3FLUA

Crystal structure of dihydrodipicolinate synthase from the pathogen neisseria meningitidis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
294
structure length
294
Chain Sequence
PFTMLQGSLVALITPMNQDGSIHYEQLRDLIDWHIENGTDGIVAVGTTGESATLSVEEHTAVIEAVVKHVAKRVPVIAGTGANNTVEAIALSQAAEKAGADYTLSVVPYYNKPSQEGIYQHFKTIAEATSIPMIIYNVPGRTVVSMTNDTILRLAEIPNIVGVKEASGNIGSNIELINRAPEGFVVLSGDDHTALPFMLCGGHGVITVAANAAPKLFADMCRAALQGDIALARELNDRLIPIYDTMFCEPSPAAPKWAVSALGRCEPHVRLPLVPLTENGQAKVRAALKASGQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning and characterisation of dihydrodipicolinate synthase from the pathogen Neisseria meningitidis.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup b
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 110
structure length 294
sequence length 294
chains with identical sequence B, C, D
ec nomenclature ec 4.3.3.7: 4-hydroxy-tetrahydrodipicolinate synthase.
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3fluA00
1O60A 6TIMA 2B7OA 1SO3A 3ATYA 3TKFA 3LCWA 5G2IA 4YXGA 1G4EA 2FTPA 3WK3A 1OFEA 2W0UA 4NJIA 4JYEA 4ADTA 1PV8A 3W2MA 5D2VA 1LOSA 3CEPA 4JDBA 1DHPA 4UNLA 1FDJA 1UUMA 5G4WA 1OX4A 1DOSA 2Z0IA 3H53A 1W3NA 2C3ZA 5LKYA 1KW1A 4K38A 4BR1A 2DJXA 3EX4A 1OX4B 4Z1AA 5D04C 2ZA3A 2WSRA 1FCVA 4FNQA 4UFHA 3G0SA 2NX3A 2DP3A 1W1ZA 3G1HA 1VYRA 3UWVA 3PS7A 1RVGA 3M0ZA 3NQFA 3G0XA 4MJMA 3A23A 3M16A 5FF7A 1OFDA 2VKZG 3W2UA 2QDHA 5F2IA 3HJZA 2E6FA 3UWYA 5BW6A 4CCEA 2TMDA 2RH9A 3WK0A 4XZ9A 3L9CA 4RK8A 3LCLA 5IBXC 4ZQNA 3O07A 4FXSA 4IX0A 3MI6A 4NJGA 5HUOA 4RXGA 2CZ5A 3NQMA 4GBUA 5TBOA 3W1PA 4YCOA 3UD6A 3AJXA 3M9YA 4O14A 2RDTA 3JRKA 2QUTA 3LTPA 4N9DA 5CPLA 4L4MA 4X3ZA 3NOEA 3HPXA 2GVLA 4KFNA 1K8YA 4A2RA 4MYXA 1OYAA 1PHWA 4JTLA 2X1RA 3IGUA 1T99A 