3FLEA

Se_1780 protein of unknown function from staphylococcus epidermidis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
245
structure length
243
Chain Sequence
b'KTTATLFLHGYGGSERSETFMVKQALNKNVTNEVITARVSSEGKVYFDKKLSAANPIVKVEFKDNKNGNFKENAYWIKEVLSQLKSQFGIQQFNFVGHSMGNMSFAFYMKNYGDDRHLPQLKKEVNIAGVYNGILNMNENVNEIIVDKQGKPSRMNAAYRQLLSLYKIYCGKEIEVLNIYGDLEDGSHSDGRVSNSSSQSLQYLLRGSTKSYQEMKFKGAKAQHSQLHENKDVANEIIQFLWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of SE_1780 protein of unknown function from Staphylococcus epidermidis.
rcsb
molecule keywords SE_1780 protein
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 67
structure length 243
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fleA00
3R40A 4BBZA 3E0XA 2XB6A 1QFSA 2V97A 3ED1A 5AKLA 3UUEA 4X90A 4CG1A 1XZAA 3NOXA 1K63A 4BVKA 4RE6A 3KXPA 4H35A 4DSZA 3H18A 1B41A 2P8SA 1W76A 1L7QA 1NU8A 3OC0A 3T4UA 5ALIA 3G0DA 3MGAA 4QEKA 1MNQA 2B20A 1YA8A 3SX4A 4TVKA 3BE8A 5AP9A 3X3HA 5D3KA 3OM8A 4Q05A 1U8EA 1MT3A 3C45A 3PF9A 3WL5A 3WL6A 4BE9A 4MEBA 5EHZA 4LIPD 1GKLA 1WB5A 1IUNA 3IB3A 3E4DA 2DFPA 1WOMA 2BCEA 5A71A 3O9VA 3FVRA 3C43A 1LPPA 2GZSA 2HRQA 2PX6A 2CZQA 4XWGA 3I6MA 3KWJA 4ITVA 5AKEA 1SCIA 5CT8A 1HL7A 4CIBA 2JGJA 4J0GA 2HA7A 3PE6A 1CUHA 3BIXA 1EK1A 5KREA 1NX9A 2EDAA 4J0KA 2JGEA 4BAGA 1CUFA 1ZD3A 2PSFA 3QITA 4EY6A 4X95A 4H7EA 3WJ2A 4JH0A 1EI9A 4HS9A 2VJBA 1IUPA 2ZJFA 1AGYA 4UHEA 2OCLA 4JNCA 1IZ8A 5F4ZA 2HL6A 2K2QB 2QZPA 3NUZA 5AK5A 1X70A 1XZKA 2Y6VA 1A8SA 5FP0A 1DWOA 5JAOA 4AX4A 4U2FA 3HYSA 4Y2RA 5EHXA 1FFDA 2WIKA 3R3UA 4EHBA 5AKJA 3CXUA 4CCYB 1FSSA 3G0GA 4HRXA 2ECFA 2I3ZA 4WY5A 3C6ZA 1JKMA 3VXKA 4HRYA 1FFBA 4HXGA 2JGMA 5FPPA 3WL7A 4F21A 1XZFA 2H7CA 2QT9A 3G8YA 4G4IA 1H2ZA 2QRUA 1XZGA 4IHAA 1O6GA 3FVTA 4X00A 3DEAA 4KAAA 2HADA 3WKEA 2HM7A 4B6GA 5HCUA 1EH5A 1ACLA 4FHZA 3M3DA 1GPKA 3QPAA 5SYNA 1HBJA 2OAEA 1LPBB 1K4YA 1LZLA 3QVMA 3FWHA 2OGSA 4WFIA 4H18A 4AO8A 5CT4A 1LPAB 3STWA 5K3EA 4F5ZA 2PUHA 5A62A 3K6KA 3WLAA 1GQSA 2GYVA 2RHWA 3G0BA 3V48A 2HA5A 1QIEA 5AI0A 4X7BA 3HEAA 3LLCA 4CCWA 3DJYA 3FAKA 3HZOA 3JW8A 1P0PA 4DLNA 5A2GA 4AMZA 1R9MA 3I28A 3HABA 4X3CA 2XLBA 4PF1A 4OYLA 3VJMA 4MJ3A 2VA9A 2CJPA 1C7IA 1AUOA 3D59A 4FLEA 4HVTA 2GBFA 2HU5A 4GW3A 4U2CA 1LLFA 1XLVA 5EIHA 3DOHA 1YB7A 2QKYA 1IZ7A 4X71A 2Y2UA 2OQIA 4UBJA 1XRQA 3F9CA 2OQVA 4KE6A 3H2KA 5EHQA 3DLTA 4H7FA 4G1FA 4KRYA 2RONA 5ALSA 4FNMA 2X76A 1BS9A 1E5TA 2O2HA 1H22A 5AIAA 4AZ3A 3VVLA 4IO0A 3PUHA 3A2LA 2WLSA 4W1RA 1CUDA 1CUZA 1Y7IA 1ORWA 3DL4A 5LYYA 5A7FA 2ZYIA 2BUAA 4YASA 1CUAA 4E15A 4P08A 1HKHA 3WMRA 1QIJA 2ES4A 2JGKA 4AN1A 5T4BA 3KWFA 5KWIA 4J0CA 2G63A 4DMKA 1Q0ZA 1FJ2A 4G9GA 2DHCA 2WJ4A 2EDCA 3FNBA 1USWA 1HPLA 1JJIA 2XMRA 1BCRA 3GFFA 5AM0A 3AZQA 4AXBA 3EQ7A 4IH4A 4BCBA 4ROTA 1GPLA 2JEYA 4GHWA 1MU0A 2WSLA 5CMLA 1KU6A 4QDTA 3STXA 2YASA 4NZZA 3K9BA 3FYTA 4I19A 3AJAA 2ACKA 2WIJA 4KACA 3WK7A 2XUPA 4N8SA 2WKWA 1A8UA 3PI6A 3C5WP 2XDWA 2WG0A 1Q84A 1QIGA 3C70A 3WK5A 1WHTA 4W1QA 4X91A 5DLPA 5LZ7A 2OCKA 4DMFA 4QDUA 3WZMA 4CIAA 3G9ZA 1D07A 4LYDA 5D6OA 5JARA 4GI1A 1MTZA 1KEZA 4IH1A 1AURA 4LYEA 4Y2TA 5IVHA 3WK8A 5DYTA 3WIBA 1JMYA 3EIOA 3DD5A 1E8DA 3S2ZA 1H23A 1EDBA 4FNGA 1SC9A 2VEOA 5LZ2A 4QE3A 3OURA 3OG9A 3AZOA 4Y2UA 3I2JA 1GGVA 1LPMA 1RYYA 3FYUC 5SYMA 4UBKA 3DS8A 4PQEA 4MQLA 4XVCA 4C4YA 4HXFB 3RKSA 3D2AA 4ZXFA 3TEJA 2V98A 5ALJA 4AQDA 4N5IX 2PSEA 3DOIA 4H7IA 3F97A 3D2BA 5AKKA 4X6XA 2RAUA 2VT7A 2RI6A 4KRXA 1Z68A 5HK9A 4WY8A 1UWCA 4CFSA 5AM1A 3YASA 3ESBA 5K3AA 5CRIA 1UZAA 1VLQA 5AI9A 2E3JA 3LCRA 4ZV9A 2XI4A 2VSQA 4GWLA 2GYWA 4U2GA 3WK9A 3R3XA 5DNVA 2RGUA 3AILA 1F0NA 4F60A 2YYSA 3G9TA 2I3DA 3I2HA 3GUUA 1AMNA 4Y2VA 2OG1A 4CG3A 2QUBA 5ALRA 1DWPA 2ZSIA 1J06A 3H2HA 1B6GA 4OYYA 4BDSA 4H7DA 4DNQA 4UFNA 5AICA 1CUSA 1ZGCA 1DQZA 4H77A 4Q1VA 1N8SA 5YASA 2BJHA 1GT6A 1ZI9A 4EB0A 1UK6A 3DYIA 1EXWA 1ZIYA 1XZHA 4YPVA 2XMZA 2PU5A 1XRLA 2XUIA 4UBNA 5BWCA 1JJBA 4W1SA 2HA6A 2OCIA 4UFOA 2WUGA 1DQYA 2XMSA 4NMWA 1YS2X 1WCYA 4J0IA 5ALMA 4BAZA 2JBWA 1JJFA 2W6CX 4X6YA 1AKNA 5LZ5A 3RK4A 1BEZA 4BRZA 5JAHA 1ETHA 1LPSA 5CXUA 3N0TA 4BCDA 2DQYA 1LPOA 2CMFA 3G0IA 1VA5A 1XKTA 5AJHA 1WM1A 3O4HA 1NU6A 1QIHA 1EVQA 4PSUA 4N5HX 1UK7A 2XUJA 3CCBA 5AKZA 3O4IA 5D7BA 1PFQA 5JANA 4UHCA 1UT6A 3FLAA 3QPCA 5CBKA 3QBJA 4X93A 3STVA 5AKXA 3T52A 3P2MA 4OSEA 2AXEA 5FV4A 1CFJA 3F8SA 1OILA 4J03A 1TCAA 4UHFA 3V1LA 3I6YA 3H2JA 5AO9A 4UFPA 5HFAA 4U2DA 1LBSA 4Y7DA 3D3NA 3WA7A 3IUQA 2BGRA 1DX4A 4LXHA 4QZVA 1WPXA 2ORYA 5EIEA 5HK8A 5CTAA 1QZ3A 1XLWA 3A70A 2Y2VA 3DYVA 3H1AA 3ZI7A 4AN0A 3I1IA 2OCGA 3V1KA 2Z8ZA 1C4XA 3GELA 2ZJ7A 1IVYA 3DQZA 4Z49A 4XIIA 2DSNA 2QXTA 4IH9A 3GBSA 2OGTA 3W9UA 3F96A 5CH3A 4Y2YA 4HXEB 1ZD2P 5ALFA 1VZ3A 4FDMA 3KDAA 4D9JA 2HA2A 3AUKA 2CBGA 1BE0A 1GZ7A 3O95A 1DT5A 1CRLA 1RWQA 3KSRA 3RARA 1AQLA 2CEKA 3KOOA 4XJVA 3V1NA 1W4LA 1OCEA 5KBYA 4H7HA 1OXMA 1H2XA 2Y6UA 1XRRA 3JYHA 5K5EA 2XUFA 2JF0A 1PJAA 1K8QA 1JI3A 4B83A 5JZSA 5ISMA 1R4ZA 3L1HA 2XQGA 2XUQA 4Q3KA 3ILSA 2XMDA 1QIMA 1AZWA 1VJ5A 2FJ0A 3V1MA 2WHRA 3IULA 3O4GA 4BRSA 3UUFA 4UHDA 7YASA 2H9YA 3M81A 1MX5A 1MO2A 2XUDA 1E8NA 5LKRA 4UHHA 4QNNA 5A7HA 1JFRA 