A2GA 2HFJA 2WFLA 1AUOA 1MTZA 1LPAB 1UXOA 4FLEA 4UBNA 2WUFA 3I2FA 5DJ5A 1CVLA 2IX9A 3D3NA 3I2KA 4N5HX 1T2NA 1TIBA 3TJMA 3H1BA 5C8ZA 3H2JA 4AMYA 1E89A 3V48A 5JD4A 2FJ0A 2WHQA 4B0OA 1ODCA 1CUGA 4G4JA 1JMYA 4B6GA 5ALWA 4GI1A 1F0NA 3JWEA 2DFPA 2V9ZA 4FHZA 5JZ9A 5LLSA 1EVQA 5JANA 2HIHA 4L3WA 5YASA 2QUBA 1J1IA 5AKEA 2HRQA 2OLEA 1JKMA 2WJ3A 6YASA 1CUFA 1UK8A 1CUYA 5ISMA 3WL6A 2HU7A 2OCLA 2BUAA 1IUNA 5AOBA 2QJWA 1YAHA 1ZD5A 4Q1VA 4ITVA 3WWDA 5AI4A 1N8SA 1XKLA 3G0IA 1A8QA 3VISA 2RHTA 2XMZA 3WL7A 1TK3A 4MQMA 2QXUA 3R3VA 1MNQA 2XUHA 4M0FA 4MWTA 3HLKA 1KU0A 2XUAA 3D2AA 5EHNA 3Q0TA 4OB6A 4WCVA 2B61A 5HF8A 3WK4A 3F9CA 4I3FA 3TGLA 4PV7A 1YA4A 3H2GA 5AOCA 3FWHA 3C43A 2DHDA 3G02A 4YK7A 1QO7A 1UK9A 4DSAA 4ARBA 5JADA 3V9AA 5E2IA 3RK4A 2CUTA 4C89A 1QO9A 3K9BA 4U2GA 3STUA 1S8OA 2J4FA 5DLPA 1ZGBA 4Q3LA 1QIEA 5ALLA 4W1RA 4UHBA 3D2CA 1CUSA 2W22A 4Y2JA 4DTCA 2BAGA 4J7AA 3SK0A 2BFNA 4DMCA 4YX9A 3WYDA 2P8SA 4AMZA 3AUKA 2GBGA 3WK5A 4DMHA 3DOIA 4H7JA 2HA2A 4CCYA 2ORYA 1BROA 3PFBA 1J07A 4DNFA 3F67A 2PU5A 4OU5A 2HA5A 1PJAA 1R3DA 3C70A 3Q8WA 3QZUA 1DT5A 2VEOA 3KWJA 3BWXA 1NU6A 5LZ9A 2YASA 1YA8A 1XZHA 3PE6A 3LLCA 4JNCA 5JASA 1ZIYA 2HFKA 1LPBB 1QIHA 5CT5A 1CUEA 3A6ZA 4G8DA 1EX9A 4FWBA 1VXOA 1F0PA 1XROA 5JAPA 3WK7A 5F4ZA 4QA9A 3N2ZB 4N8EA 1AMNA 3ILSA 2WKWA 1W6RA 1VZ3A 5A71A 5JALA 4B81A 1DQZA 4BVLA 5I9IA 4U2DA 1R1DA 1GZ7A 2ZJ6A 2ZYRA 3H04A 5ALEA 3IUJA 3U0VA 2RGUA 4IH1A 4J3JA 5BWBA 1MX5A 3C6XA 4Q34A 4LIPD 1YB7A 1TAHA 1UZAA 4ARAA 4Y2PA 1Q0ZA 4N5IX 2XMDA 2HRRA 3SC2A 1UT6A 5IKXA 3ZLTA 3WYNA 5I8PA 3BDIA 4MXDA 4UPDA 4RE5A 3B12A 4QWWA 3O0DA 4X95A 1G4HA 5DTJA 4BATA 1JU3A 2GBCA 3G9UA 4BP8A 3C6ZA 2X76A 1HLGA 1TQHA 4PSUA 5ALGA 3O4GA 2VSQA 5AM2A 1C7IA 2RIPA 2V98A 4X00A 1IZ7A 4LXHA 3G0DA 4I19A 1F8UA 5AKHA 1XLUA 1CUAA 2WFLB 2G63A 5DNVA 3VJMA 3ESCA 2WU4A 2XQKA 3IA2A 3S8YA 2ZSIA 3W9BA 3IIIA 2WJ6A 3I28A 5HFAA 3UUFA 2PKYX 2DSNA 4Q05A 1DWOA 4LYEA 1XFDA 2VJDA 2Y1KA 4BZWA 3WJ1A 3WK9A 2PUHA 5EIEA 3WMRA 2Y6UA 1W75A 2WQZA 4IH9A 2WG2A 3FYUB 4BE4A 2GBIA 4D9JA 3GELA 3DOHA 1FFAA 3FAKA 3C6YA 1XRPA 1FFCA 3WLAA 4U2FA 4JUIA 2XMRA 3A2LA 3EQ7A 5HF9A 2V97A 5ALSA 3KD2A 4XVCA 1XZFA 1U4NA 1GQRA 4X91A 3G9ZA 1XQYA 5CT6A 5EFZA 3DDUA 1XRLA 4BP9A 4KAAA 4J0HA 1ACJA 4MYDA 3I1YA 4HXEB 3DYVA 1XRNA 2XUPA 2QTBA 1QIMA 5K3AA 3WKDA 2XQJA 3WL8A 4QLAA 4L72A 1ZIXA 1T4MA 4Y2VA 4GBGA 5AI9A 1EHYA 5KBYA 3VVMA 5EGNA 3ANTA 1QTRA 4AQDA 3VDXA 1R9MA 2DHCA 1ODTC 2JGJA 1MAAA 4QZVA 5HZGA 1ZD2P 4UFPA 1FSSA 4E11A 4F0JA 1MN6A 1OCEA 1GPNA 5JARA 1ACLA 1B6GA 4GW3A 4L0CA 1SCIA 2CB9A 5ALZA 3H18A 4FNMA 1E5TA 3O4IA 1EI9A 2OGZA 1CR6A 3M3DA 3OTQA 3BDVA 4DLNA 3N0TA 1R4ZA 5AKJA 4V2IA 3NWOA 1BCRA 3C45A 3IULA 4XJVA 3C6BA 1FJ2A 4BRZA 4HS9A 2XMCA 1QTIA 1G42A 3BJRA 4WFIA 2H7XA 4WY8A 3DD5A 2JBWA 2OAGA 5IVIA 2ONCA 2QZPA 3JYHA 1EA5A 3EIOA 3PF8A 1R9NA 3HRHA 5CW2A 1WHTA 2EDAA 3WJ2A 3GROA 3FSGD 4C6HA 2OGTA 2PSFA 4QDOA 4FTWA 4W1SA 2XMBA 3HACA 3CCBA 3PFCA 4NS4A 2VT6A 4BZZA 4PSDA 3C5VA 4INZA 3FNBA 5K3FA 3MUNA 2ZJ7A 1VOTA 4RE6A 4BTVA 1H22A 2DR0A 1F6WA 3F98A 2PSEA 1MPXA 3LIPA 1AURA 3D5EA 2WUGA 4H7EA 3WA7A 3O9VA 2WIDA 4E15A 3QPDA 3AIKA 5CRIA 1E8DA 2VF2A 2JGKA 5E4TA 1P0MA 1EB9A 2ROQA 4FBLA 1AKNA 4K6HA 4P9NA 5CMLA 4Y2UA 3D59A 5AI0A 5JIBA 4ZI5A 1GKLA 4L9AA 4X93A 3B3QA 4G1FA 4EA6A 3QMWA 4BAZA 3PICA 5EI5A 4MQLA 5IH7A 4KE7A 1XRQA 4AO6A 3WWPA 1H2WA 3R41A 2JEYA 4GLBA 1QLWA 4FNGA 3H2KA 1SC9A 1K8QA 4G8CA 4JYPA 4XIIA 1XZBA 3FLBA 4HVTA 1WPRA 4O08A 4X94A 1LZLA 2BUBA 5ALIA 5D3ZA 5FRDA 1EH5A 2WHPA 3QBJA 1P0QA 5FPQA 1Z68A 2J3QA 3G0CA 1PFQA 4EY7A 4U2CA 1MO2A 1VLQA 4EUSA 1TRHA 4UBKA 1O6GA 1CUUA 4KACA 1XLVA 3RM3A 2AJBA 4N8DA 5AK6A 4Q3OA 5SYNA 5HKBA 4G9EA 4G4GA 2VJBA 5EHQA 1A8UA 4UHDA 2C0QA 5FDFA 4OYLA 4JEIA 3H0CA 4EY6A 2FUKA 3ZI7A 3ICVA 3RKSA 3QPAA 5DTIA 2OPHA 1LPNA 4X97A 4UHFA 1WCYA 3DEAA 2CZQA 5ALVA 2XMQA 2XT0A 2CMFA 1E3QA 3IBTA 1CPYA 3C5WP 4BDTA 3D0KA 1FFDA 3FYUA 3A2NA 2VAVA 5D7BA 1TCCA 4X92A 5K3BA 5AKZA 3PUHA 4A23A 2W6CX 5CT8A 4IO0A 3QM1A 3A70A 3EF3A 5KREA 1JJFA 4CFSA 4I4CA 5LZ8A 3STXA 4PW0A 3R40A 2QXTA 2WTMA 4J0CA 1N5MA 2RHWA 1ZI8A 2ZVDA 4QDTA 3K2IA 1QIIA 3PF9A 4B9EA 4MJ3A 3JW8A 4HRXA 4UBMA 4EZIA 2AJLI 1XRMA 5AI8A 1QGED 5AM3A 4C4ZA 5BWCA 2EEPA 1XQXA 2B4KA 3KSRA 3YASA 2DHEA 4BE9A 4FFWA 3DKKA 1XQWA 4GECA 4AXBA 1YR2A 4UBIA 3EQ9A 3I6MA 3I2JA 3WL5A 4AZ3A 2HA6A 3V1NA 1EDBA 4AN0A 3BIWA 1BEZA 3DJYA 3SWWA 5EHZA 1CUCA 2PBLA 2WSLA 4DNQA 2WU3A 5K3DA 1UWCA 3TEJA 2HL6A 4KAFA 3KWFA 5ALRA 1RWQA 3GA7A 1XZMA 2WIGA 5D6OA 5CH8A 2V96A 3BF7A 4LKOA 4X6XA 3WWCA 5FP0A 2QRUA 2GYWA 2XB6A 1JMKC 3DYIA 4F5ZA 4RPCA 4LXIA 1Y7IA 1K5PA 4WDRA 