2EKCA 4FF7A 4ZQMA 4DXVA 3P7YA 2WNZA 3USBA 4JGDA 1OFAA 2QAPA 1N8FA 5LNSA 1XUZA 3TSBA 4A21A 2ZZ3A 4AB4A 3QQ1A 5FEZA 2VELA 1IIGA 3G8EA 4WOZA 1W3IA 4AAJA 2QUUA 2YYUA 4I7UA 3BW2A 5D37A 1KLZA 3B0PA 1TV8A 3HG3A 3EX6A 2G96A 3A22A 1JCMP 3LI1A 1TPWA 3IGSA 3L5MA 3PBYA 4N2YA 1F6PA 3E49A 1KM5A 2HS6A 3FEMA 1GG0A 2VOMA 3GVGA 4HSOA 4JEQA 4XBSA 1WBHA 5BOOA 3PSVA 4Y8FA 3H55A 4ZMGA 1IXOA 1J2WA 2C6QA 1XM3A 3W7PA 2NWSA 4OV9A 3TSMA 5K3VA 1SW7A 1TRIA 4JIPA 3GNDA 1P1XA 5CPOA 3F4WA 1TB3A 2ZRXA 1IIHA 1XDMA 4DO6A 2Z6IA 1QPRA 4P2VA 5DBTA 1R30A 1JR1A 3NQEA 3GLCA 2J27A 1M6JA 1OX5A 1LORA 3N14A 2RHGA 3PB2A 3V1PA 1EA0A 1KTCA 4O4VA 2XN2A 2YDAA 4PH6A 3CTLA 5D33A 4UFLA 3I6RA 3P74A 3S8HA 4RJEA 3LLFA 3GX9A 1DV7A 2NXGA 1H50A 3IEBA 3QSRA 1GVOA 1TPEA 5E1QA 1ICQA 2C13A 2QCDB 3TQKA 1IGSA 2A5HA 5AN7A 1DVJA 3MHFA 3GR7A 1ME7A 1MEWA 3CLMA 3HGJA 4PL1A 1DJQA 1I4NA 3P61A 3T44A 5AHLA 1AW5A 3BW4A 3NZ1A 4XTDA 5K2ZA 1JRCA 1AL7A 1NFBA 4K6AA 4FX6M 3TAKA 3QYQA 2H6RA 3HIJA 3P67A 3MMTA 1LDCA 1EWDA 4OHQA 2R94A 3GDRA 5D30A 3G1FA 1VPXA 4JS3A 4UC5A 1B4KA 2QJIA 2CW6A 2ZRZA 5DLCA 3N34A 2BX7A 5EL1A 3C2EA 1ZJIA 5AHFA 2I9EA 2R91A 3FJLA 2A0NA 4PA8A 3S5ZA 3NL3A 2EHHA 2OJPA 1QAPA 3S6DA 4H4IA 3TXZA 5E0KA 3HB9A 4CQAA 1SO4A 4WJEA 3B0VC 4LVGA 4DELA 2YZRA 3OIXA 5KSWA 5C2XA 2A7NA 5U4NA 3LHVA 1GVFA 5MHBA 1EIXA 1E51A 5CSSA 4NJKA 1YXCA 3HMJG 5LNRA 3QC3A 3NM1A 3N3MA 3GDKA 5DBUA 5IM51 4GE8A 5EA9A 4JYFA 1GQNA 1WOBA 3A24A 3W88A 1W31A 3KX6A 3HPZA 4OE7A 3HOJA 3S9YA 1KM2A 4UUIA 2GPTA 3CHVA 1IXNA 3N2XA 2B4GA 3UQNA 1ZALA 1IXQA 1RQBA 2FFCA 5G2WA 3CEUA 1EWEA 2CLOA 1PIIA 5G1YA 3S1WA 4JTGA 2E09A 3NQAA 4AH7A 3MUXA 5EYWA 1KFBA 3OVQA 4GUHA 1R46A 2GOUA 2VEPA 2Q3OA 1TQJA 3BG5A 3GXPA 3WJXA 3TA6A 4H6KA 1OX6A 5D2TA 2QCLA 1VCGA 1ZNNA 2E5BA 3TIMA 1ZENA 1T0OA 3IVSA 