3FLEA

Se_1780 protein of unknown function from staphylococcus epidermidis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
245
structure length
243
Chain Sequence
KTTATLFLHGYGGSERSETFMVKQALNKNVTNEVITARVSSEGKVYFDKKLSAANPIVKVEFKDNKNGNFKENAYWIKEVLSQLKSQFGIQQFNFVGHSMGNMSFAFYMKNYGDDRHLPQLKKEVNIAGVYNGILNMNENVNEIIVDKQGKPSRMNAAYRQLLSLYKIYCGKEIEVLNIYGDLEDGSHSDGRVSNSSSQSLQYLLRGSTKSYQEMKFKGAKAQHSQLHENKDVANEIIQFLWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SE_1780 protein
publication title X-ray crystal structure of SE_1780 protein of unknown function from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 67
structure length 243
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fleA00
1AURA 4H7DA 4QLAA 1CUZA 2XMZA 5FKJA 3AUKA 5SYNA 2YASA 2R8BA 5AM3A 3IULA 3WWEA 4DLNA 5LZ7A 4X6XA 3L1HA 2Z8ZA 4BE4A 1QONA 4AZ0A 1XRQA 2K2QB 3S8YA 1CUSA 3G0GA 5DNUA 5EHQA 3G7NA 2HA6A 4AQDA 1KU0A 2QMQA 3IUMA 1A8QA 5E4YA 1MAHA 1H2WA 4FNMA 4V2IA 3QH4A 3WK6A 5T4BA 3ESBA 1CIJA 1ZGBA 1R9MA 3IA2A 5BV7A 3C6XA 1E8MA 4ARAA 4JNCA 2RGUA 3GZJA 5EIAA 1ZD3A 2WUDA 5AM5A 1U2EA 2XDWA 4F60A 2OXEA 2HA3A 3E0XA 1XFDA 1G42A 2DCMA 5DNWA 2GBCA 4X71A 2AJBA 4K5QA 5JAUA 1L7AA 3PUIA 1Y7IA 2PUJA 1BS9A 1BROA 3ESDA 5DNVA 4BDTA 2HFJA 4GW3A 3ANTA 3M3DA 3C8DA 4EB0A 3STVA 1A7UA 3DNMA 3M81A 3MGAA 1DX6A 3H1BA 4G9EA 3WZMA 1XZCA 1ODTC 4QWWA 4DSZA 1AX9A 5CRIA 3WKAA 3KSRA 4EZIA 2WSLA 2GBFA 2HA7A 5AP9A 1EK1A 5JATA 1BEEA 4UBLA 2XUFA 3AIKA 1VLQA 3ILSA 4OB7A 4IH1A 1WM1A 1ODSA 2Y2UA 3HABA 2XUGA 5ALXA 3FLBA 5AI9A 3IUJA 4CFSA 3O9VA 4H7FA 4B80A 2HRRA 4X91A 2VT7A 2WG0A 4C87A 2O2IA 4ZRDA 5CT8A 1GGVA 2OQVA 4LYEA 5AKYA 3V1NA 3K2IA 1MO2A 3EQ7A 2EDCA 4OSEA 4G8CA 2X8BA 2VAXA 3D4LA 3UUFA 4NMWA 4Q3KA 2XT0A 2ECFA 1MX1A 3IDAA 4S0XA 5JD5A 2C0QA 3L1IA 2QRUA 3KOOA 4W63A 3WWPA 1F6WA 2HADA 4QZVA 4K6KA 3LS2A 2WJ6A 1CUCA 3C8HA 2HL6A 5D6OA 2WHPA 5AIAA 1QIDA 1BRTA 3R0VA 4UBJA 4C4ZA 1CUEA 1EI9A 3OTQA 4G4GA 1IUOA 1QE3A 1X2BA 5HK8A 5AM2A 5CXXA 5A7FA 1QIMA 4RPCA 2GBGA 2P8SA 4BAZA 4F5ZA 2ZJ7A 2EEPA 1YAJA 3QVMA 2WHPB 2HHAA 5AKEA 2PUHA 3W2TA 1CRLA 2OGTA 3I6ZA 5ALLA 3LCRA 2H9YA 4BC1A 4WJLA 2J3QA 4AN1A 2O7RA 3W9BA 5ALMA 5K3FA 5ALPA 2ZSIA 1CFJA 3PE6A 4XIIA 2HIHA 3U0VA 1QIIA 3S2ZA 1XZHA 4H0CA 1ODCA 5AIBA 1CUDA 6YASA 2VJBA 2O7VA 5ALDA 4Q3OA 1HDEA 5AM0A 2WIDA 1QOZA 2RI6A 3HXKA 2PKYX 5SYMA 5LZ5A 5BOVA 2VSQA 4IH4A 4PNZA 4OUKX 1BN7A 1CUGA 2DQZA 3TJMA 2JGFA 4Y2YA 4Y2RA 4JYMA 4B9EA 1G66A 4WDRA 1YR2A 1CV2A 2VF2A 1EA5A 1D07A 4X95A 2RIPA 1MNQA 1LPMA 4JYPA 1GPKA 4FNGA 2WG2A 5AOCA 4UHDA 2VTVA 3F9CA 3QPCA 4MYSA 3R3XA 2PX6A 3IURA 1CEXA 5AM4A 3PDCA 1QJ4A 2ES4A 3WIBA 4OB8A 4J0CA 1Q83A 1TIBA 1CUWA 4PV7A 3KDAA 4PW0A 1CUFA 2PPLA 5HF6A 5JD6A 2FJ0A 5E4JA 4X90A 3B3QA 1USWA 4BE9A 4X3CA 5I9IA 5ALTA 2WFMA 1THGA 5LZ4A 1LPOA 2GBIA 1GXSA 2YXPX 1R4ZA 2GYWA 2G4LA 1UOQA 4B83A 3PICA 2ROQA 4KEAA 4DSAA 5ALJA 4FDMA 3G8YA 3VVLA 4AX4A 5C7YA 1IUNA 1TQHA 3ICWA 2RHWA 1MTZA 2WIGA 2BUCA 1ZI6A 1ZD5A 3BWXA 2XQKA 1Y37A 3I2FA 5K3DA 4K2AA 5IH7A 4MJ3A 4A23A 4AZ3A 4JEIA 2XQFA 4B85A 2D5LA 2C7BA 1IMJA 1EINA 5FPPA 1UKCA 3R3VA 3HEAA 5KBYA 1AC5A 1U8EA 2V9ZA 4ZV7A 5A6VA 5HZGA 4P9NA 2XMGA 5ALUA 4E46A 4U2EA 5HQ3B 1E66A 2WUFA 4ZI5A 1H23A 4MEBA 2BAGA 3T52A 1M33A 3H18A 5EHZA 5AK6A 3QM1A 1YA8A 5FP0A 3W06A 2E3JA 5JZBA 1C7IA 1A8UA 1CVLA 4LXGA 5ALHA 5JZ9A 4ZV9A 1QIGA 3NUZA 5AKIA 2H7CA 2AJDA 4OU5A 2JF0A 2XMDA 4J0DA 3IUNA 1BCSA 2WFZA 4UHBA 1XRPA 5K3EA 1TKRA 3RLIA 3WK5A 1ETHA 1L7RA 4WFKA 5K3CA 1WHTA 3D59A 2W6CX 1IUPA 1YAHA 5K3BA 5FXMA 3WQHA 4Q1VA 4DNPA 5BWCA 1OCEA 4KRXA 1DT5A 2HU5A 4PSUA 4TGLA 4J0JA 2OAGA 5K5EA 2RHTA 2OCGA 4PO3X 1BE0A 1XZDA 4KAAA 5HK9A 4IO0A 3D2AA 1XZFA 2H7XA 3FVRA 4MWTA 3C6ZA 1K8QA 3FWHA 5F4ZA 1LNSA 4DMCA 5C81A 4J3JA 3MUOA 1GPNA 2HA4A 1IZ8A 4X00A 1QTRA 4GXNA 2XQGA 2G5PA 1HLGA 3WYDA 1LGYA 3WLAA 4FMPA 4B6GA 1ZICA 3STTA 3SC2A 1QO9A 3WWCA 4AO7A 3R3YA 1XLWA 2QR5A 3H04A 4HAIA 3W04A 4M0FA 4PSDA 3STXA 1H22A 3FVTA 1A8SA 4G9GA 5CH3A 3WYNA 1U4NA 3WJ2A 2C5FA 3HJUA 4G5XA 4UUQA 4JUIA 4FLFA 4WY5A 2BFNA 4CCYA 2I03A 1K4YA 3C5VA 1AUOA 1VZ2A 4G4IA 2DSNA 5CMLA 2ONCA 1EDEA 2OAEA 4U2FA 5T4HA 3AIOA 5ALIA 2BJHA 3WK4A 2BKLA 3ZWQA 2VATA 2JIDA 4HRYA 4CG3A 3VXKA 4FLEA 4CCYB 4LYDA 4QLOA 1EVQA 5JALA 5ALQA 3G0BA 4HS9A 4NS4A 3WL6A 3MUNA 4BB0A 1R9NA 2C0PA 3HACA 4Q3LA 1FFEA 3DCNA 1ZJ5A 3PFCA 1XZBA 5CXUA 5FOQA 1WCYA 1XZJA 3H0CA 4BAUA 5JZSA 3R3UA 3ZLVA 5LLSA 5IKXA 4EHBA 1VE6A 4W1RA 4EY4A 1GKLA 4F0JA 3MVEA 3G02A 2ACKA 1MJ5A 3NOXA 3I6YA 5JIBA 2WJ3A 3DYVA 4N8SA 4Q82A 1Z68A 3WK8A 5ALRA 1Y7HA 4QA9A 1ZGCA 2QM0A 1DT3A 3C43A 4CG2A 1GT6A 2IIVA 4MEAA 3IUQA 2WTNA 3NGMA 2BCEA 4UBOA 2QTBA 4BYMA 1PJAA 3D3NA 2XUKA 3DEAA 4IHAA 2WU4A 3TGLA 2O2HA 2PSDA 5H3HA 3IVMA 1XKLA 5AK3A 1EB8A 2FX5A 2UZ0A 1F8UA 4NVRA 1XROA 4QDOA 3LIPA 1EK2A 4CCWA 5HKAA 2B20A 1JMYA 2XUQA 2PSHA 4KYVA 2XI4A 1WPRA 3SWWA 5EIEA 4WDQA 2QKYA 1W4LA 2HA5A 2QJRA 3ANSA 5EFZA 4MXDA 4TPKA 1A88A 1ZIXA 1EXWA 2GZSA 1LPPA 3WL7A 2RAUA 1UT6A 3KWFA 2CZQA 3N0TA 2QJWA 5EGNA 3GFFA 2OCLA 2HRQA 5DTIA 4EUSA 4YX9A 1HBJA 3C70A 4BVKA 5IVDA 3FSGD 1R1DA 2VT6A 4Y2TA 1JU3A 3C87A 5AK5A 3ZPXA 3H2HA 4DNQA 1QIFA 