2ACEA 5EFZA 4C6HA 3L1IA 1G42A 5JAPA 3AZPA 2XUHA 3C6BA 1JT2A 4G9EA 3WWPA 5EHNA 4BB0A 5JYCA 4IQ4A 4EZIA 5LZ4A 3WYDA 2PSDA 1LBTA 5IH7A 1ZD5A 5CT9A 5AKIA 5ALOA 2VJCA 4H7KA 1XKLA 1GKKA 2WM2A 1TK3A 2G5TA 3VJLA 4E14A 3FYUA 1YAJA 3C6XA 1G66A 4AZ0A 2HIHA 3GA7A 1J07A 2H7XA 5AM2A 3U0VA 2Z3ZA 3AIOA 2OLEA 4AO6A 2UZ0A 4OUKX 4C01A 1QONA 1QO9A 1CV2A 2Z8XA 5ALNA 4KE8A 4LXIA 3EBLA 4OB8A 5FXMA 1WB4A 3O0DA 4Q34A 1MAHA 4DYHA 5D3ZA 5JALA 3R41A 5AK3A 1E3QA 2XUAA 5ALDA 2O7VA 2DR0A 4AMYA 1XZCA 5DWDA 2DCMA 5ALLA 1MPXA 1MAAA 2IIVA 4Y2XA 1P0IA 1RP1A 3QPDA 1XRPA 5AOCA 1A7UA 1XZIA 2QUAA 3NGMA 1M33A 3CN9A 4HAIA 3BDIA 1FFEA 3VJKA 4QWWA 5I9IA 3WKDA 3HI4A 1R9NA 2QTBA 1QTRA 3I1YA 4K6KA 5JD4A 1QIKA 4JYMA 3F67A 5LZ8A 1BN6A 5HZGA 2FJPA 2R8BA 5AHXA 3QMMA 3MUNA 1YCDA 1CUEA 4YK7A 5H3HA 1EK2A 5CXXA 4TGLA 1EVEA 2Y1KA 5DJ5A 4MYSA 4AB1A 4U2BA 3IURA 3O4JA 4UBLA 5LIPA 2AJDA 4FWBA 2IITA 5AKHA 5FLKA 4L9AA 2WHQA 4UUQA 1DX6A 2EEPA 4B82A 3TJMA 2XT0A 5I7UA 6YASA 5LKAA 3FCXA 2C5GA 4EY5A 1EDEA 4ARAA 1S8OA 3FLBA 1E89A 4A5SA 4E11A 1A88A 1R3DA 1BU8A 2PPLA 1GXSA 3WI7A 2WUEA 5HF5A 2C7BA 1C7JA 2JEZA 2AJ8A 3H04A 2GBGA 1YASA 4PSCA 5LLSA 5FKJA 3M82A 3WKCA 5HQ3A 1VZ2A 1XZLA 4LKOA 1LGYA 4PSDA 2H1IA 5AI6A 4WCVA 2VF2A 5BOVA 1TCBA 3HACA 4OU4A 1QIFA 5J3JA 3GROA 2O2IA 2ONCA 3FSGA 4BYMA 2WU3A 3A6ZA 3FYUB 4NS4A 2XQFA 2HHAA 5CT5A 4DM7A 1Y7HA 5HKBA 1CQZA 5JASA 3F98A 2WJ3A 4B9AA 1UK8A 2I03A 4B81A 4MEAA 2J4CA 4BCCA 1XZEA 1TKRA 5IKXA 4B0OA 2H7YA 3ANSA 2QXUA 5K3FA 2WHPA 4Y9SA 5BWBA 1ZGBA 4G4JA 3BDVA 2HFKA 5ALGA 3WK6A 2VJAA 1XFDA 4F0JA 2WILA 1PV1A 2XMGA 3IVMA 3LIPA 4X6UA 2YH2A 1F6WA 4W9RA 2B4KA 4CG2A 1T2NA 3G7NA 3QMWA 1VXOA 2WFMA 4BC1A 2C4HA 3SWWA 3EQ8A 3OTQA 4JUIA 2WIGA 4UBOA 1U4NA 4B80A 1QGED 3HRHA 4KAJA 1G4HA 4FFVA 4Y2SA 1WB6A 3BJRA 5IVDA 3LP5A 5ALKA 5C8ZA 3MUOA 1UFOA 1ODSA 1CR6A 4M0EA 1ZI6A 1CQWA 1WPRA 3KD2A 4X94A 1MX9A 1SFRA 3ZPXA 5ALHA 4Q3OA 2C0PA 5LP1A 1VXRA 3R3VA 4Y2JA 2ZSHA 5EGNA 1IMJA 5T4FA 4PO3X 4EBBA 5AH0A 1QTIA 1CUJA 2BKLA 1ZICA 1YR2A 3RLIA 1I6WA 1XZJA 1YAHA 4QA9A 4J3JA 1XROA 2XUOA 4EUSA 4BP9A 3BXPA 5JZBA 3C5VA 4DNOA 4B0PA 1JMKC 5FOQA 2PL5A 2PSHA 2RIPA 1W1IA 2GYUA 5HKAA 4EY4A 4ARBA 5HQ3B 2BFNA 2WJ6A 3GZJA 1DU4A 3DL7A 4BTVA 5ALPA 3R0VA 4OB7A 3S8YA 2AJBA 4DTCA 2XQJA 5AM5A 5ALTA 2C5FA 3STUA 1CUGA 4P93A 1LZKA 4OPMA 2WUDA 3G02A 5K3CA 1ZIXA 1VKHA 5FDFA 3PF8A 3I2KA 3W04A 4L72A 4ZWNA 2VQ6A 1W52X 1U65A 4C4ZA 5AM3A 3OOSA 1DTEA 4MQMA 2QR5A 2LIPA 3HLKA 5JIBA 3ESCA 1FFAA 4KJXA 3SC2A 4MYDA 4J0JA 3QH4A 4HTAA 5K3FB 1UOOA 4MWTA 2WHPB 2OPHA 2IX9A 4AO7A 3QYJA 1P0QA 4JYPA 3IDAA 4UHBA 2BGNA 3A2MA 3B12A 2O2GA 4KR0A 1SOMA 4QLAA 5FPQA 2XE4A 1DT3A 2WIFA 5K3BA 2VTVA 3W06A 3WWDA 1EB9A 4WFKA 5ALXA 3I2IA 3FLEA 1XQWA 2FX5A 3PICA 5ALUA 2OAGA 2D5LA 1L7AA 1T4MA 5T4HA 4UBMA 3ICWA 4BZWA 1J1IA 1R1DA 5K3DA 3B3QA 2VAVA 4N8EA 2O7RA 2DHDA 3V9AA 4FFWA 1QOZA 2RHTA 1CPYA 4MWSA 2WFZA 4M0MA 1BROA 2VATA 2YXPX 1K6EA 3D7RA 2BUCA 2PVSA 2ZYSA 3ZWQA 2DHEA 1SCQA 1CUUA 3G9XA 3H1BA 3AINA 4ETWA 3WKBA 4TPKA 1CEXA 3AIKA 3BIWA 5A7GA 5DYWA 1W75A 2XMCA 2VT6A 4Y2QA 1JU4A 4RE5A 2G4LA 4FKBA 5AI4A 5T4EA 5ALQA 2XMBA 4BTLA 4PV7A 3ICVA 4HZGA 1CUYA 4J7AA 4K5QA 2GBIA 2HDWA 4QDZA 2HFJA 5DNWA 4FOLA 1UXOA 4DMHA 2AJCA 4FMPA 1JU3A 4RPCA 1ZOIA 5C8XA 4BVLA 1MJ5A 4Q82A 2HA3A 3IIIA 1HQDA 5HF6A 5AOBA 1CUIA 4WFJA 2QJWA 3RM3A 3BL8A 1XZDA 5CT6A 2ZYHA 4H0CA 4RGYA 2VAXA 5FRDA 1ODTC 2WFLA 4CI9A 1VOTA 2W22A 1EHYA 2WU4A 1F0PA 4B84A 5C7YA 3C6YA 2Z5GA 1XLUA 1TIBA 4EA6A 1TQHA 3TGLA 1H2YA 1N1MA 4OD0A 3I2GA 5JADA 3IA2A 2PKYX 3C8DA 1BEEA 1ZJ5A 4RNCA 5ALEA 4A23A 4KE9A 4GDMA 1W6RA 3WIOA 5DNUA 4Q3LA 3HJUA 3H2IA 5AKGA 2WTMA 3MVEA 2ZVDA 4P92A 4KEAA 5FUMA 1XRNA 1CLEA 2QJRA 2WG2A 3LIIA 3PFBA 1EA5A 4BVJA 2X5XA 4G4GA 2CB9A 1UKCA 1O6FA 3NWOA 4LXGA 1KU0A 4PW0A 5JD5A 3ANTA 4KAFA 1X2EA 2QVBA 5HFNA 2HA0A 5E4JA 5EI5A 4JEIA 4KYVA 5CURA 3BJMA 4OU5A 2B9VA 4BATA 1IUOA 5ALZA 4FTWA 1AC5A 3VISA 3IUJA 1QIIA 3H17A 4PNZA 1GPNA 3U1TA 1EB8A 3WK4A 1LNSA 3D2CA 2GZRA 4ZREA 3DKKA 5EIAA 2WIDA 5BV7A 1E66A 1XQYA 3WJ1A 2R11A 1YB6A 1K5PA 3FCYA 2JGLA 3BF8A 5DTIA 1CUWA 4G8DA 5DTJA 1QLWA 2ZJ6A 5HF9A 2WUFA 4M0FA 2PBLA 1UOQA 5C81A 3LS2A 5JATA 1Y37A 4FBMA 3AIMA 4WDQA 1QFMA 5AIBA 2QM0A 4O08A 3PUIA 2AJLI 4GXNA 1UKAA 1Q83A 3CN7A 3L1JA 3W05A 2DQZA 4WJLA 4UBIA 1THTA 2FUKA 1CUBA 2GBCA 4J0HA 2B61A 4K2AA 3ZV7A 2V9ZA 3HSSA 3WYNA 4V2IA 1N5MA 2J3QA 3C8HA 1ISPA 4QDOA 5JZ9A 2WQZA 3Q8WA 3N2ZB 5JAUA 3ESAA 3ESDA 2WFLB 2C0QA 2JGFA 1UK9A 2NW6A 3VVMA 1ACJA 1CIJA 1EDDA 1GQRA 3FBWA 1XZMA 5ALYA 1Q0RA 4I3FA 1EX9A 1WHSA 3R3YA 1CUVA 2XMQA 3AFIA 4ZGBA 3H2GA 1DWQA 1UOPA 1ZD4A 3TRDA 1MNAA 4B9EA 3H0CA 1U2EA 3VDXA 2PUJA 3IUMA 1R50A 2CKMA 1MN6A 4BE4A 3VKFA 4DSAA 1MX1A 1VA4A 2CUTA 3D5EA 1CUCA 4ZV7A 2ZYRA 3BF7A 3WWCA 1UKBA 4I4CA 4ZI5A 4G8CA 5DYYA 1CUXA 1XZBA 3EF3A 1QO7A 5I8PA 1YSCA 4BZZA 1TCCA 3DDUA 5CH8A 4FLFA 2PM8A 5AK4A 3WZLA 3W9BA 1H2WA 1VE7A 3WQHA 2JIDA 4X92A 5AI8A 4DGQA 4GEGA 1TRHA 3I2FA 4EY7A 4S0XA 1QE3A 4QLOA 3R3WA 3STYA 4P9NA 4WDRA 2QMQA 4ZRDA 1XQVA 1TAHA 4XX1A 1ZI8A 5E4TA 5ALWA 3QM1A 3DNMA 5AKYA 2VJDA 1ORVA 4NVRA 4X85A 3HC7A 2Q0XA 5IVKA 1XQXA 3FSGD 3QZUA 4MXDA 2QS9A 2JGIA 4E46A 