3OHIA 3FYOA 2ATSA 4UNKA 1LRTA 3L66A 3OG3A 1M7OA 4DPQA 1W5NA 2VFEA 1OFOA 3LDVA 4ZQOA 2LLEA 2VEIA 2E77A 3IIZA 2QCEA 1JQXA 4AHQA 3GDTA 4CCCA 3ZR4A 2X30A 2B7QA 1SZEA 4O12A 3RF9A 3ZFHA 3LHZA 3O6YX 3G3MA 3W2KA 3C2OA 3LLDA 2DORA 1W3TA 4O1DA 1GG1A 2DJLA 2Y62A 1HO1A 2OMAA 1ME9A 1LBFA 4NVTA 1QMLA 3GK0A 1P4CA 2X2GA 4UTTC 3EWWA 3T4CA 1IXPA 1N55A 3OVPA 3N19B 2ATMA 5F1VA 1JUBA 3FS2A 4CNPA 1EUAA 3QMTA 3DKJA 1XL9A 2BTMA 2CZDA 3FA5A 3T78A 4ZL1A 1K8ZA 3PBVA 2HS8A 3PC0A 3GXNA 3B05A 3W73A 4R34A 4NX5A 1JCLA 4LU0A 1W0MA 1EUNA 3PY2A 1FCQA 3C8FA 1I2QA 2Z6JA 3W1NA 3M5XA 5G2HA 5IBXA 5FESA 3BG3A 4K8EA 4DF0A 3LCGA 2P10A 3KRZA 4BK9A 2NX9A 3EWXA 1TPH1 1M7PA 1ML1A 3TSDA 3U6WA 2CLLA 2WNQA 2QCCA 4EF9A 1O94A 3GYEA 4UTJA 5AC7A 5DY2A 5D2YA 4H3DA 4N6FA 5H91A 1A5CA 1YXDA 4RKAA 3LTYA 1UB3A 3W71A 1VH7A 4LV4A 3C0JA 1G7VA 2ZRWA 1EP3A 1FWTA 3TJXA 3DZ1A 4NX0A 1H60A 3UY7A 1K7FA 3C56A 4PODA 3G1VA 4HN4A 4MY1A 1YTDA 4IJBA 2E5DA 3NG3A 4K7VA 2OCZA 5EBUA 4AF0A 3DH7A 3W2LA 1G4SA 4Z08A 3LX9A 4JN6A 5I3JA 1L6YA 5DCBA 4QJ1A 4U28A 1K3UA 2CLEA 1JULA 4I7WA 5AYXA 4LVDA 4XKYA 4JICA 2GQ8A 3DFSA 3RFAA 2YW3A 2FJKA 2WJZA 2J24A 3A5VA 4RZ4A 3DHDA 1VR6A 1DQXA 1VLWA 3W1XA 1WYIA 4LRTA 2B0MA 3PUOA 1A5SA 3TMLA 2QCDA 5C5YA 3G0UA 3LCFA 1TCDA 2WOQA 1PCWA 5TQLA 1JCNA 5DXXA 1TPC1 3W1MA 3OA3A 2ZRYA 5CKSA 2ZZ4A 1V5XA 1G4PA 1FWWA 5I3KA 3CQ0A 1R2TA 1S5TA 3TAOA 4DF2A 3VNDA 4AWTA 1KM6A 1TYGA 2V5LA 3W22A 3OVRA 3KFTA 4PL2A 4OT7A 1ZAJA 5KITA 4AEOA 1OABA 3C61A 3LHYA 4DO4A 4NUWA 2G95A 4PC8A 1GPWA 4NXSA 4Y6GA 4GUIA 4NJJA 5EKYA 2ZZ7A 3M41A 3MP3A 3ELFA 3G8RA 4GUJA 2X1UA 3YPIA 5D38A 2NV2A 3I7QA 2FIQA 5F2LA 4GXMA 3LV6A 1PCKA 3CPRA 1LBMA 3MBFA 2WO5A 2XFWA 3TX9A 1U83A 3W7IA 4JTFA 1L6SA 3LHWA 4UXDA 3VE7A 4IWWA 2DZTA 4QSHA 2NX1A 3HF3A 5K4XA 2YFNA 4WY0B 5D02A 2QCFA 