1XZGA 4X6UA 4EY5A 4W1PA 4FWBA 3SX4A 4M0MA 1W1IA 3O4JA 1FFDA 2PU7A 1JKMA 1ZD2P 2I3DA 3D2BA 3I28A 4PF1A 5AI5A 4UBKA 1HPLA 4UBMA 1GKKA 3DKKA 5IVIA 2XUIA 1CUHA 3VDXA 1EH5A 3FOBA 1TCAA 4UHEA 5FDFA 4DGQA 5EIHA 1XQVA 1VZ3A 1ORVA 2XUDA 2XUOA 4WFJA 4UBIA 5KWIA 3R3WA 1XRLA 5J3JA 4WFIA 1UK8A 4FBMA 5LYYA 1LPSA 1P0MA 1XZMA 4Y2UA 4B9AA 4X92A 1WB5A 2YH2A 3CN9A 1HKHA 1QLWA 2AJLI 3FAKA 4FBLA 4K6HA 3HSSA 3QMVA 3DLTA 3GUUA 1ACLA 3D7RA 3O9MA 4UHFA 4FTWA 4UFPA 4G1FA 2QUAA 2B9VA 3G0CA 5HF9A 5FPQA 2B4KA 4MQLA 1WOMA 5FV4A 3P2MA 1W52X 4E15A 4Y7DA 3VJKA 4BBZA 1CUJA 2XMQA 5K3FB 3ZV7A 4QDTA 1BU8A 2I3ZA 2CBGA 1FFCA 1XLUA 3AZOA 2BGRA 2XMRA 1YB7A 4X85A 4AO8A 3FYTA 5CT4A 5AI0A 1ZI8A 2WIFA 5ALWA 3WK9A 2ZJFA 3ZLTA 2ZYSA 4ROTA 4DMFA 1XZKA 2HU8A 2PSFA 5AKJA 2FJPA 4KAFA 4FHZA 5AI4A 2WIJA 3QBJA 2YYSA 2OGZA 3DS8A 4C88A 4HXEB 3FSGA 3ZLUA 3ZI7A 5LKRA 4H7HA 2ZYIA 1CLEA 3NWOA 3DDUA 3R41A 2WUEA 1E8NA 1N1MA 3H1AA 2CEKA 1SCKA 1P0PA 1UK6A 5DYYA 4W1QA 3C6YA 2ZYRA 3FYUA 4M0EA 4Y2PA 3JW8A 4J03A 2HFKA 4UFNA 4UPDA 4GBGA 1NU8A 4LHEA 4WY8A 5JYCA 4Z49A 2CUTA 3QPDA 3DOHA 4LKOA 5AKHA 3QYJA 5AOAA 3CN7A 3O4GA 2XUPA 1RP1A 5C8ZA 5C8VA 3SK0A 3CCBA 3BIXA 1R88A 1K5PA 1N5RA 5AI6A 5DWDA 2J3DA 2BUBA 3T4UA 5JADA 1QIJA 3VISA 4HVTA 3G9TA 1SFRA 2JEYA 3DL7A 4AXBA 1TCCA 1WHSA 5ALSA 3A2NA 1UWCA 1DINA 2Y6UA 3PI6A 4C89A 4KE9A 1EVEA 5CW2A 1G4HA 4H7JA 4CIAA 4MQMA 2ORYA 1JJIA 1TK3A 1UK7A 5E4TA 3C5WP 2PSJA 5DTJA 3EQ8A 1TCBA 5AHXA 3V9AA 1J07A 1MAAA 2WU3A 3W9UA 2Y2VA 3F8SA 3WK7A 2WJ4A 1OXMA 2B61A 1R50A 1QO7A 4U2BA 4YASA 4AN0A 4L9AA 5AH0A 3E4DA 1MX9A 3Q0TA 5DLPA 2DHCA 2VJDA 1E3QA 4KRYA 4BCDA 2AJ8A 4D9JA 4Q34A 1E5TA 4RGYA 4N5HX 1O6GA 4PSCA 3H2GA 5AKZA 5AKGA 3A6ZA 5DJ5A 4BRSA 3QMMA 3WJ1A 1FFBA 5LIPA 3V1LA 4AO6A 2IX9A 3FCXA 5C8XA 1FSSA 3QITA 5AOBA 4F21A 3D2CA 3G0DA 5JAOA 2OGSA 4HXGA 5E2IA 2AJCA 5A2GA 1XQWA 1YCDA 3OOSA 4QWMA 2ZSHA 3GROA 3BE8A 4RE6A 3AILA 4H77A 1AKNA 3X3HA 1CUVA 4FLMA 5EHXA 3HLKA 2WHRA 1MU0A 3W05A 3FLAA 3PF9A 3A70A 2XQJA 3GELA 3EQ9A 1LBTA 3B5EA 2JGLA 2D0DA 3FLEA 5KREA 3UUEA 4BTVA 4BCCA 3WKEA 3I2HA 1EDBA 3L1JA 1ZOIA 5ALOA 3STWA 2BGNA 5JARA 1MT3A 2XMBA 3OG9A 1VA4A 2WQZA 3BJRA 5ALYA 4ZREA 4INZA 1JMKC 1Q0ZA 4L72A 1XQXA 1MPXA 4OD0A 4Y2QA 1KU6A 2GYUA 4I4CA 1WPXA 1LZKA 2PVSA 3E3AA 1QIKA 1J1IA 1DQYA 1BN6A 2QT9A 1GQSA 1ZIYA 2ACEA 4BATA 4P93A 5I8PA 1LBSA 1OILA 4H7KA 1VA5A 2QS9A 5K3AA 3A2LA 4HZGA 4BAGA 3OPMA 1MN6A 4C4XA 4B82A 2C5GA 4K6GA 2OCKA 3H2JA 5EI5A 1CPYA 1JI3A 1T2NA 3DYIA 1UKAA 1XZEA 1LPAB 2V97A 2X76A 1I6WA 3M83A 2WUGA 2WFLA 1QFMA 2BUAA 4H18A 2NW6A 3WL5A 1XRRA 3OM8A 5FUMA 4FOLA 5KWJA 1CUYA 1CUUA 1QZ3A 3G9XA 4U2GA 2Y6VA 4EA6A 4B7ZA 4WCVA 1CUAA 1DWPA 1GPLA 1C4XA 2CJPA 3E1GA 3KD2A 1CUIA 2WKWA 4BDSA 1LPNA 4H7EA 2WFLB 2PM8A 4U2CA 5YASA 2VAVA 4ETWA 5FRDA 5HF5A 4N8DA 3O0DA 3R3ZA 1SCQA 2JEZA 1EB9A 4OYYA 3AFIA 3IIIA 1PV1A 3STYA 5IVKA 5ALNA 5HCUA 1AZWA 4A16A 4QDZA 1CR6A 4GLBA 5LKAA 3JWEA 2OQIA 1LLFA 3UMJA 1P0IA 5JD4A 4KE8A 1QFSA 1JFRA 1T4MA 4G4JA 1YA4A 2C4HA 3O4HA 3FCYA 2ZYHA 4L0CA 1CUXA 2QXUA 4BZZA 1WB6A 3IBTA 5LZ9A 4FFVA 3WI7A 4I3FA 5ESRA 2HU7A 3F96A 1E8DA 4ZWNA 5CT9A 3YASA 3WKBA 2X5XA 1H2XA 2XB6A 1JJFA 5DYWA 3I2JA 1C7JA 1VJ5A 4QDUA 4ZGBA 3WKCA 4C01A 2XUHA 3AINA 4BRZA 1K63A 4CIBA 2J4CA 5CH5A 1UOOA 3LIIA 4QEKA 1W75A 4RE5A 3K9BA 5ALEA 1N5MA 2JBWA 2FUKA 3HYSA 5FLKA 1UZAA 4CG1A 1DTEA 3O95A 5ALZA 4OPMA 1SOMA 2RONA 3V48A 3HRHA 5IVHA 2DR0A 4N8EA 2HA0A 1XZAA 5ALVA 1YB6A 4GECA 2DHEA 2IITA 2H1IA 4X6YA 1Q0RA 4W9RA 3BDIA 2I78A 4BVJA 4HRXA 1DWQA 1P0QA 2Z3WA 4HTAA 2QOEA 5D3ZA 1S8OA 3C6BA 3TRDA 4BTLA 1FJ2A 3LP5A 3I1IA 2PL5A 2QVBA 4C6HA 1BCRA 2VJAA 1O6FA 5ISMA 4QNNA 2V96A 5AK4A 2WM2A 1B6GA 1WB4A 1YSCA 4B0OA 5ALKA 3O4IA 4HXFB 1DWOA 4J0KA 1MX5A 3G9ZA 3WA7A 1HL7A 5D3KA 2XUAA 1VKHA 4GDMA 5JAHA 4UBNA 2OCIA 3H2KA 3TEJA 7YASA 3RK4A 1PFQA 5AI8A 4DYHA 3G9UA 1DX4A 2QUBA 1ZD4A 4X93A 1XKTA 1XQYA 1XRMA 3VJMA 3BL8A 5CURA 5LZ8A 4OCZA 2XMSA 4AB1A 5JAPA 4L3WA 4AMZA 3PUHA 3WL8A 4NZZA 2C58A 2V98A 1H2YA 3I1YA 1RWQA 3V1MA 1N8SA 4XX1A 5AICA 3HC7A 1AGYA 3ED1A 3DL4A 1MNAA 3WMRA 4G8BA 3PFBA 2VEOA 1L7QA 2WHQA 1CQZA 4J0HA 3IB3A 4EY7A 3BF8A 4EBBA 3H17A 2CMFA 2J4FA 4JH0A 1EHYA 3BF7A 3ESCA 2GYVA 4UFOA 5A71A 4BZWA 3WZLA 3DOIA 2DFPA 3I2IA 4PQEA 3OC0A 4C4YA 4QDXA 2Z3ZA 3WWDA 3D5EA 1UK9A 3CXUA 1NU6A 3K6KA 5A7GA 3QZUA 1J06A 1SC9A 3I2GA 1ISPA 4H35A 3VVMA 4X94A 4U2DA 3AJAA 4DM7A 1ZI9A 4MWSA 3A2MA 2HM7A 4X7BA 2Y1KA 4J0GA 2DHDA 3M82A 1Q84A 4DIUA 2WLSA 4BCBA 1U65A 4DTCA 1LZLA 4TVKA 5HFNA 2OPHA 2XMCA 4DMHA 1EDDA 2EDAA 1UXOA 3WA6A 3CCCA 1IVYA 4Y2SA 4ARBA 4Y2VA 3RM3A 4BP9A 3AIMA 4OYLA 4YPVA 4Y2JA 5EHNA 4RNCA 5T4EA 1QIEA 4O08A 4MYDA 1G5FA 2CKMA 3ICVA 3BIWA 3PF8A 1XZIA 3DKRA 2PBLA 3KXPA 4KE6A 3Q8WA 1ORWA 2AXEA 1RYYA 1GZ7A 4H7IA 4KJXA 3FYUB 3EBLA 1IZ7A 1KEZA 4LXHA 3GBSA 1YASA 4ZXFA 3HI4A 2DQYA 2JGMA 3BDVA 1XLVA 4IH9A 2PU5A 4N5IX 1VXOA 4EY8A 1XZLA 3WIOA 1QGED 3FNBA 3VJLA 2XE4A 4AMYA 4Y2XA 1R3DA 1TAHA 5I7UA 3AZQA 2XUJA 1UFOA 2XLBA 2GZRA 5HQ3A 1QTIA 1LPBB 3WKDA 2QZPA 5AKXA 5ALGA 3STUA 4DNOA 1QIHA 3H19A 2Z8XA 5AO9A 4CI9A 5A62A 2VQ6A 4YK7A 1BEZA 4QE3A 2XQIA 2VJCA 5AM1A 5DYTA 2PSEA 1F0NA 4DNFA 5HKBA 