2D0DA 4FBLA 4K6HA 2HRRA 1P0MA 5AI5A 5AM4A 1FFCA 3STTA 4C88A 2XQIA 2G5PA 3G0CA 4K6GA 1ODCA 5KWJA 4B85A 5A6VA 2V96A 4L0CA 2C58A 2Z3WA 5JD6A 4GLBA 4DNFA 3H19A 2ROQA 4OB6A 3SK0A 1X2BA 3BWXA 3PDCA 1F8UA 2X8BA 1N5RA 4BAUA 1J2EA 5CW2A 4GBGA 2XQKA 3K2IA 4X97A 4C87A 1YS1X 4N8DA 4OCZA 3C87A 1LPNA 1G5FA 3D4LA 1CVLA 4C89A 4L3WA 5IVIA 4Y2PA 1VE6A 3JWEA 2BAGA 3A2NA 3QMVA 2HU7A 5LZ9A 5ALVA 2PU7A 1HLGA 1SCKA 2HA4A 2BUBA 5C8VA 2PSJA 3R3ZA 4QDXA 3WKAA 4DNPA 2J4FA 3PFCA 3Q0TA 4BP8A 3B5EA 3E3AA 5AK6A 4W63A 1BN7A 3G9UA 4LHEA 4DIUA 1ZJ4A 1BCSA 1BRTA 3WWOA 3I6ZA 4GECA 2I78A 4B7ZA 4QWMA 1DINA 4A16A 4BDTA 3D0KA 5CH5A 3WA6A 2OGZA 3E1GA 3W2TA 2XLCA 2XUKA 4W1PA 5E4YA 5HF8A 4G5XA 1EINA 4C4XA 4J0DA 1XRMA 5ESRA 1YA4A 3ZLTA 3ZLVA 3IUNA 1THGA 4U2EA 4G8BA 4FLMA 1AX9A 4UPDA 3M83A 4YX9A 2WTNA 4KE7A 2QOEA 4CCYA 3DCNA 3WWEA 4DMCA 4EY8A 3HXKA 3ZLUA 2XUGA 1QIDA 2WG1A 4INZA 5AOAA 4BC0A 3EQ9A 1E8MA 1R88A 2HU8A 2J3DA 3O9MA 3UMJA 1HDEA 3WL8A 3IBTA 3OPMA 3DKRA 5E2IA 1A8QA 1L7RA 4H7JA 2OXEA 3CCCA 3FOBA 1QJ4A
chains in the Genus database with same CATH superfamily
4MV3A 1GPYA 3OCWA 3VYRB 5C37A 2FN8A 1I5OA 4LV8B 1H93A 3OP4A 1J97A 4HWTA 6PFKA 2Z09A 4JVNA 3T41A 4TKVA 3KOXA 2IELA 1QFSA 4JXZA 2V97A 3LWBA 3QVVA 5AKLA 5AW7A 3QWHA 1XZAA 3NOXA 4JC5A 2VP4A 1N6PA 1R5JA 2HT6A 4RE6A 4AWBA 5CDUA 4JX8A 4C0HA 3AEUA 3X1KA 1D03A 5BYAA 3BZWA 4PQRA 4E30A 5LP6A 1EVLA 1GAWA 3QEAZ 3SHTA 1GYQA 2MSCB 4BLOA 2ZRNA 3H18A 1JLLA 2O8CA 3RUDA 2QJOA 1B41A 4Y6LA 4N4AA 4H0FA 2P8SA 3QKUA 1L7QA 5JTUA 1C0IA 2RBEA 2J6CA 5D5PA 1PX2A 3GFSA 3IPCA 4YUWA 3OC0A 3ABSB 2FPWA 2UZIR 3RJZA 3THYA 4LOAA 1UBOS 3ITNA 3MGAA 5D85A 2N0SA 1B43A 1UZLA 4QEKA 1EUDA 2GEUA 3C98A 4V0MA 2B20A 1JSXA 4XOUA 4KR7A 1YA8A 3EGDA 4QPZA 4A1OA 4ZCSA 1SXGA 2AE1A 4P38A 3X3HA 2RGAA 4EG8A 1PAUA 3V8PA 1Z4QA 3PXCX 2WU8A 3D8RA 4R8VA 3L8GA 1UC9A 3REOA 1M74A 1TKBA 3GMTA 3MJTA 3K8YA 3WVNA 3L93A 1XTKA 4QYSA 5EZ5A 1OBOA 5PGMA 2V1XA 3FTQA 1ACMA 2W0MA 4ZYLA 1CTQA 1NYQA 3WL6A 3VPHA 1Z3IX 4BE9A 3O82A 1ZCJA 4R3UC 4F6LA 2E6UX 2AFHA 3FZNA 4L57A 5ELMA 1SHUX 3TXAA 3K1AB 4IRXA 1DEAA 2PQ0A 2YWHA 3OIDA 4KQEA 3KAJA 3P2JA 4D4IA 1Q0LA 3BMOB 2DFPA 2QU8A 1U1IA 4LYHA 3N87A 4YCLA 4NE7A 2G7MC 1I3KA 4OKSA 2ERCA 4ZJZA 5JJKA 3MQ2A 4PAQA 2WWRA 3FVRA 1LPPA 1E2EA 1YJ5A 4L51A 4XWGA 3ZWKA 1CJKC 3I6MA 1JG6A 1S8FA 1BD3A 1HLPA 1OWOA 2OCYC 1UH5A 1HFWA 3E82A 3KWJA 1NASA 3PHJA 4O63O 3SLRA 4IXNA 4D41A 1XE3A 4QASA 5KVSA 3MGGA 3ZNQA 5CT8A 1HL7A 4EGFA 4KFTA 3VSDA 4EFLA 1QYIA 1JEEA 2PRIA 3QHAA 2DWQA 3QI2A 4LQLA 1XR3A 4OO3A 2ZITA 3IT2A 3T3PB 4B75A 1KJQA 2IYNA 1F8YA 3PDWA 4ZOBA 5GJCA 3RJ9A 2ZRGA 1GUBA 3EIWA 4Q9NA 3O8RA 4J0KA 4UEWA 3D6VA 4URVR 2WWXA 5KOYA 1QKKA 4GRAA 1AS3A 3M6VA 4DKXA 1AQUA 1M54A 2ZAOA 1WXWA 5ANRB 2WQ6A 1NMXA 2XVZA 1GL9B 2LKCA 2FA9A 5IULC 2P40A 4M9RA 5H4GA 4Z1MD 5KI6A 5HIMA 1TJPB 3OZIA 3BBPA 1ODIA 2J7PD 2W83A 1XPRA 5FUBA 1SG6A 5E0OA 4KHPB 2MWMA 2PSFA 3SIWA 1EVIA 4FGKA 4V24A 4OQDA 3VR4A 5FWYA 3JQPA 4OUDA 2F7SA 1ORDA 3I30X 4BGUA 1G2PA 1KO8A 2A7XA 2FKAA 1EWVA 4JH0A 1KFKB 4B7CA 1J9GA 4WKCA 4RL6A 4URHA 3P94A 3COWA 1M5TA 3LHDA 1EBFA 3JXEA 4AJJA 2J3HA 2J5QA 2F48A 1EE1A 1B4DA 4DCSA 4RF4A 3LUDA 1GQQA 1PR3A 1MJHA 2CNNA 1KKUA 4OTZA 1USIA 4HNHA 5F4ZA 2VJYA 1PFGA 3FTDA 1GZSA 2PX5A 2FZGA 5AK5A 4I0WB 3H8SA 1TNDA 1XOIA 2HBZA 2BKUA 2L19A 3OY7A 4UREA 3TXYA 4F72A 4EI7A 3FX2A 3S8EA 1F3LA 2AZTA 2Y6VA 4RORA 1OE0A 1PS8A 3W5CA 5LL6P 2JBAA 4DZZA 4AX4A 3F3YA 3SYTA 1WWKA 3HYSA 1ZM7A 4B73A 4YQZA 3S5UA 2BKXA 1RYFA 2WIKA 3K9WA 3MT7A 2IF2A 2LCQA 2W2KA 2AG5A 4Q4JA 1NNI1 2AS0A 5CNMA 1YD7A 2OXRA 1FDIA 2P3QA 2XA9A 3GFOA 3CXUA 2NYVA 3LU1A 5KOHA 3HZHA 5SZKB 3NHKA 1IC6A 2QVXX 2ZIXB 1C3JA 3KUKA 1GSHA 4H31A 4HRXA 2PZBA 4V39A 3TE7A 4E09A 5DEIA 2QQ5A 2A5GA 2FPUA 3JQFA 5KNDD 2CZCA 4RTPA 2C5EA 5EE5B 3SEQA 4DL9A 1A2QA 1E6LA 3KRTA 5G4KB 4HRYA 3UA3A 2R48A 4HZUB 3M70A 3TR6A 3ZIAD 2Y76A 2M2IA 1EK6A 3WL7A 3KAQA 1W4CA 4WOPA 5LD2C 1YE8A 4G4IA 2VTBA 5TQ0B 4M53A 4RD1A 1DRWA 1O6GA 5IJZA 4M0CA 1RXSA 4KQMA 4PO1A 4XEUA 4GP6A 3L0BA 4D2IA 2HM7A 3DAOA 2YWDA 4B6GA 5ECWA 1ZLYA 4PCVA 4LDZA 4PZEA 1WZNA 3FZGA 5AQEA 4H4EA 1SUEA 3T12A 3PQ5A 3ZE2B 3HXOA 1TAGA 1RR6A 2PRKA 1DAPA 3K16A 4LF6B 1OMOA 4HLQB 1J8FA 1O77A 1W5EA 3EFBA 2B30A 3C3WA 3QPAA 3SNHA 1EVKA 1T8SA 3O1JC 4UVEA 4I3HA 5HQJA 5AW3A 4TKVB 2BSQA 4G0WA 2OAEA 1LPBB 3TQIA 2AN5A 3D6TB 1PT9A 2Q1TA 3B6ZA 1YTUA 5C5DA 3AVXA 3RU9A 3KQQA 2HSEA 2P4UA 2ZB4A 4QOSA 1U2DC 2V7PA 4BKUA 2A5YB 5IXYA 2GKOA 3I8XA 1LPAB 3AEUB 2FOIA 3TBKA 3S68A 3EIHA 1ZM3A 5LP6B 2BYTA 1GLVA 2EJWA 3WBJA 2E4ZA 2Y1DA 5K4AA 1XL1A 2PS9A 3CH5A 3KLPX 3Q5DA 2YY5A 3T7EA 1B1AA 3UOGA 3DFFA 5A62A 1JLLB 1RM5A 2O8CB 1JQDA 3V8RA 3WLAA 1GQSA 3TOVA 4LF7B 2IOFA 3PX2A 1ZX1A 3BTOA 2AHRA 2GYVA 3G0BA 2DWCA 3THYB 2OZLA 3KKQA 5AI0A 4TSKA 5LCXA 4LNUA 3FOAA 5BYJA 1IN5A 1EUDB 2QL9A 1MV5A 3ORFA 3AF6A 3CVWA 1IRIA 3EGDB 3LDGA 1NVDA 3NC0C 5E38A 2CB0A 1ZGGA 2P4EA 2PZJA 2CT8A 1L7OA 1MCZA 3FCUB 3PDUA 3RFXA 2H18A 1QANA 1XRSB 3ECSA 5DBIA 2Q3MA 2VHJA 2CUZA 3JSAA 1YRAA 2HCJB 3BXHA 1I6MA 5A04A 3A4YA 1P0PA 3LWZA 1M8PA 3HVJA 4B79A 4AMZA 2D13A 5CIYA 1EHIA 3I28A 4HPWA 4GMGA 2BGUA 4PGHA 1ZN9A 4X3CA 5E7MA 