3C8DA 3ICWA 2BJHA 1BE0A 3STTA 2I78A 3MVEA 4A5SA 1WB4A 1H2XA 2WILA 1WPXA 4W63A 1SOMA 1GGVA 4MEBA 5SYMA 4F60A 2PPLA 5AKGA 5JAHA 2D0DA 2I3ZA 3IUNA 2B9VA 3G0GA 1XZIA 4G4IA 4JH0A 2XQGA 3HEAA 1B41A 5K5EA 5FLKA 3VVLA 5CT9A 4X6UA 3U1TA 5AJHA 2C7BA 3QPCA 4BYMA 4J0DA 3W2TA 4HXGA 2BGRA 1LLFA 2WUDA 5LZ4A 1WB5A 4ZGBA 2WTNA 2JGIA 4AX4A 2DQYA 5EIHA 2PSHA 4FKBA 3HJUA 2J4CA 2HU5A 2LIPA 3EBLA 5LIPA 1FFEA 2XUQA 4W9RA 5ALJA 3O4HA 3WKBA 1DWPA 1OXMA 3ESBA 3I6YA 1U8EA 2QOEA 3FSGA 4B9AA 5AK5A 1MAHA 5HF6A 3P2MA 4LXGA 3FVTA 3F96A 3H17A 4Y2XA 4X85A 4K2AA 3WIBA 2G5PA 1YS2X 5CT4A 4H7KA 2PL5A 4CIBA 1WB6A 2XMGA 5FUMA 1N5RA 3F8SA 5EIAA 4NMWA 3O9MA 5HKAA 5JAUA 2CJPA 3CXUA 1J2EA 3LCRA 4Y2SA 1GT6A 4B82A 3STYA 1LPPA 1VE6A 2VQ6A 3FYUC 1L7RA 3BXPA 4G8BA 3DNMA 5A7GA 5C81A 1M33A 2QVBA 1HDEA 1ZI6A 2XUJA 4QDXA 5HCUA 4UBJA 4M0EA 3QYJA 5EHXA 1J06A 1QONA 1CLEA 4HXFB 5AKLA 1UKAA 2C58A 3GZJA 1E8NA 4Y2QA 1VA4A 4G9GA 1PV1A 4C88A 4B84A 1HPLA 4FFVA 3WI7A 1GKKA 2PX6A 3H19A 2Y2VA 3BE8A 5HK8A 1BN6A 1W4LA 3A2MA 1AGYA 5ALKA 1ODSA 3AILA 4Y2YA 4JYMA 2HDWA 2XUFA 5A6VA 3KXPA 5FV4A 4W1QA 4C4YA 3HSSA 4PNZA 4ETWA 4M0MA 2AXEA 5JZSA 2WIJA 2XUDA 3KOOA 1SCKA 4P92A 1CUDA 1IVYA 2OCIA 1IUPA 3W9UA 3I6ZA 2H1IA 4H0CA 2I03A 4TGLA 1WOMA 1ISPA 4AB1A 4FDMA 1Y7HA 3BF8A 4X71A 5KWIA 1USWA 2GYVA 3IB3A 5DWDA 4BVKA 4FLMA 4QE3A 2OG1A 1WM1A 1XRRA 1LBTA 1YB6A 4IHAA 4QNNA 5CBKA 5HQ3A 4C01A 4EB0A 5AIBA 4NVRA 3OM8A 4B7ZA 2VJCA 2JIDA 1EK1A 1NX9A 5IVKA 3STWA 2OCGA 3FVRA 4A16A 1X70A 1QOZA 5AM5A 5ALTA 4W1PA 3STVA 2CBGA 5CTAA 1CUWA 1YSCA 4Y7DA 4X7BA 2EDCA 4UFOA 1TCBA 3ZLUA 4AZ0A 3FBWA 1BN7A 3PI6A 3G0BA 4K6GA 1CQZA 4OB8A 1G66A 3OOSA 2XQIA 5K3EA 2R11A 2K2QB 4X3CA 5ALMA 5FOQA 1H23A 2JGLA 3FOBA 4OYYA 4GDMA 1LZKA 1LNSA 1K63A 3KDAA 1ZJ4A 2C5FA 1DQYA 5A62A 1H2YA 2JEZA 4LYDA 5FPPA 4YPVA 2GYUA 1E8MA 1W1IA 1XZDA 2IIVA 2Z5GA 4K5QA 5DNUA 2ZYSA 2XLBA 1ZI9A 3CCCA 4QDZA 3VJLA 2C5GA 3IURA 1QE3A 3AIOA 3EQ8A 4WJLA 4AO7A 2FJPA 1DINA 4RNCA 2JGEA 2OQVA 3NOXA 4UUQA 4CG1A 3LS2A 4KE9A 5JYCA 2H7CA 3GFFA 3ESDA 2Y2UA 2AJ8A 5JZBA 2C4HA 3WIOA 4XWGA 3D4LA 3SX4A 2QUAA 2XI4A 1JT2A 2WG1A 3CN9A 1VKHA 3PUIA 4H77A 2BUCA 5LKRA 3QMMA 4MYSA 4EHBA 2NW6A 3CN7A 4U2EA 1ZJ5A 1Q0RA 1XZAA 3HABA 4RGYA 1G5FA 3I1IA 4UHEA 3AINA 4BC1A 3HXKA 5AM4A 4H7IA 4IQ4A 5C8VA 5ALDA 1MT3A 1QIFA 3VJKA 2ZYIA 1UFOA 1ZD4A 5AI5A 1LPSA 5I7UA 4OPMA 2O2HA 4H7DA 4WFJA 1D07A 3GUUA 3M83A 1CV2A 3QH4A 5FXMA 4HZGA 5LZ7A 1JFRA 4CCWA 3O4JA 1BRTA 4FBMA 3WWOA 3M81A 1GPKA 4HTAA 5AO9A 2WG0A 1H2ZA 4AO8A 4PF1A
chains in the Genus database with same CATH superfamily
3QELB 3R0XA 4PQEA 5EXPA 3OUUA 4JUFA 2ZLBA 1S8FA 2XMSA 3IJRA 3NTQA 4MQFB 5CGQB 2C4MA 4DMKA 4GMGA 4OIMA 1HE2A 4TZKA 521PA 3I2GA 5EEGA 3X1ZA 3O47A 1H1DA 1NVXQ 3OOJA 3Q3CA 4JHLA 1NYQA 2ORVA 1QIDA 3H7AA 2AFRA 3F78A 3QF4A 4J4TA 3AETB 1M2HA 1EAYA 1FDTA 4TWIA 2VFAA 4XX1A 5KQPA 3ZOKA 5K3FB 1MVNA 3PEEA 3O9ZA 4HGRA 4BXOB 4BAGA 3S2IA 3QKRB 4HLUA 5I9LA 1RLOA 3RTEA 4O0LA 3CONA 2BH9A 1R74A 5AOAA 5FT9A 4PRZA 2E7ZA 1RYNA 4N5NA 5IBQA 3QMVA 4GYWA 4DT1A 2QP4A 3LKDA 4Q4AB 4GP7A 1U8UA 2YHIB 3QJ5A 1G3MA 4ZAVA 2ECPA 1APBA 1I10A 1Y5RA 2JAOA 3BWMA 2C9OA 4YJGA 2F4VB 3MBOA 3L49A 3T3DA 4GXQA 1DTEA 4G1CA 2J45A 4OSEA 1QQ6A 2EZ9A 2QSJA 1BXGB 1KDTA 3MPOA 5BNWA 3BVPA 3PQ2A 4EPTA 3C1TA 1AN9A 1I2DA 2FRDC 2PO5A 3E5RA 1FNCA 2FWMX 1IBSA 5AP9A 2AS0A 4R2XA 1SIWA 1VPVA 2C7OA 3DO6A 1OIWA 4RZ3A 3DQZA 1Q0UA 4FQ8A 1SUEA 3FWYA 3IALA 4L5YA 1Z5NA 3H65A 1C7QA 1SK8A 3E18A 3L9XA 5E4JA 5C80A 4NG4A 5C35A 3O8CA 4HB0A 2W6IA 2B8TA 3H3XA 1PV4A 3VNVA 3B6KA 3ND6A 3ZWVA 5LQAA 1AKRA 1NXOA 2YRXA 4QJ4A 1OFTA 2X8BA 1E2HA 4PYNA 2NTJA 3NBUA 1N2JA 4MAMA 4C03A 5HZMA 4ZTZB 1QIKA 1GZ3A 1S5PA 1FX0B 3DWEX 1LSOA 4BCBA 3AHIA 2VZ9A 1F60A 2ISQA 3HE3A 1NW8A 4RZIA 5FO1A 3SS8A 1WCV1 2I4LA 5EJGA 2Y4OA 4KK4A 3WKEA 4BFCA 2A5GA 4QOFA 3RU2A 1YTUA 4DQKA 2WFZA 5EZYF 3WK8A 3AZQA 2Q3BA 2GEFA 1RI4A 4FOLA 4N7BA 4CF3A 3CLUC 3TZKA 2GNAA 4OUDA 5FQNA 2WM2A 2R8EA 5ALHA 1LDYA 2E48A 3IAHA 3MG9A 4I4TB 2VAXA 3GJYA 1W85B 4S1TA 4QUKA 4DQ0A 2Y1FA 1Z4KA 4C08A 2WJGA 4RUKA 1Q77A 4GLLA 5ALPA 4D9NA 1OYWA 1AZSC 2O05A 3HWRA 4X1OA 5G02A 5DRYA 4UUMA 3JZMA 1M2WA 1WJGA 5FB3A 2OZVA 3GZTB 2JIRA 3AV3A 3QUAA 4RBNA 3QNUA 1W73A 3CZRA 2C0PA 3R6LA 3CZ9A 4GPBA 4QUHA 3LHDA 5T4EA 3U37A 4E94A 1SUAA 1VMAA 2AQIA 1CR0A 1OXSC 2FZWA 1X0XA 1DJPA 4JIGA 1N2ZA 4GHWA 5IXJA 4EX7A 2DCMA 1R0KA 1EINA 4OD0A 2Y9PB 4IKEA 3GQVA 2ILVA 4ZIRA 2IXDA 2F90A 4OAOA 3FLAA 3IP3A 5IVHA 4UTVA 3UICA 5JSYA 1B4DA 2EFYA 1RMQA 2BM1A 2P78A 2R25B 3RO7A 2BKAA 1QZ3A 3CFYA 4YXWA 5I6DA 2OQRA 1DV2A 4PLVA 3SG0A 3ZR4B 1LQTA 3LOQA 4D97A 2V1UA 4CKCB 