4B5NA 4X9SA 5KTLA 1Q3NA 3MHGA 4JTJA 3TNOA 5FF2A 3N9RA 3NDOA 1H7PA 3LCXA 4ZVJA 4MZ1A 5AHEA 5FEXA 1JJKA 1I45A 1LYXA 3WJWA 2ZYFA 4AF0B 3GKFA 1LOQA 4EOUA 1KTNA 5FF4A 1JRBA 1JUEA 4PCFA 2Q8ZA 3GDMA 3L5AA 1C29A 2R14A 5I3GA 2Y88A 2G97A 4GJ1A 3STEA 1K03A 1EPXA 3FOKA 5G4EA 4EVZA 4DF1A 3THAA 4S1FA 3W6YA 4QITA 1SW0A 1RQEA 3E96A 5FF3A 4DBDA 3DI1A 3SIZA 2X1SA 1F76A 2IQTA 4N9BA 3NM3A 3NPUA 1X8FA 2QJGA 4ZZ9A 4JY9A 4LTSA 1SSGA 1TTPA 4UTLA 3TW7A 1QPNA 5LHFA 5DN1A 4KFPA 1U5JA 1VZWA 1PVNA 2FB3A 5I3IA 3BGJA 4JY8A 1HTIA 3W7RA 2NWRA 1LP6A 4LW7A 1ONRA 3DHFA 3CWOX 2A7RA 3DFNA 5DY3A 3UZ5A 1R2RA 3NL6A 3NGJA 4FX7A 2WV8A 2YGYA 4BWLA 2XN1A 4LNYA 3WK2A 1LTDA 3K30A 1AG1O 3NNTA 4MUZA 2ALDA 4ORMA 4Q4KA 4TMBA 1ICPA 3NQ8A 5D05A 1FCBA 3RU6A 2A7PA 5F4WA 5FF0A 3IIPA 1AW1A 1MEHA 3W83A 4WUIA 4ADUA 2VXNA 1HUVA 3JS3A 4LVBA 4QM1A 2VC6A 3MP4A 3UYCA 4LVFA 3UXAA 2QR6A 3NL5A 4JTKA 5HMSA 1VCFA 1TJPA 1G67A 3S42A 3W7DA 4NNCA 1B57A 1KBIA 2FPTA 4HPXA 2PRMA 3B8DA 4O1AA 4Q33A 1MO0A 3BGGA 2Y61A 1YADA 3W2NA 4RR4A 1TTIA 3O05A 1J4EA 3O15A 4MY9A 4XTIA 4EIVA 3O8AA 4O13A 2O7SA 3U2OA 3HBLA 3A21A 3LCHA 4LT9A 1VS1A 3MW7A 2OZ0A 2C14A 1TPDA 1VQTA 5LGZA 3TFXA 3GAYA 5L6UA 1MSSA 1UJPA 4YCPA 3W7HA 4JX5A 1SQ7A 4O1CA 4ADSA 3M1ZA 3TQ0A 4POCA 3C2VA 3LM7A 1KFLA 3MHUA 3DFTA 2E6YA 3WJYA 1LLWA 2E5CA 4OV4A 1X1ZA 3ATZA 2E6AA 5K7JA 3IVUA 1QO5A 2A85A 4BF9A 3KVKA 3UWZA 2B7PA 2TPSA 3S5YA 1LROA 3W7EA 3W84A 1GYNA 3V75A 1TMHA 1LLZA 1D9EA 5LNVA 3S0CA 3QQ0A 3GNNA 4JR5A 1KBJA 3LHTA 1DBTA 4M7SA 4UFJA 2YCEA 1DJNA 2YR1A 4UR8A 4WXZA 3B06A 3PG8A 2AAMA 3GB6A 4K36A 2HTMA 2ZA1A 3CWNA 1GTHA 1LM1A 3W72A 2CLFA 3NQGA 1XKYA 2PE4A 1LBLA 1Q6RA 1RZMA 2V30A 3O6CA 2GUUA 4HHPA 5AFDA 3ABRA 3W7CA 3M7WA 4WQ6A 1I8JA 1YTKA 3LB0A 4O0ZA 1AMKA 1SW3A 1PS9A 2H3BA 4UFIA 3W1UA 4XBKA 