4G8DA 5JANA 3B12A 3AZPA 4X97A 1ACJA 5HF8A 3DQZA 4BVLA 3KWJA 2JGIA 4XVCA 2HDWA 1JU4A 3RKSA 1AQLA 4GEGA 3EF3A 5BWBA 3N2ZB 4DMKA 4UHCA 1NX9A 3OURA 3LLCA 3JYHA 4J0IA 3D0KA 1K6EA 1B41A 1W76A 4LIPD 5AKLA 5CBKA 1VE7A 4P08A 2WG1A 4P92A 4IQ4A 4FKBA 1CQWA 1JJBA 4OB6A 3R40A 4BC0A 1EX9A 3F67A 1UOPA 4BP8A 3DD5A 3GA7A 3BXPA 1FFAA 1X70A 4W1SA 2HA2A 3G0IA 1CUBA 4XJVA 1H2ZA 2H7YA 2G5TA 5CT6A 4GI1A 2G63A 5LZ2A 2Z5GA 3F98A 2WILA 2ZJ6A 1VOTA 1GQRA 1VXRA 4B81A 5CTAA 2WIKA 4A5SA 4FFWA 3ESAA 1THTA 5LP1A 4XWGA 2CB9A 1DU4A 3WWOA 4KAJA 1X2EA 2Q0XA 1XRNA 4ITVA 2OLEA 4J7AA 5CT5A 2R11A 1DQZA 2QXTA 3VKFA 5T4FA 3FYUC 5CH8A 5JASA 4E14A 1AMNA 2JGEA 5D7BA 4KR0A 1UKBA 4KE7A 1TRHA 1E89A 3U1TA 3I2KA 1W6RA 1YS1X 3EIOA 2JGKA 5AJHA 4UHHA 2WTMA 4KACA 2O2GA 5HFAA 4Y9SA 1J2EA 2XLCA 2ZVDA 2LIPA 2JGJA 5ALFA 4I19A 4E11A 4Q05A 4LXIA 5AKKA 3RARA 3H2IA 1YS2X 3DJYA 3FBWA 4GWLA 3V1KA 1F0PA 2OG1A 4EY6A 3BJMA 1HQDA 4GHWA 2VA9A 4B0PA 4B84A 2W22A 5A7HA 3I6MA 1JT2A 1ZJ4A 3C45A 1SCIA 3QPAA 3F97A 3HZOA 3QMWA 4OU4A
chains in the Genus database with same CATH superfamily
1ZKDA 2NU7A 1S5PA 3NNNA 1G6Q1 4BQFA 4F1KA 4JOCA 5HJEA 3K05A 4H7DA 4PXSA 4DARA 2YZ7A 3DBHB 2PKRA 3HZZA 4I8DA 4XDGA 4KXLA 1ULTA 3JS5A 5FKJA 4M21A 3UXEA 5JNRA 2NPOA 1QGOA 5SYNA 1K0FA 1WXIA 2H85A 1K92A 3BWCA 3DFZA 1M2NA 1Z4QA 3O2SB 3QY0A 3ZE6A 4B5KA 4FSDA 5AM3A 3EIXA 4KVZA 1X3SA 3PZRA 5HQJA 2BI4A 1HMPA 1Q1NA 4DLNA 2DXIA 3TZQA 1Z56C 3UO8B 3L1HA 1VG9B 2P2DA 4OXYA 4DLVA 4M8SA 4ZHQB 3FPEA 3N58A 1DKRA 4FYJA 4Y1RB 2REBA 4R6XA 4YLEA 2CJFA 1UC4B 5BWNA 1QDLB 1W59A 1OFVA 1Z9BA 3F6EX 1K2WA 1S9HA 3SGLA 5K0TA 5FLXA 5EN4A 1WW8A 4M55A 4QBIA 3HR4A 3OQNA 3RC7A 1Y4ZA 1QSGA 3UB3A 4TLDA 2F1KA 4PSAA 1WXHA 2QUIA 4MSUA 5E4YA 4DDTA 1MAHA 4ACBA 1K08A 4FNMA 3V9PA 3PGLA 4LHXA 4D8UA 1K27A 3JWIA 1UM9A 2R9VA 2XH8A 2G0TA 3DV9A 3IQEA 3A3OA 4OXIA 3DULA 2FE4A 5JQWA 2ZJBA 2FOLA 1ZISA 1U98A 2BBSA 2BWJA 2QG6A 2V55B 3K5PA 3IQWA 2FSPA 4J2OA 4JDPA 3ITKA 3ZJVA 4LHSA 4RZ2A 5IC6A 4X66B 5BV7A 4LVNA 4Q7KA 4FT2A 1ENOA 4JJ4A 4KVFA 5B4VA 3C6XA 4FKZA 4QXRA 4TRRA 2VDJA 1I0ZA 3CX3A 2RHJA 1G21A 4R8RA 1NZFA 3AM3A 4RWEA 3EIFA 5EIAA 3EZ9A 1KK3A 1U1FA 5AM5A 3PFIA 1NI4B 2IJGX 5FUYA 5IJWA 1UF9A 1WZEA 1WD7A 4F60A 3DR5A 1SA0B 4KX3A 5C3MA 1XFDA 1AZSC 4P7JA 3LKDA 4F5YA 1M2OA 4PZPA 4DV5B 1JIKA 4DA7A 1Y9EA 4X1IB 2MYPA 2J0UA 4ESVA 2Q5CA 3N2NA 4C05A 3QVGA 1S7GA 5H70A 2B7CA 3ELBA 5DIZA 2AZTA 4QUKA 3A1UA 3EGOA 4LYAA 1JHYA 2HBYA 3TLJA 5BN3A 4OXRA 4MS4B 3D4IA 1VBKA 5JAUA 1PJ4A 3AVVA 2RHDA 1HL3A 3PWZA 1H8HD 1EJ6A 2MJLA 2P3OA 2WKRA 2QYTA 1RWBA 4B8YA 3BRCA 4URWR 4Q3NA 4ON9A 3BA6A 3OY2A 2VHUA 4ISCA 4YGYA 1UBUS 2WE8A 1T35A 3EA0A 3HUFA 5DNVA 3UYKA 1VYTA 4BDTA 4PS0A 4C4AA 2PX2A 3GFQA 4M8LA 4EB0A 2CC2A 2I8CA 3U7RA 1Q5PA 1DC7A 4DCSA 5IN4A 3M81A 5C1PA 2G36A 1L4EA 2NYUA 3NAGA 3H1BA 2BM0A 1KEUA 3Q5DA 4QG3A 3UCEA 2XYRA 4MW4A 1WQ3A 4QL3A 1L5NA 2XBMA 3HCFA 1N6IA 1GZSA 1NHWA 3RAPR 4DR4B 4UTPA 2Q3LA 1KY3A 5IM5A 4DSZA 3RRBA 2GARA 2CXNA 5INTA 1EFLA 3N05A 3PHJA 5DP2A 4M88A 4OHWA 1YBVA 5D85A 2YKGA 5U4XA 5AP9A 2GBFA 1TQ6A 2HA7A 3BWMA 4Q1CA 3LPMA 5CIWA 3Q8LA 4EQ6A 1EK1A 2GN2A 4MAAA 4JASB 1CZOA 1BEEA 1GA1A 3D3JA 3TRFA 4GP7A 4LI3X 2XUFA 5J2TF 1EJBA 1U3TA 2VP2A 4QSHA 5IPFA 1VLQA 4QPCA 1Z8HA 1ZU4A 4OB7A 4FVTA 1T9AA 4IH1A 2HDNB 1CRZA 2IEAA 3OECA 4ZVLA 5IMBA 1BKYA 2OHHA 3RW9A 5LQRA 4AY4A 3UAVA 2H2DA 5L7YA 5ALXA 1NBIA 4JSYA 4Q7EA 4V1CA 2GVZC 4UQLA 1C1XA 2QN2A 4QOGA 3PE3A 4MV1A 4CLRB 1PR9A 1IN4A 1IC6A 2EC5A 2XRYA 3KYIB 4LHYA 3VI3B 4B80A 3AERA 2FDRA 3HJGA 5HMLA 3IUYA 3AY7A 4CF6A 4UM9B 1Y8AA 2WG0A 2HCJB 3RC8A 4BNDA 5BSVA 4KQ6A 4N5MA 2GPSA 4CHTA 2KPOA 3S44A 1ICEA 4C7XA 3TE7A 4OQPA 3Q3JB 1PBTA 3QFSA 2P6MA 2WWGA 3O8OA 4OHFA 1DQPA 1JF8A 1YKSA 3A28A 3K2IA 5CEJA 5JSFA 4I50B 5A6SA 1A4UA 4MJLA 1G1MA 1H2HA 2X8BA 4G8CA 4RXUA 1AKQA 1R9GA 3QLJA 4RIEA 5CVUA 4YRRA 4ZP1A 1MORA 3UUFA 3OJOA 2H51A 1KAEA 2BKVA 2BY4A 1TEXA 2L69A 3B1ZA 4RF3A 4YB8A 3SBOA 4HPJB 3IDAA 5HE8A 4D3ZA 2YFHA 3VYWA 4LX8A 1LWNA 4NMLA 2ICAA 1U0FA 2C0QA 3F71A 5KNBD 4CR6A 2HAEA 3CRQA 3ICPA 1GZ6A 4HRVA 4W63A 2EJCA 2CZGA 1VYHA 4Q01A 2CNWD 3PCXA 5IEBA 2OM2A 1FMJA 5JWOA 4E12A 1W1UA 2IPXA 4ED9A 1IIBA 4K6KA 1P39A 5F7ZA 3LS2A 3MGCA 4D02A 3M3HA 1CUCA 4NAHA 3T3MB 1W96A 3C8HA 3R5HA 5KHOC 2HL6A 2FQXA 3HV0A 2XCSB 2Q6IA 3RK0A 5C80A 1BRTA 4LDNA 4FZJA 2G17A 5JH7A 2OHJA 2YVUA 5KOJB 1Z2DA 2ZRMA 3OTQA 1CVRA 2GTPA 1XTIA 1QE3A 2C7QA 2EL9A 3T1OA 1RCTE 2PTGA 4BNNA 1OI4A 5AM2A 5CXXA 2ZM6B 4G97A 2LDBA 1QTNA 2V45A 4PZUA 1JEDA 2DULA 4KQWA 4RIIA 5ARDA 3VR4D 4L5BA 3E7PA 2VRCD 3UMCA 3NKVA 1U1DA 4BQEA 2FG7C 4PC6A 1WOYA 2BC9A 1L6RA 4BAZA 1L5MA 5TEVA 4L6CA 2GK3A 5CB0A 3QKSB 2VWPA 4CM4B 3PB3A 2ZJ7A 3IYLW 4RS4A 2R6ZA 5BN5A 1NHGA 1YAJA 1I3OA 3LPAA 3BIOA 3OJWA 2BE9A 3BE6A 3LQYA 2WHPB 1JA1A 2WWVD 3KTDA 4HAWA 4U2KA 4UREA 1DXHA 2PUHA 3W2TA 1PNVA 2H06A 2JZNA 2ST1A 3DAHA 1Q7BA 4XZ3A 3VNVA 5E8RA 4I8IA 2AUNA 4Y18A 3TWOA 1PGJA 1W19A 1F14A 4WJLA 3GDFA 2VJMA 2ECQA 1N8KA 1T9GR 2CE2X 3FSRA 5B1YA 3VUEA 1NUQA 2O7RA 3MCAA 1Z2CA 5ALMA 3FPFA 5GZ6A 5AQ1A 4OX9B 3THSA 1ADGA 4X62B 1PUXA 4IV5A 3U19A 1XTQA 2NV2B 2D00A 3I8OA 4A91A 3KOXA 2Q1WA 1L4NA 2BEKA 1SHJA 