1RD4A 2X1LA 1LDBA 2QV7A 2WTAA 4DV3B 3UAGA 2A6PA 2G36A 5ITWA 3NG1A 4BP1A 2AFHB 3CNOA 1K6MA 4JLMA 4AYXA 4YAWA 4CM8A 2JIZD 1AUOA 3R5HA 1E1DA 2Y1EA 1GN8A 1TIKA 1QFJA 3UJ9A 3DW3X 5IJXA 3TZLA 3DOJA 1LLFA 2YN4A 4H7PA 1E9AA 4AF8A 4TLCA 4BRWA 1A7JA 3KALA 3ROMA 2ZI9A 3ROFA 5TLSA 3M3PA 4HLCA 4X71A 5DSXA 2Y2UA 2CHVA 4HK4A 3ZWOA 3JYOA 3NTRA 5JAQA 3WYCA 4EHJA 3VPAA 4ITUA 1V8OA 4IDGA 4JBWA 4L22A 2GZAA 3ICCA 1ISMA 1XRQA 4M1TA 2OXCA 1MH9A 2X8LA 2ZVJA 3P2EA 4MROA 2V55B 3GO4A 3N2NA 3L6CA 2OQVA 1MJFA 3A9UA 2FPXA 4LMRA 2HRDA 4RSRA 1TO6A 3MB8A 3J80A 4KGDA 1KORA 1NR1A 1S4MA 4ZEOA 5CA1F 2Q9UA 1HDYA 1HZJA 1GLGA 3TLJA 5FEUA 4EHFA 3OCCA 3VR5D 1U7ZA 4KRYA 3ZV6A 4QGGA 5DHAA 3AJ9A 1W47A 3WNZA 4X64B 1VDZA 4IEEA 4ZCQA 1ESDA 1RTKA 4OI4A 1U3VA 1E9SA 4FW9A 2V74B 1RJ9A 2L82A 1CY0A 2QIPA 3VVLA 4GE3A 4AZ3A 1BMFA 2VPQA 4JL8A 5IKEA 2Q45A 3A2LA 4FNOA 4XZ3A 4J2TA 3N0VA 1Z5UA 1GCUA 1CUZA 2V4UA 5BW4A 1ORWA 3BD8A 3MC1A 1RBYA 3KXKA 1VIMA 4EL0A 2OV8A 1CUAA 4NNPA 4GPD1 5C1BA 4MVJF 1E3IA 1FUYB 1I10A 2MR6A 4OUDB 4PINA 5FWYB 4XOIA 4P08A 3I5XA 1H0SA 2ES4A 1D4FA 2BHRA 2VT2A 2X41A 1UBCA 3CPHA 4H08A 2RHJA 3FKSD 4J4TA 3ZWYA 1SUPA 2BKAA 1JEDA 2FH5B 3C3XA 3H1EA 3HS3A 3I9V1 4FU0A 3EEIA 1H8EA 1N6NA 1DHRA 2V7XA 3AF5A 3KWFA 5AVJA 1E2LA 1E9BA 2BI7A 1QZUA 5K3SA 5CM8B 3OUUA 2DECA 1TTPB 3X1YA 3MT8A 3KL4A 3KQHA 1EK5A 2H1FA 4G9GA 1DO0A 1I30A 3LGXA 6NULA 3VKWA 1RXIA 2GXQA 4L27A 1OW3B 2HQBA 3AONB 4DBZA 2D5CA 4D26A 1WTCA 1XL0A 1M2HA 2I4MA 2IYTA 3OQVA 4HC4A 2NACA 4LHXA 1BCRA 1KS9A 5TS3A 2ZIWB 1KH1A 3GFFA 1VKJA 3AR2A 4PAMA 3TSZA 3U9TA 1YR1A 3EQ7A 1ZN2A 3OTIA 1H05A 5ETJA 1LC3A 3LBFA 2JBAB 3A0RB 3IDSA 2H7VA 4HAYA 2CDCA 1S96A 1GPLA 2D5AA 2EWWA 2JEYA 4XJXA 2HIGA 3TIIA 2ZWOA 3UENA 1M6HA 3RF7A 4AK9A 3TLMA 1KU6A 4QDTA 1TKCA 3DFUA 3E81A 2YASA 4JUFA 4QD3A 3IIMA 3M3HA 2W2KB 4ZA2A 5ESDA 2X0IA 4NZZA 4Q4JB 4DPLA 2V8OA 3MHPA 4HX2A 4IUBS 1VQ1A 2I55A 5KOHB 4G3XA 4ZOLA 4YR9A 3T94A 1A8IA 2ACKA 4KACA 1ORHA 3I5AA 3WK7A 4ZI2A 5EIXA 2X0NA 3PTLA 1ID8A 4EKNB 4RY0A 1UKVY 1MB0A 5JDIC 3CJRA 1RIFA 5JAZA 3IE1A 3JV7A 1A8UA 1CJSA 2W8BA 1TQ4A 2PJRA 1YMUA 1LLQA 1P61B 4LN1A 3QWBA 2VUIB 3UJBA 4FI3C 1IOWA 4YI5A 3WGOA 2KM1A 3RHSA 1DDGA 1N0UA 3DEZA 2ATCA 4GM0A 2VTBB 2QAIA 2X14A 1QIGA 3EQZA 3EGCA 2B94A 1CR1A 3AKEA 3NHJA 3TW8A 1DMSA 3D0OA 3LDUA 5C9ZA 4HGQA 3IQGX 1J25A 1P7VA 4IIHA 3VYSB 4A0HA 5J4HA 3AM1A 2GDZA 3BCUA 1U7HA 1XTRA 2Q5QA 2OGUA 4I8XA 4MO2A 4MUEA 3RJTA 4EHAA 4EPRA 2F1KA 1T5OA 1P62B 1XEXA 3H3XA 3T3HA 2K4MA 4YCNA 2OCKA 1Z2PX 1AB5A 4DMFA 4PR0A 3PUJA 4LPKA 2WKPA 1CZHA 4JOSA 4OYHA 4NICA 4R8KA 3DT9A 4YCCA 2J0UA 2PKEA 3A25A 4OOFA 4ESOA 2KBFA 4LYDA 4CKWA 5DBEX 4ESVA 5DZSA 5B1SA 3NEPX 2FFHA 5IVHA 1RCFA 4LRXA 3K0SA 1F7UA 4P32A 2XWBF 4EATA 4WCFA 2FSGA 4OGFA 2YN0A 3BEOA 1YS9A 4JGBA 2DWPA 1YI8A 1JDBC 1UFVA 4Q7KA 4DUGD 1OU4A 3WIBA 3UGQA 3EIOA 5EMKA 1BHJA 4C7XA 4DG9A 3DD5A 2JK0A 3NNSA 4NYIR 3W7VA 1HFJA 5LFAA 1NHGA 4IOLA 3PS9A 2XTJA 5E8JA 4OOEA 1H23A 5DULA 1S2OA 1MA0A 2HOQA 2OZLB 5LZ2A 1Y3IA 1J99A 3O6VA 4LV5B 2WZCA 4LNUB 5KMGA 2M6SA 3OURA 1B8PA 4CBVA 5PNTA 1J23A 4Y2UA 2YRWA 1V43A 4DLPA 4BMSA 4BLRA 1GGVA 5JRZA 4IIJA 1LPMA 3LPDA 1K66A 2D62A 2FMFA 4YDHB 2ZXEA 4M1KA 2BISA 3FYUC 1PUJA 3AHJA 4UUPA 5SYMA 3CX6A 1SBTA 4KGZA 2EHDA 2HPZA 2WTEA 1Z7EA 3OE4A 2R6FA 1ISHA 1IDOA 1RAHA 5JS2A 1I5RA 3E4CA 2FAXA 4ZVKA 2JJYA 3RKSA 1SUCA 2EF1A 3S27A 3N2KA 4ZXFA 2C4VA 5A9TA 1JALA 1ETUA 3HDHA 4CM8B 3BT7A 2BP7A 3U4HA 3WWZA 1Z0UA 2AEJA 3A6JA 4MYHA 3C6KA 3S40A 3T7DA 1EDZA 4HBGA 3VM6A 821PA 2EF0A 4YIKA 4TV9F 3Q7RA 1SXJD 3ITKA 1KDPA 5ALJA 3DSRA 4XGKA 3BGWA 4ILEA 4PYLA 1BYIA 3MELA 3PWKA 1Q0HA 3D8SA 1II9A 3DEKA 1HO3A 1OA1A 1OFIA 2DMRA 2CLFB 3D2BA 3F97A 4RVFA 1L1RA 3FHJA 3VSAA 3ZU6A 4P8RA 3KTOA 1AE1A 4NE2A 1C9JA 1Z08A 4KXFB 1G3IA 4TMXA 4ENVA 5BUQA 5JJIA 1QHYA 3NIGB 4FILA 3DULA 3NHBA 1NVWQ 1R6DA 1KQNA 1YC2A 3L7LA 4Q9DA 1V1MA 1E9DA 1Z68A 5HK9A 1KHTA 1UWCA 5KJ1A 1G41A 1BWSA 2H2GA 3SMQA 1U4OA 2H06A 1U1FA 3I3OA 1P77A 5DK6A 2NAFA 3SNKA 1VLQA 2AUMA 3GDGA 5AI9A 3UK7A 2E3JA 3PE3A 3I1JA 4MV8A 2O14A 2E4UA 4IUYA 3Q8KA 1FMTA 1VPLA 4X0EA 4ZAWA 2C20A 4FOOA 1TQ6A 2H0RA 2VFAA 4EFMA 1OKKA 1KBOA 1RJ9B 4TUYA 4AZ3B 2A7QA 3ANXA 3KETA 4GWGA 3HBAA 1CY8A 3HGMA 5LMCA 2ONJA 5GV8A 4CM5A 1BZYA 1V9SA 1XTZA 5FAXA 2PZFA 2JD1A 3NPMA 3QPWA 3T3GA 4PAWA 3D1LA 3QVGA 1DXQA 2N46A 1FLAA 1F0NA 2C5BA 3MERA 1KJZA 1PI3A 3OZAA 4HWSA 5COBA 4BJ3A 4C2UA 2ZZMA 1J2UA 2GA9A 2GKGA 3ZEIA 2VPIA 2H08A 4W99A 2V54A 3H65A 1QG0A 1R5NA 4A27A 4RHFA 3IYLW 4FZVA 4DCCA 4RXTA 3PJFA 4TXJA 1H2RS 4WBNA 5CDFE 2X7JA 3ZY4A 3PU6A 1SKYE 2O7QA 2IS4A 5H4HA 2QVGA 5BP7A 1JR3E 3DCYA 2BFFA 4P84A 1FQJA 2REOA 2HNBA 1ONBA 3RRFA 2OG1A 1MHTA 4XLTA 4CG3A 2HMVA 3AR5A 3N7TA 4EHIA 5HUQA 3DPSA 5LQKA 4LBZA 2YMPA 5HDBB 3PXAA 4U02A 4B46A 2W4QA 2OHOA 2F6RA 3U7GA 3I0NA 4KXQA 1QRUA 1J4AA 5I9SA 2Q1WA 3KQSA 3LI2A 1G6KA 2HWKA 1YUMA 4JASB 1PQWA 2GZMA 2RGBA 3AF3A 2DJIA 3MCWA 3AK4A 3NWPA 3GRAA 1BCRB 1WSBA 2VUSA 4GP9A 4IDDA 2DFNA 3T9CA 5CYOA 4QUHA 5DNYB 4A0RA 2VRCA 3LCMA 5AFSA 1QG4A 4W9NA 3HJRA 3FPSA 2LP4Y 1KJYA 4UFNA 1EP3B 3ZVMA 4QXOA 4JY7A 1S7CA 3KB1A 3SHVA 2O8BA 3IALA 1E1KA 2O8VA 1K7FB 2QN8A 5DHUA 