3FLEA

Se_1780 protein of unknown function from staphylococcus epidermidis.
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
245
structure length
243
Chain Sequence
b'KTTATLFLHGYGGSERSETFMVKQALNKNVTNEVITARVSSEGKVYFDKKLSAANPIVKVEFKDNKNGNFKENAYWIKEVLSQLKSQFGIQQFNFVGHSMGNMSFAFYMKNYGDDRHLPQLKKEVNIAGVYNGILNMNENVNEIIVDKQGKPSRMNAAYRQLLSLYKIYCGKEIEVLNIYGDLEDGSHSDGRVSNSSSQSLQYLLRGSTKSYQEMKFKGAKAQHSQLHENKDVANEIIQFLWE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SE_1780 protein
publication title X-ray crystal structure of SE_1780 protein of unknown function from Staphylococcus epidermidis.
rcsb
source organism Staphylococcus epidermidis
molecule tags Structural genomics, unknown function
total genus 67
structure length 243
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3fleA00
1PV1A 4G4IA 4TVKA 4IH9A 4TPKA 2QUAA 4L3WA 3FWHA 2WLSA 4P9NA 4EY7A 2PX6A 2QJRA 4X90A 1JI3A 1E8MA 2H9YA 1H2XA 2H7YA 5C7YA 4QA9A 1CUXA 4OB7A 4QDZA 4JEIA 3EQ9A 1XZMA 1R3DA 4HXGA 3QYJA 4G1FA 4LIPD 3PI6A 1AMNA 3WL8A 3S8YA 2ORYA 2WG0A 2WIJA 4X94A 1KU0A 4X71A 3A2NA 3I28A 3G7NA 2ZJFA 3ILSA 5CT5A 2G5PA 2PBLA 2OGTA 2JIDA 3VISA 4ZXFA 4P08A 4B85A 4KYVA 3I6YA 3AINA 2J3QA 2Z3WA 2PSHA 4YASA 1ODCA 2JGMA 3HSSA 5A7HA 4X6YA 2Q0XA 4HS9A 4G8CA 2H7CA 1LPPA 4PSUA 2XUPA 2JF0A 3E4DA 2NW6A 2J3DA 4OU5A 5CH8A 3ED1A 4M0FA 4WY8A 4NS4A 2WUFA 2VSQA 3CCCA 1XZBA 3PUHA 1Y7HA 2CUTA 4UFNA 3OPMA 4J03A 2WHPA 1UKCA 2WUDA 5DNUA 1BCSA 3VXKA 2FJ0A 1QIDA 4A16A 1MT3A 2JGLA 4DM7A 1GQSA 5AKZA 1THTA 2ONCA 3I6MA 1DQZA 4PW0A 1N5RA 3N2ZB 4Y2VA 4B6GA 3KD2A 5T4FA 4ZRDA 3ANTA 1U8EA 3W9UA 4H0CA 4OU4A 1MX9A 4GDMA 1HL7A 2O2IA 5DJ5A 3AUKA 3VVLA 5AKJA 4W1RA 3HZOA 5J3JA 2ZSHA 5ALIA 4C4ZA 5JZ9A 3G9XA 5FRDA 3VJKA 4UBOA 3LIIA 2UZ0A 1XZJA 1ETHA 2XQJA 4QDTA 4B0PA 3EBLA 5LZ4A 5DTJA 1YASA 3C8DA 5K3FB 1DT3A 2PM8A 4C87A 2RIPA 3RARA 4X91A 5D3ZA 5LP1A 5ALOA 3I2KA 1LPOA 2HRRA 2HA7A 5ALWA 5DWDA 5K5EA 5EHZA 1PFQA 1EK2A 1CUWA 3O0DA 1BE0A 2VQ6A 4RE6A 2ZJ7A 3G9UA 1IZ8A 4EB0A 3IIIA 3WIBA 4MYSA 4FFWA 5AHXA 5AJHA 3C8HA 4PV7A 2BCEA 5AK4A 5ALSA 1S8OA 4DNPA 3V9AA 2ACEA 1QIIA 4FLEA 3DYVA 3PFCA 3W06A 1RWQA 2AJBA 4E46A 4YPVA 1EH5A 3WWDA 4IH4A 3V1NA 4DMCA 4CFSA 3O4GA 4U2FA 2VJDA 4U2BA 5BOVA 4QZVA 5ALHA 1IZ7A 3FSGA 4UPDA 3O9MA 3QMWA 4F21A 3F96A 2RHWA 2AJDA 1BS9A 1CEXA 1CUUA 3A70A 3H2GA 3K2IA 5AM4A 3DLTA 1UT6A 5FXMA 4QLAA 2AJLI 5ALVA 3DS8A 2QKYA 1EB8A 3H17A 5ESRA 1VZ3A 2WIKA 4LXHA 4AMZA 3BJMA 3KDAA 3E3AA 1UOQA 1R88A 1WHSA 4C6HA 2WHRA 3ZLUA 3D2CA 4KR0A 2YH2A 4J7AA 3WKDA 2HA5A 3M3DA 1CUJA 1SCIA 4J0JA 3STVA 3BIXA 5CW2A 2VJCA 3PF8A 4B84A 3WWPA 5LZ9A 4H18A 2Y6VA 5D3KA 2PSFA 2QM0A 5DLPA 1KEZA 1XQWA 1QZ3A 4UHEA 4HXFB 4UBLA 1QFMA 1YS1X 1XZGA 5H3HA 3ICVA 4PSCA 4MEBA 1OILA 4BP9A 4K6GA 5JATA 4GW3A 4J0DA 4CCYA 4UUQA 5KBYA 2WU4A 4X93A 1QIHA 5K3BA 4H77A 2ZYHA 4IQ4A 2DCMA 1JJBA 2CMFA 4RNCA 1F0NA 2C0PA 3VJLA 3IA2A 2PU5A 5ALEA 3STUA 4QE3A 3T4UA 4MEAA 2HFJA 3K9BA 1VLQA 5T4HA 1ZICA 4G9GA 2ZSIA 2BUBA 5AP9A 1SFRA 2BGRA 2OCIA 2XB6A 5EI5A 3JWEA 2K2QB 4U2CA 5CMLA 1TCAA 2WSLA 5LZ2A 1MO2A 1LZKA 3H19A 1TAHA 3TRDA 4QDUA 3D3NA 3I2JA 5JAHA 5JANA 1YB6A 5AK5A 1CQZA 4AX4A 2GBIA 4H7IA 2RONA 1CUAA 3WWEA 3AJAA 2XMRA 2B9VA 1ZD5A 1CQWA 4EA6A 1ISPA 1VJ5A 1XLUA 3HJUA 5D7BA 1BEZA 4I3FA 2WJ6A 1ZD4A 3UUFA 4QNNA 3L1JA 2PSDA 1ZOIA 2HRQA 4KE9A 2HA0A 3W2TA 5AIBA 3M83A 1A8QA 4RGYA 1WB6A 2PKYX 4FLFA 4GXNA 3PE6A 5IVKA 2P8SA 3RM3A 3HYSA 5I7UA 1HKHA 2XUIA 1IUPA 1E3QA 5K3CA 1EK1A 2IX9A 1GXSA 4CG1A 3AIMA 3EQ7A 1YR2A 2GYVA 4BC1A 3WZMA 3V48A 1K63A 1IUOA 4MJ3A 1XQYA 2ES4A 5AICA 3Q8WA 4B81A 3BDIA 1XZDA 1JJFA 2HU7A 5AI0A 4QDOA 3WWCA 4EZIA 2XQGA 1ZD3A 4UFOA 2B20A 2XUJA 4TGLA 1HQDA 1GQRA 2XUFA 3WKCA 4DMKA 3DDUA 3OURA 3TGLA 1LPNA 4U2EA 1CLEA 2I3ZA 4J0CA 4F60A 3FYTA 3VJMA 3QBJA 4BAGA 1T2NA 4GECA 3AIKA 1MNQA 3Q0TA 4MXDA 4AQDA 4DMHA 4KJXA 4B0OA 1TKRA 1H2WA 3WKEA 2XDWA 2QZPA 3W05A 4C88A 1DWPA 4DGQA 1FFCA 5EIHA 5HF5A 1WCYA 1EX9A 3G02A 3ZV7A 1EVEA 2EDCA 5KWJA 5JD6A 1MU0A 5JADA 3WA7A 3I2FA 1MNAA 1HLGA 1FFAA 2BUAA 4WFJA 3WJ2A 1TRHA 5A7FA 4E14A 1FFBA 1CUCA 1ORVA 1X2EA 2GYUA 3L1HA 3MUNA 4HTAA 5EGNA 4G8DA 5D6OA 3ESAA 1XZHA 3BL8A 1YCDA 2Y2UA 4G4JA 4FHZA 2QR5A 4XJVA 5CT8A 5AK3A 4CCYB 5HCUA 3HEAA 4ROTA 2R8BA 1CUYA 1N1MA 4NZZA 3D2BA 1XZCA 2VJAA 3HRHA 5KREA 1U4NA 1BU8A 1MTZA 1E8NA 2XI4A 3NWOA 3H0CA 4BCDA 3DEAA 3ESCA 5EHXA 5HQ3B 1ZJ5A 4ITVA 1XQXA 2C0QA 1VXRA 2XQFA 2AXEA 2VT7A 5ALXA 1XZAA 1ZI9A 1EVQA 1XRNA 5ALUA 1IMJA 3M82A 2VAXA 2VAVA 2GZSA 1NU6A 4Q3LA 5EHQA 4H7EA 4Y2SA 5AKIA 5AM0A 4L9AA 2XQKA 4UHFA 2DFPA 3HACA 1VA4A 4JNCA 5E4JA 4B7ZA 2JEYA 4KE8A 2QJWA 1DU4A 1UK9A 4NMWA 1W4LA 3QM1A 5AKXA 5T4BA 4AMYA 4X6XA 5A2GA 2QXTA 1B6GA 3QPAA 4C01A 4BZZA 1CUGA 3FVRA 4DNQA 2JEZA 1BN7A 4KEAA 3WMRA 5T4EA 4BRZA 3ZLVA 4K5QA 1BROA 1O6GA 5ALGA 4JH0A 4MYDA 4A5SA 1USWA 4U2DA 1L7QA 4BB0A 2BFNA 4Y2JA 1ZI6A 4WFKA 1MX5A 1ZIXA 4FMPA 1GKKA 4KRXA 1F8UA 3ANSA 2I78A 2OLEA 4DTCA 4FKBA 3FLAA 3D2AA 2RHTA 3STYA 2X8BA 5JD5A 2PU7A 4OB6A 2JGFA 1LLFA 2D0DA 4Y2PA 5LZ8A 2XUHA 2OGZA 4KACA 4KAAA 2V97A 2WTMA 5EHNA 2CJPA 1HBJA 1N5MA 4HRXA 1H23A 1L7RA 3FYUA 3I1IA 1EI9A 5IVHA 1GPLA 1WPXA 3WZLA 3WLAA 