3TMAA 4CYMA 5SY4A 5BWMA 3RSOA 3UYKA 3CS3A 2VQDA 2VWHA 2D2XA 2W00A 3PG5A 4WDQA 1VL0A 3A4YA 1US8B 3L8GA 2G88A 2XQFA 4DBVO 3U49A 3R9KA 4Q3BA 2RHCA 5A9RA 4RENA 2XE4A 3AB8A 4Y9UA 2IUUA 4WNAA 3DMTC 2VPYA 3AK4A 3FTQA 1N5KA 1MR3F 1GUBA 2H4ZA 2HA0A 4PC1A 1Z0ZA 1GA6A 1ST2A 1A7AA 4JQCA 4JOQA 2LR0A 1J33A 1NZDA 1P9LA 3MSCA 1C3JA 1Z15A 5KWJA 3C5CA 3PBKA 5EOVA 3LUGA 3DG9A 3MTBA 2ST1A 4M1TA 3HVHA 3GLGB 3M2PA 2VO1A 2OZLB 5ED4A 2JAHA 3D8TA 4INOA 4D74A 3AR4A 3B7WA 1KJNA 1M8PA 4QPCA 1Y9EA 1W34A 2Q28A 1O8BA 2YMPA 4RZXA 3AY7A 3DVQX 4CE6A 3T38A 1Y9DA 1VHDA 3HP1A 1E7RA 2E1RA 3M6WA 4S05A 3I12A 4IFEA 4LYJA 3ZH2A 1W36C 4EPRA 1VSBA 5E4YA 1C2TA 1W0CA 1RYEA 4DIEA 1DIRA 2DMRA 5D00A 4RO0A 4LRUA 4EF5A 2QGNA 3NBZC 4JP8A 2JGFA 3Q7IA 5DGDA 3SLGA 3ZHZA 1WMFA 2O3QA 3I9NA 3NDPA 3RYCA 3HY3A 1RP1A 3LCCA 4BBPA 1KEEB 3UMCA 2DM6A 2DGDA 3TSOA 2JCVA 3E0XA 2GZMA 4FQ7A 1Z3CA 4UULA 4YDHB 3DO8A 1D2GA 1CIJA 2BEVA 3BGDA 2ZYGA 3DD1A 4DBZA 2FMHA 2R1ZA 4QO8A 1KFJB 2QS9A 3CLSD 2FYTA 3TNDA 5IJ0B 1W8IA 1J99A 1WV1A 2OXEA 1SELA 3COSA 4J43A 1F6DA 4BGEA 1GZ5A 5JI2E 4V1CA 3DT8A 3ZD9A 3DFUA 3AETA 1WABA 2IKSA 4U9UA 1Z0IA 2RH4A 3VC3A 1W4ZA 1Z5ZA 4B74A 3LRPA 3PC2A 5LDGA 3RF6A 3GL9A 5SYAA 1WU7A 4C4XA 1XZQA 2R44A 1TLFA 4KZKA 4NE7A 4WZBB 2W6PA 4K88A 4P4SA 3K0CC 3VC2A 1XJ5A 1R6VA 3JQAD 1X8XA 2KLBA 3SNKA 1FFGA 4XFDA 3MTIA 5B6JA 1T8YA 1RRPA 1JTFA 3TSYA 2QENA 2VJKA 4U0JA 1Y9AA 5FCDA 1HK7A 2HK6A 2OXCA 4P82A 4PS1A 5GM1A 1SCUB 5F2OA 2ECFA 3IP9A 1W0JD 2JRLA 3PVCA 3HJFA 3SQMA 2EWMA 1DCTA 3T1TA 3H5RA 4GWLA 4BLSA 3AKCA 3AR8A 1QV7A 2Z5LA 3QITA 4B3IA 1REQA 3AOGA 2FK8A 3HA5A 3QU7A 3QFCA 2ZJFA 1DWUA 4AVYA 1KNQA 3KR1A 4HF7A 5CFNA 2ZBRA 4RULA 1QIGA 4RAQA 5SZJA 1L8OA 3FPJA 4IINA 3Q7RA 4MUGA 2XZDA 1O6BA 3IC5A 2CHVA 4U6SA 2XHEA 1J8MF 1RCFA 4TX1A 1XU4A 1OWLA 1PT9A 5JVDF 2MMGA 5T41A 3RE1A 3ZY6A 2C8KA 1X8LA 1VFPA 1K1EA 2QRZA 1CERA 4HEA6 3G17A 3H0EA 1KI4A 2Z5FA 3ASYA 2P2YA 1CF9A 2OCDA 4P4TA 2VF4X 3BSFA 2A1UB 4MV8A 2GEBA 3IVMA 3NPMA 1VCMA 3HV2A 5GONF 1SMKA 1ICIA 4EH1A 5BOVA 3L1HA 4KHPB 2R7NA 5BR4A 4COKA 1MORA 4O1MA 1JDTA 3JQRA 4TWBA 5K4HA 3P2JA 3BQNB 4YCBA 4KPUB 1P2DA 1R88A 2IFTA 4P7GA 3OURA 1TEXA 1FYFA 3IR5A 3ZGZA 3D1VA 3JZIA 3PDCA 1QC5B 1YAJA 2QV7A 2JZNA 4X84A 2CGEA 3HPQA 1P0IA 1LF5A 1Y6GA 1YR3A 1MC4A 5TLSA 2Y76A 2V6MA 3GFTA 4KSCA 4G5RA 3X1JA 2GM4A 1JQKA 1P4JA 1SURA 2LXNA 4MQFA 2Q29A 2RGNA 3HHPA 1AXGA 3K2EA 5EWJB 5KSWB 2C9ZA 2PZEA 4MDFA 2XXBA 3G5LA 4IJQA 4B46A 4KWTA 3D0QA 1BS9A 3Q87B 3U4QA 2JD0A 1DKMA 5FKJA 1KY4A 2Z8ZA 1II0A 2TSYB 3CUVA 4P3NA 1MHTA 2C2BA 3KT0A 3AR2A 5EUMA 4DRXB 3F73A 2V0CA 3TKLA 1C7ZA 1DCMA 1P8AA 3GUZA 3O8QA 2VZ8A 2RHGB 1K2VN 1G1AA 1Z37A 3PZRA 2QMYA 4NBVA 1A7UA 3KTFA 3EPRA 2G8LA 2C5AA 1H3EA 4R1MA 1TQ4A 3KYBA 1QC5A 3KLPX 5IEBA 2VRWA 2CXNA 3DZFA 5ICCA 2ZBVA 4ZC1A 4MW1A 2WVJA 4C6RA 5JXGA 2ANBA 2G1KA 4NZZA 2QHXA 1O95A 3L0SA 3V33A 3KQHA 4I1OA 4MA4A 1FZTA 2ZIXB 2PT7A 4YRZA 1RWKA 1A4XA 2P9CA 3ESYA 3OO0A 3R7SA 3CZ4A 4MCHA 4E5MA 3QIAA 5DYTA 4RZUA 1UPAA 1NBIA 3CG0A 3JVEA 3Q1LA 5K3SA 2ETVA 4E6EA 5CFMA 1DT3A 4BC0A 4LUCA 1X19A 1KP2A 1V2HE 3IMGA 3TMKA 4RCYA 3TXAA 2DLNA 4BTLA 2Q0XA 3AL0C 2P41A 2ZK7A 1M0EA 2XXAB 3BJMA 1NY6A 3DGEC 3HUEA 3P27A 3NPAA 2XBUA 4QNMA 4AICA 4J6EA 1BVRA 4MGHA 1GRQA 1PR6A 1D4OA 3G9QA 5GVRA 2PSJA 2BEUB 4R7ZA 3RGGA 2CLFB 3BRCA 5TARA 2CUNA 7REQB 3IXQA 1AKUA 3H5TA 3GZ4A 2R00C 3LF1A 5FV7A 5SZKB 4OQQA 3IUMA 3DTVA 3HFSA 3OEWA 2P1RA 4BNVA 1H6BA 1O5TA 3A9SA 1LDMA 4N82A 4UNRA 4C3ZA 2ZR0A 3JRXA 2Z3WA 4OAPA 4V0ME 2H29A 3I76A 1T43A 2OGSA 3L6CA 4LHEA 2KM1A 4BOYA 2FGKA 1GHTA 2O0KA 1Z25A 2L18A 4B4WA 3AVWA 2AKEA 2UYGA 1H6AA 4QYMA 1L2TA 3EODA 4TLBA 1EFRD 4C4OA 4Z2YA 2QMZA 2YFHA 1HL7A 3OX3A 1VB5A 3WL4A 2ZJ1A 3W5VA 1UCFA 1NLFA 1NU8A 3CG4A 1UDCA 5CDTA 2B20A 1P1BA 3G9TA 3RC9A 4LJ8A 3U3JA 1M0SA 3PHIA 4D41A 2OO5A 3PUWA 4ZGGA 3Q0EA 1KH3A 2BFWA 4KEAA 3AVTA 4G8JA 2G71A 3I0ZA 3KQVA 1YVPA 3QE0A 3MPUA 1T2VA 3AVPA 1F8YA 3HZOA 5DX0A 2NUBA 1EJ6A 1TM4E 3TK1A 2OTCA 4EHIA 4FX5A 2P5UA 5F3WB 1VYHA 5TMEA 5GQSA 1FP4A 4I4IA 1TL7C 2BFEA 2AC2A 4O4JA 1PEKE 2Q6LA 1K8RA 3FI9A 3H2SA 3LHIA 3R24A 3GBVA 4N7RA 5JD5A 3T3OA 1E98A 4WCDA 1XWWA 3BL8A 4IH4A 1TU3A 1KYIA 4CM8A 1JKXA 5I7SA 1ULHA 5CB8A 2D06A 2G06A 3HZRA 3EDQA 1SUSA 8AT1A 3LJKA 4ANFA 4CM4A 3GFSA 3EDCA 1X7XB 1JP7A 3MUFA 4L5AA 5D85A 1FP6A 4XB2A 4HRAA 2NZXA 3ZCVA 2JLSA 4FB5A 2LKCA 4IV8A 4OJNA 1EG2A 5KWEA 2DWCA 3NFYA 1V16B 3I5UA 3IDAA 4YRDA 2IIQA 2WJ4A 1HDRA 5LUBA 1ZD8A 4V0LA 2FQQA 1HQDA 3DMDA 3K0KA 5CH5A 3RUFA 3VR5H 4FGUA 1XX6A 1BS1A 4AX8A 1S89A 1JN0A 1LPOA 1XFAA 4B75A 4WZBE 3V1LA 5AIAA 5BT8A 1OH6A 3L6RA 3RAGA 3X2EA 3PQ4A 2HUNA 