3PNYA 1X3LA 3KFVA 5A0TA 1OD6A 1TU3A 1I1HA 3EVBA 2V6FA 4BQRA 5I4CA 4ZOLB 1N8SA 2IY7A 1I7QB 2XCOA 4ZOQI 3T9AA 4TMTA 4X44A 1WCV1 2O1SA 2Q28A 4PZCA 3UJ6A 3ZV4A 5CEFA 2P9GA 3WE7A 4B4VA 5KNCD 3CPJB 1EXWA 3FWYA 1XZHA 2QN1A 1K7CA 3D6MA 1MT0A 3LOQA 2W8BB 2PU5A 2XMZA 3MTJA 4GLOA 4HNSA 4J3FA 4QUJA 3R7WA 1IN4A 2JPDA 1I6KA 2DPGA 2I29A 4W1SA 5J4LA 4O3FA 2V7QD 5A03A 1P39A 1OZGA 2QMOA 2BELA 2O2DA 1U3TA 4RBNA 1ZMXA 1IHYA 5FYQA 3IBSA 3TW8B 2GJSA 1II8A 5AJXA 3WMWA 4FFPA 1SQSA 2EU8A 5DHTA 2K87A 3WHIA 3E7PA 2FNAA 1IHUA 4H4DA 3Q6MA 2INGX 2OP0A 1XEXB 2JBWA 4V0RA 2XODA 1JJFA 3LNCA 1N2SA 4PCAA 5AR1A 1U9IA 3JYQA 3DMNA 2R1TA 3KTDA 5JQWA 5CGZA 4J91A 4Q1EA 3KYBA 4PC7A 5AVRA 2J0UB 5A4MS 1TYAE 3ZVKA 2J9GA 3AKZA 1EQUA 4CKWB 2BF7A 3TLYA 1Q22A 4Y6OA 4LX0A 1ETHA 1LPSA 1VSQA 3N0TA 4KPUA 1KNXA 2VZLA 4BCDA 1W1UA 1VG8A 1LPOA 2CMFA 2HZ7A 3KKNA 4WCFB 1PLJA 1M1ZA 4XYMA 4IKOA 4D25A 4DQVA 2CNWD 2E1PA 1XKTA 2JNWA 3CYFA 4BN0A 5J2UF 2J0SA 4R1MA 1CVRA 5LXTA 1ZUHA 3H9CA 2VUTA 3JRWA 4PSUA 5I6DA 1F2VA 1Q7RA 3PXUA 5B1EA 2Z9DA 4F46A 2O0LA 1AHIA 5KUTA 4C4RA 3PNVA 4EA7A 3GJ5A 1BQ4A 1FRNA 4L4SA 1Q1AA 4YCAA 3R8CA 1JLMA 1SZJG 2GK4A 5KMGB 1PFQA 4HQLA 4IG9A 2HJHA 5L3RA 1LSJA 1UT6A 2RHDA 2OG2A 1GPAA 3KQYA 5A0FA 4D9KA 2XWPA 3OSUA 3QPCA 4UNSA 2FWRA 4BVBA 4RTOA 4YREA 2PMDA 2RHBA 1PT5A 4XJTA 1IVSA 4X93A 1EJ2A 3H4MA 3GP3A 4I9NA 4JGIA 1KGDA 2LV8A 3PUWA 1SC6A 2C2HA 1PWEA 1HTWA 3FUXA 4FQ7A 4PE5B 3ZZTA 4KMRA 3O9ZA 1Y8ZA 1FUEA 3DLAA 4LOIA 2B7LA 2I1WA 1F2TA 3LY5A 3SQXA 4EPVA 4J1NA 2YV1A 3PL5A 1N6RA 3N2KB 5GONF 5CB8A 3OHPA 3JQAA 5J1SB 4DR3B 3V6LA 1OILA 2IEZA 1RPTA 2V03A 1HE5A 3MWYW 4MYTA 3EPPA 2BP7B 3F0TA 4RDIA 4XARA 1PD0A 4YWJA 1TCAA 1CNFA 1N3LA 4L16A 1X19A 4C76A 4G65A 2UXDB 2VP2A 3C1OA 3T7TA 1MKYA 3SZ3A 3IBGA 3GJ0A 1FNSA 2UKDA 3WLEA 5F73A 5KU1A 1GPJA 1LBSA 3H86A 4Y7DA 2EKPA 2HXSA 3IUQA 2BGRA 3ZXXA 4OEHA 1ECFA 2W37A 3CLSD 4OMCA 3V8QA 1DRKA 4NBRA 5A3JA 3CRNA 4BFXA 3N70A 1MEEA 5CDYA 2ZTLA 2GF2A 1E6EA 3HO8A 1XLWA 2ZXFA 3A70A 3BFXA 1BO6A 3BRSA 3KWMA 3PFFA 5CVVA 1W5AA 5HFJA 3W7BA 4F9GA 1V1MB 1D4AA 3FFBA 4HWPA 1NW5A 1RWPA 3CWZA 4G1CA 2I2BA 3H1AA 4GZLA 1TF2A 1XU4A 4MVYA 1GU7A 1IAQA 1JAZA 1L4FA 3I2YX 4XYEA 3UTCA 1AGRA 4YT4A 2ZUDA 3MD9A 4LXUA 1BD4A 2X40A 3WICA 2I54A 2I1VB 2XB4A 3GELA 2OAP1 5KQLA 2QTLA 3OTGA 4JR1A 1FYFA 1U3WA 2MSLA 2ZJ7A 2ZAGA 3DKVA 4DLZA 3LMKA 4TQ9A 1ESCA 2EG9A 3DQZA 3I45A 4TUYB 2V7GA 3LX6A 5CJPA 4URZR 1ECPA 1TU0A 4E6EA 4I4IA 1KZ6A 4NBNA 2QXTA 2OR3A 3GBSA 2B7CA 2YZKA 2XXBA 2ERYA 2IP1A 3W9UA 1FXUA 5F3DA 2C7OA 3QVGB 2JW5A 4XUGB 5TC4A 1R0BA 1QCDA 3PR1A 4Y6PA 5CH3A 4CMKA 3GV0A 1XTPA 1SUDA 4EDFA 1XPJA 1E59A 4Y9DA 2XV1A 4OHWA 1TE2A 2WB4A 4ZVRA 3W5JA 4WBNB 1JG7A 1VZ3A 1JFVA 2P0AA 4V0ME 1TD9A 3B53X 2BFFB 1ORRA 3OM0A 2O1EA 3MOGA 2J5XA 4HWKA 4CLDA 4JT2A 2GN1A 2CBGA 3U26A 1E1QA 2F00A 2R6GA 4M89A 4U7JA 5EJEA 4LYJA 2R6CA 3SHOA 5ICGA 1KNQA 4G89A 5EOVA 1R9JA 3PHBE 1DT5A 1CRLA 1KO7A 2RKWA 5I51A 3Q7PA 2X13A 2RDMA 2AJTA 3S2FA 3ZDQA 1KDOA 2Q6IA 3R6WA 3RARA 4ZCIA 3I5MA 2VBIA 1QHSA 2OMEA 2Z08A 1X1EA 3KOOA 4PGGA 1S2MA 3UMFA 1J2TA 3V1NA 1DBVO 1W4LA 2QLJA 4CV0A 3OF2A 1EBBA 4UXHA 4Y1FA 4AZWA 1S2NA 2GNAA 4D3SA 2JH8A 4PSAA 4BBJA 2C99A 1JQEA 2Y6UA 2PUEA 1C3VA 4Q9KA 1Z8HA 2O8BB 4GL4A 1U2ZA 2AZDA 4L8LA 4LVNA 3CO5A 4W5JA 1N0IA 1UCFA 5JHHB 2VAPA 1WCWA 3N2GA 2VDWA 3TTVA 1A5SB 2I71A 3CY6A 4C0QC 5ELXA 3VAZA 1JI3A 2C59A 2R84A 2XHEA 1AOXA 4U6QA 3SMVA 2NV6A 5KX5F 2Q3JA 4H2DA 3VR3A 1NN3A 1ULAA 5ERYA 1PZEA 4CU5A 3KAPA 4KITB 4MAMA 4U0KA 1IBMB 4BX2A 3R7WB 1RKBA 4FIDA 4HPJB 4DLUA 4QECA 3VU9A 4Q3KA 3ILSA 3PKIA 1D3AA 3MUFA 4LK3A 4OBBA 1AZWA 2FJ0A 3PQ2A 4O4IA 3AHEA 1A9TA 5DPMA 1XA3A 4ZMSA 7YASA 5F5XA 5U9CA 1AKQA 2H9YA 3QX7A 2QY6A 5FD8A 2AQHA 3Q3VA 1II8B 1MO3A 2A0WA 3ZGXA 1UOEA 3JYPA 2FF7A 2R8OA 2YJ4A 4YRJA 4C3UA 1E8NA 3ICPA 3L8HA 4IMRA 4UHHA 1ND5A 1Z5PA 4HQOA 3Q3CA 1R74A 5LUAA 1UINA 1HYBA 2R7MA 1BE6A 1YQEA 2HUPA 3AUUA 2R1TB 4FSHA 4JLKA 5DYIA 4C6HA 5KQSA 5EJFA 1NTOA 1EE2A 1G16A 1U8XX 2REBA 1YRLA 3IXLA 4G0XA 1G3RA 4HKTA 4DMGA 3W5AA 1PR9A 4JGGA 2RCNA 4J6FA 1SR8A 1JIVA 1X1QA 3KO8A 4PAGA 1YDHA 1Z16A 2PL9A 3PC3A 4KPUB 5JJLA 1OT3A 1ZN7A 4ZO4A 2OO5C 1A2OA 3EXG1 2QYOA 1U2GA 1TM7E 5ECGC 3V4FA 4CM3A 1KZ7B 4WD3A 2MMCA 4HGOA 2CYCA 3KJHA 4HFRA 4I9HA 2PEYA 3OJ0A 4PRZA 1VMKA 4R2LA 1Z2AA 1LBTA 1Z4MA 5LXTB 4YRGA 2ZRPA 5JS7A 1JHDA 2W90A 5CT9A 4X60A 4DV1B 1L6IA 5K8VA 1B8NA 3SVTA 2VJCA 4K1LA 3EPLA 1XKLA 4O2BA 1M9NA 3VR4D 4M0KA 2AN4A 4GYKA 1OXUA 3E2IA 4M22A 1PEDA 4RQAA 3VJLA 2QAGA 2BSXA 1T2FA 2GZ1A 4RVGA 3UK2A 4BNWA 2MHCA 1N25A 3I9NA 5EUCA 1KYXA 3CH6A 3L0SA 5BR4A 5IU6A 3BYZA 4TV8A 4HFMA 3KSMA 3O3CA 2O3UA 5DM4A 5IT0A 3L2OB 1NXWA 4EM6A 3HU1A 3L6BA 3OJFA 3OFVA 3OE5A 2OHXA 4BS9A 3ITDA 5LQUA 4UU8A 1Z75A 2YRFA 3QSGA 5AM2A 1F2TB 3OEHA 1WR8A 3GPCA 3BORA 3UUGA 3AM5A 2Z3ZA 5AVQA 3L8DA 4PSKA 3IIJA 5DLEA 4FWIB 5AHKA 3JQAB 4EA9A 4BKOA 2FEOA 1C80A 2PX8A 5H3CA 2OLEA 3V00A 1DKRA 2DPYA 1KDRA 3C2QA 4MK4A 4H27A 5CPFA 4B8ZA 3SD7A 1QO9A 2Z8XA 5ALNA 1DARA 2WSYB 3EVDA 3IFSA 2C84A 3V5NA 3ESXA 4BX3A 4A2PA 1PFWA 1KYIA 3EBLA 1PG2A 4YMSA 5FI0B 3V4RA 3B1XA 1RJGA 4I9UA 4Q4DA 1WB4A 5DEOA 3UZUA 4URFA 3X1DA 1RI5A 1ZVVA 