5BV7A 1UXOA 5YASA 1OXMA 4G5XA 4J0IA 1X70A 1AURA 1GKLA 4IHAA 4P92A 3QZUA 3AZPA 1LPSA 5E4YA 1LGYA 4Y9SA 3GBSA 3WL5A 2VEOA 4IH1A 2VF2A 2XLCA 1Q84A 5DNWA 3IULA 3AZQA 1XKTA 3WL6A 1ZGBA 4HRYA 2JBWA 3R41A 1AC5A 1VKHA 2H1IA 1CFJA 2O2HA 1WOMA 1SCKA 1NX9A 3IUJA 2WFMA 1LBTA 2VATA 3P2MA 2GZRA 2ZYSA 3KOOA 5HF8A 4IO0A 1M33A 4U2GA 2XUKA 2DQZA 4N5HX 2DQYA 4OYYA 3F9CA 4OSEA 3QMMA 2XMZA 1Q0RA 1R1DA 1AKNA 3T52A 1NU8A 1XZEA 3C6YA 3F8SA 2C5FA 2XUDA 3GELA 1CRLA 3L1IA 5BWCA 4WCVA 4DLNA 5DYWA 4WFIA 4H7JA 2V98A 5FV4A 5BWBA 3CN9A 3PDCA 4BAUA 4A23A 1U2EA 1LNSA 1WB5A 5HKAA 4BVKA 5ALJA 2BKLA 3JYHA 5I8PA 2QXUA 4PNZA 4ARBA 2XE4A 2WG2A 2DHDA 2XMQA 4CI9A 3A2MA 2C4HA 5ALRA 1L7AA 4WY5A 1W76A 1N8SA 4GI1A 1YAJA 1X2BA 3QPCA 4BATA 4E11A 2QT9A 3IDAA 4Q1VA 1XROA 3GFFA 4N8DA 2XMDA 4GHWA 4B82A 4PQEA 4Y2UA 3KWFA 4UFPA 5K3AA 3TEJA 4FFVA 4O08A 1F6WA 3PUIA 4Q3OA 4E15A 1CIJA 1BCRA 4XX1A 3BDVA 5AK6A 4KAJA 3CN7A 2Y6UA 5C81A 4UBNA 1JT2A 1XLWA 1EDEA 2OPHA 1IUNA 1DWQA 1QGED 1QONA 3G8YA 4AXBA 1ODTC 4QDXA 3ICWA 4FWBA 2HDWA 5E4TA 5K3DA 4ZV9A 4PO3X 5FKJA 4LKOA 1QJ4A 1UK7A 3WK6A 4EY8A 1QIFA 2V9ZA 4K2AA 4W63A 5AM1A 4ZV7A 2GBFA 4Y7DA 5JD4A 1BRTA 2PL5A 4GBGA 5ALDA 3IUNA 3EIOA 5JAOA 2WIFA 1WM1A 4ARAA 1HDEA 3DKKA 1TQHA 2OQIA 1XRMA 3O4HA 2PSJA 2OGSA 1EINA 1VOTA 2GBCA 1Y37A 5AOAA 2QRUA 5FPPA 5C8XA 5FPQA 1K8QA 2X76A 4G9EA 5LIPA 1CPYA 1QLWA 2RI6A 2WHPB 3WYDA 2GYWA 5CH3A 3CXUA 4V2IA 4CG3A 3FYUB 1DT5A 1A88A 1UOPA 2D5LA 5AIAA 2CB9A 4S0XA 2CBGA 2XUQA 1D07A 3NOXA 4XVCA 4BCCA 1R9NA 4UHHA 5ALQA 2C7BA 4AZ0A 4EBBA 3HC7A 3KSRA 2WFZA 5AI5A 2Y2VA 2Z8XA 3ESDA 1QOZA 5DNVA 2WJ4A 3F67A 4M0MA 1XRLA 3SC2A 5JYCA 3FVTA 2H7XA 1QIKA 1TCCA 1J07A 2CEKA 3MUOA 2VA9A 5AKHA 3GZJA 3QMVA 4OUKX 3FNBA 1DINA 5CH5A 5SYMA 3GUUA 4OB8A 5ALKA 5HK8A 1DWOA 3DD5A 4B83A 2AJ8A 1IVYA 2XUOA 2O7VA 1WPRA 4BDTA 1A7UA 3D0KA 3X3HA 5AI4A 2HL6A 5AOCA 3AZOA 1XZKA 4X3CA 1E89A 4FBMA 2DHCA 3WK5A 1Y7IA 1QO9A 5HFNA 3BE8A 1CUBA 7YASA 1A8UA 5F4ZA 1O6FA 3PFBA 3IURA 3D7RA 4KE7A 4AZ3A 2XMCA 4B9AA 3SK0A 5HKBA 5CT6A 3FCYA 2OXEA 2O7RA 1J06A 3H1BA 2Z5GA 3U1TA 4F0JA 1UZAA 2PUHA 4DYHA 4X97A 2FJPA 4RE5A 4AN0A 1YSCA 2XMBA 3W04A 1WHTA 1H2ZA 5CURA 1MX1A 1H2YA 1QTIA 4MQMA 1ZI8A 4XIIA 3STTA 2HA4A 1ACLA 3G0BA 3WK7A 2RAUA 3H2KA 3BJRA 3WQHA 1SOMA 4N8EA 5AH0A 3BXPA 4UBIA 4UHCA 3C6BA 1JMYA 4C4XA 4UBJA 4ZI5A 4B80A 5AM5A 4X7BA 4W1PA 1UK8A 2J4FA 4H7HA 1K5PA 1EDBA 1XRQA 1GT6A 4UBMA 1MAHA 5AKLA 1XLVA 2OCGA 5CTAA 3M81A 1PJAA 3R40A 1WB4A 5EFZA 3BF8A 3LS2A 2BUCA 3WK8A 4Q82A 1J1IA 1R50A 2WHQA 2XMGA 4FOLA 2O2GA 5DTIA 3B12A 1BN6A 2JGEA 3SX4A 1EB9A 4OPMA 2RGUA 3WKBA 2HU8A 4J0GA 3ESBA 3WI7A 1W1IA 4BP8A 1CV2A 3WKAA 3FBWA 3U0VA 2ZYIA 3EF3A 1JU3A 3H2HA 3GROA 3QVMA 1K6EA 3WYNA 5KWIA 2OAEA 1GGVA 3IBTA 4OCZA 4X6UA 5IKXA 2WFLA 3IUQA 4X92A 4YX9A 4P93A 3FOBA 2PUJA 3V1LA 1LZLA 2PPLA 5ISMA 4Q05A 3WK4A 3D59A 4G4GA 3V1KA 2EEPA 4W1QA 4BZWA 3DYIA 5CXUA 1CUHA 5ALPA 2G5TA 1RP1A 2B61A 3H04A 2BGNA 1ZJ4A 3FYUC 4ZWNA 4UHDA 3DNMA 3DJYA 2PSEA 1H22A 4OD0A 3AFIA 2LIPA 1QIJA 5EIEA 2OQVA 1G42A 1G66A 5A6VA 1AZWA 1CUDA 3DQZA 2ZYRA 1E66A 3RK4A 1Z68A 3SWWA 2Z3ZA 3FAKA 1C4XA 1BEEA 3BIWA 1R9MA 2C5GA 4LHEA 3R3XA 4FNMA 1QO7A 1R4ZA 1VXOA 4QWWA 3QH4A 1FFDA 1GPNA 1MAAA 2ROQA 5JARA 3B5EA 4AB1A 3C45A 4H7KA 5AKYA 3ZI7A 4LXGA 2WIGA 1Q0ZA 1DX4A 1JJIA 4AO6A 4GWLA 3PICA 4OYLA 3R3YA 4FLMA 1P0QA 4BDSA 2HA6A 2DR0A 4BCBA 5JAUA 4L0CA 2QTBA 1CUEA 3C6XA 4DNOA 2QMQA 2HADA 1EXWA 4HXEB 3IB3A 2WUGA 4QLOA 5E2IA 4PSDA 3WK9A 3I6ZA 2C58A 3NUZA 1THGA 1RYYA 4CIBA 1QIMA 3H18A 2EDAA 4FNGA 1UFOA 1XZLA 1ODSA 3EQ8A 4JYMA 1G4HA 5HF6A 1U65A 3QPDA 4ETWA 5C8ZA 4J0KA 3AILA 6YASA 3HI4A 1VA5A 3FLEA 1GZ7A 3RKSA 1FFEA 4QWMA 4DIUA 5CBKA 1AX9A 1XFDA 2VT6A 5IVIA 2XMSA 4K6HA 4CIAA 3WIOA 3CCBA 4BBZA 3QITA 1YS2X 4CG2A 1CUFA 1DX6A 3DL7A 2IITA 3LIPA 3G9ZA 1XQVA 1CUVA 1ORWA 5LZ7A 3C43A 5ALMA 1J2EA 1W52X 4EUSA 5AI9A 3LCRA 4INZA 3R0VA 3ZWQA 1QIGA 5FOQA 3V1MA 2ACKA 3G0CA 1P0PA 4H7FA 1MPXA 4W1SA 3WWOA 2E3JA 1E8DA 2WJ3A 3OOSA 4DSZA 3G0GA 3OM8A 2YXPX 4KE6A 2WFLB 3DL4A 5LZ5A 3D4LA 1P0IA 1ACJA 3ZPXA 1KU6A 5HFAA 1XKLA 3C6ZA 2PVSA 3FCXA 4BYMA 2XLBA 4EHBA 5A71A 2HHAA 1HPLA 2VJBA 1CUSA 4D9JA 4JUIA 1Q83A 3LLCA 1UK6A 4LYEA 2QVBA 3HXKA 4HVTA 3R3UA 3N0TA 4G8BA 1UWCA 4N8SA 2OCLA 1JKMA 1F0PA 2Z8ZA 5I9IA 4L72A 4BE4A 4ZREA 3UUEA 5K3EA 5SYNA 4KAFA 2IIVA 4Y2YA 5ALTA 5LKAA 5EIAA 2WQZA 3O95A 2DHEA 5LYYA 2HA2A 2WU3A 5HZGA 1FSSA 4Y2QA 3IUMA 4AO7A 2AJCA 3STWA 4KRYA 3F98A 5FUMA 1MN6A 5ALNA 4BAZA 3ZLTA 1EHYA 2WUEA 4NVRA 1CVLA 1OCEA 4I4CA 4Z49A 4H7DA 4WJLA 1YB7A 5JALA 1SCQA 2WTNA 1UKBA 1JU4A 4Q3KA 2ZVDA 5AI6A 5FP0A 3G0DA 4WDRA 4W9RA 3UMJA 5AM2A 3R3WA 4JYPA 4X85A 1G5FA 1XRRA 5CXXA 5LKRA 3OG9A 1VE6A 2DSNA 1XRPA 4BVJA 2QOEA 4N5IX 5DYTA 3MVEA 4RPCA 4Q34A 3RLIA 5LLSA 3TJMA 4UHBA 3JW8A 5A7GA 1LPMA 3STXA 2Y1KA 1MJ5A 3R3ZA 3OTQA 4HAIA 2W6CX 1QIEA 5JAPA 2I3DA 5HQ3A 4XWGA 1AGYA 2HU5A 4QEKA 1ZD2P 3S2ZA 3OC0A 2ECFA 3K6KA 1AQLA 4CCWA 5AKEA 1XZIA 1SC9A 4UBKA 4DSAA 3H1AA 2HA3A 3C87A 4Y2XA 4ZGBA 1AUOA 2WKWA 3DCNA 1A8SA 4YK7A 4M0EA 2G4LA 2R11A 3I2HA 4WDQA 1CUZA 1E5TA 4J3JA 2OCKA 3A2LA 3DKRA 2QS9A 2YYSA 4F5ZA 4C4YA 5FDFA 1FJ2A 2HIHA 4LXIA 1EA5A 3H2IA 