2AN9A 4OXNA 4QPNA 1BMDA 3MYRA 1W48A 1W52X 2IHJA 1GJRA 4L57A 4L8VA 3O8BA 4R8SA 4Y9SA 1N1GA 1CUHA 2WUEA 2Z2KA 3C6KA 1G7TA 3CTPA 1HKHA 3KZMA 4MRVA 3TLXA 1N2BA 1Z38A 3TPCA 5K0GA 5TF0A 1QDEA 3UPUA 3NHBA 6CHYA 3OE4A 2ZUEA 2DX7A 4GP6A 1UBKS 2ZBDA 1OZFA 4BNWA 4WINA 5AVZA 1NAHA 3REOA 1W76A 1LSUA 2QSZA 2BFAA 4CKBB 3MGAA 2OK7A 1TPZA 3OEED 1DOAA 3PPWA 2FW9A 4C0HA 1SXQA 2GOYA 3GLKA 4C87A 4UASA 2GJ4A 2CJFA 4R6XA 2VDMB 1RBMA 2WNSA 2Q3JA 4CL8A 2C42A 4ZVMA 2JBAB 4A8HA 1X7YB 4Q3AA 1S2GA 3WJ7A 4R3WA 3ZHVA 1JS1X 2G5TA 1NM5C 1R4NB 1XD2B 5AI6A 5EKDA 1X1DA 2R0QC 5A04A 1UWVA 3PCRB 4NXMB 2W6NA 3H1AA 5CHYA 2JIZA 2VXYA 1CY8A 2DY1A 3AHHA 4P31A 5A7FA 2YV1A 3OQOA 3VYRB 3GEHA 4D42A 4GFDA 5EL0A 4HHEA 4D8YA 2ZWIA 4H7FA 1A4UA 1Y8CA 4HS4A 4ZEWA 3HO6A 4Q82A 2YXEA 1NW7A 1C30B 3AGPA 5DYGA 4IGIA 1LH0A 1XQ1A 3D8NA 4KBGA 3DDCA 2C9DA 4PS0A 1H9BA 4AUMA 2VXBA 4Q3DA 4TLAA 4K9QA 1NVBA 3PVSA 4MW7A 4ZK2A 1YDHA 1G5HA 5KYXB 3G2JA 1D4ZA 3L1JA 1YZTA 1XTPA 1QKJA 2DWPA 3FGZA 3ZLBA 4CFYA 4EHDA 4UMVA 5B4VA 3N87A 4IMPA 2TMYA 2NU6A 4DSOA 4LDQA 5JYBA 3EXIB 5CLGA 1DSSG 1E5VA 2V8OA 3KKPA 5JFGA 1REQB 4AK9A 1O4VA 2QJRA 4DYHA 3P7MA 5I7AA 1FZQA 1L8QA 1QIJA 4NK5A 4RWZA 3EIUA 5KS2A 1PR1A 3EEBA 1LK5A 4NBTA 2V54A 1GNLA 2JD1A 2WT4A 2YRWA 4CW7A 4XGIA 4IIBA 3RASA 2WFMA 1J49A 2C3UA 4MMYB 1LRKA 3R3YA 5EJ9A 4DLWA 4HYQA 2NP7A 4G1VA 1SEPA 1CR2A 2PMWB 1TF7A 4IIGA 1EHCA 4C0AC 4M6WA 4O4IF 5K01A 4FYMA 3G23A 5HNKA 3CGGA 4QQRA 1DFHA 1J24A 2CVHA 1Z4MA 1YJQA 1SY7A 2CD9A 1TXGA 1HLPA 3GRPA 1O9BA 1CUVA 1UKBA 2JFFA 3KKLA 5M3BA 4KL8S 3ZUPA 3EGXA 5ALFA 5HA5A 4EYKA 4XWOA 5KQSA 4G63A 2P9HA 5TMBA 2FFQA 5A9SB 5A4JA 2Z43A 1YASA 2W93A 2G7MC 4XR4A 2GZSA 4B87A 4EVIA 2D5LA 4UQOA 4HQOA 1ZAKA 3BA6A 3PQ6A 1HQCA 4EB8A 4ECAA 4ZPXA 2OMKA 4YCCA 3M6LA 3RRJA 2IK8A 3EXEB 2R8XA 4MSUA 4WAUA 2PD4A 3DL4A 4XIGS 4XVHA 3T7TA 5BMVB 5FPKA 1KO1A 3GEIA 3LC7O 4M9QA 2ACKA 3SJUA 4BNFA 2UZ0A 4DARA 3HL0A 1KMCA 2R86A 2ZIUB 4FFOA 2FWIA 2PUDA 2X8JB 1FU8A 3PNMA 2GSDA 1H9AA 4GRIA 1YK1A 2VAPA 3UMBA 3LXUX 1BEEA 3SQLA 1NM5A 3WNZA 3RAEC 5CLLA 4RZSA 2IRWA 2GZHA 2C2WA 2GK7A 2DPHA 1UJ6A 2COUA 1SXGA 4JU9A 3NM6B 4P36A 4DDVA 4DVGA 4B8ZA 3ZD6A 1K3UB 1EK2A 1JPUA 3I2IA 4MUHA 1NULA 4QOHA 3UK7A 1E3LA 3AJRA 1PQWA 2COKA 1XPJA 3UWSA 4YXWD 4F21A 1T3ZA 3ZQUA 3B6ZA 4TTAA 5J4VA 3R7LA 3BXGA 2FWNA 4B3SB 1SCQA 1AA9A 5LZ5A 3E9NA 2PQ2A 5C8YB 1L7QA 1NIPA 1T2EA 3ENVA 3S4YA 3NASA 1OTYA 4P53A 4ZAWA 3ZC3A 4KR3A 4KJXA 4HLUC 3EH2A 4QDUA 4QRDA 4NMLA 1GR0A 2PSSA 4QREA 1YQUA 3PJDA 4BFLA 2FR0A 2LWIA 4I4NA 1ZPDA 2X77A 3THSA 3ZZ1A 1JZTA 1Z6ZA 4FXOA 2FZGA 3IOEA 5CXXA 5GIPE 3EW7A 1JJVA 2E4ZA 1KO8A 4RABA 1RM4A 2GT1A 4X7RA 5DU2A 1IL0A 1ZBDA 1L7NA 1DTSA 2ZYTX 1YVEI 4A0GA 4R2KA 5I7EA 4FFSA 2P69A 3RSCA 3S2FA 4UBOA 3N2EA 2H9YA 3FYTA 3FOFC 4IKOA 3PNBA 3TTVA 4ZZ0A 3KSUA 3BFKA 1PJRA 4JA0A 4KR7A 1AB6A 4YV2A 3DEKA 2C2KA 2WHPB 3DTTA 5C7LO 3HLYA 4ITUA 4RHXA 4F8JA 1UFKA 4CMIB 2IOHA 4K6KA 1NXQA 1WNTA 2ISSD 2KQUA 1KYVA 2GKOA 3EF0A 1PLJA 1U8AA 2WWHA 3TW6A 2H3EA 3P4XA 1GCUA 4RLHA 4A26A 1AT1A 1X7ZB 2WD7B 2BFCA 4U00A 2GHRA 1USUA 1XPRA 3DF7A 3P5BA 3W06A 3DNFA 4FOSA 2EKDA 3UWDA 3FPEA 4JCOA 1NI4B 1EQAA 1NQWA 2J85A 2WFLA 4LFAB 3MMPA 5DT9A 3NC4A 1LPAB 1UXOA 3EGXB 5E2BA 3K0FB 5MF6A 2WW8A 2WUFA 3WBBA 5FUWA 4YLGA 2X8LA 3VR6D 3O8NA 2J09A 2G9ZA 1CB0A 1VPEA 4HJXA 3CBGA 3OF5A 3OEHD 2X4DA 3L1UA 3S8EA 4WLNA 4FM9A 2QT1A 2JAPA 3M6IA 1AUPA 3U26A 5C5CA 3AJDA 3JSAA 3KKNA 2BRUC 2BFOA 1ABFA 1DXHA 5A9TA 3RSHA 1UPTA 1YCGA 4JJ4A 4CG0A 4DMRA 4CXMA 2BHRA 4BX8A 3NAQA 4N65A 4DIDA 2KI5A 5C8DA 4CI0B 2GDZA 4E7PA 1LU9A 1F0NA 1T9HA 2R6ZA 5IAAA 5KYXA 3A8TA 1UBFA 3GRKA 2NUTB 5TC4A 2BF4A 4G5HA 4ER5A 2BCGY 2I99A 2JLCA 1SH7A 3DWIA 3NVDA 2NO4A 4QELA 4ER6A 5E6RA 2WWRA 1CX9B 3ZZUA 4EI2A 1R5OA 1KMMA 4BLQA 1IB0A 1KJYA 2DCUA 4GMFA 2ECKA 2PE5A 4N9WA 3IIKA 1J21A 3G59A 3PDIA 1X1QA 1YMUA 2LRHA 3L7LA 3GCDA 4L3WA 3FKQA 5YASA 3TAUA 2QUBA 4F1JA 4KDCA 2YQ5A 2EG9A 2D2IA 5LPNA 4DV3B 4CEHB 1SU7A 2OK8A 2OLEA 3I39X 3NEJA 3ST7A 4P0PB 3T0GA 4MMZB 1C0LA 4FZRA 5D51S 2PH7A 4MVWA 4JOBA 1G291 1NI5A 1RAFA 4E5VA 4HEJA 1MB2A 4YJ3F 3H83A 4KK3A 3H99A 3K73O 5P8WA 2ZAIA 2CL5A 1O95C 1YB1A 5H0IA 3QXXA 3LUPA 2PZBA 5CB4A 5AW0A 1IN8A 3FGPA 5ISMA 5BSFA 4M9XA 2G17A 3DMNA 4IHJA 1E4EA 3MTJA 4YRTA 2UXDB 1SU8A 1A5BB 2YV3A 4GMDA 3ONWA 4MPPA 1WDMA 5B2ZA 1ID8A 2JFOA 3PE3A 4D4KA 4PLWA 3OQBA 4GM0A 1K4KA 3QF7A 4O1IA 1UC4B 3S27A 3VPAA 2C1XA 1O6CA 3C3XA 2K7FA 3FHLA 2O1WA 2B37A 1N9ZA 2C9CA 3ZXXA 1NF2A 1ENPA 1UMKA 1C3OA 1F9EA 3FPFA 3IVAA 2AFVA 3G0IA 3KSDO 4FMDB 1X87A 2F43A 3MJRA 1Z6QA 1WF3A 2XSZA 3OMLA 3DHYA 3EWIA 2C83A 4B4KA 4P5EA 5B1IA 3AFMA 