3N74A 4TMKA 1FS5A 2QMHA 2EP8A 3AF2A 4FR0A 5E7IA 4DYHA 3ZDXB 3NUGA 1EDOA 3ZCQA 1E3QA 4OY3A 4UE2A 3ND7A 1FMLA 1ZUWA 4J2OA 2C4TA 2XUAA 4DY6A 4EG7A 1YF3A 2K7FA 1FC0A 1FCJA 1GFIA 5DU2A 5H1YA 1C1XA 1MAUA 1TYEB 2BGJA 3DHYA 2VHEA 3H3JA 3JARA 1U3UA 2IVZA 3D7SA 3ND9A 5FQNA 4K6MA 1C3EA 2NYAA 1OIXA 3ZD7A 2JDIA 2Q7OE 4UNQA 1Q92A 1HMYA 1KI2A 1MAAA 1SHKA 1VI2A 1TQ2A 3IV6A 4IIDA 1QAOA 2NTNA 5IK2A 2GEFA 1G2IA 1IXZA 3DC2A 3VPCA 4HNRA 4WKOA 5C8YF 1XP5A 2H5LA 2W6PA 3GVHA 5I3ZA 4V2UA 4Q9AA 2CD7A 1XMIA 3GFVA 2HREA 2XJ9A 3BA6A 3W6PA 2FR8C 5CLGA 3QPDA 5JY6A 4UNNA 3GH3A 3CGGA 5BXQC 4RFSA 1E92A 3T9FA 3ZQJA 2RI1A 2JJ1A 4UM5A 3UG6A 2P79A 1DBQA 3NH6A 3K9CA 5FBLB 5HGXA 2O1XA 1EUZA 4PIMA 2R25B 3NGMA 4L95C 3M9WA 3SX2A 4HAIA 2R4TA 4NOMA 3CTMA 4OMDA 4UTXA 2V0GA 3LKZA 4HSGA 5IARA 4HGYA 2J3EA 2Z9BA 3GJ3A 4L50A 4QWWA 5G0TA 4R5MA 1MF7A 1ZONA 1P0CA 1CZLA 2AZMA 1R9NA 3HI4A 5EIWA 3WOVA 5I9IA 1RXVA 2ATVA 5G0UA 3N8DA 3BGDA 2JHCA 3NM5A 3SYKA 3G2IA 1PJCA 4RTQA 1SN7A 1EFPA 1NJ8A 5JD4A 3HO1A 1QIKA 3IHTA 4K8RB 5FTKA 2JH3A 1UJ4A 1WMDA 3QUCA 3F67A 1MDFA 1XEAA 1JKIA 1PTKA 3DFZA 1FRZA 2R8BA 1N92A 4MI3A 2O0MA 3EDYA 4CHTA 3DEJA 1U0EA 3ABRB 1RYBA 4H6PA 3DZFA 3M5CA 4M1MA 4XCXA 1HZZC 4UU1A 1SK8A 5FX2A 1BSVA 3L4BA 1M0TA 3N2GB 2BOVA 2VDWB 2H9IA 2O2YA 4KR3A 5LNK1 5LOVF 3JD3A 4D0SA 4DEVA 4RTSA 3KQWA 2H1SA 5E2BA 3C85A 3EDQA 3EPJA 2QTRA 4DNXA 3MAJA 1QP7A 1YE3A 1SC1A 2PQ6A 4ZHQF 4GR5A 2RGYA 4U2BA 1PGPA 3L8YA 3IURA 5SY6A 1NN1A 1JBEA 1WDMA 2VC2B 3VU9B 3SQLA 3KEGA 3MJFA 4L5YA 2BHSA 2WWWA 3RASA 4ZVTA 4DJ5X 4JBXA 3INNA 4O4IB 1XEWY 3NGXA 4WASA 3ZW9A 4I66A 3NUQA 4LDQA 5A4FS 1RVDA 4L9AA 4H3SA 4UUQA 1PSWA 3K0FA 1WF3A 5L7YA 1UZUA 1UPUA 2EFJA 2CVZA 2PMFA 4G01B 3GDWA 3QFTA 2A8YA 1PR0A 2LTAA 2XT0A 3B70A 4OXYA 3AJ8A 3LYAA 1C4OA 5LKAA 1UXGA 4MW2A 4GZ6A 3TKAA 1PZHA 3WMGA 3LFHA 5FWNA 2G7ZA 4I36A 2ZWVA 4EX6A 1PZMA 1KARA 4A5SA 3KT8A 1A88A 4MW1A 2IPAB 4I1VA 1BU8A 1TA4A 2IHTA 4JR2A 1RPNA 2JFVA 1XK7A 2BBWA 3OTHA 2CSUA 4KMSA 3EIQA 2WUEA 3IP3A 3K1TA 3C3BA 3FIJA 2WKSA 1RE0A 2C7BA 2GZDA 3IAS1 2JEZA 3CNEA 4DWJA 1Y8QA 3NIFB 3H04A 5KQRA 1JKFA 1YASA 4C5AA 1BMFD 2H5JA 3F3SA 1JBQA 1PBNA 4JELA 5FKJA 3LUAA 4Q7JB 3V2HA 3G5TA 3AH8A 2DP4E 2BZ0A 2H8KA 2JBHA 3U3KA 1Z6AA 3CM0A 4WCVA 3U5ZB 3QPUA 1HNWB 4U5QA 2QTCA 4WW0A 4LWZA 4CWAA 2FUEA 3HACA 1LDNA 1BW9A 1GKIA 2XNCA 3E5MA 4O2BB 4E07A 1QIFA 4H16A 3FJYA 1BC5A 2FVYA 2GTIA 5EJIA 2QAGB 1UR5A 2ORED 2WU3A 2Y1GA 2N47A 2QM7A 4RJTA 2HX1A 2JI9A 2EGGA 2PJDA 4UCQA 1H8ED 2NVWA 1N5KA 2OECA 4TV8B 1QH9A 3IEXA 4U4AA 2AKYA 3OZ7A 2P2CA 4DM7A 5KYKA 4JHXA 1WG8A 3RVBA 1AUVA 4DA0A 5JASA 3KQLA 1NFFA 1NGSA 3W2FA 1V7QA 1Z35A 1ZM4A 4N3CA 1TLFA 3KQNA 3CRZA 3TVTA 3G59A 4G41A 3TI7A 1SUIA 3KZXA 4PONA 3M6UA 4MW9A 4M1OA 5IABA 3G82C 2C4MA 1RHKA 4QM7A 1TA0A 3FF1A 3KTFA 4Z53A 3GUCA 3MCTA 4WBSA 4BASA 4BCCA 3I04A 3Q98A 4IIVA 2P5TB 2PA3A 5DOZA 2QORA 4DSNA 3GGDA 3EXHA 1I0ZA 4D3FA 3CB4A 2IXFA 1PGJA 4B0OA 4D5GA 3K92A 4JHLA 2CCJA 1E7YA 3R3JA 2QXUA 3R6DA 3T99A 2Q0SA 4RH0A 5AVVA 3PGA1 3QNWA 4U6NA 3RGGA 1GGEA 1T34A 3WB9A 2FEAA 2FPSA 3L01A 1P6QA 3N76A 4EYSA 2Q5JA 3O4VA 4S2EA 1PKXA 4S1WA 4D6PA 2VUUA 2GS9A 3CT6A 1Z2NX 4LJ6A 5EEGA 1WB9A 2NU9A 1TJ3A 3Q5EA 5H3LA 1RQ2A 5ALGA 4YRTA 1C1XB 2YWEA 3DW1X 1XFDA 4CMAA 1JILA 3JARB 1P6XA 1KK2A 4EP1A 1ZINA 2BD0A 4RLHA 4YV7A 3S8MA 4XVQA 1PV1A 3T15A 4OYRA 2XMGA 3SEAA 4B3RB 3UJ3X 2GHTA 1Q7EA 3QV2A 3AQIA 2RHCA 2AD5A 2ZRDA 3IVMA 4DANA 3P9QA 4MR9A 3GRUA 4YMWA 4WK4B 5CEJA 2IYLD 4G0QA 3NHSA 1JEQA 4C1NA 2XRMA 3KR1A 3WL4A 1X38A 4RAOA 1HNZB 1SU6A 4MS1A 1GA4A 4M8KA 4CG2A 3VVBA 1T2NA 3G7NA 4YMTA 2NYUA 3UW3A 3QMWA 4IMIB 4BC1A 3X2SA 3FYCA 4RFSB 5CLIA 1NT4A 4JUIA 2WIGA 4YTEA 4KQGA 4MV1A 3ISTA 3EH1A 2F55A 2YW9A 3NETA 1MJNA 3HRHA 2W6OA 3ROXA 3UK1A 5JFTA 1CY1A 2RG1A 1BS1A 3KJFA 1YJQA 3P2KA 1G4HA 2ZS8A 2EW2A 5DBFA 1K8RA 5FO1A 5BQOA 4EG3A 1NG9A 1B0ZA 3E15A 1Z6YA 4K9OA 3H2SA 1E3SA 4N39A 2ECPA 1HA3A 2J46A 5IVDA 5CVTA 1GFWA 3LP5A 4L6CA 5IN5A 3ODGA 5ALKA 5EE9A 3SXJA 3FW1A 5C8ZA 3E5NA 3IUEA 5JVDA 2FN4A 4NU8X 2H9AA 1OQAA 4D7AA 1EFPB 3A26A 4OKIA 5IMSA 5TEVA 1KZGB 3CQ9A 3GDOA 4A4DA 1QGYA 1BVRA 4E5DA 2W2MA 1OIWA 2QG4A 3LX5A 4NAUA 4BTEA 2QRMA 3RR2A 2NO9A 3CG4A 1EHCA 5J2TA 3WZ2A 1FX1A 4PXSA 5E6SA 3TNLA 1T5TA 1KAMA 2HV9A 3CNBA 3HDTA 2FRVA 4RKFA 4N7MA 4GVXA 5ALHA 3ZPXA 3NFRA 3FHTA 1OH6A 1TGYA 2H0AA 2PZGA 4MYRA 3R5FA 2GBPA 4QJIA 5E1MA 3PKZA 1L5RA 4JI6B 1W88A 3SZRA 1WZUA 4D4GA 2OLJA 1KF0A 5AH0A 1PHRA 3O7WA 4OXKA 1QTIA 3EFOA 2AG0A 2QL6A 2ZJ1A 3TXXA 4DLWA 4MCAA 3KR2A 1KDYA 1MAWA 1KQ3A 1QVAA 3SJCA 3RLIA 1I6WA 2VF8A 1JFFA 3K0FB 4MTCA 1KR2A 3OZRA 1Y6FA 2HJVA 4J3JA 2OOKA 5LQCA 2WD7A 1POXA 4IDNA 3HEBA 3L77A 4WLUA 3B9QA 3E2PA 4ZVSA 2YQZA 3ZHVA 1EXVA 4G5QA 5ICCA 4CXMA 3NIDB 3BL5A 1N2HA 1NUUA 2Z5LA 3GRFA 2XBMA 3FGOA 4QXAA 1FY2A 3RWMB 2VDUE 1XP8A 2J3IA 3C5VA 4OM8A 1G9XA 1V4NA 3V4LA 4MV0A 5IDVA 1XYGA 4JXKA 1KGSA 2PZAA 4TZKA 5FOQA 3DE4X 4GR9A 1JIQA 4LC0A 4EO7A 2PKQP 2Q3FA 1Y8QB 3K5WA 1OKKD 4S2UA 2KX7A 3RDPA 4RZHA 3V80A 3TSCA 3ULKA 4YDSA 4C6RA 5HKAA 5AW5A 3GOQA 4X84A 5K4HA 3GLUA 4E3WA 3HA5A 1EESA 3F1KA 4E51A 4PLPA 4QQRA 5E3HA 1NJ2A 5D1NA 4G4SP 3N2EA 4PYRA 4NCHA 1GTG1 