2HFKA 1XZFA 1TK3A 2QUBA 4K6KA 5DYYA 2WIDA 2W22A 5A62A 2WG1A 4GLBA 1LPBB 2JGIA 4B9EA 3VKFA 2CKMA 5JASA 3GA7A 4X00A 1W75A 4Y2TA 4BTVA 4H35A 5FLKA 1CUIA 2CZQA 5ALLA 5HF9A 4AO8A 5AKKA 1VE7A 1W6RA 1YA8A 3KXPA 1LPAB 4Y2RA 1JFRA 3MGAA 2B4KA 1P0MA 3C5WP 4MQLA 2V96A 3F97A 5ALFA 2I03A 2WILA 1DTEA 3I2GA 4EY4A 3WJ1A 5ALYA 3BF7A 4X95A 1K4YA 3BWXA 5JZSA 3KWJA 2VTVA 3DOIA 3R3VA 3E1GA 5CT9A 1ZGCA 1LBSA 4GEGA 3FSGD 1B41A 3H2JA 1QFSA 3PF9A 3HLKA 2FX5A 4BTLA 2XT0A 2G63A 2HM7A 2WM2A 5CRIA 3NGMA 1GPKA 3G0IA 3AIOA 4EY6A 2JGKA 1UKAA 2OAGA 3WL7A 1C7JA 4I19A 3FLBA 1VZ2A 1I6WA 2OG1A 2ZJ6A 3DOHA 3E0XA 1DQYA 2XUGA 4BVLA 1T4MA 2GBGA 4FTWA 2BJHA 1C7IA 4HZGA 5AOBA 5IH7A 4C89A 5C8VA 1QTRA 4LYDA 2FUKA 5JIBA 5K3FA 4AN1A 3B3QA 3C5VA 5IVDA 5JZBA 3O4IA 1UOOA 1EDDA 3W9BA 2BAGA 3G9TA 3LP5A 1JMKC 5CT4A 4DNFA 2YASA 4PF1A 2X5XA 3O9VA 1TCBA 3O4JA 1TIBA 4DMFA 4BC0A 1CR6A 4J0HA 3HABA 3A6ZA 1YA4A 1YAHA 3WA6A 5HK9A 5AKGA 2J4CA 3YASA 4MWTA 3VVMA 3VDXA 4MWSA 4BRSA 3D5EA 4BE9A 4EY5A 1ZIYA 1QE3A 5AO9A 5AI8A 2XQIA 2JGJA 3I1YA 4FDMA 5ALZA 3C70A 2XUAA 3IVMA 4FBLA 5AM3A 3I2IA
chains in the Genus database with same CATH superfamily
2DUUA 3QLVA 3EVZA 3IQDB 3QFFA 1H8EA 3WMXA 3HJGA 1GG5A 2DKOA 2F3SA 1VHQA 3A1DA 3FNFA 3NX4A 1SKAA 1X7WA 5A3VA 3ZHTA 5BXQC 3NDIA 3SD7A 3TPFA 4YYEA 5JMTA 3HXQA 1LY1A 1KYYA 2Z95A 3PNKA 4AF8A 4C0HA 1CY7A 5D5HA 5BSFA 3ROXA 1WB9A 4YJFB 1VJRA 1S9DA 1ZK3A 2BE7A 1NXPA 1JB9A 5CCDA 2WLSA 1RWMA 3U9SA 1JI3A 1H2XA 2A7QA 2H7YA 3JTMA 2ZQYA 1JE1A 1U8YA 3EN0A 3R24A 5C7YA 2JJ8A 2GAIA 2PA3A 5EESA 1KY4A 5DBOA 1K5DA 1ND6A 1Z38A 4IHJA 1JT9A 2H0QA 2HCBA 3D8SA 1IMOA 5EA2A 3SYNA 1T5DX 3R7SA 4D0GA 1XZMA 4FFDA 5B1YA 2HMWA 3NKFA 1GT91 1NFFA 5A6SB 3TYXA 1EWQA 4G1FA 3K6JA 1JLLB 4TQ9A 5TF0A 3R09A 4CKCB 1M0EA 2CMDA 1LC0A 3EZ7A 1WQ1R 3SMQA 3FNEA 3V7WA 1AMNA 2UAGA 4FE3A 1S02A 2A5LA 3RAGA 1U04A 3TXYA 3T12A 1BX1A 1TKCA 3NHWA 4IJUA 2CE7A 3K0SA 4A6PA 2JFHA 5LLDA 3DZ8A 1OXKB 2HJ9A 1QX4A 4X94A 4FGSA 3I28A 1YHNA 2R4TA 1HUQA 3NM6B 4GP9A 5E9JA 2ZJFA 4OSPA 1KZ9A 2BC9A 3ABSB 1N2CE 1RQLA 1PNVA 4WV3A 5G0WA 2WTUA 3ZDAA 5HM8A 3NH6A 4JOQA 2C54A 4M21A 2LRHA 2OHFA 5LQCA 1PR3A 2JLRA 3FMGA 1W88B 3L07A 1RYZA 5EXEA 1ZAYA 2UUAB 2BBOA 4ARSA 1MO3A 4DSNA 2J3JA 2VL7A 2YN4A 1ZG3A 4PLZA 1WIWA 4EQ6A 1KZGB 3TIIA 2Z3WA 4B45A 3OF3A 1B26A 4YASA 4EYOA 3ONNA 3HSSA 3A3KA 5A7HA 1YR3A 2HLHA 2MTBA 4HPXB 4U7JA 4RULA 3T9EA 1JNYA 2Q0XA 4RUKA 5CA1A 3RU7A 3FZYA 4YAIA 1MHPA 4RHEA 3HGMA 2P2SA 3N28A 3NJ8A 4HS9A 5DLDA 3J7TA 4G8CA 3V8EA 4PN3A 1KYTA 3U4DA 4Q01A 1SM4A 3QU9A 4PHTA 1S3FA 2JF0A 2XUPA 4F97A 4V02A 4HV4A 4PC2A 5LOVB 1O0SA 2NW6A 3EPJA 3CKYA 3IBCA 2W5UA 2J3DA 1VKOA 3OOYA 2POCA 1N6LA 1GNTA 1SBZA 4NFHA 2PZEA 4U7WA 3TL2A 5EJAA 5FYDA 2NADA 4NS4A 2VSQA 4YRIA 1IZZA 2FRDC 3PUHA 4FR2A 3B7PA 3FPSA 2A5GA 2SNIE 4HB3A 1J5XA 4PRYA 5TY0A 5BUQA 1I80A 2WI8A 3DMPA 4JBIA 4WT7A 4YLGA 3T3PB 2Z5FA 3EH1A 3JD3A 2OMEA 5DNUA 4FWTA 1O57A 5C32A 2YNMC 1SU6A 3ZCUA 4MRMA 4AD8A 1QHXA 2FJ0A 3M3HA 2DBZA 1XTPA 1R4NB 3EW9A 5C8YB 5F4BA 2RAVA 3LE8A 2NXWA 4M99A 4RHTA 3FTEA 3VKGA 3I6MA 4LQCA 1X38A 2VHYA 4ZHQA 4PW0A 3X1XA 1N5RA 2FPSA 1PL0A 4F4IA 1W44A 1LDYA 2LPMA 3LA6A 3RTDA 1NI4A 4BNWA 5IABA 7REQA 4BNNA 5JRZA 1XZQA 4DJFC 3KD2A 4OHOA 4B3TB 3WHIA 4NCBA 2XCLA 3EWAA 4L1KA 3RFTA 2OZLB 4FU0A 3Q15C 1TF7A 3FNHA 4ZRDA 3QEJA 4QUKA 2V8BA 2FFRA 1U8EA 3W78A 3OKFA 4I9HA 3VR4A 4NULA 4OU4A 1TM3E 1ZKMA 3VNRA 4D25A 2CLOB 1XLTC 2QN7A 1WEHA 1YDGA 3P52A 4LRUA 4HAXA 2O2IA 5DJ5A 3JR7A 2ZTVA 1OZHA 2H2HA 1Z2CA 3SPXA 5IUNC 1QB7A 2NQ2C 4GIBA 5AKJA 4R7TA 2B2NA 2E1RA 1NVVQ 4UULA 2OBFA 3CF4A 1K6JA 3HZOA 3LCCA 8GPBA 3H84A 4TYPA 2C9MA 1JA1A 1JF8A 1JPJA 3CE9A 4LRSB 4N18A 4R3WA 1RKQA 4W8OA 1FA9A 1KYQA 2QG4A 5TC4A 1OTXA 1XRSB 4AY4A 4YLYA 4X6LA 1BHQ1 3GUVA 3PUYA 4QJIA 4X8LA 1SOAA 3R9KA 3CH5A 1Y80A 4LMAA 2H3HA 4G0MA 1QHSA 1DFIA 1ZGZA 1W5TA 3CBGA 2DMRA 2ZVJA 5EIOA 5JH7F 1BDHA 4YXFA 4C4PA 5IUJC 1SG9A 1FY2A 1UBGA 2YJ4A 3A9UA 4MV1A 4EB8A 2CVOA 1SC1A 4G1MB 5AVSA 2ORED 3EGDB 1M0SA 3I83A 4JNKA 2P69A 1XZJA 4YIKA 4K9SA 4QDTA 3VZRA 1QNFA 4R9RA 2MSNA 4RK6A 4HEQA 4XIYA 4D8VA 1I7SB 5C37A 4TVBA 5SV2A 3UTCA 4JLUA 4QQNA 1XD9A 2NPOA 4YTEA 3NDBB 4DDWA 5K3FB 4QXPA 4BO9A 3PDIA 5I7VA 2PM8A 5CBPB 2RIPA 3MC1A 5EMNA 2N1BA 1SVLA 1Z2EA 4OY3A 4J7UA 3D6AA 3QELA 4RKQA 3T3OA 1LC3A 4PFJA 2BCJQ 2F3TA 2A8YA 1YACA 4GF5A 4HMPA 5TS3A 1WZIA 3LCJA 4Y9RA 4PXAA 1M2OB 4GOXA 4IIEA 1J8YF 2HRRA 5D5QA 3PITA 2C8JA 2FSHA 4BO4A 4HNQA 5K5EA 1OFTA 3ORHA 4DY4A 3CT4A 2EGHA 4AZTA 2YBEA 3IOMA 3B3AA 2VJYA 4ZU3A 4OX9Y 4QTUB 5JSFA 4WQMA 2B4RO 2I7VA 3ZE8A 3LT5A 1X1SA 2ZJ7A 3UC5A 4ZAFA 2XNHA 3C4QA 3O2JA 1F38A 3WIBA 4JUDX 2EYQA 4I9UA 4MIKA 4R8MA 1GU1A 4DR4B 3OZDA 1I10A 2XGMA 2R60A 1ECJA 1E2UA 3Q9LA 5DHQA 2IUEA 2QTTA 2QQFA 3C8HA 5G40A 1SCDA 2GYYA 2EXXA 1E7SA 1C8VB 2IZ6A 5ALSA 1S8OA 5I9BA 6PFKA 4NAVA 3AJ8A 4H4DA 3ZNOA 3TO5A 1GPJA 2YN2A 4DNPA 3ILYA 1N2SA 2GN4A 2TRSB 2VJQA 4EPYA 3H8WA 5IFKA 5IZCA 1FDVA 1QPZA 1JG1A 2GQ0A 2ZQZA 1QIIA 2IEZA 2MINA 2YS7A 2PXXA 4QDJA 3R7WA 3QE3A 3EPHA 4REOA 5EP1A 3JPYA 5NLLA 3RU3A 1I5OA 3W06A 3ZN2A 2AJBA 3AF1A 3DPUA 4JLNA 3F4KA 5A3SA 4V3CA 5CVJA 1JYSA 2V65A 3JWHA 4IIFA 1K86A 