2XMZA 5DM0A 4ZVSA 2CV1A 2FA9A 1TK3A 5JHGB 3LCJA 2E6KA 3M4JA 1RJGA 2D5CA 2HWXA 4E03A 4QAJA 5G0VA 1F51E 1W93A 2OBYA 4IOJA 4MWTA 2Y1EA 1QZXA 3RI3A 4BVFA 1FDIA 1KU0A 1U7PA 2PYZA 9ATCA 3QBDA 1KYXA 3WDMA 5CPFA 3BMCB 2VN8A 1YIDA 5M04A 2I80A 1NHGA 4CNBA 4KC0A 2B61A 3ESZA 3NWJA 3ONNA 2GK3A 4D92A 4JJ7A 2PV7A 3F9CA 1GPH1 1YQDA 3B7PA 5JSZB 3EZ6A 3SSNA 3WIDA 3FWHA 4PG4A 2ZATA 4CLEA 4Y67A 1T3SA 5DNCA 4UOEA 4LWPA 5KTTA 1AS3A 5KI6A 4M0DA 4HN9A 1UQUA 5FUVA 5LQMA 5TGDA 3WO1A 1QYCA 3QE2A 4MV6A 3D3WB 3GH3A 3DDNA 3IMCA 3F4LA 5E2IA 4Y6GB 1W2GA 4FXPA 4RPGA 4HDKB 2ONKA 3IA7A 4ZALA 4JODA 2J3IA 1QVVA 1RWBA 1ZGBA 4B3JA 2PX5A 1QIEA 3IDSA 3I3SR 3A9UA 1EK6A 3NKVA 3V7FA 4ZI3A 4DGSA 2V0NA 4LGMA 5JQGF 1DE0A 1ZNYA 3RS7A 1L4UA 1CUSA 2QR3A 1CU1A 4Y2JA 2QTFA 4Y30A 3PVZA 3INGA 1AKYA 4DMCA 4XUCA 2WB2A 3A6HA 4DDWA 4MCAA 2XRFA 3JX9A 2CLDX 1CQPA 1ESZA 3WHIA 3PXAA 4AMZA 4AULA 2R8OA 1O6ZA 1XTBA 4FZVA 1Z29A 5DE3A 4DILA 2OBFA 3HBMA 2XGOA 5G2OA 3WK5A 5HUHA 2AB0A 4PQYA 1P4RA 3DOIA 3U7QA 2NX2A 3J7AC 2PWZA 3GLFA 5CM2Z 3OTHA 2WWXA 3LUAA 3PGVA 4NFSA 1J07A 4HYEA 2OD7A 1D0SA 4GD3Q 5AJXA 2CXOA 1WTAA 3F67A 4MQ5A 4UZSA 4DNFA 1PVVA 5A4KA 4GIBA 5TSDA 4OU5A 2PZGA 2HNBA 3OZIA 4KPFC 4U7PB 3DMHA 2GPSA 3K0FA 3K70D 1VCHA 4WLVA 4G6ZA 4IEFB 2BLLA 4XTRA 3T9AA 3UJNA 3BB4A 1N32B 2YXBA 3FPKA 2VC2B 3QZUA 3RF7A 2C9YA 3GDHA 3PPXA 8GPBA 1TZ2A 4EQZA 4BRUA 5E3HA 3MWJA 1Q0PA 1XVLA 1H2AS 4FMBB 4EG0A 1OXKB 4YQZA 5HS6A 1KS2A 1TDJA 3A1TA 3RC3A 5MN6A 1I7SB 1F14A 3DPIA 1QHGA 4B7UA 2O8EB 4RQBA 5DHQA 1W47A 3JU3A 2B1RA 4KAXA 4K6OA 1R0ZA 4ZQBA 3PEWA 1WW3A 2CXSA 1EQUA 4LECA 2HMTA 2XODA 1VHQA 3CSUA 5LQKA 3NBKA 4J4HA 1LPBB 4MP6A 5B6PA 2MT9A 4MV5A 4HC4A 1BFDA 1OC2A 4HG2A 5CT5A 2QN7A 4AF7A 3LQ2A 4TZ6A 4RQAA 4P4GA 3A6ZA 4UEQA 1S0UA 4UNPA 3GZNA 2IZ1A 4ASUD 3HBLA 1N3IA 2ZE8A 3FBGA 3P9XA 1Z56C 3AF1A 3A26A 2VUIB 3K0AA 1XROA 3NIGB 3OPYA 1W4AA 3LAWA 3RRNA 1GTRA 2GA8A 1MGOA 3DBHB 2NLOA 3F2IA 3IAUA 4REOA 4WLUA 5BN5B 3WK7A 4L5JA 3RFCA 4NZNA 2C1EA 4BMNA 5F4ZA 4MVJG 3NOOA 3JQ7B 4NYMR 3MJDA 2I3GA 3B5JA 4R9UC 3ROKA 1BHJA 4ND6A 3W5SA 4I1RA 2V7XA 2GTPA 2ZRQA 4N8EA 1QH9A 4YAWA 4B6PA 5L4SA 2Z3VA 2WKWA 2I91A 1CF4A 4I66A 3KUXA 3EB9A 3CX4A 4URUR 1FCJA 4FE7A 4NESA 1L7EA 1MABA 4B3GA 1A7KA 1Q0SA 1GZ7A 1BKSB 4OHRA 3BRWD 2I6QA 4MZDA 4EJSA 2X2PA 5JJLA 1SVMA 1DCFA 4DAEA 3H42B 4I1SA 4KMRA 2PEYA 2YJTD 2GRJA 3IUJA 4REMA 5DCWA 3U0VA 3ER9A 1OLSA 1DDIA 2D6FA 1UQRA 1E92A 2XGMA 4PYOA 1OGJA 4JJGA 4OGGA 4F4JA 2BEJA 3LL7A 2GFHA 5AXAA 5L51A 3K35A 4BNKA 1RPJA 2BGIA 3BFVA 2ZS7A 1DUSA 1Y0BA 3K15A 3EGDA 3QFHA 4GR5A 4NCXA 1T0HB 2O14A 3TOSA 4F9TA 5T5QA 2ZXFA 2JJ2A 2O50A 1TD1A 1E2LA 3ACDA 3K1JA 4Q34A 4E6PA 2EERA 2PKXA 1UJ4A 4ILKA 1Y8QB 3BWBA 3IEMA 2QDXA 1QGDA 3A2KA 1XCMA 4GGOA 5BSRA 4Y2PA 2VHXA 1Q0ZA 2IE0A 3GLFB 1DHRA 3OPYI 4RFSA 1UM8A 2CF6A 1KHTA 3L82B 4F84A 2INGX 1LSJA 2VYVA 3KJEA 3HRKA 2HY7A 1URPA 2XMDA 3SC2A 1PZEA 2FDRA 3OKPA 1I1OA 1PL0A 2Y3IA 1JRLA 3PFKA 4TKLA 2WTUA 1CP2A 4YCAA 5IKXA 4OKNA 4FR5A 1NJ8A 4R1OA 4YRRA 3N8NA 3ZLTA 2FGJA 5BW5A 4US2R 2R4QA 3WYNA 5EY5B 4D0NA 4ATNA 3K92A 4G09A 4O5OA 1ORRA 2VDJA 1M6NA 3BGOS 4HDRA 4RFVA 4TSFD 5EMMA 2O3JA 3ZVNA 4KCGA 4RE5A 1Z3IX 3ZGVA 1QNLA 4GPEA 5JV5A 1G4HA 4E0BA 4LNAA 5DTJA 1JU3A 4J91A 3ZV4A 3QU2A 2X0IA 3SSAA 3G9UA 2O8EA 3EYAA 4MYHA 2ZRDA 4MKXA 4CNQA 1G17A 5HPYB 2OCYC 1A3CA 1XTVA 2AFIA 2RGGA 1IJFA 1AOXA 2VDUE 3QUCA 2IXFA 4TVBA 1SA0B 5J5CA 2O06A 3EJ6A 4YACA 5TS3A 1I1QB 2PBRA 4TRMA 5L3ZA 1Q44A 4OMDA 4Y7CA 3DPSA 1L6IA 3A6FA 4HDKA 1KAEA 1WX1A 3GLRA 3B3GA 2I76A 1JILA 3HDVA 5EE9A 2EW2A 3OX4A 1TVCA 2BD0A 1RYFA 1YZHA 2IHUA 2VSQA 5AM2A 4X00A 1RWPA 4MKIA 1DX9A 3K1TA 2DQKA 1DAGA 4AI6A 3CLTC 4PNPA 3T5AA 3WB1A 1FBTA 5G4KA 4L74A 1T36A 1X0VA 5JDIA 4LMRA 3W5JA 2WFLB 5CG2A 1YOBA 2QG4A 4WASA 3FETA 5KNDH 4R01A 4ZI7B 3LA8A 5DNVA 1BFUA 5E3IA 4YRAA 5G3ZA 3JD3A 4NV3A 3TOZA 1Z8FA 2MMCA 3F47A 1JYFA 3AESB 3ME5A 2F3UA 1JIUA 3H13A 1XE3A 1R15A 2JIBA 2JLQA 3S81A 4FGKA 1PQYA 3RUEA 3GYBA 5EMJA 4AG6A 4HDSB 5E1DA 5E6SA 1KZ4A 1JR4A 1SXJD 3ZJ4A 1WDLA 3NHUA 4P3KA 3T1YB 3LSTA 2MIIA 2DSNA 1JXQA 4MUXA 2Q3MA 3LT4A 3T15A 2XXAA 1DWOA 4IIYA 3FWZA 3LD9A 3QX3A 2Y1KA 4BZWA 1EDOA 1GY8A 3FJ1A 4RGVA 1NFQA 2P1DA 1UBMS 4IQGA 3HI6A 2W2KA 1X94A 5SV2A 2HHCA 4TRRA 3TMYA 4OXQA 2NZUG 4K6MA 4O02B 3FYUB 1YHYA 3OMXA 3FMVA 4Q03A 5EJFA 4BE4A 4F2WA 1R37A 2QRLA 721PA 3GELA 3RRFA 2HR1A 2ZSDA 3QX8A 4LYFA 5B57C 3ICQB 3RIXA 3C6YA 1XRPA 3WG9A 3IUYA 1FFCA 2HWUA 1PE0A 1E2MA 1V7PC 4RM2A 2XMRA 3EQ7A 4KI0A 2HK9A 1J7JA 1U9JA 5FOXA 2ID7A 3JWGA 3KD2A 3PQDA 4K26A 4QXRA 2YWBA 1GQRA 5BSGA 4JP2A 4GZ5A 3ORRA 1WQ3A 3G9ZA 2BONA 1XQYA 4HDSA 