2JGDB 3SHWA 2YXLA 3OZCA 3LPNA 4JBXA 4A0GA 4O2AF 5HIIA 2VTKA 3FKQA 3HYRA 4CFZA 1XZHA 1QHYA 2OZEA 3GJ3A 4H0CA 1ODCA 3PC6A 4DRXB 5AIBA 4DQDA 4HEQA 3HXOA 6YASA 4E5UA 1IOWA 2PXXA 1PJCA 3MINB 2GZHA 1SQSA 3MTIA 5ALDA 1A9YA 1E99A 2O8CA 5LQCA 4XUEA 1VKOA 4BBJA 3OKAA 4LMBA 2PKYX 1CY0A 2RGWA 1Z7WA 2P2GA 2GN9A 1UWLA 5JEDA 1CERA 4M1YA 4YDQA 2IZ7A 2QM7A 4EOGA 1UBSB 5IK2A 3IJRA 1E20A 2VI5A 4ONEA 3JVEA 1Z7EA 2W00A 1NQTA 1DFGA 1RVV1 3SKVA 3RYHB 1SUWA 1OLSB 2G4CA 1BAPA 4L16A 4Y8VA 4IH4A 3Q41A 3U6KA 2COEA 4KIGA 2CXPA 4WADA 4MYCA 3OCJA 3ZU3A 2BFFA 2CYBA 1V5GA 4A2QA 1D0SA 1O5OA 4DW8A 4QM6A 1EM8B 4GPAA 1JFVA 5SZHB 5BNIA 4MV7A 1UDCA 3GZ4A 4R2LA 1WUIS 4DCUA 3AQ4A 1YRBA 4O4HA 4LC0A 4ALMA 1NZDA 2Q6TA 4CXMA 1XC7A 4IDDA 1PD1A 2WINI 1MOZA 3X44A 3AR3A 4G26A 2VF2A 2MT9A 1UZNA 1EA5A 3DBVO 2G88A 1AKMA 3IALA 4GLOA 1XYVA 5IKOA 1J70A 4CMBA 3K5IA 2XVXA 5JUWA 4B3IA 3CS3A 5CYOA 5FPHA 5CFNA 3TB6A 5JMTA 4DXHA 3TG2A 3FMIA 3A4VA 3PSHA 2BFCB 4ZI7B 2COKA 4NS1A 4KFCA 1LV8A 3KFVA 3SF8A 3AI1A 4CQMD 3VMFA 4BKPA 4JSRA 1JG3A 2OGWA 4UHDA 2VRNA 4YV0A 3O74A 2IHUA 4ZPJA 3EC7A 1G0NA 1B8UA 5IAOA 4HDRA 4JSTA 4M60A 2DR3A 3MRTA 1CEXA 4R83A 4XTCS 5C7IO 3DGFC 2ES4A 3GEMA 3PYMA 2IIQA 4PM4A 4J0CA 2EF1A 4ZT7A 1N2CA 3ROKA 4PNHA 1COWA 4RA6A 4Q9NA 4YGXB 4PV7A 3ABOB 3AK4A 4BNWA 2IV7A 4L5JA 4CCAA 4F85A 5J2UF 3THWB 1RD4A 3A37A 4Z4CA 2BBWA 5HF6A 4ZTBA 5JD6A 2RD2A 3FOAA 5AVYA 1JEQB 2Z6AA 1JXOA 1SXJB 5HVNA 1FUKA 1AVTA 1USWA 4PRYA 4OJKA 4A7PA 2OMEA 1PJZA 4YMLA 1NMXA 4M9RA 4NTZA 4TZTA 3IVXA 5ALTA 1HYQA 1USUA 1XA3A 2E1PA 2ZQYA 3SP1A 1THGA 4GF5A 2AGVA 2Y9MB 3B20A 3S29A 2GBIA 2XUZA 2DHRA 1R4ZA 2GETA 1P7CA 1DCFA 1SZJG 2G4LA 2OHFA 2WAXA 3C16C 3KJQA 2ZI7A 5DU2A 1MB4A 4A3SA 5B12A 3O94A 2HWKA 3PICA 2G25A 4QIHA 3UWDA 3ZYCA 3ET5A 4L2IA 4RJIA 5KOJA 4LSZA 2J59A 5ALJA 1K7YA 4FDMA 3JZIA 1A8IA 2XA1A 3K53A 4OQ4A 2C7OA 1OYOA 4GX1A 1QZZA 2BHTA 2PZ8A 3RC1A 4JYAB 3M5DA 4RL6A 3MA0A 3G8YA 4DS3A 4HNHA 2ZRFA 4BMVA 3VVLA 1H5NA 4MW0A 3HV2A 1AN9A 3MYYA 1S96A 3WRYC 4OP1A 3D8RA 2BTOA 2REXB 3W1EA 2Q3EA 3RWOA 4CF5A 1JQBA 2AFHA 4A8HA 4YV2A 5BSEA 4CCSA 4RQBA 1KY5A 5CB4F 2PUGA 3IHWA 1G21E 5I9MA 2EV9A 1K4MA 4P83A 1E2QA 2RHWA 2WWWA 4FR2A 3DOCA 4KIWA 2BYTA 4AJ2A 2C1XA 4FFSA 3Q3HA 4E03A 3BYZA 2O1EA 3K0FB 3KYJB 2HGZA 3IPAA 4K2HA 1ZD5A 4BNFA 2FNAA 4GLFA 1DJNA 5I9BA 3MSXA 3LVBA 2VHXA 4TTTS 4O2BB 3HL0A 4X0EA 3VYSB 4P0PB 1AV6A 5F9HA 2XQKA 5EXEA 3I2FA 3SHFA 2ZKIA 3OLZA 5TGTA 4G2TA 5K3DA 3IAFA 2QUHA 3V1TC 1FUIA 5DM4A 1GDTA 3PC8C 3OX3A 2L42A 5A9TA 5KYKA 2VYNA 2VH5R 1GKYA 3WLTA 3PVCA 2ONJA 1WX1A 2QVZX 3PXBA 1J1ZA 1VYVA 4FFOA 4WKCA 1GG8A 2PH5A 4QQ8A 5FNVA 2JD1A 1GUAA 1J49A 4RD4A 2JIBA 1ZM3A 4Q9HA 1Z6GA 1JHAA 2CWWA 3GDWA 2C2OA 2NUAA 2FG6C 4LMAA 1FFHA 1PZFA 1XN4A 3KKKA 3LWDA 5KBYA 5LLDA 4P32A 5JO9A 5HZGA 1IXZA 2JI4A 3I4LA 4K88A 3HN7A 4P9NA 3FOZA 3WJAA 2NX2A 2GTIA 2ZBDA 3GD5A 2VHZA 3CO0S 4IX1A 5T6MA 1E66A 1VE3A 4A73A 4EF4A 2PCJA 1Q6YA 1VECA 2PWAA 1ZMTA 3GYBA 2PLAA 2VJYA 3R6WA 4JLNA 1H23A 5F51A 3T9CA 1GTSA 2BAGA 5IM4A 4JGIA 3KJXA 4ZRNA 4YP0A 3H5NA 3OIGA 4HN2A 1NZJA 2FAXA 5BSRA 4G8JA 5E7QA 1I51A 3FF4A 3R8CA 4AZ3B 2VWQA 5F1YA 4HDNA 5DLQC 4UE6A 1U0EA 3VKGA 1A82A 2E3JA 1WDKA 3R1IA 5D1HA 3BWVA 1C7IA 1DHRA 3DE6X 3PQ6A 2I4RA 3FZNA 3CLSD 3KLOA 3S8EA 4LXGA 2VRBA 5JZ9A 3A1TA 4ZV9A 2N1MA 4WXPA 1GTZA 2JLRA 4BV2A 3AVTA 2IYNA 1HWYA 1JB9A 1V95A 2V5UA 1JHPA 2D5CA 3KLBA 1DRKA 4KOEC 5B4TA 4OU5A 3A06A 4B17A 1Y3DE 4J0FA 4RCYA 5JO0A 1Y8RB 3F1LA 3P2IA 3K8QA 4IDCA 3T0GA 3I01A 4JS0A 3R76A 3U0BA 3VVCA 1CS4C 4MX8A 1S8AA 1V6AA 3IUNA 3ZK7A 2WFZA 1NASA 4LAFA 1ZSNA 3T4EA 4B2PA 4G84A 1V96A 3HKDB 1C7ZA 1LSOA 1PL7A 2JJ2D 3MFYA 3IKLA 3RLIA 1Q0QA 2QV7A 1YOBA 1L7RA 1XK6A 1U5BA 3LBAA 4JU9A 3DQQA 3EULA 1U6IA 2H4FA 5DBIA 4DMLA 3ZWMA 1TRKA 1CZUA 2J30A 1XVTA 2JJMA 3KSDO 1K3TA 1GZDA 3NKFA 4TUYB 1XE3A 4M9XA 4Q19A 1IUPA 4P3XA 2R96A 5K3BA 5FBRB 4Q4AB 3TFOA 5CK4A 4WOJA 2I6GA 4JQSA 1UPUA 4XEHA 1VJ0A 3H11B 3NHFA 4FYKA 4P4LA 4WBSA 5B7NA 3NWEA 2EIXA 5COQA 5F23A 1I4TD 4KRXA 3PFHA 1UMKA 1DT5A 2BRUA 1SKYB 3CYFA 2HU5A 2IXDA 3GEHA 1IXRC 3INNA 3OIVA 4PYOA 4WCFB 3L4JA 4LCEA 5B37A 2UKDA 2D7JA 4J0JA 3D3WB 1P72A 1QPGA 4JP8A 1ZNQO 2PT7A 3I4FA 5BSMA 1LUAA 1MXHA 1WY5A 4RM2A 2PXAA 2RHTA 1E3LA 3OCUA 3OJFA 4G81A 4N65A 5JPDA 2CVZA 2BVNA 4DLBA 1N34B 4B3RB 4D6XA 3NIWA 1AG9A 2QTGA 2QZSA 4BNVA 3EC2A 1RFLA 4HO1X 1DC4A 1ESCA 1VBFA 3E6AA 5ICSA 4N0MA 3E61A 3MHPA 4YMGA 4FKMA 1X7YA 4IO0A 2YJ4A 4AFNA 5G2OA 1XZFA 2JVJA 1D0IA 3B6EA 3PV0A 2ZTMA 5E6RA 1MB9A 4GL4A 4LZJA 5FO1A 1Z47A 2L2QA 3C5CA 1VMAA 2PRIA 3IKMB 3TIXB 3TW6A 1LY1A 2X58A 1FTWA 2FK7A 3O1HB 2RGEA 1F0YA 4Q18A 1AB5A 4Q24A 5F4ZA 3Q1KA 2H8KA 1L5LA 5E6SA 4GP9A 4P22A 4BNTA 1F38A 3JR7A 5C81A 1ZOOA 4LY0A 1N2SA 4JBYA 2HA4A 4MVJE 4ARSA 4TV9F 2A57A 2R47A 2VYVD 2AOTB 4XGRA 4AJNA 1JAHA 1YB1A 2QENA 1M34E 2VUIB 4PQFA 4X1KA 1OWNA 4K3VA 4H3KB 5IHXA 4CT5A 3EIUA 2H4HA 1KYYA 2O5VA 2RBGA 2IV3A 2GJKA 1ZICA 2BMAA 3SC2A 3WWCA 521PA 1XQ6A 4AO7A 3KR2A 4IZOA 2IBTA 4A5OA 1O0BA 3EGIA 5B57C 5F3WB 5TLSA 1XLWA 2QR5A 4GT1A 4R3WA 1AMUA 2ON6A 2ZE8A 1IUKA 1PEAA 2ZUCA 3NH9A 3QFCA 4KXQA 3M70A 3RVQA 3QWHA 3RUIA 2JLZA 1HT3A 4ZO6A 3AUFA 