3H5IA 3OCJA 2IX3A 1HE2A 1JAIA 3GAAA 4I5DA 4BBPA 1ZA1A 4B2YA 2AZTA 2FMIA 2Z2KA 3I1FA 2X19A 1E1QD 2WOJA 1OI3A 4F6CA 1U6JA 1JMVA 4YI3A 2R47A 1WX1A 4P6VF 5ALHA 1E3IA 2GZAA 2Q2VA 3FSGA 4D98A 2VIIA 4G0YA 2DX7A 1POXA 4KR6A 1LRJA 1DLIA 5EMHA 1RPAA 4JCOA 3R3JA 4P5PA 3GLVA 3QJYA 4R1LA 4HOYA 4C07A 4TL8A 4Y8VA 5FTLA 1D04A 1Q0PA 1GGJA 1T5TA 4JL6A 1P45A 3A0RB 5IN4A 1TCVA 1RE1A 1YFKA 2VZ8A 3IKLA 4BLOA 2V6JA 1HFEL 2F3QA 3IESA 4BWYA 4L5BA 4DVGA 1EB8A 1BRMA 1GL9B 3T3DA 2O8CB 3OH8A 3BILA 4BKUA 4BMSA 2O3RA 2B1QA 1GLNA 3L0SA 2B8TA 2OV8A 3BJMA 4Y2HA 3T3HA 2G07A 2Q6VA 3IP3A 4XX0B 1UOQA 4EMUA 1HSZA 3QLJA 3E7FA 2JIBA 5DULA 1H9AA 1P0CA 1OD6A 4KBFA 1WHSA 3KAKA 2GDZA 2R7MA 4TWBA 3ABIA 2RGNC 1PQYA 4OJTA 3MT0A 2CN1A 4LVNA 2GPTA 2QVGA 4HQNA 4A8HA 4N9QA 3PKJA 5C52B 3AX6A 3M3DA 5BSHA 1CUJA 5CFNA 1SCIA 4J0JA 4LY9A 5CB0A 3STVA 2ZUCA 4R1PA 3KELA 4XUDA 3NDPA 2REQB 2MR5A 3AR2A 4Q3NA 1G60A 3TW6A 1EP1B 4PSVA 2EKDA 3PRKE 2R96A 4H18A 2RCYA 2BHLA 5K01A 2AN4A 1XNHA 2G1UA 4NBRA 1ZRSA 3V8QA 1DRWA 2I0FA 4ZTBA 3SSMA 5JXWA 4DSOA 1XQWA 3ZC3A 1QZ3A 3PGA1 2GESA 3TR5A 2IYAA 4DLSA 3O26A 2IP1A 3NJ4A 4NONA 3AUTA 1GZDA 3SVTA 1XZGA 4JJZA 4M38A 4NMMA 1PP4A 5ESWA 5H3HA 3WJ7A 1MQ9A 5CVCA 3E03A 3KVYA 2ATXA 4FDAA 3EVEA 5EC8A 5KEIA 5J5CA 2LCFA 1HDOA 1IH8A 2XOKD 3BQMB 4MEBA 5LYJF 5IEBA 5DH9A 1X1TA 4BP9A 4J7CA 2JA1A 1LLUA 1RP7A 4K6GA 3F5QA 1C4KA 2HJHA 4GW3A 4X8HA 2CLDX 1NKVA 3CVXA 4XSGA 4M8LA 5HKLA 5LQNA 1ZMTA 1ZHOA 1QYDA 4BO0A 1GTVA 4CVNA 2XRMA 4L57A 4RV5A 1ADGA 2C7QA 4CEIB 1ZH0A 4X93A 4WW0A 1KC1A 3IIKA 5KKAA 3OPVA 3WRYA 2C4VA 4NDNE 4PGMA 5BNWA 5CA0B 2IH5A 1VIMA 2CC2A 3RYIB 1FLVA 1JJBA 4C7JA 3E8SA 1QE0A 2OBMA 1MP0A 4H4EA 2PU5A 5E38A 1RADA 1KEEA 5ALEA 2UDPA 5SY4A 4JGGA 5ENDA 3STUA 5HP4A 4YJHB 4BMCA 4OHRA 3V8BA 3HUTA 3BXZA 9LDBA 5IG2A 2QP3A 1UXIA 4J0FA 3E3NA 5GP1A 2F3RA 4D3YA 4UEWA 3LFTA 1SKBA 4FD2A 1RQNA 5DN6A 2WF7A 5ULLA 1U0OC 3UK1A 4YC7A 4XUGB 4ZGWA 1WDWB 3K9BA 3WTBA 4QBIA 1U3TA 5T4HA 3KOYA 1ZICA 1PS9A 2B36A 4UCQA 4NDZA 3OT4A 5T67A 2HJRA 2HC9A 3ROGA 3BVPA 4ABYA 4EKIA 1Y3AA 3CUEF 2NU9A 3Q11A 4KO4S 4B31A 3LX8A 4AKGA 3JQAD 1RM4A 3TGPA 3ZLJA 1JLKA 2QYSA 1GZ5A 4GP6A 4LG1A 4Y9UA 2RI1A 3F8WA 1OROA 4BP1A 4LMRA 2EEZA 4NBNA 4ZYXA 3BRWA 5JCJD 2IEGA 2OCIA 5A4DA 1JGTA 4L78A 4ZT5A 4GE0A 1C3OB 1R00A 1SBYA 3KPWA 2OD9A 4IL5A 1FYVA 3AY7A 4U6SA 2A5JA 4DJDC 4ZDIA 3T9CA 4Q6WA 3Q7EA 3T1VA 3ZYZA 4JLSA 3OTGA 2QUHA 4C5AA 2YQ5A 1SD1A 2ZRHA 3KSMA 5LB2A 1QR2A 3VR6A 4WESA 1P1FA 1NC1A 3IEPA 4ARVA 1MC8A 2P65A 4WJKB 1U3GA 1MO2A 3MWFA 4JY7A 3TQQA 2J5RA 1K1EA 1LZKA 1FPQA 1TAHA 1VCMA 3PQDA 3T3GA 2VCEA 2B3TA 5LPNA 1DJQA 3HFSA 1SIUA 2DWUA 4FMCF 1GLVA 2ZT7A 5DXFA 4TKVB 5C4GB 5KSYA 1T3LA 3DVAA 3AG6A 4JAVC 3RF6A 1J0XO 3FHCB 3S68A 4YMIA 1G17A 3ONDA 4QYWA 1HT0A 3ELYA 2NO5A 4LDAA 1SXIA 5K4HA 2GH1A 2IW3A 2Q0QA 3D5TA 2RONA 1L4HA 2GILA 4PPGA 3AJAA 4AJ9A 4CLRB 3KQTA 2QAGA 3ZIAA 3THWA 3FN4A 4YT4A 2J6CA 2VDJA 3QEOA 3ILHA 4RX1A 5JWHA 1ZD5A 1FFSA 2YC2C 4MO9A 2JLSA 1BXGA 1N3IA 3IV9A 1S3IA 5CLQA 2W6JD 4YRGA 5HGXA 2ZRBA 2IXFA 2G8LA 3G3EA 4OBXA 5HM6A 4FQ8A 1ZD4A 4UEOA 3TDMA 1MC4A 2G88A 2ZW9A 4HDNB 7ABPA 1N9KA 2QM8A 3P27A 3TQCA 2VHVA 4IDHA 4LZAA 1ZOIA 1QORA 2KW5A 3PT5A 4Q7KA 2ZZMA 2BTQB 2HA0A 1Z0JA 3RREA 2R6GA 4AUKA 1ILWA 3OTWA 1V39A 4FEEA 3N6RA 1IOVA 1OC2A 1WB6A 1Z3CA 4FW9A 3E1SA 1FUUA 4BO3A 4UU0A 4YJ3B 1W8IA 2ZWOA 3E3MA 3UAZA 3AF0A 2PT5A 2X9GA 3L7KA 1MB9A 3A28A 2O6HA 3G2OA 3PE6A 1WUKS 4HUQB 2FUNB 1ISSA 1UAGA 5IVKA 3KCNA 1YU9A 2P8SA 2XE6A 4MUAA 2WQ7A 1C7ZA 2X0NA 1H5QA 1HKHA 2X1MA 2JHPA 1IUPA 5CDHA 2QSZA 3R1IA 4YRRA 4MHTA 4DLUA 1T9AA 2PPVA 1K0FA 4V0NA 3SX2A 4CZ2A 5KYKA 3TFQA 2QL5A 2ZPTX 3CUVA 3ZDFA 4NFLA 4F7WA 2MYPA 1NQOA 1SD2A 2WJGA 1K7FB 3ST7A 2HV9A 2A1TR 3ZDEA 1GN8A 3GFBA 4N1AA 5M5BA 3WRXA 1MQSA 1A96A 3VPXA 4PG7A 3RRJA 3B7GA 1GM5A 1H0RA 2QDKA 4DANA 4URYR 4HQ6A 4PRLA 3OM9A 3FX2A 3VNUA 1P77A 3A9VA 2I8AA 3LUKA 4AKTA 1UBNA 4ZD6A 1W4AA 4JSRA 2GGSA 3N9IA 4DGSA 4DUGA 1QS0B 1LSUA 1PUXA 3TI9A 1KFCB 1V8ZA 1KJNA 2W11A 1JYFA 1VDMA 2HMSA 1W5AA 5B5SA 4P7BA 1HMYA 1IQRA 5E1OA 1LRKA 1J1ZA 1XOIA 3ZLBA 4KPUA 1N5KA 1NBHA 1OBCA 1KKLA 3MD0A 5BT8A 2XUFA 3WKCA 1KQPA 2OFFA 3LSTA 1M34A 4LQLA 4ZDWA 3TWOA 5J4HA 5KX5F 3TGLA 4D9NA 3DDSA 1G6HA 1RIFA 2F1IA 4H1HA 1V35A 3L7LA 1IXZA 2JCGA 4GSLA 4G8JA 3LO8A 2QVCA 4ZO4A 4G4SO 1LPNA 4U2EA 2ZXFA 1QG0A 1O6BA 3FYTA 3AI2A 4Q4HA 4F60A 2ZREA 4ZI7B 3VZPA 3VR5A 1U3WA 4GPZA 2HRZA 3HCRA 1L5YA 4BNTA 4TTQA 2HJVA 2OM6A 3ZX5A 1GARA 3DE7X 3LRPA 1T2NA 1TLTA 2D0IA 1P3Y1 2ODPA 2YUTA 3AGPA 1RXCA 3H5AA 4GECA 4DG9A 2FSIA 3B6IA 4DMHA 3WMWA 1RLUA 4A2QA 1O94C 1TKRA 2VYFA 1OYYA 1XVTA 3ROKA 1E9SA 1KOGA 2IS4A 2OP1A 3VA7A 2NPFA 4LE0A 1FNSA 1X80B 2DJ5A 7AT1A 3VZSA 1GUAA 1EEHA 1PK9A 3FFBA 3TRJA 3LQ2A 3I5XA 4MGHA 2CJYA 2NTJA 2OO3A 3DMTC 5HF5A 2G08A 1ULBA 3DCJA 3RQSA 1WCYA 2RHLA 4X24A 5H82A 4EJ2A 3EDYA 1CQPA 2OBNA 3DD1A 4OYRA 5F1YA 3F4BA 3ZV7A 2IXEA 1UMDA 1YR7A 1EVEA 2L18A 3SBXA 1N5OX 2EDCA 3V7FA 2Z57A 1N6NA 5JADA 1C7EA 3I2FA 3PXDA 2PWZA 4MYUA 1ZUNB 4WBNF 3GMTA 4XJTA 4NECA 3AOEC 3E5NA 4LV5B 3GY0A 4E14A 1FFBA 3RUAA 3VDRA 2GYUA 2RDMA 3MUNA 4YR7A 4HTAA 2G1PA 2N46A 6ADHA 4HFMA 5D6OA 4BJ5A 1P5FA 1HETA 