1MGOA 1NYRA 5LDHA 2APJA 4R16A 1QK4A 2ZIUB 3DL7A 1RHMA 3L7CA 4U8GA 4BJ1A 3ZQUA 1JA0A 1BW9B 2ZQ5A 5IEJA 4EG1A 3E9QA 2II6A 3RHFA 4CT4B 3AXTA 1RHUA 2RK3A 4KI0A 2QU7A 4OB7A 3S8YA 1LTHR 4DTCA 1II0A 3WV4A 5F21A 4PBRA 1SC4A 3C7TA 4MQEA 1CUGA 1SO8A 2QG9A 3QIAA 4P5PA 4UEQA 1XNQB 2F2TA 1T5IA 1CF9A 3BRWA 3G02A 5LQNA 5A4JA 1DQSA 4N3GA 3IHWA 2EIXA 3LCCA 5K1ZA 3FIUA 1Z0DA 3PF8A 1EYZA 3I2KA 4RZ3A 5ILGA 4L72A 3SEZA 3W2HA 4Q02A 4ON9A 2YVQA 2VQ6A 4Z3OA 4DLTA 1W52X 1R6TA 3OU7A 3AETA 2C3OA 2WAYA 3A6LA 1YKFA 3F5MA 3IQEA 3IT1A 2VG8A 3KV3O 4YEDA 5K0EA 4LZZA 3OOSA 3SZLA 1YZUA 4M9SA 4FS8A 5A4DA 2VRCD 4MQMA 1FIUA 3MCZA 1DBSA 3C6QA 2CJXA 4J8PA 1D8AA 1X42A 2I4NA 3UB2A 1U28C 2GF0A 1ESNA 3LT0A 1RSZA 3B6IA 3D7NA 3NYWA 3EXHB 2OXIA 5EL0A 1BHO1 1UJMA 3OSZA 1VL0A 2JD2A 1KK3A 2SICE 3LLSA 4MHSA 3RS0A 1W8IA 4E3ZA 1EWRA 3DWEX 3PGXA 4J0JA 3KSUA 4JU8A 3BWVA 4QQFA 4AKSA 2Z2ZA 1XXHE 3DR5A 3IR6A 2X5KO 3LBIA 1K1EA 4YO8A 1Q0PA 1AMUA 3AR4A 4HWGA 4J07A 3QYJA 2IOYA 3MMXA 2GVNA 4RZUA 1XMSA 3G8AA 2BGNA 1F4LA 1VLLA 1ZIOA 1NIJA 2DLDA 3D8UA 2NU9B 3RQSA 4O2RA 4IZHA 4MHOA 1M75A 1UT8A 1Z2DA 2O2GA 1ZFNA 3FZEA 3KELA 4QLAA 4YJ2F 3VSBA 3L9WA 2XE4A 3P0JA 2BKVA 3ORSA 1DT3A 1VPEA 2PCLA 4OH7A 1MMFB 5LYJF 1PGOA 5BN4A 1SQ6A 4EEZA 5ALXA 4R7TA 4QDKA 3I2IA 3Q9SA 4I8DA 2FX5A 2XR1A 3OJLA 2QB5A 4MR9B 1AHNA 4EPTA 3OLCX 4B3SB 3HCWA 5G53C 3NTXA 2XE6A 1JEQB 3G2JA 3NR2A 4J43A 1T4MA 2ZB7A 3RU3A 2ZULA 1L8QA 1KKMA 3IQIX 1NFQA 3WYEA 3P4XA 4TTQA 2PMBA 4MRSA 1OWPA 4I50A 2GCPA 3OIFA 1XI2A 4BVHA 4YHHB 4BO9A 4AAYA 4BWYA 2HB6A 1KFJB 5F2KA 3DZCA 4DB2A 4V3BA 3T4PA 2RHTA 4AKGA 3V8EA 4QPJC 4NKRA 5P8WA 6REQA 2WYIA 1UXJA 4EJSC 2WFZA 4F56A 1WE2A 3AEXA 2R1ZA 1T6ZA 1SZCA 4N3AA 3ZNOA 2IYQA 2WDZA 3G2HA 3RTBA 3D7RA 2BUCA 4FNAA 1C8LA 1AH2A 2VZ8A 3ZWQA 3NXKA 3SQOA 2DHEA 2CNBA 1AKEA 3LX4A 5JO9A 2IUUA 1YJAA 5IM4F 4Y8VA 3P0IA 5IYZF 2O5VA 5DYGA 5I9BA 1OLUA 2CVQA 4ZDIA 5JVDB 2C9MA 5DIFA 3A28A 3AINA 1YV9A 4TPKA 1CEXA 3OPNA 3I01A 3JYNA 1HFEL 2JARA 3ET5A 4QHYA 3WRVA 3ZE7A 3C15C 3W4JA 2VHWA 4Y2QA 1JU4A 3EZ6A 2L0XA 3B3AA 4RE5A 2PA0A 3EFHA 3IEVA 1Z4NA 3LVRE 3MFQA 4R68A 4E08A 2P9EA 1OZHA 4F45A 3CHYA 5J2TB 4RABA 1HGXA 5ALQA 1Y6ZA 3FXAA 1M1XB 1SQGA 2V5UA 3CKMA 3GEGA 4IF4A 5E6SB 5MF6A 4OIMA 3U4DA 2DPXA 1A9PA 2P2YA 4QBHA 2Y0BA 1COWA 4J7AA 1S8AA 1GPWB 4P0TA 3OLQA 4EUKA 2GBIA 5I7FA 2R4UA 4QDZA 3SFTA 3RODA 5IWAB 4AUEA 1I6LA 3JQAD 3CUEF 1W88B 2QL7A 2XX3A 3EZYA 3MWJA 4KN6A 4RM2A 1C3OA 1XSEA 2AJCA 1GEEA 2FMIA 2FRDA 2NADA 1D2GA 4RPCA 3DL2A 2JFUA 2YL2A 1ISGA 5M5BA 4EW3A 1KVRA 2ISQA 2HK7A 3EFOB 5HJEA 1LSUA 2J09A 4H1VA 1YOVA 5DXJA 1L7BA 3NWEA 4RLSA 3RH0A 1JTFA 2XDYA 4PHCA 1JFFB 5JAMA 3KU1A 4BFYA 5DNDA 2B5VA 3VNRA 5ICSA 2JAXA 4PQYA 5AOBA 2WD7B 2WWFA 3A05A 2QJWA 1KDVA 5LQRA 3RB8A 5C1IA 2VT3A 1K68A 3RM3A 4DBLE 1N6KA 1DELA 3D3JA 2XA2A 5EUMA 1KI7A 2HSDA 2XEXA 5LD2B 4R8LA 2XCUA 4L0DA 3GFQA 3T7CA 2ZYHA 4DCUA 5HVNA 3OZFA 2NZXA 2VAXA 5I4IA 5FHRA 5IRCD 4OQ4A 2W22A 1VGQA 3DDOA 1J90A 1K5HA 2EP5A 1ST2A 2ZJZA 2HI0A 1F0PA 5K0BA 5C7YA 1O95A 3CURA 4JROA 1VIVA 4MJLA 5CBPA 2EG5A 2ZU6A 3F47A 4BNZA 3EEQA 4GX5A 4JI0B 1NA5A 1E2JA 3O73A 4D6YA 2OOSA 2Q9AA 4K05A 4MVJI 5I5GA 1H2YA 1N1MA 3T7KA 4N41A 4I1RA 4URXR 2V5VA 1XN1A 3I2GA 5JADA 3ZGZA 2ZSUA 3JQ9A 1E0JA 4YT5A 2PKYX 2ZBPA 1VPDA 2GGSA 1C50A 1F06A 1TF5A 3KVYA 4CUKA 4HEJA 2O2SA 3B5IA 2FSFA 3FAZA 4MQEB 5ALEA 3CPEA 1QHIA 2YV4A 1XC7A 3BN3A 1E1QD 2D4AA 4BV3A 3U9SA 3MJVA 1V3QE 5HA5A 1RLMA 2VYQA 3IMGA 4OLJA 4RZIA 2ZRQA 1TLLA 3C3EA 4YQFA 2Q5EA 4P81A 5FL7A 4BWGA 3F46A 3AETB 1J8DA 2Z95A 3H2IA 5IX8A 5B30A 4XIYA 4M49A 3MVEA 3D7KA 2VQ3A 2ZVDA 3LQYA 1FFWA 1LJ8A 2NZVG 1TO1E 3DDSA 3H9QA 3SVZA 5I01A 1NBHA 3UB4A 1NRJB 3VQTA 4EB3A 3RW9A 1YZNA 1JW9B 4KO4S 1CLEA 1ES9A 1E60A 3F5QA 3PFBA 5KNBA 2QTAA 1LFAA 1G7TA 1V11A 1NJGA 4BFTA 5LMUB 3QFHA 2E1RA 3AI1A 3TI9A 3VR3D 1KU0A 1ULUA 2A1IA 3ANTA 1M10A 4G37A 4KFSA 3H9EO 5C7OO 5CCDA 2PQMA 4P3OA 1RPAA 1UBNA 2HA0A 3LRXA 5E4JA 4EH1A 2FGJA 4PN7A 1CZKA 1Y3BE 2HJ9A 1Y6JA 4RL4A 3ZE8A 3O90A 1OC2A 1FSZA 3BJMA 1C0LA 4FHEA 4WEOA 3B38A 3LSYA 3SJBA 4EWLA 1KSHA 3AUSA 5BN4B 2HXGA 1ZJWA 1C0EA 1M2KA 1MEJA 2B9VA 3KOZA 1RQPA 4G1BA 1JPUA 4U63A 2VEDA 3UC9A 4BATA 2F8SA 3LTEA 1WNFA 5LIRA 2SKDA 4IWYA 1U0LA 1Z3CA 3R7FA 1K75A 1PL8A 3HP7A 3VBCA 3IJPA 1POWA 4LWOA 3TYXA 4F3YA 5C1OA 4BVEA 2GQ0A 4N48A 4IEIA 2FFJA 3VISA 1R4NA 2A1UA 1OFVA 4KOEC 4B6RA 1P1HA 1HSZA 1Q1EA 4Z7NB 3SDBA 2YXDA 4I50B 3KXIA 2NSDA 4PNZA 4UDNA 1JDZA 3OQ1A 2H65A 1CQXA 4UDOA 3VC7A 3WK4A 4C2BA 1HI9A 3WGYA 3MJEA 4LBVA 3CNNA 3V4ZA 5LJIA 4AD8A 1EAMA 1LI7A 3CLRC 3LHFA 4Q0MA 6REQB 1PHPA 1QTNA 1Z4KA 3BH0A 3E9YA 1IK6A 3GCDA 3JWHA 3P5BA 3PQDA 3GP8A 3TLCA 2FWMX 5E6UA 5CFLA 2WIDA 3R5JA 3AM4A 4H6WA 1Y8CA 2R11A 3GUVA 1DRVA 1Q1ZA 3KU4A 1GVHA 5KVAA 4WZ6A 1PYGA 3A6GA 4LGMA 3D3QA 3BF8A 3TNYA 1QGDA 2WOJA 3QJGA 4OLFA 3PC8A 1CUWA 4IIGA 2YFQA 1OLUB 3NPAA 4A82A 2YMMA 1KERA 3HL0A 1WDWB 4BO5A 4K0KB 4TTJA 4WNIA 4YXWA 4PLTA 1G21E 4D97A 4LF8B 3DVQX 5EZ6B 4BRUA 1ZJ6A 3PKJA 5FNVA 1E6UA 4B74A 1CRZA 1NLZA 1UOQA 4WERA 2DULA 4V1CI 5JRJA 3ADDA 3OH8A 3Q7TA 5BUSA 5JBIA 1O97C 2WAXA 3IJEB 5JATA 4KTTE 1P75A 2AX4A 4FBMA 1CR2A 3DT6A 4ZVMA 