1NTRA 4ND4A 2REOA 4MCIA 3C5HA 3OQJA 2KBEA 1KSGA 3QUSA 4MUJA 4J0HA 2R6CA 4ZOCA 2NSHA 1FTSA 2VYVD 5BWNA 4MS4A 4Q18A 2Q4EA 1UFQA 1PFKA 4OHWA 3G5UA 5IWCA 3D7MA 4IIFA 3ZGYA 4BJ5A 4D80A 2BOVA 1AD2A 5IF9A 2HYIC 1XRNA 1QPGA 5IXSA 2OYRA 3VH1A 1QG0A 2QTBA 3FVWA 3O8OA 5JNSA 1AHNA 1N2GA 5F23A 1FY2A 1G55A 3L6BA 4MDHA 4MH0R 4I8IA 1YZQA 4MUEA 3SEQA 2IGTA 3IEXA 4RELA 1XDDA 5EKXA 3WL8A 1Q0LA 2ZEJA 3P97A 2WLTA 4P0TA 4GI3A 2B21A 4RVGA 1ZIXA 3V7NA 3G88A 3WADA 2KSQA 1RM0A 2UVQA 3RVBA 3HVJA 1NVKA 1J4AA 3MLEA 3KJGA 2V7VA 4LC9A 2RHRA 5AI9A 1EHYA 2QE7D 2ZRJA 1M73E 5F9HA 4RY8A 1CB7A 2P4QA 3ANTA 2F9MA 4AQDA 5JMOA 1X7HA 4BEWA 1VHWA 5CX1B 1GIAA 4Y3UA 3VDXA 1UEXC 2IYUA 5J5VA 5ADVA 1Z26A 5EINA 2DHCA 3FTNA 1XTIA 4EX6A 2OFWA 5FWXB 1TZJA 2C77A 5A4AA 4ZHQF 4F85A 1VSQA 1JB1A 4ZO6A 1S96A 1EJ2A 4YV1A 4UFPA 5HZGA 5IG2A 4EUHA 4JEHA 2H3HA 4K05A 4LCEA 2IA5A 1J20A 1M6YA 1TUBA 1VGVA 4NFHA 3OQMA 2A9JA 3ZQKA 1TQDA 3P9YA 4ADSG 1PR2A 2IDZA 2VWQA 3GFBA 5FL7A 4RDXA 4BGDA 4DCTA 3NIDB 4DQXA 1ACLA 4HUQA 1CJVC 2BW0A 4KQ1A 1Z74A 1SC3A 1VQ1A 3FHCB 3JZFA 3K0BA 3N5KA 4LJSA 4TMWA 4ZD6A 4XVUA 3LZ6A 3AUTA 1Y4DE 2UUAB 4CM6A 4YFYA 1EEHA 2NXJA 2P91A 3EAFA 5JCOA 3QLVA 4TXJA 2MSWA 2XE7A 4C14A 3U09A 1XKQA 4FNMA 5TNXA 5IJ9B 4JZYA 1FVHA 4QYIA 1V8BA 1DRJA 3O4IA 3UJ7A 3B38A 2R5NA 5EHIA 1L4KA 2IHBA 2C2GA 3EVCA 3F7OA 2P2LA 3GB9A 4OHXA 4RAOA 4UU1A 4Q7EA 5ICEA 3MINB 4GX1A 4WTOA 5EKTA 4Q37A 2FLWA 1FVFA 4W7SA 2HNKA 3QG1A 5K6TA 3WAGA 1YACA 5TQ0A 4DLNA 4EW2A 2X9QA 5AKJA 4QQNA 5FO0A 2GF0A 1BCRA 1J9ZA 3FR7A 4ETIA 5A5DA 2IYYA 1CG6A 4GF5A 4XJVA 3C6BA 3L06A 1FJ2A 2QROA 4NOLA 3OOHA 4HS9A 4NPAA 4P5PA 1RQRA 1TOAA 4KO3S 4OQMA 1HNNA 1SKBA 1UJNA 1PW7A 1TD9A 4HZUB 4KXYA 1AIPA 2IYVA 2PWAA 3FBTA 3VMFA 5IWAB 3DD5A 3K20A 2QQEA 5GADl 2YMQA 3M1LA 3LPDA 3CVJA 1Y8RA 5IVIA 1E0DA 1VJ0A 2WK1A 3MELA 1DEAA 1Y81A 2QZPA 4H31A 3QP9A 2FFBA 2JIOA 4PZLA 2GZ3A 1EA5A 2I6XA 3C39A 3OPXA 3P45A 5IYZA 3EIOA 1RM5A 4FZ3A 4EA9A 3AP3A 4CF7A 3OZUA 3QBTA 3SJ7A 3T06B 2A57A 1JL3A 1EFDN 2UYOA 4ZZ2A 3G5MA 3ZX4A 4E32A 2ECOA 4D8UA 2R7KA 5TQ0B 3HRHA 1LDEA 1PJBA 3K9WA 4LOHA 4CUKA 4WLOA 4QPPA 1CDEA 1NOIA 4EHFA 2PS0A 1UM9A 5CYPA 3GVHA 1LFAA 3FSGD 3TQIA 5JC1A 2FPKA 3HM9A 1HUQA 1V5WA 2I0FA 5L53A 2C2MA 1YDMA 1SVWA 2FMIA 1HMYA 3DVAA 1B00A 2UKDA 2D0IA 3GDFA 3Q3EA 2YZNA 3SDZA 4J9UE 2RH9B 3SQNA 4BIMA 4MARA 5K05A 1VRCA 4ZEXA 1ABEA 2WE8A 1PYGA 3TNYA 5DX1A 4DA8A 1C8LA 3HACA 2BEWA 2Y0PA 3CCBA 4JI7B 1U7UA 4N7JA 4PAGA 1VYUA 2R68A 3OZAA 2ZBFA 3I6BA 1OASA 3QWAA 5FUXA 1GAJA 1G5TA 4TN1A 2Z04A 4M1OA 2J3HA 4BMXA 4R3NA 4H6XA 3FNBA 3GWZA 4DMMA 2QMUA 2XXJA 4QTZA 4RE6A 1ZGZA 1WHSB 2ZJ7A 1FYEA 3L7MA 4IEEA 4QQKA 2DR0A 5HKKD 3UW1A 2IYAA 2PSEA 3F98A 3MOGA 4AJ2A 2PMCA 1NWCA 2H2IA 4P84A 1SZCA 1AURA 4EF6A 3ZW8A 2EX0A 3SFVA 3TKYA 3JQ7A 1KR5A 3ETHA 3GGDA 1EWYA 1ODJA 1FFSA 4LVOA 3USZA 5LOVF 1DKRA 4YB8A 3A9WA 3U13A 4ZZ1A 1U3TA 4FE3A 4KR2A 1HA3A 2PXAA 3CPHA 3DE5X 2ERCA 4PRKA 4W7IA 5CRIA 4HB4A 4KKXB 1ZS9A 2QV0A 3K9FC 3CUKA 3UAYA 1E8DA 4XM2A 2JRCA 2VDWA 1P0MA 3GARA 2X86A 1S1MA 1WPQA 1HE4A 3I73A 3M4NA 4ML3A 4HATA 4K6HA 3CF4G 3WMEA 3R77A 3IKLA 3KT8A 2JLRA 4TVOA 4H6WA 4YCDA 3KVYA 5FWDA 1FXWF 1Q74A 2FETA 1GKLA 2ZROA 3HGQA 4PTZA 2Q6IA 3PRYA 4LWOA 1TEZA 4G1FA 4GO1A 2X5NA 1ATZA 5BUCA 1Y5LA 4L8GA 5H9WA 4LV8B 3H75A 3D4PA 3FCOA 4KBYA 1GTL1 2XIJA 1X7WB 2QQGA 2CNWD 1MJGM 3IDFA 1RWXA 3L84A 4FHDA 4GR9A 1NJGA 5E4FA 1C0IA 2BFEB 4O4JB 1L5HA 4H4DA 1TYCA 2WYHA 2ZCUA 4NNOA 1GUAA 2UVPB 1VIYA 3R41A 2A8YA 5BORA 2JEYA 2P4HX 3QTLA 4CIVA 1UMCB 2VJQA 4TS4A 2BL4A 4ZP1A 3OZRA 5DN6D 4FNGA 1BXRA 1SC9A 1SOAA 4IGAA 3VVBA 3P9KA 2V7WA 4JYPA 3CUSA 1M1YE 2H54A 4POOA 4HVTA 2VUSA 1BMFD 1U5BA 2AEEA 2F17A 1I2ZA 3GRCA 2IYNA 2V9PA 4GOMD 2VH1A 5EG5A 1Z83A 3HU5A 4PPQA 3SYRA 4CCSA 2IYWA 2NZWA 4BNIA 4YR9A 3ZVKA 1P0QA 1HYQA 2P68A 5JSFA 1W0KA 5GINE 3LDUA 4UVEA 3ONFA 1ZN2A 4P3XA 4CV0A 1D2EA 3CF0A 1PS9A 5EIWA 4CMEA 2I4TA 4I08A 4L15A 1OR8A 4YAOA 4EY7A 4AP9A 3IXLA 3X0DA 1BX0A 5A4IS 2D1QA 1ZH6A 2DFTA 1NNSA 2YWRA 4BX3A 1KTIA 4V2UA 1H0RA 2UVPA 1MIOB 1IQPA 3DC7A 2G4CA 3HDGA 4IVNA 4NBSA 4XIFA 3DHWC 4EUSA 4GX2A 1QX3A 3NWEA 1O6GA 2BEUA 5BUZA 1V9SA 3CF2A 3RM3A 2QMEA 4UM9B 1ZG3A 2AJBA 4CL3A 1BXRB 1X1BA 3QX9A 3QXCA 4MUKA 1PX2A 1P75A 4O2AA 3OIGA 1E3MA 4MV7A 4LC0A 1O1YA 5AW5A 3NM4A 4Y1FA 1Z62A 5HKBA 4G9EA 4QAQA 4LOLA 4RM3A 4RS4A 2AG0A 3S5JA 4CFZA 4E4TA 3I5MA 2GARA 3ZZNA 4LRYA 3AF0A 1H8HD 2VJBA 4JAVC 5EHQA 2JI6A 1XMQB 3ZLJA 1DARA 4EKDA 1W94A 2J07A 5A1TA 4PHCA 4ASUA 4Z9AA 1A98A 4MMXB 4OHMA 5BQ3A 2HXGA 4LX0A 5G4KB 4GS5A 2H31A 3R23A 3VDNB 3VZRA 4YCNA 5CLQA 4DV6B 4EY6A 1D7AA 3N3AC 5K0NA 5IC5A 4WX2B 