5FA6A 3U4CA 4QU5A 3S1SA 3OQVA 4RFSA 1XZHA 1EVZA 1Z83A 2I9PA 3JQBA 3TECE 1BX0A 1YCDA 1XTVA 1YFLA 1E2MA 2JFVA 2BYTA 1SH7A 3CNQS 4FHZA 4JIMA 3UV3A 5D7NA 5HZKA 2W8BA 2QR5A 4S12A 1L7VC 1SUFA 1YZKA 2YJ5A 4RVFA 3IC5A 5AK3A 3M5WA 5EWMB 3CKMA 4IJ6A 1SVMA 4JL5A 3KJFA 2H2DA 3HN7A 5ITVA 2P75A 2R8BA 2BMVA 1CUYA 2J3HA 1DIOB 1KQOA 2Q0SA 2XNJA 3TJZA 2QGZA 3D2BA 3SZMA 4BLVA 4F3NA 4F6RA 4DIEA 1LB1B 3RR2A 5KREA 3ZBQA 3RQIA 2Q2QA 3TG2A 3RT7A 5BMVA 2NMVA 4GQIA 5AW8A 2XI4A 5LOVF 4B3SB 3R0QA 4R2LA 3PP8A 1UDAA 2JI4A 4P5EA 3H0CA 4MRPA 1WXDA 4PWYA 1FDUA 5BN3B 3PGJA 2G80A 4B35A 4ER6A 1A04A 1ZJ5A 3U3XA 3MCUA 3ZV6A 2C0QA 4KL8S 5TVKA 1J1UA 1PV2A 4RLHA 4LF5B 2EKZA 3HZRA 4D7AA 2ZUBA 2C3OA 1XA4A 3MSXA 3G1TA 4XB1A 4ENTA 1ZI9A 1EVQA 1UEXC 3HB4X 1ONNA 2EFCB 1IMJA 3E9RA 4C7OB 3SDBA 1B16A 1YQUA 1XKQA 2VDMB 2VF8A 1HTWA 2OO7A 2XZTA 1PZEA 2GZSA 3JATA 3PT9A 1NU6A 2P5TB 3S7ZA 5H02A 1V2HE 4H7EA 2KLHA 3LYUA 3JD0A 5C8YF 3CEAA 4MRVA 4OI4A 3MWGA 1QHHB 3IKMB 2H2GA 4D5EA 3VMMA 4UTPA 1PBTA 3TK1A 3HI6A 1JEYB 1FTQA 3E05A 5DP2A 2JLBA 3AI7A 3T7AA 1G41A 2OR3A 5CYPA 2OV1A 3DF7A 4L07A 3HYTA 1BJKA 2HCTA 1VA4A 3HACA 4JNCA 1M5TA 4UHFA 1BHJA 1N57A 2QN6A 4UVGA 1PKXA 2JEYA 1QRDA 4J2OA 3IQZA 4HQRA 4FB5A 3LO5A 1UK9A 1CP3A 2CWDA 1KEUA 1KI8A 4XWYA 1YFZA 5DVZA 1IN4A 3DT8A 1H0SA 3OUTA 2X58A 2C8KA 1B93A 5T4BA 3DLAA 1WDKA 5E7JA 4X6XA 5HE9A 5KB3A 2WB2A 3WSVA 1DUVG 3LHKA 5EJ6A 3NETA 3F5DA 5ES3A 1WL8A 5C46F 4ZVUA 1TQDA 4C01A 4BZZA 1QRTA 5BMOA 4GYWA 3R6GA 1ATIA 2AVNA 4O4JA 4BGDA 5JC1A 1XDGA 2ZG6A 3KLPX 5FBWB 4OHKA 3OX1A 1OFUA 1NF3A 2CL7X 1XMSA 1KYVA 1LBQA 4WLOA 2H1VA 4P4UA 2O7SA 2PJUA 2R8YA 1TEHA 3N86A 4CMKA 1AGXA 2HV8A 3DBLB 3DT6A 1SKYE 1SXJB 3QU4A 4K5QA 1WNTA 2WV9A 3TZLA 5SICE 4RL4A 1Y5NA 3SICE 1URPA 3SOZA 3UFXB 5BR4A 2X8JA 1SCBA 2Q1XA 1T26A 2GKOA 3DEZA 1HYGA 1JR3E 3OQIB 2ODEA 4JH0A 4KN9S 4BFSA 1CWUA 1OLOA 4DCOA 3EUEA 3LUBA 3MELA 2H1WA 1S01A 4X8MA 4DLYA 3VYTB 4W5OA 5LQKA 2GEJA 3CRZA 5TNXA 4EQZA 3SHQA 5HQTA 5I9TA 1ZL2A 4OUDA 3B6KA 1B42A 2W58A 3UJCA 4WNCA 1L7QA 4FC6A 4BPRA 2V6IA 4X60A 1OOEA 1B1CA 1AZTA 1VYUA 1ZIXA 3LT1A 3WGTA 4HH3C 3K20A 1CJVC 2PCJA 3AF5A 1M1YA 1RRPA 1KF0A 4LY3A 2EV9A 4YXWA 4DLKA 1E1KA 1NVUQ 1VL1A 3PIDA 5CYGA 5KOJA 1QGOA 2I78A 4F3YA 3Q72A 3HXTA 4PX3A 1HQYE 1U9JA 4FKBA 4RVDA 4OM7A 5TB5A 3WGOA 5CDFE 5AWFC 3I3OA 1S1MA 2G9QA 2CW5A 3SZ3A 2QEQA 4E2YA 1Y6RA 3RIYA 2CSUA 4KIWA 1I5EA 1NA5A 5JNLA 3COVA 3JASA 4RH1A 2X8BA 3GEPA 4IJWA 3RJZA 4BMOB 4ML3A 5FAKA 5GAJA 1XO1A 5JD5A 1LSJA 3NXKA 4OB6A 1A1SA 1TD9A 3AEUB 4HX9A 2X5JO 3RVQA 1DB3A 4Y2PA 4LBWA 4MRAA 5SY6A 2HOQA 2QTMA 2ZBGA 5K51A 5LB4A 4CM9D 4EFDA 4FPXA 1T29A 4KACA 4RIIA 2R9VA 3KUCA 3EZGA 2IFTA 3N1UA 2WABA 2V97A 4RDHA 2B78A 3NWBA 2CJPA 3DKIA 1HBJA 1S3GA 4AJLA 4S3MA 4CCYB 1DPFA 2YVQA 1HT3A 2FPRA 5B7NA 2G0NA 2H5JA 3MXOA 1NBMA 5BN5B 2EYUA 4CNBA 1GRVA 2QX8A 1JECA 4FDLA 4RVOA 3RSQA 3QVUA 1WPXA 1F7UA 3CX7A 3WLAA 3CEJA 3HB7A 2DPXA 2E37A 3MAGA 2AFIE 2NP6A 4KMRA 3L49A 3NAQA 2ADMA 4N7JA 2V6FA 1A3CA 3B1FA 3BMCB 5L51A 4IQ0A 4KJZA 4B7AA 1X70A 1RNLA 1NJGA 3CMCO 1VIAA 2F62A 4R0MA 4DTIA 3EQZA 3OJFA 1ZBQA 4H2DA 4ZK6A 1KFEB 3PJDA 3C1UA 4P92A 4UNNA 1Z7EA 5IP5A 4LFBB 4KQJA 4TUYF 4H16A 1RWWA 5E4YA 3R2JA 5JXHA 1ZR4A 1PRYA 4Q18A 3ZZTA 3PHIA 1MV8A 4QYTA 4AZSA 1RAIA 3MCWA 4ZN6A 4AWAA 2YJNA 1Q3KA 3H6GA 4OGLA 2Z2YA 2Q3DA 2IU4A 3OJCA 3OE4A 3GVXA 1W4BA 2RC5A 4LGMA 3AZQA 4F4DA 3AQIA 1GCGA 3ZWAA 4TXHA 1ADYA 1BQEA 4H1UA 2Q62A 1U8FO 4WUTA 5JSZA 4CI0B 1AG9A 3NTOA 2X77A 1W0JA 3WDKA 5A5FA 3DR5A 1PTJC 2IF2A 4ZOAA 1AC5A 5EHIA 4ESHA 4YA6A 4D42A 1VKHA 3HNRA 2PKQO 2MDTA 4P80A 5J9FA 5HW0A 4KBGA 4DXDA 4GP7A 1BMFD 3E7XA 1ZH4A 3KHKA 1WOMA 1MJFA 1FTSA 4JJFA 4GKBA 1D7AA 1Q0TA 4XVHA 4OA5A 4M54A 1U2GC 5EWJA 4ZJUA 1UJMA 1E9EA 4YPFA 1V7ZA 1FW8A 2ZYSA 2V4UA 4Y1GA 4J3NA 2PX2A 3UHAA 3VR1A 1P4HA 4ZU1X 3KQOA 4FN5A 4C0SA 2VP3A 5DV9A 1M33A 3VR3A 2FKAA 5IX8A 4DT1B 3MNFA 2PR7A 3KXIA 3TAXA 2LNDA 1T2DA 1EFRA 1Q22A 2VRWA 5IHXA 4NV3A 2DQYA 3THXB 4CR6A 1PT8A 3MQ2A 2BFFA 2F2TA 3TLYA 3KIPA 4RAQA 1M6VA 2R66A 2I2CA 3A1FA 3O8DA 4JB0A 1DDIA 3V8NA 2CXNA 4OSEA 2JG3A 3QMMA 1Z4PX 4JITA 2PGNA 3KZXA 1M1YE 3BPSA 4WCFB 4OFXA 1Q0RA 1XD8A 1ZJZA 2FRDA 3N3BC 1R1DA 3ITKA 4O4IB 2CFOA 4EFLA 2XOEA 1BDBA 1PU2A 4MJLA 4G0WA 1QG6A 1V7PC 4NYIR 4C7VA 4JZYA 2Q5EA 3NBYC 4IDAA 3ROTA 3E3LA 1ZESA 3DHNA 1WV1A 3GJXC 4LJLA 5THQA 1C3EA 2YNMA 2DT8A 3OETA 4DLNA 1RRFA 5HXAA 1R0SA 4H7JA 3KZ1E 2A1UB 1NSTA 5FV4A 1P2SA 1VB5A 4UTXA 3TD2A 4CQNA 3VYSB 4C0AC 3JVDA 3ESQA 3V7YA 5IAOA 4BAUA 1EHIA 2XXAA 2O8DA 1MO5A 3ZQJA 1QTQA 3ADKA 2P4EA 4A23A 5FPYA 4NICA 5KYUB 1U2EA 4P0TA 2ZSDA 4JP3A 4BVKA 2G06A 3N7AA 3BMNB 1KMQA 1EM8B 4H3SA 4K9RA 3JYHA 1EWYA 3H11A 3O83A 5E6SB 3W8EA 3U7HB 1FUYB 3BMOA 1A2QA 4B5KA 4JBXA 3QA9A 3OZUA 5BO5A 2JFWA 1YJQA 3T9BA 2PIDA 3NHSA 2OPBA 3FGOA 4KLRA 2PY6A 3EF0A 3D3KA 4GI1A 5LL6P 2VJOA 3EG9B 1QO0D 2YHUA 3ISJA 1D0SA 4DCTA 4E33A 2I66A 4Z3KA 5IT0A 5CDTA 1XHEA 5IC5A 1EDZA 1P17A 4ZAGA 2GM4A 3KDSE 2R8EA 3T1TA 3EMBA 1EBFA 3MAAC 2AB0A 3G8BA 3LWBA 5DFAA 3TG8A 4Q1VA 5JS7A 1RBZA 1XROA 1K6XA 4YRAA 2VHUA 1OHHA 1XMVA 3UGKA 2V4MA 1A2BA 3CU5A 3LTEA 4LNUB 2EZ9A 4WE3A 2V55B 1YFJA 2X15A 2XCUA 2IHKA 1Q0HA 