4BI5A 4UTKA 4O57A 4WX2A 3KVLA 3QW4B 3IGXA 2Y7FA 4UCGA 4GNJA 3GIYA 3QJAA 1EP1A 1H5YA 3P5ZA 4ML9A 4NNBA 1O5XA 2C1HA 3EKZA 1ZHAA 3LOTA 1P5BA 1TTQA 4J9JA 1K8XA 2TYSA 3EXSA 1GVRA 4NQ1A 3CC1A 1QCWA 3PG9A 1YDOA 3KXQA 3T55A 3C2RA 4O15A 2NUYA 1TO3A 1RQHA 3KVJA 1VJIA 1O95A 2ZZ2A 3M5VA 3S5NA 3L21A 3EX2A 4IQLA 3BLIA 1YTEA 1V7YA 4U4MA 4LWWA 4WOQA 2VFIA 1H63A 1NEYA 3CT7A 2YW4A 1KM3A 5D32A 4ZQRA 2H3DA 3B03A 3B4UA 4MY8A 5HNRA 1H7OA 3W1QA 4JDYA 4WZHA 3INPA 3KRSA 1DQWA 1TV5A 4FHAA 1W5PA 1WV2A 3PF3A 3QW3A 4UFKA 1F05A 3W7KA 4FB7A 4UTWC 1XCFA 1GT8A 4BFAA 4UTWA 3EEGA 1Q6OA 3EWZA 2ABBA 1PE1A 5AHMA 3H54A 1I2RA 2XN0A 3DFPA 3W7GA 1W37A 3A9IA 4XQ6A 3W2JA 2EGZA 2H8XA 2JKEA 4S2BA 1SZNA 1W54A 3W7OA 2WKJA 3TV8A 3RMJA 2YX0A 3P82A 4K8HA 3DU0A 5EMUA 3QEZA 1UUOA 3P84A 3NYZA 1X6UA 3MP5A 4CCDA 2ZCGA 1F73A 2Q8LA 2NXIA 1FQ0A 4QAIA 5DCEA 3R12A 4LV9A 1TPB1 5EY5A 1L2UA 4MLJA 1TIMA 4IMGA 1OJXA 5H2ZA 2VEMA 3R5EA 3P8IA 1XBVA 1KFEA 3A5FA 2C15A 2V0TA 3HO8A 3VE9A 1OFRA 2J88A 1H7XA 3UZJA 4E2BA 5L9FA 2PURA 4G1KA 3M43A 1A50A 3O1NA 3WJZA 3NPXA 1OK6A 1GTEA 4HIBA 1XBXA 3N9SA 3TDFA 3NQCA 1Q6QA 1QWGA 2QCGA 4FIQA 3TC6A 4TU1A 4TX9A 3MJYA 1X1OA 3OBKA 3W76A 2YXGA 2JKPA 2EAWA 1GJPA 4IMDA 4MKNA 4IMFA 3LXAA 2E68A 3RNDA 5FI8A 2Y63A 2DU2A 5U7SA 4WY0A 4MZ8A 1OYCA 5J5DA 1S5WA 1TTJA 3FKKA 3UPBA 3TC7A 1ZCOA 3I7RA 2QCNA 4O17A 4MPQA 2V9DA 1QO2A 4JTHA 4WXYA 2WSYA 4Z1CA 1HFBA 3F4NA 2Y7GA 3L0GA 5AHIA 2QUVA 1H62A 3SW6A 4A3UA 1AL8A 5AYZA 2W79A 4OU1A 5CZTA 3NEVA 1YPIA 4FEZA 4IX2A 3G22A 8TIMA 4UTIA 3ABSA 1K7XA 1ALDA 4QNWA 3TE9A 3HGSA 4TIMA 1O5KA 2NLIA 3W85A 1FDZA 1VRDA 1EP2A 4D2JA 5LNUA 3WFAA 1XDLA 2YFOA 4N9CA 2QJHA 4A29A 3G3DA 3L65A 2ZRVA 4O52A 4UFMA 5BMXA 2CLIA 3Q94A 2W6RA 3M6YA 1FCUA 3W3OA 3UXDA 2BSLA 2V82A 5CZSA 1CW2A 1BKSA 1H61A 2X1TA 