4HLNA 2RH5A 2NZ2A 3STXA 3OZ7A 2BEVA 3FVTA 1BMQA 5CBPA 5JVDA 3GD7A 4UXIA 5LB4A 4YUAA 3QV1A 8OHMA 3WJ2A 4M83A 4J16C 1DTWB 3G5MA 4Z4FA 4UUQA 3RYFB 5EIOA 2HXGA 2OP1A 1IQPA 2CYCA 5K45A 1YFLA 4PU0A 2LVBA 3AKYA 4FI3C 3AVQA 2WJWA 1SB8A 1HFWA 2YZMA 2DM6A 2WD9A 4IDNA 3O8QB 4E0BA 3DWGA 16PKA 3R5SA 1EGQA 4DN6A 4RLSA 3OWOA 1FDTA 4MUKA 1EESA 4AKGA 3WBBA 3EDOA 4YRQA 5CVVA 2AZXA 2GPTA 2YHUA 1T6YA 1MQAA 5EE5B 1E2FA 1FVFA 1NIPA 2I03A 4JA0A 2ANCA 3ZXYA 5LMZA 3DC2A 5EYPA 2J0SA 3KUCA 3PDHA 2D0OB 3NPAA 2NWQA 4WXRA 4FGUA 3UT5B 1LV7A 2BGIA 5CLGA 2BR4A 1VLVA 3UMGA 4QG7A 5CMLA 1L7VC 3LUCA 3RS5A 2ONCA 4TMXA 3TINA 3C3KA 1W73A 3GVIA 2BJHA 5DF1A 2UUPA 4IDEA 4UD6A 3WK4A 2BKLA 1HF3A 3VSDA 2JZCA 2PLRA 1ZN8A 1CE8B 4FD2A 4KXYA 1DBPA 3S2FA 3SSOA 1RYEA 4BLPA 2I3BA 1X3LA 4HRYA 5AW5A 1TUBB 3VXKA 3H6HA 1SXHA 3KB1A 4A0RA 2O8FB 1GL6A 1ZNZA 4MV4A 2ZPUA 2R4TA 3LCVB 3FG9A 1KP9A 2VXCA 3V8VA 4KMRA 3FWKA 5H8WA 4LYDA 1F8YA 2PGDA 1ISFA 5A04A 4E1AA 3U7JA 3C8MA 4ZAWA 1EVQA 3E9CA 4DYDA 1T36B 3G59A 3UV7A 3GRUA 5BW8A 3G0BA 4HS9A 4J29A 4Q4JB 4NS4A 2IKQA 2X2FA 2R8XA 5AVZA 3DMNA 3O1LA 5CA0A 3HM9A 3ITEA 1K9VF 3W7VA 2KW5A 2XJ9A 5DM2A 1Y5RA 1NJ2A 5TQ2A 3RUEA 4BB0A 1R9NA 2CSUA 1DAHA 1UH5A 1XDBA 4Q3LA 1YI1A 3PD1A 3ZG6A 4DIDA 1FFEA 3DCNA 3RF7A 2XF2A 1ZJ5A 1DIRA 1XZBA 4GQBA 5CLLA 1N2CE 5JE8A 5FWXA 2VR1A 2NVWA 3GYGA 2EFEB 2BGMA 3CKKA 5A0TA 5EZQA 2O57A 5JZSA 4RZQA 4NAVA 3R3UA 4URZR 5LA6B 2WZCA 3RFFA 4YRJA 2VLBA 1CR0A 2OTCA 3V1YA 1RC0A 3WGTA 1DKQA 2OESA 1BWRA 1GKLA 1G20A 3MUFA 3ZKAA 3CUTA 2GK4A 1U7ZA 2ZM5A 4DWOA 1POXA 2H1FA 3HH8A 3F8TA 4FMBB 4QFBA 1VB5A 3LLSA 7ADHA 2JA2A 3FPGA 4Q0MA 1R3UA 4A9AA 1GWNA 1YJBA 1Z2AA 1FX0B 3ILYA 3U60B 2HMTA 3HXPA 4XTRA 5DHRA 4RPKA 5GVRA 4OGFA 1C81A 5CPBA 4DQVA 3VZRA 2WJ3A 3DYVA 4QU5A 2AF4C 2Z3VA 2UYOA 2ATIA 4N8SA 4EMUA 5HIAA 4I3GA 2BZ1A 5GADl 3I62A 2EL7A 3G68A 2WYWA 4OHBA 1WMAA 2MR6A 4QQRA 3WK8A 3QKWA 4MVJD 4G1MB 4O3FA 1ZGCA 2R00C 4CT4B 5JMWA 2QM0A 3I5XA 5TIIA 1C1HA 2EBWA 2WP8J 1W9HA 1P3JA 3C3BA 2NUTA 1EQ2A 1W5FA 5C8YB 5CB8A 3QE9Y 3H84A 1QXSA 3DSRA 3E3OA 3TFWA 1N9KA 1T2EA 4IOMA 2D1SA 1IY0A 4BYMA 3O21A 5BWOA 1AH2A 2XUKA 5DX8A 2D4HA 1AHIA 3AL3A 1S8NA 4PVCA 2B82A 5HIMA 2Q1SA 4IHAA 3ED5A 1YVRA 3OWXA 4LFCB 3IILA 4D79A 1U2PA 1NFQA 3SSMA 1LDEA 3UB2A 1E98A 5E38A 1G59A 2PSDA 4CODB 1P5HA 1P91A 4RPIA 5B6IA 2D7DA 3IVMA 2F8MA 1LC0A 1XKLA 4S2EA 4IFTA 3BIJA 2Z1DA 3AFGA 3OMWA 4XGKA 3C85A 2FX5A 3R6GA 4YJ2B 4EM6A 1F8UA 2ZRPA 1ZHFA 4YJHA 3LIPA 2HRCA 3I52A 5AWFC 4REQB 2GPAA 2FOIA 4NCAA 3PP8A 4HGZA 2XUQA 1EZ4A 4BO8A 2PSHA 4CV3A 5IK2D 3U49A 4PZYA 1E0JA 1OXBB 1PK7A 4R1PA 2V03A 5LXTF 1SOWA 5T41A 3FVVA 3T41A 4J8PA 1U94A 1BIFA 3RRXA 5EIEA 5K0SA 4W6QA 4L8FA 2WWXA 1JB1A 2IY7A 2VP0A 3CIOA 2GA8A 4MXDA 3D43A 2O3QA 4YMWA 1J2UA 2VAMA 3PE4A 4IIGA 3OE7A 4YP6A 3R7NA 4FB5A 2F8TA 1PZHA 2VQDA 2BFBB 1KOLA 4DMMA 3O82A 3LLVA 3OEYA 2GZSA 4IG9A 1DAMA 2DBZA 1H1LA 3D7MA 1BG6A 5DTRA 3REFA 2Y76A 1LX6A 2BI7A 4Z1MD 4J6EA 3GUZA 2P40A 3T7DA 3WQBA 2FR0A 1H0RA 1KZ7B 4RDHA 1HNWB 4HNRA 3SS7X 1DJPA 1VI5A 2HRQA 1BMTA 1Q74A 2XTZA 2HLDA 2QMYA 4LDQA 2OCXA 4EUSA 4YX9A 5JTTA 4H15A 5CW1A 2CFSA 1P3Y1 4ZU1X 1EFAA 4B2LA 3OIFA 5JS6A 4IR7A 3AESA 4LFBB 1CU1A 5A9RA 3T5BA 3IEMA 3CVWA 1FTGA 3OQIA 4PXYA 4PYMA 5ERGB 3KU4A 4KQJA 2GBLC 3C87A 3GH3A 4COKA 5CNIA 1G2QA 3LD9A 1GKIA 3T1VA 4CHGA 1GAWA 3H2HA 2OXTA 5L6MB 2V3CC 1DADA 1WDMA 3MIZA 1XZGA 4MLCA 5CGQB 4X6UA 4FXPA 4WNIA 4W1PA 3EEOA 5TT1A 5TRTA 1XNQB 3G2NA 1FP1D 3B7WA 4WZAA 3A9CA 3D31A 3TNFA 3O3OB 1OVMA 1ZOPA 3EH2A 5JNVA 1EFRD 2CL7X 5B1IA 3ROPA 2ZPAA 1PAUA 3M34A 4JJZA 3IQIX 3PL1A 4MTLA 1RHQA 2IYXA 2VPIA 4W5TA 3T9BA 4GGPA 4MRNA 4IIUA 1A5AB 4C4RA 2VNJA 2ZWOA 2UAGA 3FPKA 1SUFA 1TYDE 2MSEB 4XLZA 1VHTA 2QGNA 4FHEA 3RRFA 4RIGA 1OXXK 2Y1LA 4G5SA 4JEMA 1SY7A 3O0TA 3UQZA 4XJXA 3ZV7A 1NWHA 1QOPB 1EH5A 3PI7A 1X9HA 3CUVA 3JASA 4UHEA 4P53A 5BVHB 3QSGA 1PR6A 2I6FA 3F9IA 4TWBA 3TVDA 4D3YA 1O6BA 3HCCA 2JBAB 4RQTA 4TV8B 4JBGA 1GPUA 4HXYA 1VZ3A 3CNEA 3AGQA 4DILA 5AHOA 1ZCFA 4JMPA 4QYMA 5J3JA 5KWIA 3R3WA 2C29D 1KVTA 3IMGA 1MO6A 1UK8A 3JD4A 4R5HA 1JR4A 4WFIA 5DYNA 3ZHTA 4DIFA 4CR7A 3EVCA 4Z7JA 1P0MA 1VE5A 4IV8A 3ZD6A 4Y2UA 2W93A 1I0IA 1YQGA 4NC9A 4QYWA 4C21A 1VLMA 1F4VA 3GLIE 4IYRA 5BSTA 1E1RD 5I7FA 4TYYA 3WDSA 5T3UA 3BQNB 3TKAA 1DRJA 1QLWA 2K6GA 3B8HA 1M1YE 3DKIA 2AJLI 3E9NA 3PNLA 1NNEA 1Z3IX 4KQ1A 3KLNA 3S7ZA 1A76A 3BJIC 4GI5A 4YY3B 3HSSA 4QUDA 4MQ6A 1DEKA 1I94B 3QBVA 2KI5A 3DLTA 5AW6A 2ZIXB 5IN5A 3O9MA 2G5GX 3VR5H 3WB0A 4FTWA 3BS4A 3GEEA 1SC3A 3BVPA 3A9WA 3HSKA 3OE5A 3PPWA 5LP6C 1U28A 2TECE 4F4IA 1RM0A 3LWNA 4I99A 2B9VA 2DFKB 4ABTA 3G0CA 1TVEA 3DBLB 1GNTA 4NBVA 1KZ6A 1TGVA 4TT3D 5FPQA 1J9ZA 2YC2C 2B4KA 4BLRA 2A58A 4MQLA 3WBJA 1U63A 2F3SA 2IEZA 2OZPA 1W52X 3P2MA 4O63O 5EXDA 3RNLA 3U1BA 2VP6A 4OBXA 1RPZA 3UMVA 3WQSB 4BHTA 3VGJA 1MH1A 4OK3A 1Z4MA 1OX5A 4ZQIA 1CUJA 1HDOA 2Z2ZA 3GLKA 2LGJA 3N07A 3ODPA 4R0MA 4FN5A 2GVNA 4UEOA 1FDIA 5FOTA 2VH2A 1YVEI 1C30A 5F2EA 3T7RA 2Y67A 1TJNA 1Y3AA 1XTBA 4PIVA 1G9SA 1XLUA 3GJZA 4F71A 4HL6A 4K3UA 2QVLA 4KN6A 1LSJA 1GNSA 4RACA 3RI3A 3SX0A 1RXSA 2IZ5A 4KYIB 4AO8A 1XMXA 2MSCB 3DE4X 3TW8B 3ABRB 5AVOA 4WK4B 