3S1LA 2GTIA 1H05A 2NYUA 2XCTB 4TXNA 5AW2A 4Y2UA 4C76A 3U7IA 1XTRA 1R5JA 2PJDA 2Q28A 4L6CA 3TTSA 3BSFA 6AT1A 2IH4A 1K2VN 3B1VA 5K4AA 3D8TA 4HAWA 4FDTA 3MTEA 3A1UA 1ZU4A 3IAEA 1F6WA 2XWSA 4H6VA 1OGJA 2Q2NA 2G3YA 3PUIA 3QVOA 1NPYA 1C9YA 1IC6A 2O7QA 1CIJA 1V1MA 5DSTA 2JJMA 4GZMA 4H3VA 2Y6UA 3ZGNA 4DF3A 5I48A 2PVCA 3CZ5A 1NY5A 4UBNA 1TYZA 4Z99A 1AXGA 1KS2A 1I30A 5T3UA 3W4IA 1GSIA 5JEDA 2QRKA 3W79A 3O8OA 1QONA 3N0XA 4V1CA 1M6YA 1MABA 3DV2A 2G9NA 3ZCSA 2EKQA 4Z4FA 3IOYA 1HGXA 4BMDA 2Z6AA 1TU4A 4FWBA 1RU3A 2DPGA 2TMDA 4OREX 2E5LB 2A84A 3OICA 4HRAA 4ER7A 4LF8B 1CQJB 2RB4A 4IQ8A 3M6XA 5DNCA 1KO7A 3ON5A 3R5JA 4ZJYA 1BO6A 3L8HA 3CVOA 3T4PA 4EY8A 1OREA 1QIFA 2YRFA 4G3XA 4HWOA 4EYEA 2FUEA 3UH1A 1H3EA 1SURA 3EK2A 2V7BA 3AP1A 3Q4GA 1ZINA 2EC5A 3JQRA 4JASB 4ZVRA 2HMTA 1N8TA 4UXIA 2I6UA 4G56A 3SZOA 3CGWA 4CDGA 5ALDA 1UXKA 4XQCA 1NAHA 1KFBB 3BK2A 3PEEA 3H1GA 4OKSA 4UAUA 1JDPA 1U4SA 4C4TA 4YUVA 2BGTA 2BEWA 1NV9A 1HDEA 2EFYA 4ILKA 5E6UB 1JDNA 3I4LA 3GGSA 3RB8A 2Q29A 1CXZA 4KUHA 1PT6A 1XK6A 3IP7A 1PQPA 4PNPA 3T95A 3GHHA 2YC4C 1BXZA 3VNQA 3S8EA 4O3MA 1EQ2A 3RJ5A 2QYTA 1OW3B 4UKDA 3FCUB 3R0XA 4PPNA 1OT3A 2EKBA 5FPPA 5IM5A 1E4OA 2OGWA 2K6GA 1HXHA 2NNLD 3IRUA 4YJ3F 4JD5A 3PHLA 3R5FA 2GJ4A 3E3OA 4OATA 3Q41A 2X76A 4J6FA 4K8RB 5A1JA 3K1JA 3ZV3A 2F3UA 1CPYA 5JYBA 1QCCA 1YK0A 4KOEC 2XTZA 1MHTA 3WYDA 4M6WA 5BQ5A 3STHA 4LJRA 2CFSA 1E5VA 1ECLA 1SXJC 2UZ3A 2EJBA 3OM1A 5CH3A 3HM9A 4V2IA 4YJGB 1MR3F 4RF5A 3I9V1 5LDGA 1GZUA 1TD1A 2ECOA 1HWYA 3MWEA 1YZHA 2FZLA 1EQUA 2OXCA 2ZQ5A 4MUKA 3U40A 3R9WA 2DF8A 2Q4EA 4PTZA 4X7PA 1QFYA 3IVXA 1KH1A 4F96A 4Q9NA 4Z0TA 4D92A 4NR0A 2QTHA 1XJ5A 2RHCA 3FPJA 3P0JA 1J8DA 1PS0A 3E48A 4S0XA 5KNBD 2CBGA 4G2TA 3EXEB 4WHMA 2XUQA 1G3RA 2RGDA 5H7XA 2J3EA 3NOXA 1NMEA 2FN4A 2CXTA 1TNDA 1HSOA 4V39A 3WLQA 3N2LA 5ALQA 3RTBA 4AZ0A 5F2NA 3BXFA 2KJQA 4G63A 2PFKA 5FNVF 2QVXX 1MB3A 2Z8XA 5D01A 2E49A 3GNTA 5DNVA 3FA2A 5CLJA 2FFHA 1L7PA 3A0UA 4HDSB 4M0MA 3UJ9A 1K3UB 4KG7A 4HUJA 1MENA 2WPNA 3CLRD 3WFZA 2QQ0A 3SC2A 4J7XA 5JYCA 3IQEA 4H9GA 3TR6A 4EO4A 3FVTA 2H7XA 4B33A 1E4EB 3E2IA 4R2JA 1QIKA 1VLHA 3U4QB 2ZBFA 4ZI7F 4M49A 5AW5A 3EW7A 4NBTA 5G1OA 5BV8A 4LPKA 5COBA 3MUOA 2H16A 4YVFA 1MDBA 5AKHA 3KOWA 4INJA 3ENQA 2IU0A 1DBRA 4EMBA 4YJFA 4COOA 4NSNA 3WS7A 5CJPA 3H5WA 1KDYA 3TM5A 3QMVA 3BFXA 1NMSA 2RKOA 3OQJA 2CB0A 1YJCA 3FNBA 4O5AA 3FYHA 5F2EA 5MN6A 2A4KA 2ORIA 2JLCA 1KK1A 3GP3A 4YP7A 5KIAA 1APBA 1JIVA 1K06A 2Q1UA 3CRRA 4OB8A 1F8YA 4RZ3A 5ALKA 5HK8A 2QB5A 4C06A 2FZGA 3DD5A 3RS3A 4B83A 5A6SA 2XPCA 1MW9X 3EPKA 1P8JA 1JLLA 2NZYA 5DEIA 2OYRA 5AVRA 2I33A 2O7VA 1WPRA 1DVRA 5I3ZA 4BDTA 1ISIA 1H3NA 3GCGA 3KSDO 5EJGA 5LQSA 3D4BA 1G5QA 3IVRA 4WKPA 4ZEXA 3INTA 2B5OA 5AI4A 4KFSA 3QFTA 1NVKA 2H63A 3W7VA 5CNJA 2WAOA 3M1YA 2A78A 1IBSA 2B6HA 3CRQA 3KV3O 4MW2A 1PX2A 4MZDA 3VPHA 3WWZA 1WCV1 1TUIA 1E89A 4Y18A 4A10A 1YHZA 2FE4A 2QNBA 5TQJA 2C4MA 1PQWA 2P9CA 4NENB 4C29A 3DZIA 3H2YA 3TGWA 5LQMA 2H4HA 3C7AA 3B6EA 2ZDQA 4AJEA 1GNRA 3SOPA 4C3OB 2IOFA 2IBSA 1W88A 4S2EA 4NZNA 5JC8A 4GMXA 3BXXA 5E9WA 2TSYB 2IEAA 3KKZA 4ONEA 1XTSA 3GWZA 3D3WB 4PC6A 5HFNA 3CH6A 5F1PA 4AS3A 7YASA 2NT4A 5JS6A 1YRBA 2XKJE 3PFBA 3GK3A 2JKYA 2IYFA 1ZWKA 2A9OA 2J5QA 1RKUA 2PAFA 5CT6A 4YECA 1PLJA 5F76A 3SKVA 5BSWA 2AW3A 3A6JA 2IPNA 3UWKA 1A9ZA 2WU8A 3WGMA 3FCYA 2I6QA 2DBYA 2CV1A 3ZK8A 4TYQA 5LCXA 1KJWA 2R48A 1FNBA 1HL3A 1J5EB 1FS5A 3GJSA 3KLOA 1E0KA 3MILA 2EX4A 1FLDA 1P62B 1TLFA 2KYRA 3H16A 3TIVA 4F0JA 1GZ4A 1UZAA 3O75A 4EG4A 3OQ6A 1W85B 3VH4A 3DXZA 2HRCA 3JQCA 3HDQA 4MWDA 4DYHA 3GLFB 4MIEA 5J23A 2X0IA 2P9QA 2OSVA 2P9EA 3OP4A 1RC1A 2WJYA 3IIEA 4MKRA 4AN0A 1L8QA 4UM7A 3K9QO 3ZU4A 3VSBA 2R1VB 1XPUA 4X3OA 4D6XA 1DKLA 2YWCA 1H2ZA 1QZTA 5TPZA 1QTIA 3ZOZA 4TWIA 4MQMA 2WAMA 3LXXA 3DWEX 4XIIA 2XCQA 1MB0A 5CX4A 3EGIA 1ACLA 2QRMA 2ZT6A 2X7XA 2R6CA 3LDAA 3KTDA 1SHUX 3K5PA 3H2KA 3RYCB 2CHQA 3UAGA 3EEIA 1TXGA 1YKFA 2IY9A 1V8OA 5L7YA 4QU9A 2P68A 3KJGA 4PO9A 5AH0A 5DBFA 2A1IA 1JMYA 4C4XA 1E7WA 3VX4A 2OZLA 1P75A 2QL9A 4KWIA 4X7BA 4GI5A 2VN8A 2WE7A 3HB0A 4WI1A 2LKCA 1MVNA 4XR4A 4JI1B 2F1KA 3SIRA 1Q1EA 3QU7A 3H8VA 3O8CA 5K4GA 3OWOA 1UXHA 3N2YA 3GGOA 2VPTA 4H7HA 3VR2D 1DARA 2G04A 2IS6A 4ZZ2A 2JIPA 2NYRA 1THZA 5EG5A 5B1SA 1EDBA 4FMDB 2ASVA 3LP6A 1FQWA 5ETJA 3TZHA 4FFRA 4JVMA 2FU5C 2XD9A 3G13A 3OZCA 1M67A 2YOGA 4H6XA 3I23A 1W96A 1BE6A 4Y6GB 4C4OA 2Y1OA 3TINA 5ENZA 2OCGA 3WRVA 5CD9A 4K0KB 1TQ6A 3RSFA 5CEJA 1V26A 1SB9A 2IVFA 3TI7A 3K09C 2NSDA 4E5NA 2YX1A 4IEFB 2NP7A 1B8NA 5EE9A 1UFRA 4KLNA 5CM9C 1QU3A 4JMLA 4DPLA 1NVTA 1YKSA 1N2BA 3ORYA 1P7WA 1AGRA 5EIXA 1Y82A 1UPFA 4NE2A 5DM60 3ZHQA 1UBRS 3HJAA 4OH7A 2QLMA 3IBGA 3EGDA 5EE1A 1K92A 2ZR9A 2AA3A 3AKCA 2B7CA 5COQA 1C3VA 4Q82A 3T7JA 4HDKB 1IY8A 3OEHA 2HUPA 4QBHA 1Z88A 5HPYB 2XB4A 2FMFA 4ZZIA 4XWWA 4TVSA 2XMGA 3GFTA 3M6UA 3PGLA 1A5BB 1MT0A 3R23A 3BTSA 1BN6A 3SX4A 4F8YA 2P1DA 2R4QA 4OPMA 2O20A 1T8PA 3M70A 1C1HA 3KLBA 2HHCA 3SYKA 1Y8QB 4XCVA 2O8FB 4LCJA 2PKRA 5FEMA 3GUZA 3RC1A 3VOBA 3ZWBA 4BP8A 1N7GA 4E4RA 1M2OA 1O08A 3FBWA 1DO0A 3ETCA 5JS2A 8OHMA 1U2PA 1IU9A 1TC2A 2X8AA 2JFPA 1J24A 5PGMA 4UM9D 4DEVA 3VKHA 1X9HA 2PX5A 2ZE6A 1J2TA 