1YXYA 1OFQA 3TUUA 2YYTA 5HJLA 4KKXA 5AC8A 1W8SA 2WPBA 4ALDA 1FUYA 3M44A 1SFJA 5AOUA 3R89A 3NZRA 3QMRA 4RXFA 1VC4A 3NPVA 2UV8G 4YLWA 5FEWA 1PHQA 5DELA 2TSYA 1ICSA 2GQ9A 1RV8A 2Y6ZA 1Q45A 2P1FA 1F6KA 1Z44A 3DI0A 5KZDA 4R53A 3L0NA 1K7EA 2A6NA 3W7JA 3TCEA 3FLUA 4UIOA 3NQ7A 3TH6A 4M6VA 3HGRA 5I3FA 3MYOA 2C18A 3TMQA 4R33A 3TU9A 4GC4A 1XC4A 1KM4A 4O4WA 2Z2UA 5HULA 2AQWA 3ABQA 3SI9A 4LC6A 1Z41A 4UTHA 4HKPA 4N6EA 3T7VA 2CFFA 1J5TA 3OEXA 1G69A 5GVJA 3DGRA 1UASA 1H7NA 1I2PA 4O0KA 1YYAA 4Z1DA 2NZLA 3DENA 3MBDA 1YLVA 2V8ZA 1NF7A 2CU0A 2FLIA 3LBCA 2CZEA 5D2XA 5D2WA 1KFCA 5HINA 3LGEA 3KAOA 3IVTA 2BLEA 4YWIA 3P60A 4BI6A 4N4PA 3N2MA 1C9DA 2Y89A 3EXTA 5C55A 5AB3A 2DZVA 2VFFA 4QIUA 2DZWA 2V5BA 3HG2A 4XKYB 1WXJA 1XUUA 3SGUA 4LS1A 3I65A 5HR6A 1EEPA 3LBMA 4RCXA 3ZWSA 4DPPA 3CU2A 2NV1A 1IF2A 3STCA 4IOTA 4FNTA 4OWGA 5G1TA 5D09A 3QRHA 4X2RA 2Y70A 4E0CA 2GJLA 2NUXA 1L6WA 3VCRA 2JK2A 4QISA 4MVAA 4A2SA 4M7TA 2Y7DA 2PCQA 1D3GA 3PSWA 3W7LA 3Q58A 4GRSA 2ISWA 3BO9A 2H8ZA 1QOQA 3L5LA 1UBSA 3B04A 3NAVA 4MYAA 3E0IA 1ME8A 1Y0EA 4TR9A 5DXYA 3L67A 2R8WA 2VFHA 1Q6LA 2Z1BA 2ZRUA 3S1UA 2CWNA 4PFMA 4GWEA 4GFSA 3L0KA 5AC6A 1ZFJA 2WNNA 4M19A 4Y96A 3VFLA 2V2CA 1FXPA 4ZQCA 2NUWA 3STFA 3ZS4A 1PL9A 2H90A 3DXIA 1XXXA 4HT3A 3BLEA 5LZLA 2CZFA 1KFJA 1EX5A 4Z1BA 1GEQA 1VGAA 4I9AA 2JGYA 4TMCA 3ABOA 3LXBA 4ZQPA 4NNAA 3UY8A 3MI3A 4N4QA 2DZUA 3W07A 5KINA 4N9EA 3EKLA 3W70A 1W5QA 2JGQA 1SZGA 2A4AA 3LRKA 3EWUA 4QNEA 1KM1A 4IUOA 1QOPA 3PM6A 3IIVA 2FB2A 1KV5A 5G5IA 3E9AA 3QFEA 5LHEA 3W1RA 1BEUA 4O19A 1KTBA 4I7VA 2QCMA 4LUIA 3CB8A 3ANYA 3UNDA 3HPSA 2CLMA 4O16A 1UCWA 2ZZ6A 1EB3A 3IIXA 2Y85A 1GOXA 5AYYA 2E1DA 1HL2A 5ABTA 1DKWA 1TREA 4UR7A 3P5YA 1VCVA 4MIMA 2O7QA 2RDWA 2I14A 3QZEA 4YL2A 1OYBA 3SR7A 3PVFA 1JCJA 3QSTA 1P0KA 3QM3A 