5B7NA 4ETNA 3PJRA 1BU5A 2C2ZA 5A3SA 1VKJA 3RKRA 2Q3DA 3V4RA 5DP2A 3DKPA 3U39A 2CNNA 3QI2A 1FS5A 3ROMA 3SFZA 1AQ6A 4UHFA 2VF7A 4OLHA 2XADA 1LC3A 2P65A 1P1IA 3DEAA 1IJEA 2CZQA 3H9QA 3HFGA 1PJ8A 1UBUS 1ZMBA 2RGXA 4I2NA 3TW8B 1Z4OA 4QARA 4PAMA 3GUHA 1NRXA 3F4BA 4OHBA 5E7QA 5FYQA 1KE1A 2ZM5A 1E3QA 4GPZA 4MVXA 4YT8A 2DBQA 4O2LA 4B3XA 1PSWA 2Y93A 1WVIA 3TFWA 4BDTA 4F3YA 3FRHA 5TMDA 4DDTA 2C3PA 4AQYB 1VG1A 2CYAA 3IQZA 1CYDA 4I46A 1N8NA 3W3ZB 5KOIA 1YQWA 4FNAA 4O4HA 1V0JA 2ZUVA 1EM8B 2A9FA 4C06A 1JW9B 1KXJA 3KTAB 2VAVA 2OFOA 2Y99A 5TT0A 5JSQA 1TCCA 4ZT5A 2N9UA 4BWGA 2R4TA 2SICE 1YKSA 2F64A 1DBVO 2J3KA 3IB6A 2O8CB 1AGNA 3RVRA 4FYPA 3GF4A 2IY7A 4HOYA 4A23A 5JYDA 4KR6A 4FD2A 5D86A 4XUGB 4JMPA 4CTMA 1XC7A 5LBUA 1XD9A 4MYRA 2AKAB 4OP1A 2W2PA 4PZZA 4Z54A 2EZTA 3CLVA 5F7OA 1U7WA 4HDNA 2I6FA 1Q16A 1P1HA 4AP5A 5KREA 1JJFA 2FEKA 4AUKA 3OZTA 2DPYA 4JP5A 4JZKA 4NARA 3WISA 4CKYA 4DC9A 1H2HA 2LD4A 2EATA 5EPOA 3OIWA 2FUCA 3R40A 3U9LA 4C5AA 1XEWX 3M9WA 5JRJA 1MJGA 1Y33E 4ZYYA 1JFLA 4UXHA 1T3LA 2OO5C 5B1EA 3RC2A 2QX8A 2CEAA 3GGJA 1JIXA 1II8A 3LDGA 5E2AA 5EA2A 2C0CA 3S2GA 5ITZA 1J2YA 2ZIAA 3RTDA 2WU0A 3U3XA 4EVSA 2IHNA 3MMZA 4LCBA 4RIIA 4OIFA 5PGMA 4TL7A 4UE2A 3I53A 3RDPA 1E0AA 4UUOA 2P79A 2DKOA 4QDJA 1IONA 5DEIA 4Y0VA 1XLTA 2X42A 3OU2A 4BFYA 3GEPA 4K8RB 1Y3DE 1TLLA 2WF5A 4II3A 4HRXA 2UYQA 4E1AA 3QTTA 3QY0A 5AI8A 5BW6B 3MF4A 3E3MA 2XOKA 4TKUA 1P4SA 4NYJR 2OENG 3EIEA 3FSJX 2WYUA 3P9ZA 2EGUA 3T1HB 4NTZA 4DV0B 4C4ZA 2QPLA 1WNFA 4KLAA 3O2NA 1A9QA 2EEPA 2IDKA 2NZVG 2XHZA 3LBIA 5BN4B 3H7IA 4WXPA 4RJKA 5KYYA 2OFPA 1TO6A 4BV2A 3L8DA 5A02A 5GOTA 3JV7A 3MWDB 5BNFA 2Q5FA 3NGLA 4PCLA 3FI0A 3PUZA 4B33A 4XWTA 1OXBB 2FPLA 4RTPA 2E4UA 1U9IC 1TM1E 3I6MA 2H9IA 3LOUA 1FW8A 1V11B 4KIGA 2D2VA 4RTRA 5CCEA 3LFUA 1GADO 5DH9A 2YXDA 3A27A 3H11A 1EDBA 1HOTA 3LHKA 2Y1LA 3CJRA 4EDHA 3IE2A 4V3BA 3BMNB 3GUYA 1LI5A 3H1EA 1WZ2A 2B35A 1WXDA 1Z6TA 2GPTA 2XWBF 2AW3A 1A2BA 2WUVA 2YJ4A 5ILGA 3U31A 1THMA 2J9ZB 4KPEC 1R5NA 1IDN1 2B92A 4FE4A 1IATA 1UBGA 4MVJP 4EI7A 5JS8A 1ZONA 4ZQEA 3CPJB 2XB9A 4G0ZA 1K08A 2VJOA 5D1NA 3GLHB 3ONVA 1UWCA 3RG8A 5LQCA 3R3SA 3TEJA 4WNAB 1TI7A 1Y9ZA 1YFJA 3AEYA 2WIAA 4WA8A 4HNAA 4MVCA 3UT0A 2VHVA 3NC1C 3ZW7A 2AWNA 2WPDA 3IDQA 3L02A 1IIRA 5SY6A 5A5EA 3GH1A 4FONA 4L7QA 5L3QB 2NU7A 4MR8B 5J9FA 2O59A 1RWQA 5EQJB 2OGUA 2QW0X 4F93B 2FSPA 3W79A 5DNAA 3WYCA 1N6OA 1XI2A 2JHCA 3NVAA 5CH8A 2V96A 1A9ZA 1OHHD 2WAYA 3CA8A 3P96A 1V71A 4MV3A 4OFZA 1XTTA 4NOKA 4QSMA 3TH5A 3V8BA 4A82A 3UWOA 1U6JA 2RGNC 2VHTA 2Q5CA 4JEMA 4XPZA 1IK6A 2PX4A 2R60A 4DLTA 2ZQYA 3A9VA 4F5ZA 5B2EA 1G5RA 3K70B 1NXPA 3PD0A 1Y7IA 4WDRA 4F5YA 1NF8A 1T0JB 2P2ZA 4OQNA 3ICWA 5AJUA 1T9CA 2P0EA 4H17A 4Q9LA 3ZJVA 1DBRA 1E58A 2O8DB 1Q11A 1BE0A 4KYIB 1PEDA 3C41J 4PPYA 2IU4A 1TA4A 2I78A 1K92A 2R751 3MVEA 4MO2A 1U04A 3UAXA 7ABPA 1IIBA 1L4NA 1JKIA 2P6NA 1WPXA 1RYZA 2X6TA 4JOSA 3RU3A 3W7BA 1V37A 1H0HA 4MEBA 3A58B 3GGOA 2I87A 1R18A 5FWYB 1RRCA 5B30A 3CLUD 4MQEB 1A1SA 3UBMA 5TT1A 1MB0A 1WHTB 2C94A 2XT6A 3IQIX 4KRFA 1FSPA 3NYRA 1SBZA 4ZYZA 1DAMA 2XVAA 5JAHA 1CJTC 3FZGA 3KQUA 1U98A 3KQSA 2BTEA 2B9VA 3QVLA 4MPTA 3IILA 4DIMA 1WSBA 2KJQA 3EQZA 1U11A 1NVTA 2OBNA 5HE9A 3ZBPA 4ARCA 2CNKA 3N0RA 1GG8A 5EZSA 3IV6A 4JH0A 3G2KA 1Z07A 3W6ZA 1UMCA 4A2PA 4GM4A 5IPFA 1LA2A 3O82A 3HEAA 1B41A 3JYOA 3VRHA 5K5EA 5FLKA 1XAJA 1N6NA 5KWVA 3TLEA 5CFOA 1RI3A 3H2ZA 2W2NA 1T1GA 3ECSA 5IMSA 1IMOA 3LCUA 1CJCA 1I2CA 2V7QD 3BE4A 4M1ZA 1G6Q1 5AJHA 2C7BA 3QPCA 2PX2A 2EJBA 1R66A 3N7TA 3BWVA 4DE5A 4OK5A 1VB3A 4HXGA 1Y6RA 1SUWA 1E64A 4MUMA 1E3IA 3FX2A 1Z82A 2WUDA 3DMYA 3PITA 3KUCA 3FN4A 1NYTA 4YJHB 5U9CA 5IX8A 2NACA 2JGIA 3RUDA 2Y05A 2WINI 3FRIA 3ZDYB 4AX4A 4CU2A 2CK3D 1WBBA 2PSHA 3R1IA 2LCQA 4K81B 4AKHA 5T3UA 2GPNA 2QG9A 4P0QB 2ZM6B 3K3PA 3HWWA 3EZGA 1C3VA 2HK7A 2N3ZA 3GIWA 3CV3A 1T29A 3EGWA 2NQ8A 4R0NA 4UHKA 4JGIA 1FA9A 4WVLA 3FYHA 4ERXA 3S3TA 3WJAA 2BE9A 2RHHA 1QXSA 4WZAA 1BKYA 3VTFA 3PHGA 4Y8VA 2NTVA 5BUSA 2ZBUA 1Q1QA 1L7DA 4LGVA 4JMLA 2PKRA 3I6YA 4JLKA 1E1QA 1EG7A 4HH1A 3T5BA 2AVDA 1UDXA 2IVZA 1FLDA 1EE9A 1WW8A 1X7ZA 2I29A 2QOEA 3BMXA 3N0XA 4B9AA 3KQLA 4DDUA 1H8HA 1RIFA 2BFMA 5A4FS 2YJNA 2YIJA 3LNCA 3OTOB 3PA6A 3MZ0A 5JNWA 5CITA 1IEVA 3E48A 1IN4A 3A4VA 3SK0A 2FLKA 3AXTA 3H17A 1ZH0A 5ENVA 4DN6A 3RVQA 2G5PA 2SHKA 4GPTA 4FYXA 2G1AA 1WEKA 1WULS 1YGYA 4RTJA 5LNK6 1GSHA 5JSKA 3BBLA 5IM4A 3QFSA 1HRKA 2BLNA 1U0BB 4AT1A 4F1WA 4AJ1A 5C1BA 1C3LA 1H5NA 1Q1BA 1U5CA 2PS3A 3DMTA 5FUMA 2QL7A 1ADFA 2ZWOA 4WZAB 5HBRA 5EIAA 3O9MA 4CM9A 5HKAA 2OHJA 2RMKA 3M8KA 1CHNA 4LJLA 1XL1A 2AG5A 5G4LA 5JAUA 3ZCQA 1N2SA 2NV0A 