5IARA 3WP0A 1E5QA 2F1JA 5HUJA 1KE2A 1AKRA 4YMWA 2V6GA 3FSJX 3EDRA 4KN6A 2H1RA 5KU1A 1ONBA 2IDMA 4X6UA 3NP9A 3OLQA 3RVBA 3WYEA 2WFLA 3IS3A 2L42A 1L5RA 1WXXA 2PQ0A 1XWWA 3H75A 3U1VA 1EXMA 5LQJA 3KR1A 4DREA 3AH8A 3ZWKA 1KY2A 4GX5A 5ES4B 4YX9A 4P93A 1G21B 1JWLA 3CV3A 1C3XA 3MF4A 3TLMA 2HLDD 1FMCA 2PUJA 4LEIA 1OLSA 3V1LA 4YT8A 4NBKA 4NU6A 4A5OA 5JYDA 1H9CA 1Z5NA 1ZXLA 3THYB 3KKMA 5CDYA 1XALA 4G84A 5ISMA 2QSUA 2CLKB 3DLBA 1T8RA 2R84A 3LDHA 5IVPA 4KHZA 1VSUA 1O94A 3E22B 3FDZA 3V1KA 4FGZA 5KQPA 3QXJA 3S7TA 1C30B 2NZUG 5LC1A 4I9NA 2W70A 1EYZA 2Y0CA 1Z0KA 4ZYZA 1KY3A 1L8OA 2YXBA 3K31A 4ZHSA 5C9ZA 5ALPA 1VJTA 1PWEA 4Z7OB 3OEYA 5JSQA 3OT1B 5DSXA 1IN8A 3CR7A 4PO1A 5EJ5A 4ECEA 1BH2A 3OUUA 3IEMA 2IEBA 3GEBA 2CF5A 3FOFC 1BVYF 1T5IA 1IN6A 5EGSA 1ZSVA 3FDFA 3INGA 1NSYA 4ZWNA 1YOVB 4UHDA 3AOEA 5JVDA 3H5TA 3DJYA 4Q1AA 3TNDA 4AIRA 1YZUA 3EJWA 3ND8A 1YWGO 1IBMB 3IT2A 1ZR2A 2C9DA 3DONA 1T2UA 4OD0A 1H22A 4U9IS 2WIAA 1X1DA 1Q95A 2QSJA 1VBMA 3PNVA 1UJCA 4UUMA 3NNDA 1YZGA 1Z6PA 4NZMA 2IIPA 2OQVA 3W6PA 4QSMA 5I7AA 1UC8A 1G42A 2O8CA 3RS2A 1AKMA 1XFAA 2QR3A 2RGYA 4RZXA 3FGZA 1HFWA 1JFFB 1RWKA 1E6WA 4F91B 5MF6A 4XX0A 4J75A 1Z7GA 3M4JA 1AZWA 5K8LA 5F35A 2DLCX 3LYLA 2BFDB 1PJ3A 2ZYRA 1H0KA 3EIWA 1SUCA 2HGZA 2O0MA 1Z68A 5JW6A 4J29A 4OP1A 1W5EA 4KQGA 2FG5A 1V8BA 2NG1A 2FGKA 4Q1EA 1YBHA 3E1KA 3EISA 1EE9A 1GZSA 2HZ7A 5EYPB 5KWEA 2P9TA 4F7DA 1ZHFA 3IEVA 1SZPA 3ZE0B 1Y4ZA 3C85A 3AVYA 2QN9A 3B8EA 1WUJS 3RVJA 4UOEA 2O1EA 1Y33E 3QW4B 3EVCA 2EJUA 4KVAA 5CM2Z 1I94B 3GD7A 1L1QA 5JXIA 4QM7A 1FFDA 1I51A 4GMFA 1SOVA 3EGXB 3KTAB 5E1MA 4RH3A 4O4IF 4ETIA 1RI2A 1Z62A 4P0PB 1E2JA 2VJNA 4UC0A 3KETA 1N2HA 2FV8A 1NE7A 4J94A 3RTEA 1XF1A 3REFA 4BNYA 1CZKA 5JARA 4GR5A 4KI7A 4PAOA 3LC2O 4AB1A 2A5YB 4H7KA 3VUEA 4AZ3B 2I3GA 2J5KA 2V74B 3DZDA 3MRSA 2ACVA 7ADHA 4J76A 2D5IA 1Q0ZA 2JB9A 3NDRA 4WTOA 5EY5B 3PLNA 1P29A 4BUJA 3HADA 1NXXA 4XM2A 1V8FA 1AZSC 3SHWA 4Z4CA 1VRVA 2JEOA 5CLIA 3LKBA 4N6NA 3UK0A 4LBYA 5KTTA 5K6TA 3ZZMA 4Q1DA 2QW1A 3RAJA 2GXUA 4PIPA 4P98A 3E5HA 3HSYA 5F3DA 1Z4IA 1E2EA 2HWWA 3SS8A 4DA0A 4Z8YA 5MFPA 3W77A 5JAUA 4CTKA 4BNJA 1SK8A 1TL7C 2Y0BA 2BM0A 4Z4IA 1N6OA 3H4MA 2BSXA 3G89A 4HPJB 4DCNA 5FBHA 2XX3A 3D6HA 3U4IA 2QMQA 1NL3A 4CEIA 4DMLA 3KKEA 2XWQA 5ECYA 3ANMA 3RSZA 4UM8B 4E3WA 2VP5A 4OBBA 5CA0A 1U3VA 2J3MA 2C2OA 1GGEA 2QPTA 3OJ0A 4PZ0A 3RIMA 1DIBA 1DAMA 2NUPB 3BWDD 3I6ZA 3RYIA 2AUMA 1MJGA 4WK6A 3LY5A 4EYSA 4B43A 2IP4A 4YJHA 2YV4A 4LOAA 2OOSA 4GOKA 2D0PB 1E7QA 3UJAA 521PA 2E6KA 2PRKA 3FTPA 1XZLA 2FFBA 4OXYA 1DQPA 2C7OA 1I3CA 5HJ5A 3ADBA 2HT1A 1CW2B 1CZOA 2AZDA 1V5WA 2O2YA 3A4IA 4TWZA 4XAQA 3V2GA 4EGAA 2VPQA 1ODIA 2QRLA 4M98A 3AFHA 2AX4A 2YFQA 3CLVA 4ZDJA 2A1TS 1J8FA 4RVUA 2PTGA 2BI7A 3CLTC 3HYCA 5KSZA 3WNCA 4ZPXA 4P36A 4PZLA 1NOJA 821PA 5KNDA 1CULC 4YH1A 3E9QA 3UJ8A 4MVJA 4NF2A 3HTXA 5CNIA 5FTKA 3RRYA 1GAEO 1AHHA 1KI6B 6YASA 1JHUA 3HI4A 3GJ0A 1K5GA 1LQTA 1USUA 4M89A 1KI2A 3FYCA 4A2PA 3UXEA 4B7CA 1C3OA 4CWAA 3G0HA 1ZZEA 2YIVX 1V16B 2BMJA 4MVXA 4D9IA 1TX4B 2W2NA 3ZKWA 1YMQA 4HWPA 3PUWA 3T6KA 1FU7A 3ENKA 4XWAA 1LCIA 1VC2A 2WDZA 3C16C 3OIWA 3KSUA 4GKAA 3JAKB 2WKRA 2VQ3A 2VT6A 3CQ9A 3KVVA 1XPRA 2CK3A 4CIAA 3A4VA 3WIOA 4E5DA 1GADO 2CUNA 3AEXA 4JHXA 3TPCA 4K6MA 4MR7B 4OHMA 4UTRA 4M87A 3UHFA 2TS1A 4CG2A 3MD9A 4WVFA 3HGQA 1MGPA 1E5LA 4TKVA 5BW8A 3DL7A 9LDTA 4PPFA 1E3WB 3OLWA 2C2HA 3P9RA 3G9ZA 3GJ8A 2FEKA 3AESB 5CLGA 3N0VA 3W8RA 2PKEA 1F8FA 5C7IO 4KU4A 4UU7A 4GMHA 2GAJA 4CLRA 3FMPB 5I51A 5ALMA 4DZTA 5IM4A 4RPIA 4OJMX 1PJQA 4ITRC 2Y0EA 2QRQA 2NO1A 4F4CA 1WVMA 3LJKA 4D9GA 4H7PA 3SJZA 3O47A 4EW3A 2P77A 3UJNA 2HLNA 1GZHB 4F9EA 4ON9A 4QATA 4B6JA 3MRXA 4HAZA 2ATCA 1P0PA 3L0DA 1Z15A 3LVBA 4HDNA 2ZJ3A 2I4TA 5FPSA 2BBSA 2NLOA 1ATZA 3HHPA 1IBKB 3F6PA 2WRZA 1E8DA 3FDJA 2BTQA 3NHKA 4UDOA 4FHCA 3QV1A 1DXQA 1CZNA 4V03A 1E1LA 1HEIA 2ATVA 3EMVA 4DOMA 1IOZA 3OAAA 2VWHA 3R5HA 2V7PA 3O84A 4U8HA 4EUHA 1PNTA 1VJ1A 4G5OA 1P0IA 1KC3A 2ZBQA 5THKA 3V4FA 5JNSA 4Q5IA 1FDRA 1M8KA 1JHQA 2C5HA 3IP9A 5JQGB 2HSEA 4LK2A 1OR8A 2ZKIA 5ESXA 1XKLA 2PVSA 2XNDD 2XEXA 1F4VA 4FJ2A 4FVTA 3ZHRA 5B7GA 2O23A 4EHBA 5TS2A 2DSTA 2RH8A 2YJTD 5CAEB 2HHAA 2HBYA 4G0UA 4KNVA 1KI4A 1XAGA 3HCDA 2G9UA 1RQGA 3LF1A 1N2JA 1Q83A 3QKIA 2R2AA 4UXJA 4KOAA 3VNAA 1NR1A 2GA8A 2XBLA 4G36A 1UK6A 2BW0A 1VJGA 1ZH2A 5I7SA 2AHRA 3G59A 4HVTA 2VXOA 3CZQA 1YGPA 4KPFC 3QXGA 1N5IA 1QF7A 2D1FA 3VU3A 1JG2A 1W73A 4IVRA 1N8KA 3QUBA 4N8SA 5KOYA 4HQLA 1YVPA 3GIDA 1JKMA 4NTZA 1QS0A 3T3NA 1HZZC 1Q11A 2Z2XA 4HUTA 2FSUA 2C4KA 3B3FA 1RLIA 4Y6QA 3Q88A 1XHFA 4K9NA 2PNJA 4BE4A 1HI9A 3AHJA 4KAFA 4IUDS 4UMDA 3AL2A 3QW2A 3NMUF 1QCYA 2J41A 3G17A 4N3BA 1CB7A 3UO8B 4YB8A 5TMEA 2C9ZA 3EXIA 1G0NA 1S8FA 1W30A 5ALTA 1L6RA 3MWDA 1YV9A 1ISGA 1I2DA 2HK9A 1KZHA 3DEHA 2WD7B 4S04A 4XEUA 3PKZA 1WUYA 5J43A 3A1CA 1Q3TA 2PGOA 3O95A 3PFIA 3WHPA 1MCZA 2GKGA 2XVXA 3NLLA 4LHZA 3A4MA 3SS7X 2GN1A 1MEEA 5KYYB 5A4MS 4IV5A 2JRCA 3P0HA 4Y2QA 3SNHA 1EE1A 4IJKA 1L1RA 3R4VA 2IIBA 2WAAA 4QUIA 1S89A 2QZSA 1JZSA 2AJCA 3F6CA 4CCSA 1HV8A 2IKQA 3BREA 3VI4B 4F06A 1G5PA 1MN6A 1II8A 4BAZA 3LHSA 4RK4A 2W2LD 3QSGA 4UUOA 1NQUA 1EHYA 1V7QA 3AB3A 3HYLA 4JC4A 