4COKA 3AIMA 3SXUA 1UL1X 4LDJA 1X13A 1QFMA 4WDQA 4MHTA 2H4WA 3SHFA 1TO2E 3FETA 3OEHD 4DY4A 1JVBA 2BCJQ 5J4KA 4CI0B 1FS6A 1WEHA 4CDRA 4O08A 4JJIA 4Q3EA 1C3OB 4NG4A 2C4WA 3ZNPA 2IYZA 4GXNA 3RS8A 2ZAYA 3ETJA 1A1VA 3TDMA 3IILA 2H4ZA 3H1FA 3T5DA 7MDHA 1CWUA 3QUTA 2J6IA 3L1JA 1U9CA 5EVJA 1YOVB 1QO0A 2HU2A 4W8OA 2IXBA 4HN4B 1R0CA 3PGLA 4CN9A 4YMUA 4BZPA 3DLBA 1KR5A 3QLUC 1CUBA 4OKNA 1E32A 3JQ7A 1E4VA 3PRJA 1DOHA 2TS1A 3NJ8A 1AB6A 1TZ2A 3V42A 1VECA 2CXRA 5GQSA 4YCMA 5K0FA 3UB3A 4X1OA 2HAEA 2UYGA 4BNYA 3UYLA 3KVVA 4RV5A 2AF3C 1AKVA 3DQQA 3DVSX 4LC9A 2HRCA 4UEJA 2JZCA 1DV1A 4ZO9A 4ZQIA 4YAUA 3IVGA 5AJUA 1N5MA 4PEVA 4MQBA 2WWIA 1U99A 3UEOA 3WGTA 3WGKA 1YS4A 3DNFA 4C9BA 2QLMA 3N2ZB 1UEJA 3OZGA 1NVVR 2JDID 3JAWA 2C0QA 5JXIA 1IJEA 1ZGJA 4A36A 2J3MA 2E87A 3LV8A 4GM4A 3QFFA 1CJTC 3ENZA 4N0QA 5IK2D 3OJOA 4NDZA 4EF6A 4R6WA 1ACJA 3FBTA 1JMVA 2QD3A 3I12A 5JZMA 1ZH0A 2ATIA 4PYOA 1BDHA 5L40A 5KSOA 2A9JA 3GMIA 5C8DA 5CBPB 4QFCA 3UHJA 5EHXA 2CLLB 1XZMA 4BN5A 2EL7A 3ADBA 4FXOA 1FOEB 4Q7LA 1ONSA 1E2HA 1RFGE 2JLAA 1X74A 1F7VA 4NIMA 1CZOA 1BFKA 4MW5A 3R3YA 4HDNA 5FI5A 1CUVA 3D43A 1EUYA 2JJ1D 4RMHA 1XAHA 2IHYA 4NI5A 1JP7A 1LVGA 2JK1A 5HG0A 1Z6ZA 3BTVA 1KIAA 3CEPB 3HJGA 4IXMA 4EUHA 2QN2A 4FDLA 3Q3JB 1JDBB 2W2LA 5JMOA 1MNAA 1DG1G 2IEYA 2NQ2C 2I34A 3AGQA 3IVCA 1D7AA 3ZLBA 4HQNA 3VDXA 3K71B 3IUMA 2O1WA 3TZQA 2BN4A 1S4QA 1UP4A 3LX8A 2XZDA 1MN6A 2A0XA 4IQ0A 5DHQA 1QQTA 2YXNA 4LJ8A 4ARIA 4PBTA 3BIOA 4QREA 3ZGYA 3KXDA 3HCAA 4JFRA 3EEYA 1B0UA 2KQUA 1UC8A 4HAXA 4DGSA 1VA4A 2BZSA 4YP7A 4IIXA 2GJAA 2WZDA 3HMKA 3NBMA 4PG5A 2QYTA 4U39A 4XCVA 4GDFA 4RW0A 3IAM1 3F5SA 5KDDA 3AB3A 4QOHA 5T7BA 3LXRA 4FGJA 4ZV7A 5IWCA 2A9KA 4G9BA 3C3MA 4J7CA 4RVCA 1D7OA 3MSXA 2PUVA 5ENDA 3OZUA 2R8RA 2NUBA 2YBEA 3K2EA 2D8MA 1NR7A 2HWUA 1IULA 2B2NA 2QUKA 2WSMA 5DDIP 3WWCA 1UKBA 5A1TA 2IS2A 2MMGA 4I4CA 3L8EA 1YS6A 2X2FA 1V11B 4K46A 1F6DA 3CLUD 5B37A 4ZI5A 3ZU2A 4IDPA 3R0IA 3OPXA 4G8CA 3T0IA 3WX0A 5DYYA 1U3CA 3CKYA 4EHHA 4BFSA 4RF2A 2C7QA 4OHPA 2NM0A 2OHGA 1XZBA 2YBDA 3LPNA 4K26A 4NEHB 4QVGA 4S12A 3QE2A 1ISJA 1PIWA 2Q4RA 4LGCA 2AOXA 4OHUA 2HCTA 3DDUA 2SKCA 1KK0A 3CSUA 4MGEA 4P2GA 4Z5XA 1E2DA 1KEVA 2CMGA 3ZDCA 1PZGA 2RGCA 4KBYA 3HWWA 1P74A 4MAFA 4A1FA 3TUZC 5HBGA 2HO4A 3WQHA 2JIDA 1YTLA 4D3XA 4DGQA 2FUNB 1R6AA 2CD9A 2RKOA 3KT3A 3N58A 4DA6A 1TRHA 3I2FA 1K9SA 2CEAA 1NOKA 1NLFA 1QKJA 3I9LA 3K30A 4QXMA 3HWRA 1XQ9A 4Q1BA 2VPYA 3STYA 4P9NA 1R4NB 2A1UB 2QRNA 3ERCA 3VYVA 3RSZA 3RIXA 2GEKA 3BQNB 3ZCRA 4LGYA 1T3SA 2QMQA 3L6DA 3QVWA 5DBHX 2ENUA 2QNBA 2E4YA 2VH2A 1SD2A 3KQOA 1TAHA 5TV2A 2WJYA 4WESA 2M6KA 4FPXA 1U8TA 2BW0A 3RT9A 3AOEC 2R6R1 3HCEA 3WYGA 3VSEA 4CW7A 3A1VA 4Z4EA 4HAUA 3L82B 4YJHA 4E5UA 5HPYB 3IAEA 8LDHA 5E6UB 4Z7JA 2UVQA 3CLKA 4HAZA 2PX4A 2W00A 1ZU4A 2GXUA 2DUNA 2JLYA 5CFMA 2ZUUA 1W48A 4KKVA 4CF4A 2EFHB 4C4PA 4DCJA 4DREA 3E35A 3FTNA 1KTVA 1BDIA 4PYMA 1E0SA 2ZSBA 1BJRE 3FUUA 2C8JA 5BMVF 2FEMA 2FWIA 4RFVA 1TMGE 4A6XA 2IC5A 4IHJA 4UTOA 4EW1A 4LF4B 4BGDA 4E5PA 2VBFA 3EA0A 3AJDA 2DE0X 4BNLA 4MXDA 4D8UA 5FPHA 5FNVB 5TQ2A 2G70A 3EQ6A 2JGIA 1YRWA 3UJ8A 4E46A 4J9VA 2B78A 4CKYA 1FFYA 4LRYA 2PH7A 1VB3A 2A5DA 3EGXA 2NZ8A 1FFCA 2BONA 2J45A 1L1EA 4XB6B 3STTA 3GW8A 1USVA 3SXUB 4BJHB 4KWIA 4MVCA 4LYYA 1Q0UA 4MKXA 3M5PA 3V55A 5KWJA 3PFHA 4XIJA 1M1NA 3T9EA 3QXXA 4B85A 3T5TA 4XGQA 4TYWA 3INYA 4N40A 3IE2A 1J5XA 2H16A 4QELA 3S4YA 4HSEA 2GASA 2DYKA 2O3RA 2OKCA 1ZVKA 4WIAA 5IDYA 1UEXC 3T35A 5BR1A 2C58A 1B8VA 5BW8A 2RC5A 4BLTA 3TLEA 2XZPA 2JGNA 2XYRA 2Q2OA 3LWDA 3PHGA 5DT9A 1SVNA 3I92A 4V0KA 1AF7A 3F7NA 1O3YA 5LM3A 4H3VA 3QE0A 3ZDFA 3BWXA 5C4IA 3JQ7B 2EP7A 4MKIA 3HUTA 4TQUS 1N5RA 4GOOD 5HMMA 3ECCA 4EAAA 1UJNA 5EGSA 5CW2A 4GBGA 4X97A 3AEQA 4M1WA 1H85A 2Z43A 2CC2A 3DO8A 2NV0A 1LPNA 1RJFA 3QVTA 4I14A 2QR3A 3FF4A 5AXAA 3SFVA 4C89A 4YDQA 1LRKA 1YZQA 2Q50A 3UICA 1EE9A 1FUUA 1NW6A 1GTL1 1U0OC 3P2YA 4HG2A 3LHKA 4PN3A 2BFOA 2O8FA 1N6HA 4NS1A 1MRNA 1LQ2A 2FN9A 3FMIA 3JAWB 5LZ9A 1DMRA 3GGPA 2NT4A 1EVZA 4KXVA 2PU7A 1N7HA 5DP2A 4YUXA 5ALVA 5JRDS 3FCCA 3IAFA 2DUMA 3O1LA 5C8VA 3BFPA 4NFHA 1A2BA 4FX2A 3VDQA 4YPFA 1XDSA 3WKAA 3L1UA 3PFCA 5DM0A 4DNPA 1ZJJA 3Q0TA 1PJZA 1YONA 5GIPE 1VGVA 3JQ8A 2O5EA 1TMKA 2C03A 3L7NA 3CLTC 4MQ5A 3TW6A 1HT3A 3G9UA 1W581 4D46A 3W5BA 4BEVA 2VYFA 3U61B 5DI3A 4RWEA 4HDNB 3M5DA 1GU0A 1FU4A 5A5DA 4S1NA 2PY6A 4Q37A 1UANA 3IPAA 3OICA 3QQ5A 4A26A 3D0QA 3WWOA 2OO5A 1OX4A 4MCIA 4PTYA 3ROQA 3OM1A 1RRCA 2B7BA 5KQPA 5ENZA 2SKEA 2IZ7A 1TTQB 2WHEA 5BNTA 2I8LA 1ZK1A 2YWXA 3QVKA 4RSHA 2Q2WA 2XOEA 3AUJB 2QW1A 3M34A 4R9NA 4TL9A 3II6X 3ZXSA 1UPXA 1W19A 4WKBA 4WZBA 3LJKA 4J0DA 1QR2A 2PKQO 4QUAA 2E6KA 2VP9A 7REQA 1VHQA 2Z58A 5JJCA 1WPGA 3B5JA 4UMEA 2XYGA 3OJCA 2E4AA 1Z63A 5LDGA 4CCSA 3ZLVA 3IUNA 2WF6A 3A14A 4IRMA 4B6OA 3JWJA 4G4SO 3IV9A 1OYVA 2XMPA 4OH1A 721PA 2Y68A 2X0RA 4UPDA 1M6WA 2W2PA 4A73A 1ZAYA 3P27A 2W9XA 2D00A 3J7TA 3L6UA 1RXUA 3QIVA 1V6CA 4HJXA 4KE7A 4D9HA 2WJPA 3CRVA 3D31A 3AJRA 2R44A 3GLQA 3EF1A 4G2NA 4JWKA 3WIVA 2G1JA 3OQPA 4ALLA 4CCYA 5A9SA 4XVRA 8OHMA 1DC5A 1DQRA 2E18A 2IEDA 4D9MA 5KZMB 3NV9A 4BVGA 4ZZ0A 2ISCA 4CEHA 3ZNNA 3QTBA 1JHVA 2BMVA 4MVWA