3FYTA 4RVGA 4QJ5A 5BUZA 5CP8A 4W5NA 5AI0A 4ZV4A 1N4AA 2EYQA 2EBUA 1DAFA 3R2JA 1GQFA 1U9YA 4KPUB 2WIFA 4QHYA 3V32A 3WLFA 1IHUA 3QEOA 1Z0ZA 2AMJA 3DP7A 4ROTA 1K5GA 5E0KB 1H42A 1BH6A 3TNYA 4EG3A 4IKPA 4UVDA 4XH9B 5JY6A 1ZA1A 2KWIA 1FRZA 4UZFA 3AFOA 3ISTA 1K7EB 2NADA 3A26A 4FHZA 2WIJA 3QBJA 4KQXA 4LJLA 5AI4A 1D7AA 1YU6A 2VF5X 4JJKA 3UJHA 3TL2A 3UTDA 3ZWOA 5JCPA 4P0QB 2DUMA 2NO0A 2JFHA 3DS8A 2QLBA 3I9LA 4HLDA 3UFBA 4PLZA 3HSYA 4R1TA 1B1AA 2B5VA 3N8DA 4FOSA 2QMZA 3RIXA 1HOTA 2PRKA 2FDXA 3LGSA 1F2TA 4MR7A 8ADHA 1GPDG 1K88A 1E2GA 2CLFB 1XD8A 2OV6A 2Q6VA 1J8QA 3KWMA 3RHSA 4FXOA 4A1OA 1CKEA 4E70A 5FFMA 3HR8A 1S01A 4NR0A 4PZ9A 4H7HA 3SDSA 3WNQA 2ZYIA 4UCFA 3FTQA 1W29A 4LPSA 3V8PA 1NLFA 3I6BA 2PMEA 4INOA 2W2NA 2XT6A 4NF2A 2VRWA 1EWVA 1WAMA 2JDID 1U3GA 4LXTA 3NS7A 4K6OA 5ES4B 4URUR 5JRZA 3H1AA 2X77A 1W35A 5EJ9A 2AYXA 1I4EB 1SBQA 4QUIA 2VOJA 1P0PA 3DVAB 1Z38A 4K40A 5WRFA 2A7XA 2X14A 1MF7A 4UM8B 4W1QA 2WTBA 2ZSEA 3MFQA 3LOUA 1QCYA 2O2XA 4HTFA 4M0EA 2ZYRA 4HAOA 3PDIB 2XBLA 4Q7JB 1S7CA 2X8AA 4NFLA 4R69A 4AVYA 1NW5A 3JW8A 2ERCA 2J5RA 4ECEA 6CHYA 2HKIA 4JT2A 3G1TA 2FHSA 3HP1A 1UT8A 2FKNA 3GFTA 4J1TC 3E9ZA 3EXG1 3SSNA 2VCEA 2DSTA 3ANNA 3QVUA 1W4BA 1HEIA 4H0NA 5L4SA 3QPDA 2DWQA 1AUVA 3R6LA 2FW7A 1M0TA 2JRLA 2QZ9A 5AOAA 3ELYA 5KYYB 4QQNA 1WVIA 4RGQA 1HA3A 3EPKA 1JHQA 4IJUA 1BOFA 2O2DA 3NX4A 3VZDA 1NLUA 4UTVA 3ZGVA 2AUTA 4CIWA 4X1YB 1RRMA 2WSMA 3R7WA 4H3SA 4MVJI 4XW2A 3TPFA 3GRFA 1EP9A 1I3CA 1K5PA 3AY0A 4HQOA 1ZBQA 2JAOA 1SM4A 2ZQZA 4XWAA 1N5RA 4ETMA 3RYTC 2A0FA 3OO0A 3IEKA 3TSAA 2J3DA 3B85A 4YCNA 3R7DA 2BUBA 3QVLA 4GI7A 5JADA 1RT9A 1QIJA 1XEXB 4GX0A 3BHJA 3K4PA 4HVTA 2QROA 4PAWA 4QAQA 3SIXA 4D1YA 3EEBA 3L7MA 1B3RA 5FI0B 2CFIA 5MN5A 3M9LA 1D4FA 5HIKA 1ZZGA 2JEYA 1KVQA 2FQ1A 3S2UA 3M3PA 4BNZA 5BVHA 3W9YA 2HRBA 5L3SA 3L6UA 2HWXA 1F1JA 3GFBA 3L7IA 1BXKA 1WHSA 4KFUA 1ZNWA 2DT8A 3MCWA 5EZSA 1L9KA 1ISIA 5ALSA 5ILOA 4DLRA 2PN1A 3AOEC 2FN7A 3IP9A 3TQSA 3CX8A 1DINA 3BRQA 4CKEB 4CEJB 1R5JA 1R0RE 2ZIGA 3KQVA 4JL5A 1SHLA 2G06A 2L17A 4KE9A 1WV1A 1Q0UA 3CT6A 4H7JA 2ACWA 4BN0A 1XVAA 3AR7A 2P77A 5IAAA 1GGEA 4F84A 5JQGA 3GRAA 1ILEA 3RPEA 4LDAA 5BW6B 1JAZA 1L5VA 4TQUS 2XNCA 1KYIA 3WLAA 2DETA 3E3MA 3OQOA 2DRIA 5ILQA 3BKXA 1JG6A 2VDOB 1J07A 1N0UA 4ID3A 2IEGA 1VGQA 2G9ZA 1MAAA 3SZ3A 3JQBC 4OY3A 2SICE 2VZLA 5B36A 2NXNA 3IV9A 3L07A 1KDPA 1Q22A 2ENWA 2F3PA 3ROZA 3URMA 3WK7A 1S3GA 4F6RB 1HYHA 3AM5A 1NDUA 2WJ4A 1EVLA 2R62A 3H2YA 3HU5A 3D1VA 3IMFA 4MW5A 4OGLA 2A86A 4V0MA 4DA9A 1OXMA 4R9SA 4IIJA 3H05A 3JR3A 2FGJA 2C96A 3LFUA 1QO7A 5DBOA 2ORWA 5ES3A 3GJSA 2IHVA 4L9AA 2CT8A 1A9XA 5AH0A 2PNFA 1MX9A 4IHQA 4FWTA 3ENNA 3QV2A 4PPYA 4JQZA 4DLWA 4IUBS 2IWHA 3FLMA 3K1JA 3LCUA 4WBNF 5TPWA 3DD1A 1G0OA 2OK7A 2YY7A 3CWQA 3F7MA 3Q40A 1QPBA 4K46A 4PICA 5GAJA 2GXSA 5IARA 1NDQA 5AHKA 1D8AA 3HCBA 4N5HX 3HE3A 3TTUA 4DHWA 4DUPA 3IKTA 2J9XB 2O5CA 5GVSA 2XE7A 3B52X 3T35A 1L8OA 1QHHA 2ARKA 2FUG1 3LFHA 1PZMA 1HYBA 1SD2A 3M4JA 4LISA 4PSCA 3ZTTA 5E3IA 4BO2A 5AKZA 3WIUA 2H2FA 4C06A 4CUKA 1V16B 1Q2UA 2E6UX 2QVXX 4KXXA 4NV1A 3TOCA 2HEGA 5M2QA 3CY6A 1NVBA 1GPJA 2BF4A 2VDMB 1V25A 1GSIA 4LW8A 3WLOA 4UQPA 3KVNA 1D2CA 3B6MA 3QMMA 4WKOA 3VAZA 2F00A 3WJ1A 3LQKA 2QF7A 1BXRB 2FMXA 2FPPB 3KDSE 2C7PA 4Q37A 3GRZA 4UMFA 2DGDA 1UBGA 4R9RA 1X7ZA 3NORA 2QUJA 4KWEA 1H94A 2P67A 3Q7PA 4QGHA 121PA 3FRIA 3D2CA 3FDJA 3G0DA 5JAOA 2ONYA 1O94C 4D74A 3R0JA 1I5OA 4MOWA 4WASA 2LCFA 2ZVJA 2AJCA 1UZUA 2R6JA 2WU1A 1XQWA 1YCDA 2H4JA 4L8LA 3BT7A 4OJQA 1ZRMA 1R4NA 2P9ZA 1VHDA 5KOYA 1ZSYA 1K8ZB 3U7FB 4H77A 3RB8A 4W5QA 3P2KA 2CNNA 1CDZA 3QEKA 4FMDF 4RULA 1AKNA 3PHLA 1N6LA 1ZK3A 4AN4A 4B43A 2IKSA 3ZWPA 4TWIA 3DA8A 2BMJA 1CUVA 3GP3A 1EDOA 4L28A 2AYZA 1DEHA 1QNFA 1WCIB 3I4CA 2IZ0A 3BORA 5I9TA 4S05A 4BO6A 3OEED 4MVJG 1ZL2A 2X9QA 5BPFA 5AVWA 4DV2B 1OTXA 2E21A 2QTAA 3A70A 1UIMA 2EJBA 4ENRA 3NMUF 1AQJA 3CZ4A 2HPVA 1UBOS 4OAPA 4Z54A 1XG5A 2HK8A 5LPNA 1DFIA 3B5EA 3OD1A 3TF5A 1QP4A 3PD7A 1C3LA 4BU0A 4MRMA 2PZKA 2Z58A 4XVHA 3U7QB 7MHTA 1RQGA 2AB0A 3CCFA 2Q5IA 3K9LA 3KRTA 1RP7A 4ZVQA 3USZA 3PRJA 3WLNA 2X86A 4IS2A 3QKTA 5BNTA 4K6CA 2IQIA 1SVKA 3MJHA 5ALOA 3P0EA 1MEJA 1SQ5A 3DH0A 4GVXA 1Z5UA 3G2OA 1AUQA 2O5EA 2JGRA 4K9NA 5K3OA 2ZTSA 2R7KA 3LHKA 3M4NA 3IGFA 5FBKA 5LJIA 3IMEA 2C7VA 1D6JA 1T3HA 2XMBA 3EDRA 3OG9A 1VA4A 3UG6A 5IC5A 2WQZA 3A3KA 2YJZA 2G1UA 2ZTHA 3BJRA 4ZREA 4CLEA 1DRWA 1UADA 2QAGC 1J0AA 2Q28A 2YXNA 3OSZA 5KEIA 3R6DA 4MINA 4Y2QA 5JAQA 3T9DA 4KKXB 2J08A 2PQ2A 1DBIA 2J8ZA 4HN9A 1ZUNB 3BH0A 4I4CA 4U6NA 1TF5A 4JLJA 4ZOLB 2TMYA 4IVRA 2R5WA 3KKEA 2PVSA 3EW7A 4JY7A 5CDFE 1AS3A 1DQYA 2Y1OA 3OLXA 1GQSA 2H6EA 2DX7A 5JSZB 1R6DA 3ZV6A 3GCWA 5ICMA 1UFVA 4KMSA 3RSQA 3PIDA 1GTRA 2H1WA 1LBSA 3PUWA 4NENA 2TS1A 4WNCA 2VA8A 3L7CA 4REOA 4ZDIA 5K3AA 1TLFA 4Z4GA 4KGVA 1W5SA 1IJBA 4NU0A 5IZCA 3MSCA 3GLGB 3RODA 4K6GA 1E2JA 2OCKA 1XNJA 3D6TB 3NAZA 1CNFA 5EI5A 1CPYA 3BUSA 3GVHA 1U1IA 2AI3A 1QS0A 2QRQA 2N1BA 5JZVA 5KTTA 3N2GA 4ZC1A 1R5NA 4PYIA 1Q44A 3C3XA 3HJTA 1AO3A 2GPYA 2YWDA 3SZGA 1UMBA 1J00A 3S40A 1A9RA 1HRDA 3KPUA 1QVZA 4DB2A 1PQWA 4LJ7A 1MRZA 1XTJA 3DR3A 5JAIA 3W5AA 4C03A 5K6TA 1QFMA 5ADHA 5ENZA 