1GCUA 3OHPA 4LC0A 5BQFA 2DBQA 1WZEA 4D0SA 1ECGA 4RFLA 5TGTA 3WLSA 3LL4A 2O8VA 3AY6A 4I4CA 3UJ3X 3A1TA 3WBJA 4Z49A 3SIPA 4RWEA 5DNDA 1XDWA 4BWFB 2GBLC 1MQ8B 3GQBA 3U9LA 2WTNA 3WLEA 4TXLA 2X6RA 2G1AA 3L7JA 3FMOB 5A0FA 421PA 3BKWA 4WKGA 2DT5A 3PX2A 4HKTA 2XTAA 3ONWA 4QYXA 2IK8A 4BNZA 2BFAA 3L6UA 4JXJA 4PHCA 4CKWB 1TE2A 4NV0A 4S1VA 2JAXA 4NYMR 1IHDA 4RDXA 3QPUA 3FKQA 2DEUA 3H0KA 1SWWA 1JAYA 3GG2A 4W9RA 4ZU6X 3WB9A 3WV5A 5KYWA 2C4WA 3A37A 1J97A 2ZJ5A 1AM4D 2IUTA 5TXGA 2F43B 3DVRX 5EQFA 4FQ5A 2PV7A 2YRXA 5CG1A 1JDTA 1VL5A 3OG9A 2Q4OA 3PFGA 3A3PA 3GAMA 4S0ZA 3W5IA 5K0EA 1EDOA 3AVQA 5DBGA 3TLZA 2QJTA 1QR6A 4WKNA 3DCYA 1ZQ9A 1XVAA 1L4MA 2FOIA 2JI8A 4DIOA 4BVJA 1QH8B 2H9IA 1Z2OX 3DLHA 4C0QC 3DOJA 2GNOA 3DO5A 3AWIA 2GXQA 3ANNA 4Q34A 3ELUA 4RPCA 5EWMA 3HL0A 5F51A 3TW0A 1A8IA 2OORC 4U9HS 5B1HA 1K7XB 2XRZA 1TVEA 3EAFA 4UHBA 4M7WA 3ER9A 1WZUA 1X1BA 1ZUIA 3JW8A 3LFUA 5A7GA 1OGYA 2IJGX 5JT1A 2XJ9A 2ZUUA 4DWWA 2FEWB 2RFLA 4JLMA 3WSWA 2Q4DA 5LWHA 1YQEA 3I72A 1BKDR 1UWKA 2J5XA 3IR7A 2BGKA 2EBUA 2R68A 4K0RA 3CZ4A 2TMGA 3DEJA 4E5YA 4YV1A 2B2XA 1NLZA 3RT9A 3EODA 4D8WA 4KPGA 3PS9A 3QNWA 5JTTA 2Y68A 1H2AS 3MWJA 1P3DA 1RAAA 5I4IA 3GLGB 3PDJA 3NEJA 5JAPA 1PE0A 5C80A 4RGQA 4I6JA 5AW9A 3VZQA 2BF7A 4IZOA 1K98A 4MW6A 1V96A 4C30A 4XWGA 4M9ZA 4JQCA 2H7VA 5HCIA 4PRZA 2WVGA 2HU5A 1ZD2P 5KSOA 4L5IA 1D0IA 5FLYA 3RBXA 5C5IA 4RBNA 3PLRA 4BX8A 1BAPA 1TJNA 3G2MA 3L8ZA 5DTMA 1JUDA 2P9BA 3B2EA 4C7OA 1SU8A 221PA 1NN0A 3Q7RA 4L85A 2HJWA 3DDZX 3UYKA 3NBAA 1XU9A 4JMPA 3A9RA 1RS0A 4ARZB 1ULUA 3S3TA 4DSAA 3KUKA 1O1YA 4G2NA 4NQRA 3F2VA 1QHHA 2FEMA 3WNVA 2CYBA 4DHEA 2W7TA 1ECBA 3DCNA 1JEYA 4GR9A 3V7UA 2V7XA 3KKPA 2HMVA 1FL9A 1C3JA 2WF5A 3SEZA 1ONOA 3JD2A 3EAGA 3ESYA 2R11A 3GOHA 5DRYA 4WDQA 1UQTA 1CUZA 3RS8A 4FYHA 3U4AA 3X1MA 2DOKA 5C5EA 2FDCA 3AVTA 2GHRA 4R1SA 2OCKA 2O3UA 3BCHA 3DO6A 1B0PA 2BGIA 3ME5A 2AN3A 2XDAA 4I2VA 4MUBA 4GYKA 5EJEA 2O8BA 4C4YA 3V33A 5FDFA 5C51B 2IUFA 4HGQA 1BQ4A 3U37A 2HIHA 2JFFA 4ALKA 4LXIA 4GBJA 4YQZA 1Y7PA 4FMDF 1VHDA 5ICCA 3BD9A 3C5HA 4YCCA 1XZFA 2F48A 2PO7A 2JLWA 1S3SA 3I01A 3I9NA 3PC4A 4OQNA 3A9TA 1BD3A 4RSRA 4LNAA 5DYYA 8ATCA 2PANA 3N8DA 3BIJA 4JODA 3K1YA 4LDQA 1POWA 1E1RA 1VRWA 5I9MA 3U48A 1PUIA 2IOFK 3CJQA 2EHDA 4GPTA 5J5VA 2QLNA 3DBLA 3OPYI 4B46A 1WULS 1SXJA 2VUTA 5JCOC 2PKWA 1X7XB 2ZANA 3HY6A 3V2UA 4EGSA 3UFXA 3B52X 5J2TB 2GHQA 1WXEA 2WC1A 1IB6A 4GZ3A 2HMUA 2JGRA 3OQIA 1LPBB 3U2QA 3W6NA 1ZMXA 3A4TA 2F9FA 1H6BA 5EUQB 4Z7NB 1U7PA 1N34B 4UOQA 3QVWA 1XBTA 2AOXA 3ENZA 4JP8A 1LWOA 4A0HA 3EYWA 2ZWIA 3GA7A 3KEGA 4XYEA 4EGJA 2MMGA 4X00A 3IT1A 4H35A 3VGJA 2EFJA 1XYGA 4K2HA 2GK4A 2PL3A 3CZCA 4NU0A 3DDNA 3JQ9C 1QB8A 3GFSA 5HF9A 4BEWA 5IMSA 1PDVA 2H52A 5AKKA 4EVRA 4PG4A 2ZRAA 1TZKA 1SIOA 2O14A 3QI7A 1UBOS 1E4YA 1D7OA 3K8ZA 4QOFA 2VAWA 4BGUA 2GEDA 5TEVA 1T9CA 2WD9A 4DWJA 2C31A 2LR0A 4KYIB 4BB5A 2CMGA 1SGWA 1P0MA 3C5WP 2V96A 1KEWA 3WO1A 3GNQA 4TTPA 3ZE6A 2H92A 2JGAA 2PH3A 3B82A 4MCIA 3AEUA 4JLOA 4OXQA 5DO9A 1QM5A 2GCGA 2WSMA 3N8KA 2P91A 2WILA 2R3SA 1PEAA 2O2EA 4LHXA 4LZWA 1SBCA 1R4MB 3GDOA 3FHTA 1WXIA 1G2PA 3R44A 4RPKA 2G6TA 1KORA 3WJ1A 3ZQ6A 4M9QA 4RAOA 1KHTA 2IZ5A 1FFYA 2IYVA 5DW3A 2GM5A 1IM2A 1H1LB 4L2IB 5T64A 1K4YA 1Z0FA 3KQLA 1GV1A 2DY0A 4WLVA 3T5BA 3BWXA 5JZSA 4EGCB 5B2EA 4CHGA 2VTVA 1C1YA 3GG9A 3R3VA 4FE4A 4DJAA 3RWBA 2JRLA 3E1GA 4G6ZA 3MEQA 2GEUA 1AUVA 4R2MA 2EVWX 5CT9A 2J59A 2A9JA 3F9IA 1RLTA 2ZBUA 2F1RA 3MK31 1NC3A 1B41A 4QDKA 3X1KA 2JNWA 4B75A 4N7MA 1QFSA 2QTCA 3BRCA 3HLKA 2FX5A 1X7DA 3KQMA 3UJHA 4EPXA 4ER5A 3WLFA 3BGSA 1D8AA 2G63A 2PJRA 4QIHA 2HM7A 5TV2A 3W2IA 1A98A 3UC9A 3HCPA 3M6IA 5HR5A 5KTNA 1N6HA 5F7JA 2QZ9A 1PLLA 4JEMA 4Z1MA 4AUEA 2X3YA 5ITZB 2QPLA 4LSWA 4GM1A 4EY6A 5K09A 4TM8A 3HWWA 1Y8ZA 1C7JA 1SBHA 4I19A 3FLBA 1G8AA 2VH2A 1GRCA 4ZK2A 5L40A 3B6ZA 5IDWA 4TMKA 3MYYA 2BFOA 5EJIA 2AFHE 5FUBA 4PGAA 1DQYA 2C1XA 2WZDA 1Y34E 3OX4A 1A0OA 2ADOA 1MZPA 2DETA 4BVLA 4FKMA 1NXVA 4MRNA 4DV0B 2R7NA 2PGXA 2VFAA 4JBHA 1NMQA 4NNPA 5AXAA 1T4MA 2GBGA 2ETVA 1G20E 1MA3A 3RNLA 2HQOA 4QHTA 4IXNA 2BSAA 4YALA 1MVLA 4EMTA 4HNGA 1E1MA 1HDCA 1XL1A 5IH7A 2VYNA 2QD4A 5C8VA 1QCDA 4UCFA 1MOZA 4DR1B 4EY3A 4J0EA 4XDHA 1VSTA 3COSA 3HG7A 4W8HA 2G4CA 2OEPA 2B8WA 2YVUA 1I3NA 3FBTA 3KBOA 4U3JB 2F4NA 2NUTA 4TZ6A 4MWOA 5FTWA 4FYIA 2CFTA 5JIBA 2GF9A 2N3ZA 3KKNA 5B53A 1UDRA 5FIUA 3NKLA 4HYTA 4I1IA 1NRJB 4YAWA 4RKEA 2ZJ0A 5IBQA 4Z53A 3PYLA 4DT1A 1RWNA 4OLFA 4AJHA 1CRQA 1J42A 4YO8A 3DBRB 3KL4A 4TLAA 2IYOA 5DIZA 4ESEA 3B6MA 3FR7A 4MW1A 1G55A 2H2AA 1TYEB 1UPUA 2Q7DA 3VDNB 3THXA 1DLJA 1JLHA 1IFXA 4DXAA 3WGKA 1BNCA 2BAGA 5DMHA 3AHGA 1UBLS 2POQX 3C8UA 3H3JA 4I50B 1RMQA 3LP5A 5CT4A 4AN4A 3BXEA 1ZRNA 1DAEA 1ORTA 2GS9A 2E1PA 3QIVA 4GVLA 4IDCA 4D96A 1PJ4A 5LN1A 3GEEA 3GYGA 3N7UA 3DVSX 4KDEA 3FPGA 1YNSA 3WGJA 3IB6A 3C0KA 1Y4AE 4Y1RB 1OLXB 2HUNA 5FULA 4BC0A 1YB2A 3HABA 5DLEA 2Q49A 3A6ZA 5GJWC 1YA4A 5HKKD 1O9HA 1QAQA 2C83A 3CNLA 2FPKA 3DC2A 4J1NA 2Q5CA 4IVPA 3OIVA 4PGFA 1SXQA 2A1UA 4TYWA 2H1OA 3AOGA 4RD3A 3S40A 3VVMA 1U2QA 4GGOA 5AUQA 4MWSA 4Y2GA 3VV2A 1CBUA 4BYGA 1SHZA 4BRSA 4OO3A 3SBOA 1UMBA 4YJ2A 4LY0A 1GGNA 4QJ5A 1W581 5KYUA 4AKSA