4X3OA 1AB5A 4MI6A 4DABA 2EWVA 3AHDA 1IAQA 1Z5VA 3CXUA 3GIDA 4GKVA 3V4SA 2QIPA 3F74A 2NUTA 3VR4D 1GT6A 1R4NA 1XD2A 2YQZA 3STYA 2PH1A 2XCOA 5HEKA 3GVCA 4MDEA 2EKZA 1LPPA 2RSLA 3PJGA 4J16C 1I4EB 3UXEA 4AY5A 1GVHA 4A1OA 2VQ6A 1FU4A 5F12A 3T1QA 2FJUA 4BIIA 3ZJTA 1O9HA 4TMKA 4FFPA 1EFCA 3SOZA 3N8DA 4WVFA 1RACA 3N07A 3QOFA 3NFRA 3QIVA 1WPGA 1Q20A 1WBDA 3ZBUA 2LBPA 3S28A 2QSYA 1TQ8A 2BFBB 3E35A 3L0OA 3TI7A 1R6AA 1ZI6A 2TS1A 1DXOA 2RDMA 5H68A 1YRAA 3AHFA 4WPGA 1J0CA 3VPBA 3U1VA 2PRKA 1CS0A 4LBZA 4IJ6A 3QYJA 1ELOA 3F6SA 2Z9BA 4I81A 4IDCA 3QQ5A 2FFHA 4F2HA 3ISJA 1SKYE 4D9KA 5JXIA 1N36B 3VPCA 1N0IA 2ZG6A 2IHZA 3ZU6A 1E8NA 4Y2QA 1O89A 3LY9A 1VA4A 3U17A 1YR6A 3MAAC 2W98A 1VJRA 3BRSA 2JZOA 4R1LA 3DBIA 1A1VA 3UGKA 3WI7A 5EMKA 4CTNA 3B82A 4FFNA 3CNBA 4BO0A 3CVUA 2NADA 2ZE7A 3FHOA 1T1JA 3Q7SA 4Z51A 5CDYA 2LP4Y 4UXJA 2CT8A 1F8FA 3QV2A 4MYTA 3NAZA 5ALKA 3GMDA 3R7FA 3D6NB 3MSXA 1JJ7A 1ZNQO 3E9RA 3HB1A 3OKAA 3QTBA 4IOKA 2MSLA 4N3AA 4P4SB 4E5UA 5LD2C 3MWDA 2YV2A 2I1QA 1T25A 4C7VA 1HE8B 1E60A 3FMIA 5FNVB 4UNQA 2QB5A 2AL7A 5EERA 2BDTA 2HJSA 1I2AA 4NMMA 2VDLB 3LC1O 3VZSA 4AU1A 1B6SA 5A6VA 1QBKC 2E4YA 3IQGX 4C4RA 1B2RA 4U1RA 2W70A 4ESHA 3THWA 1EVYA 4MLZA 4NJMA 3OQIB 4FT2A 1XVAA 5BSMA 3D0RA 5FWAA 2HQ1A 3AEKA 1ORDA 1JIJA 1RNLA 3T7AA 4M0MA 2AXEA 3VKUA 1IUKA 5CIYA 4G5GA 1UBLS 1GNQA 1KIFA 2V7TA 4EATA 4Z8YA 3HR8A 4TKVB 3KOOA 4M21A 2A3RA 1SCKA 2VNKA 1YVDA 4B31A 1CCWA 2JLVA 1I3NA 4MRMB 1NW3A 2MDTA 3MGGA 4P92A 2XT9A 1CUDA 2O5RA 2OG2A 4MDYA 3LWBA 1D6SA 1YK0A 4GKAA 3NJRA 2AF4C 1JGTA 1N7GA 2JHAA 2GZ2A 2J48A 3MJFA 5C0OE 4BFZA 1WZNA 3CW2A 1G2QA 5ES3A 3WOVA 3I32A 3C85A 3VKHA 3W9UA 1JFFA 3PFFA 5KOHA 3O93A 4G36A 5K7SA 3LT0A 1P45A 4TGLA 1PDVA 4R8RA 1Y6ZA 3PFHA 3IAM6 1MAWA 1OFHA 1QM5A 2PRYA 1FPMA 2W43A 4GNKA 1XJCA 4EJSB 2GCIA 2ERYA 3NB0A 3P4YA 5K6AC 4X71A 1SULA 3Q2KA 5KWIA 1USWA 3LL4A 5DSXA 4FP9A 4NC9A 3SM9A 2QD4A 4MGEA 1R16A 1KETA 4W6QA 5EUQB 3U1BA 5DWDA 3EX7C 2BIFA 2QRJA 2B25A 2X41A 1G4AE 2NUAB 1JX6A 1FTGA 1LBTA 3TUZC 3KZ1E 4JGBA 3SLKA 4F3NA 2A33A 3REQB 3NDBB 2ZJZA 1TTHA 5IU6A 2IHTA 5EMNA 1PG5A 1X7YA 3ORSA 4KODA 1OTXA 5F2KA 4ZYUA 2WPNA 4XVRA 3BX1A 2GDJA 4IV0A 4ZA2A 3OICA 4C01A 2VKTA 4MGYR 2FSHA 3OZCA 4GKKB 1AXRA 4NVRA 1JIVA 3BMCA 2VJCA 3L0YA 3ZD7A 2IOFA 4DF3A 1HDZA 1JHMA 4XSVA 2XPCA 2ZQ5A 1EBUA 1EK1A 2FMUA 2HQOA 2P11A 3I01A 4OI1A 3DP7A 3OCZA 5IVKA 1ZMOA 3LLSA 3WNQA 1BG6A 4IVQA 4MYCA 3VHLB 1BHSA 4CM5A 5LA6B 2BGKA 3NAMA 1RWOA 2NZ8A 4YCMA 3K0SA 6ABPA 3CGWA 1P4HA 4DCPA 4Z4EA 3EIXA 1CUWA 2AH5A 1WE2A 1YWGO 2PMDA 2ZIXA 4ZQHA 3WMFA 2EDCA 2E1PA 4UOQA 3M5PA 1RPZA 5ITWA 4EENA 3BXEA 4LAFA 5IBPA 2A3NA 4BNJA 1N7HA 3C4JA 3G0BA 5FEUA 1U3UA 4O4IA 3K9CA 4PQRA 2QJTA 3OCYA 4P83A 4X64B 2C98A 3OOSA 1QHNA 3ZHUA 4OFBA 5K3EA 1D2NA 2FSVA 5FTMA 2DE0X 4J0QA 4KWCA 1RJ9A 3IT3A 4OXIA 2ICAA 4DJAA 3CO5A 1H23A 3IUPA 1HT2E 1K3TA 4P7FA 1T8PA 2JGLA 2OCPA 2OHHA 3FOBA 5EYPA 4RXUA 4NWIA 1HFJA 1IWPB 2QZZA 2ETXA 3NALA 4GDMA 2UZ3A 2EXXA 3W5DA 3TG8A 3GRVA 2C8JA 1P9RA 4BKQA 4HNUA 1LEHA 2J0UA 3KVOA 1M6EX 3S2UA 4X66B 1CJUC 4M1MA 3NT4A 4NATA 4RSHA 1K6IA 1ZVJA 1PWHA 3TTYA 3KYCB 4L4YA 1P2FA 2JATA 2DT5A 4JVSB 5F1PA 4YJ2B 3WYBA 4CR6A 4CTKA 4DQDA 1L4MA 4C21A 2CC2A 2XNSA 3R3JA 5DDIP 1TUEA 4RTKA 2A94A 2FK7A 3EMVA 3V8MA 2BTQA 1HZJA 1VIMA 4REQB 5C32A 2GN9A 4G0PA 5DLEA 2FUNB 1S9HA 2QQFA 4FC7A 1QK5A 3NTRA 3TTWA 1PNQA 2DUUA 4LSWA 4JI8B 4FIZA 1PI3A 2WWTA 2EJWA 2Q8QA 3PC4A 4LTMA 1EUZA 2CXXA 4PBTA 4B8YA 1U0TA 4EW1A 1ZI9A 3DOJA 3R0IA 4ZOBA 5BR1A 1DIGA 1RAIA 1FW6A 5EQTA 1I3MA 3LQFA 4KNWA 3TW4A 3VI3B 1QE3A 3AIOA 1KZ1A 2ZKIA 1JKJB 3KZOA 1JIIA 3EQ8A 4HSEA 2CYBA 4OQYA 1KEUA 4GR4A 3ENZA 2JJ8A 4Q93A 3T4EA 1DINA 1AGPA 3EXFB 3NOQA 4YP1A 2IUSA 2C29D 3JD1A 4RNCA 5CIWA 5ECYA 4CLXA 2HSZA 4IUBS 4UUQA 2HF7A 3GPDG 4KMOA 3VX3A 1X7GA 4E3ZA 4CG1A 4Q66C 2B36A 1GYPA 2IY9A 3S6JA 1TKAA 5CCBA 3G2HA 4K6GA 1VP9A 1MBZA 1LK7A 2HSGA 1F2TA 4Q1CA 5C9ZA 1E6KA 1E9DA 5EN4A 3AO0B 3ESDA 4KN6A 4UM5A 1DO2A 2IUEA 3PT9A 1HYEA 3CZMA 4FCTA 4KIJA 4HBGA 4GZ3A 1AO0A 2CMDA 3NBYC 5JZBA 1NQTA 2WJZB 3P2KA 2BDEA 4WOJA 4DLLA 1IFXA 4PFQA 2ZDHA 2GXSA 4XWGA 2R6FA 2WZCA 5EKUA 4I55F 4PGGA 2ZDGA 2QUAA 2N42A 2RGCA 1S9DA 1JT2A 1ZIDA 4PCVA 2R1TB 3GJXC 3I05A 1UKYA 3FZEA 4R8VA 3G6KA 2BUCA 2O23A 3W2GA 2XECA 3G79A 3K0HA 3A3OA 4IJ5A 5DXAA 1MDFA 1YU6A 4OXKA 2WIBA 4RH1A 1RYDA 4I1VA 1YZLA 3MWGA 2FFAA 1XYGA 1ZJ5A 3CN7A 1P62B 3BFXA 3OU6A 4ZN6A 3B8EA 3CJQA 1EBFA 3HCNA 4L3VA 4K9LA 5KVCA 4L9RA 4KUEA 4R1TA 1KMQA 4DHWA 4DLVA 5AHWA 3O8OB 3TM4A 1SIOA 5DIZA 4PLYA 3AINA 3HCAA 4S1OA 3RAFC 4PSKA 2WKPA 3CVOA 1L9XA 3WGVA 4IQ4A 3QNMA 1BDIA 4ND1A 4AP6A