2BUAA 4YRFA 1CFZA 5AJYA 4O1IA 3DUFA 1HYGA 2QBYA 2Q5EA 1LFDB 3VU9B 1N1EA 4KVGA 1RLMA 1K6JA 3OM8A 4MUFA 4FOLA 4FGLA 2ZBRA 2IIBA 3II6X 4TS9A 4DQLA 2C3UA 4DVGA 1NY6A 1ENZA 3RUPA 3RLFA 3JATA 2NZUG 3ZQ4A 2C2ZA 4J0QA 3Q7SA 1UANA 1EAMA 3MMSA 4MS3B 3ICOA 3EZ7A 4NBSA 3QXHA 4RAOA 3OFSA 4LK2A 1DC8A 5ERXA 4AF8A 5AVVA 4AUKA 1Z5VA 2FMUA 1MFZA 1FDVA 5G4KA 4KP7A 3TI9A 3WY9A 4D9GA 4LBWA 1S1MA 4YWJA 4BN4A 2PAAA 4LQCA 2FRXA 1N2BA 1LQUA 2PM8A 3JD3A 2WJPA 2VAVA 1NVVQ 3W2EA 4DSOA 5FRDA 4GNRA 5KHLB 1RC8A 2YDXA 1FUYB 4G6ZA 3SEZA 5K0JA 1SCQA 4HDMA 4RCZA 4EFMA 1U1GA 2W2PA 4S12A 4S24A 3OUUA 5FPTA 1ZIPA 2Q3HA 4XIGS 4CTNA 3EQZA 1WA5A 4FFNA 3N7AA 5I6DA 5DHPA 5H16A 2FRDA 4XWYA 5BUSA 1P4GA 3QE3A 2G9QA 3ZV3A 3EZFA 2VF8A 1U3DA 4N0EA 2MTBA 4XOIA 3ZY3A 5K8TA 1XJQA 2ZG6A 4JXJA 5C5CA 1YL6A 1LLFA 1H4SA 3LWBA 5ICCA 3UMJA 4B40A 3SJBA 3N1UA 2X4LA 2C2KA 4X8OA 1U6KA 2EW8A 2X6QA 3BMOB 3JQGB 3S2IA 2PMKA 5KUTA 1JFRA 1DCMA 1Z4JA 1PFYA 4IJMA 5UKDA 4YN3A 3N2LA 1UQRA 5KVAA 2FEXA 3B5IA 4G4JA 2J3LA 2Q3JA 3BXGA 4D0RA 3P9YA 3RSLA 3KTFA 3F5MA 3OQ1A 4MRVA 4ALLA 2ZYHA 3A1FA 4PPNA 3QY9A 3I9FA 4L0CA 1K4KA 2BEJA 4Y67A 4ND2A 2G9VA 4L4SA 4L85A 3OX2A 5DLEA 4DCJA 2Y0CA 2PZAA 1Y81A 5F5LA 4GOXA 2OV3A 4FE7A 4Y7CA 4FFVA 5DMHA 2EZ4A 3QUBA 2BEUB 3VR2D 3BPSA 1XEAA 1DAPA 4ENSA 1MRSA 3PJEA 2JI7A 3O4RA 3BOSA 4KLCA 1K8XB 4MVJM 3DG9A 4GC9A 3WE7A 1ZKMA 2GZAA 3ABSB 1SK8A 2X5XA 3YASA 1CRQA 1H2XA 4YRPA 3S6JA 2REQA 3AQIA 4A8PA 1WU8A 3HMQA 2Y1DA 4RVCA 3F5SA 4R54A 3E9DA 3VZQA 1JJFA 3GPIA 4UZSA 4CNBA 5DYWA 3I2JA 1NW9B 1C7JA 2HC9A 1BVHA 4ZALA 2V7WA 3TLXA 1TK9A 2C61A 2UZ1B 4QDUA 4L9WA 2A9OA 4B73A 3C3CA 3WKCA 1ZGAA 3KQPA 1TJYA 4M76B 1KYVA 1K63A 2GD0A 3ROMA 4F97A 1J2RA 3TCXB 3SHTA 3EZ2A 4Y30A 1JEYB 4YRAA 1JWBB 4V38A 4IIDA 4CF4A 3D9QX 1ZIOA 4TTPA 2ZUWA 1QH9A 2A7QA 1Q92A 4DV7B 1V3UA 2VL7A 3AX6A 4NPHA 1FNDA 1Q1GA 2AK3A 3ZCTA 5BO5A 3ZQKA 3CVJA 3QA3E 5FLKA 4Z0NA 1UZAA 2GO7A 1JDUA 3EXFB 5FOWA 4YUYA 1EP1B 3VC3A 3SQXA 5GV8A 3T5PA 2R97A 3KT6A 5DGDA 1HNXB 1CCWA 3O93A 4GPD1 4IXWA 5EVCA 3FTFA 3K1AB 1PFWA 2VJNA 3OIUA 2OHGA 1WXQA 5EJAA 5B3KA 3DCJA 1XZAA 4YPFA 3ME5A 5J5AA 5SY4A 2B0CA 2AUMA 4GECA 2IXAA 1MG0A 2JLQA 2MSWA 3HVKA 1T9CA 3NBKA 4Q93A 4RVDA 3I0ZA 4DBZA 4EFKA 4MWEA 1NJ8A 4IAOA 2IITA 4EYSA 1HX7A 1RQRA 1SD5A 1QQ5A 2F17A 1U0LA 5G40A 3RTCA 5JFGA 2ZWAA 3RDPA 3RRZA 3SIPA 3IFSA 4DC9A 3KZKA 3B51X 3F4BA 2E4AA 3CLKA 4W9RA 2JFWA 1GAEO 2BI8A 2WMYA 1Y82A 2XTJA 1KAHA 2ZGVA 3EMKA 3M9XA 4P5DA 4Q3CA 1NMQA 4O59O 4BVJA 1ZRSA 2VTEA 4PFKA 1M6YA 3AB7A 2HHJA 2YMMA 2QTCA 3S81A 4UJ5A 2ZRAA 4E6EA 4R98A 2Y1WA 3K5WA 3DVQX 2E0IA 2YWCA 2QOEA 5D3ZA 3RYCA 5CVCA 2DKNA 4Z0TA 2HH9A 4N40A 3TRDA 3GZNA 1TA4A 3VNBA 2RAFA 1LDYA 3JYPA 4WA8A 1JKJB 4TYPA 2FPMA 3I1IA 1XI2A 2PL5A 3U3ZA 4WNYA 2C2BA 2XD4A 4YJGA 3AP3A 2UUAB 3ZQUA 5E3JA 2BM1A 3BREA 1Y1TA 4FWIB 4UDOA 2H5EA 1BCRA 3GZTB 1H2FA 4M7WA 2FK8A 1UQUA 1KYZA 2AMLA 5E9WA 4PLWA 4K6FA 2JGAA 5AK4A 4BY9E 3NONA 4MAMA 3T3GA 2Q4OA 2HNKA 4B0OA 4TXNA 1KMHB 4UUMA 5ALKA 3BJZA 1YS6A 3R0QA 4KNVA 4Y6RA 3ZCXA 4QECA 2FSHA 3GT4A 1UL1X 3V3KA 1DWOA 4G0MA 1SVUA 2RB5A 2LV8A 3ZIDA 2GFIA 1A98A 3TIVA 4R4JA 2NTVA 3IE0A 2P11A 1JYFA 1MOSA 2AC2A 2EP7A 2AE1A 4BWFB 2X8LA 3HDTA 2XUAA 1VKHA 1SVLA 3DCIA 2IU3A 2HF9A 3AUUA 3OCWA 1MAUA 4TS1A 4XX0B 2OCIA 3DNPA 2CDNA 4URFA 1NJ5A 4C6RA 2B8TA 4DF3A 3Q6MA 4U0KA 1RSZA 5DI3B 4YJFB 4GPBA 4HDKA 2FYTA 4A0HA 5AI8A 5H80A 1DX4A 1P1IA 1YQQA 4ZZ0A 1DP4A 1EVIA 5ADWA 5IFKA 3QWFA 1PJ3A 2QUBA 4TMYA 5KTOA 3ELDA 4PLPA 4UDNA 3EA4A 1XQYA 5ARBA 4IWNA 5FJJA 2FSGA 2H2IA 2NV0A 5LZ8A 1IG0A 3PQCA 4HNAA 3UXHA 4YDSA 4TTRA 1JW9B 1U81A 2C3PA 4AP5A 4BNIA 2O8BB 3FSEA 2QE6A 3OLCX 4OP3A 1KJJA 4L3WA 5JAPA 5KSYA 2G07A 4TMKA 2JLAA 4ANFA 2GCOA 3V4PB 2D3WA 5FNZA 1YQXA 1FSGA 4WKPA 2FZ5A 2FFRA 1H2YA 4M1ZA 2XDQA 3I1YA 5FWAA 1HG1A 1SWVA 1Z73A 2A35A 1GITA 1RWQA 2EW2A 3OFNA 4FCWA 3BB1A 4ME6A 2HBZA 2C57A 4DQKA 1MVNA 4I08A 4QYIB 1N0WA 4CVNA 1T5SA 4LGCA 3OOWA 1OHHD 3BX1A 2B4RO 3PNSA 4O1HA 3HKCA 3WMRA 3PR2B 1IZ9A 2IDJA 4G8BA 1X7WB 4IGEA 3PFBA 4H6WA 3REQA 4C0QC 1T4CB 1CY7A 5LQJA 4FCTA 4J0HA 1UMCA 1XTVA 3G3EA 1N7JA 2VXYA 3OMXA 4O02B 4YP5A 4DXDA 1FYDA 1P2VA 4DWJA 1RYMA 4BQOA 3K16A 1E7WA 2C9BA 4EBBA 2J4FA 4EMBA 2N0SA 3SCZA 4NJMB 3FAZA 5H3CA 3BF7A 1E1CB 3A3PA 5EJ6A 2CHQA 3GV0A 3DPSA 2GYVA 1HDCA 3B6ZA 3DAOA 2B4YA 4MV5A 4NLLA 1JDBC 5ESXA 2VDVE 1II9A 3GC6A 1LLCA 3NJRA 3DAFA 3L8YA 2DFPA 4JJ7A 4PQEA 2AC7A 2FRDC 3OC0A 4XB2A 4WT7A 3UGJA 1RAHA 2J0QA 1VL6A 3UXMA 4AC9A 1DAIA 3WWDA 3BGWA 4GXTA 1ZXBA 4X41A 5IAKA 2JLYA 1K68A 1P1RA 2WOOA 4B35A 4FC7A 5K03A 2V74B 3QZUA 3S1AB 1FDUA 1SC9A 3PFFA 2FR8A 4MUXA 3I2GA 1AQYA 1KSGA 3SJZA 3RKUA 1SCDA 4GAEA 1YZGA 1U11A 3VVMA 2PH7A 1P5ZB 2JA1A 3ZHUA 4OLJA 5CLIA 5KB3A 2Q4TA 2XRZA 3ONFA 2LBPA 7REQA 1BHO1 4YR9A 1I4WA 5MN4A 4EYOA 4Z3DA 2JCSA 2VNIA 4MWOA 2G82A 2HPZA 4Y6OA 2EG9A 5EP1A 4YQZA 2I29A 4FGZA 4M6WA 3ZXSA 1AD2A 2UZ3A 2GGSA 3AUJB 1R0CA 1XPJA 1E5DA 4PYKA 2NZWA 1YACA 4MCHA 2QT0A 3WTBA 5KTKA 1RWNA 4LXXA 4EGJA 4OAQA 5IVPA 1S6YA 2YVKA 4KR3A 1S2OA 1EUCA 5J4LA 1ULSA 5EZYF 5JI3E 5IJ0B 3I5UA 4AJLA 2RK4A 2OORA 5B4UA 2JK1A 3PDJA 4BCBA 2JIOA 1I0LA 4OOFA 5IT0A 1E2HA 3AC0A 1KSFX 1NQWA 3BTVA 1DIHA 1PX0A 4L9SA 1J8VA 1F8FA 3OFVA 3ZDBA 1N5JA 1LZLA 1Z26A 1QH1A 4WJKB 3SKXA 2OPHA 3U48A 5HUHA 2BKEA 4RVNA 4GZ5A 2EDAA 4GO1A 2RGNA 4GR5A 5EPUA 4C4PA 5H02A 5BRAA 1O8CA 1EU1A 2O52A 5HPYB 1JL3A 1YFKA 4Y2VA 3UC5A 3RM3A 2ZSAA 1ARZA 4DREA 4HQFA 1X1DA 2AWOA 3AIMA 4EO7A 4Y2JA 4IGFA 3N3BC 3DMFA 4BJ6A 1K8RA 1UXJA 4NULA 4O08A 3BE4A 2ZI5A 1P4SA 4RX1A 4LY9A 4GRIA 5FT9A 5FD8A 3U56A 4PEVA 1JVSA 1Z7GA 2X4GA 3KU1A 5D01A 4G01B 1DIOB 4EABA 4HGRA 1OYWA 3A8TA 2PUVA 4MYDA 3C6KA 1YE5A 3GEBA 2CKMA 4Z8YA 3IPCA 3FOFC 1KJIA 3E7FA 3ICVA 4LNAA 4TM7A 4DB4A 3CUWA 4NYJQ 4HAVA 5BN4B 2YJTD 4ZYZA 1D03A 3FPAA 4ID9A 5EERA 3U3KA 2RK3A 1BDBA 1ZH6A 4E2XA 1FLNA 1V11B 1XZIA 3A1NA 2V6FA 3AEXA 3U3XA 2AG5A 3QUQA 4WOBA 4F3YA 2IU0A 3C3JA 2ZCVA 2PBLA 3DHYA 3FF1A 1YQTA 3KXPA 3K1YA 4H1HA 1O8BA 1CQJB 1BA2A 4F9EA 3OZWA 3ONNA 4OHPA 4YC7A 1E9VA 1FL9A 3ICCA 1YZTA 3L6EA 4CIDA 2VP9A 1UZMA 1HEYA 1XN1A 1EP3B 1ZLXA 4LZZA 3ZJ5A 2R79A 4J76A 1KI8A 1FRVA 2OVFA 3QE2A 1XXHB 2JK0A 2W2VA 2FRVA 4HWPA 1EP2B 4ASUD 3EBLA 4OQFA 3K4HA 4XJSA 2Q5OA 1CR1A 2ORIA 1FQOA 2NVUB 2X0KA 3S5UA 1E0SA 1Y5MA 1VTKA 1YASA 3CV3A 4M4SA 4TKVB 4RTKA 1VPLA 3WISA 4O4JA 4G5HA 1WXEA 4D3XA 1ADJA 1ZGHA 3DO5A 5DBFA 2F4NA 3GVPA 5D6NA 2E6KA 2Z8YM 1SPBS 2QORA 821PA 4E09A 1M1XB 4ARZB 2XA2A 2PUAA 4JP5A 1QP8A 3L84A 3CMMA 1CHNA 1WUTA 5U9CA 2P3LA 3OLWA 1NBWB 3UG7A 4IHKA 4G1EB 4WLOA 1VYUA 4N5IX 3TAUA 3HDJA 1DG3A 2IP2A 3VTFA 2CF6A 5FH9A 4L02A 1NPYA 3TQHA 1Z75A 5KTSA 4ZA2A 3A32A 3W8EA 3U09A 4FGWA 3TG8A 1KGDA 4TN1A 5FA6A 4OBBA 1VL1A 2CSXA 1QGED 4C3VA 1OH7A 3FNBA 3PNOA 1PG5A 2Q99A 3WLEA 4EW2A 1JEOA 1Z6YA 1TT5A 2PMWB 3CWZA 4OKNA 3ZY4A 4H17A 3H5WA 4EGQA 3N0XA 1LDGA 3GLHA 1R6TA 1E79A 1VMIA 1FBNA 2VHYA 3PUJA 4XYGA 3V8NA 2W8BA 1LPBB 3W4KA 4YYEA 1VSTA 3QTTA 5AKXA 1RC1A 1M76A 3OPYI 4P5PA 5B1EA 2XZLA 1N77A 1FRFS 1B73A 4LDZA 1IMOA 1ONNA 3MF4A 1M7BA 2PJUA 5I47A 2W42A 2O8DB 2FUNB 4YXWA 4B44A 1P7ZA 1XA0A 4LN1A 5HGXA 2ZJ2A 3LZDA 1KY4A 3UW1A 1A4XA 1IATA 2G08A 4YK7A 3TLEA 3FR7A 4LEIA 4DJEC 5F98A 1X1CA 4G4SO 3ZEIA 2I1VB 4HHEA 4ZYUA 4HVLA 1KL7A 4FFDA 3WC4A 3H5VA 4BB5A 4OV6B 1CS0A 2HF7A 4WN9B 1U31A 2VDRB 1SG9A 5HKBA 1KBOA 5A5EA 1VI6A 2QU7A 1BEUB 3HBAA 3I04M 1JJAA 3VA7A 1YVDA 1IN7A 5FUBA 4J3FA 2AFIA 3AZPA 1J21A 4KQFA 4IDQA 2PL1A 1R2QA 1G6KA 3BTOA 3LQQA 4BVLA 3KWJA 2OM6A 2B1JA 1U90A 2FEMA 3KKPA 2ZTUA 2K7ZA 1IN8A 3P0RA 3PEUA 4HJRA 4K8RB 1UBHS 1YQEA 2G76A 5EUBA 3RT7A 3KB8A 3L8HA 3UAYA 2AZMA 4GEGA 1T0UA 2W2KA 1C9DB 2Q0SA 3WMGA 2GR9A 5CFLA 3N2ZB 4DMKA 3LYLA 4D3DA 3D7NA 1UDRA 5FWYB 1NX9A 2P7IA 4RA9A 4A92A 4HAZA 4B33A 1IN1A 2JI8A 4GX5A 3JYHA 1IVSA 2ZRLA 4NBLA 3D0KA 5FYDA 3GA0A 3SAJA 1TYZA 1UEXC 1TO1E 1GR0A 3AI3A 4IGKA 1E2LA 1R6AA 4JLSA 4F92B 2XWSA 1S02A 3ASZA 5JH7F 5LXTB 4AW9A 3ETGA 4II3A 1W76A 1SKQA 5AKLA 3TLCA 3K2QA 4IFEA 5JG7A 4CKCB 3ETHA 2GKGA 4P92A 1RAIA 1TZ2A 2WI8A 4O4IA 1VFPA 5FQOA 4CM8B 5K20A 4AI6A 3MTEA 2GMWA 1M6EX 1UJBA 3ZU5A 4BX9A 2GI4A 2JFNA 1BMFD 2QU8A 4OHUA 2RCNA 3F67A 3VO8A 4LC1A 4F8EA 4N7BA 2I7TA 1OAAA 1L5GB 3AEKA 5TDHA 5KQMA 2WNHA 1LS1A 4HAYA 3G2MA 2HA2A 2EYUA 3HO8A 3N0VA 3GOQA 3ASYA 3OZIA 3QEMB 2FR8C 4REMA 1A8PA 3UK1A 2H00A 4BO5A 3R3SA 4MR8A 2PX8A 1JSXA 1QANA 1WUKS 3DZJA 3GXOA 5D1NA 2FE1A 3PA8A 4KIJA 2G63A 3NVKI 3GAMA 2B1QA 1NT2A 2N3ZA 4K0RA 3F98A 2IX3A 3WBKA 2PT6A 2ZAIA 2H1HA 1NJSA 4YBZA 1KI6B 1XHEA 4HFJA 4PHTA 2JCBA 4G0OA 3I1JA 4G5FA 1GQRA 1UJCA 1VXRA 1XV5A 1KYTA 2GEDA 3L7OA 3IR7A 1H8ED 1Y3CE 3R8FA 1NVGA 3E03A 4NE9A 5MGBA 5CDHA 4WQMA 4MV6A 4A5SA 3IVGA 4CKWB 1MO5A 2JFYA 2OORC 1GUZA 2BR3A 4PBTA 3CPHA 1K97A 4JLVA 3KETA 4G67A 2ZS9A 5EPOA 4DLSA 3DLHA 2JGNA 3V2HA 4JV5B 1ADFA 3CG0A 4PX9A 4LF5B 2XA9A 4MUMA 3N53A 5DOVA 4CV1A 3U4CA 3U5TA 4YDRA 3HGQA 5FTJA 1X2EA 1C3OA 1EJ2A 1Q17A 3O92A 4NH4A 1WV0A 3FKJA 1E9AA 1GYQA 4IDOA 1YJXA 3TPZA 5KYTA 1XRNA 4Z3OA 1MGOA 4J7AA 4EW6A 4DZTA 2CLDX 3AJRA 1O4VA 2R11A 4DVJA 1OUMA 1XZ8A 5JJ5A 5IDYA 3HDYA 3UHFA 4XJTA 3KHSA 2BFEB 2C8VA 3OF3A 3JZMA 2BW0A 5IANA 4JELA 3NOOA 4RFSA 5T4FA 1E6UA 1RXYA 1C7EA 2R84A 2YY5A 2OV4A 3FYUC 3U3JA 3V8QA 4BFZA 3CSSA 4YRBA 1BHJA 2YR0A 4FYXA 1SU4A 1B76A 3NVAA 4RH0A 4Q7QA 5JASA 3MTJA 2OCAA 4H3VA 1KAMA 5D7BA 1HYEA 4XWOA 3H6KA 2E2WA 2PNJA 2XKAA 1UKBA 2UV8A 3G7SA 1TRHA 5EXXA 3HJCA 3EYAA 4NG5A 5C37A 3C39A 3I2KA 1ZD9A 3NGLA 2AF3C 3FPSA 2Y71A 3QXGA 4O4HF 5LQAA 3HFSA 3OICA 2FEPA 3ZD8A 1ECFA 1FYVA 1DCTA 1YQ9A 1KMMA 5AJHA 1EK5A 5FI5A 3R0XA 4Z9FA 4GICA 4P35A 1GFZA 1MEOA 2AG6A 2AEFA 2FWPA 3UUWA 4OLFA 5DT9A 4LJ9A 4NXNB 3IKVA 4FR5A 4LOKA 2FDCA 4XPZA 3E15A 5HCIA 2VDNB 4LCBA 3FIJA 4XM0A 1OKKD 4OJYA 3WKEA 2P2CA 2RHLA 5TR9A 1VCOA 2WMOB 3ZXIA 1SCAA 4AXXA 1FSFA 4Q4HA 3U4IA 4FEEA 1BQ3A 4Q05A 4E51A 1NBEA 1RJFA 1II8B 3RARA 1OBCA 1GQ2A 2P2ZA 3TTSA 1WDWB 4B76A 1YS2X 1HI9A 1R8QA 3NTUA 4OJTA 2FI1A 2POCA 2QTNA 2RI1A 3DBHA 4GWLA 3UC9A 5HFJA 1NBME 2FWMX 2OP0A 2EHDA 3DDCA 2VSXA 3I92A 1NXXA 5GIPE 2GM4A 2C20A 3BSWA 4PPGA 4E5KA 3DOFA 1HQDA 1JWAB 2INGX 4F9FA 3HLTA 4H4DA 5IDVA 1KDOA 3AR4A 3D6MA 4Y9RA 4YVFA 2W22A 4B0PA 4DHEA 1GLVA 1E6LA 3H5AA 3GFGA 4A2CA 3E9QA 4BVBA 3KOZA 4IV0A 3NO4A 2VCYA 3C45A 4Y1RA 3OZRA 4ZCSA 3W2FA 1ZA2A 3IPXA 3QPAA 3NP7A