5HWNA 4NZJA 4TO8A 1TSIA 1NSJA 3FFSA 3L68A 3C3NA 3LRMA 3TXVA 4K7YA 1QFEA 3W86A 3SY5A 1GYLA 1SSDA 1L9WA 1WX0A 4L4LA 3I7SA 3NR0A 3GZ3A 1KFKA 2YSWA 3NQDA 2NXHA 4DO5A 3W7NA 3TFCA 1OFBA 3BLFA 1BWLA 4KWVA 3STGA 4K39A 5BNKA 1GZGA 3PBWA 1LRNA 2HMCA 1W5MA 3W87A 4HSNA 3W9ZA 1T96A 4O18A 4JTSA 1W5OA 5LGXA 1H7WA 4XUGA 1B4EA 4LS0A 1QPQA 1NAL1 3ZWTA 4DEFA 1OHLA 4DQWA 1BWKA 1XFBA 4MJZA 3IV3A 1LCOA 2V2HA 3NVTA 5HWJA 2P0OA 2VEKA 3BPWA 4UTMA 3RLVA 4GUGA 2I1OA 1SU5A 3NL2A 5TIMA 5K9DA 5HWMA 1QPOA 4IPIA 1GVSA 1MZHA 2OX1A 3DFOA 1SUXA 1JCYA 1G4TA 1H51A 5DCDA 2FPYA 2DZXA 1YDVA 3O06A 1W56A 3O63A 4IMCA 3CIXA 3IIOA 3G1AA 4WD0A 3RLUA 1WAUA 1TRDA 1M5WA 2BXVA 4RZ6A 4O10A 2ZZ1A 4OBTA 1FX6A 4X22A 1A53A 3UWWA 2CLKA 4FX8A 1YPFA 2X16A 5J5RA 1LRQA 2E6DA 2EF9A 1TPFA 3FJ6A 3G1SA 4Z0JA 1OVDA 3P81A 1JUKA 1YDNA 3JR2A 5F4SA 3MWAA 1FBAA 1FY6A 4HPJA 3EWBX 4AVFA 4BWLC 3NPWA 4O50A 5CGQA 1MXSA 1OF6A 5K9CA 1FXQA 3Q2DA 1NVMA 1KM0A 4LY8A 1G7UA 4K37A 4LOCA 1SPQA 3KVMA 1LOLA 4WY0F 3QPYA 1C8VA 3BK0A 4XWUA 3I68A 3FYPA 4Q32A 1SO6A 2QKFA 3HGOA 4MOZA 3QF0A 3SECA 2QAFA 5CPNA 3MYPA 1VYPX 3PUEA 1B9BA 2QDGA 1ADOA 1ZY9A 1WOAA 3TW6A 1XBZA 2Q3RA 4JXCA 3W75A 5SWUA 3DBPA 4JTEA 3HG4A 2D73A 1F2JA 1CI1A 1P0NA 1T8XA 2TRSA 4LC8A 3QMSA 3LV5A 3SFKA 3O6DA 5CZ0A 4EWND 3WK1A 1RR2A 3TR2A 2GJNA 5F1UA 3EX1A 4UTUA 2AGKA 4CQ8A 3W1LA 3NXFA 4NZFA 4Y9AA 2GQAA 3S1VA 4HNTA 3UWQA 2OT1A 1R47A 3M5ZA 3IRDA 4MLRA 2C16A 3LXCA 1VHNA 5BRBA 1I2OA 3BG9A 3HG5A 1O4UA 2FDSA 4GUFA 4DBEA 1AK5A 5HR7A 2WSQA 3C4UA 3NQ6A 4M6QA 4AWUA 5A5WA 3LCIA 1FWSA 4FIRA 4IPJA 6ALDA 4O8RA 4LVAA 1B3OA 4W9TA 3QH2A 3R2GA 1WBJA 5C6MA 2B7NA 3C6CA 4KFOA 3BARA 1VYSX 4AHOA 4LS2A 4FNRA 3M5YA 2FPVA 4YMZA 2QCHA 4JX6A 3C52A 1WDWA 2VENA 3NO5A 4KWWA 4C1LA 3PBUA 4RZ5A 3W74A 4JTIA 1X7FA 3G1XA 2C0AA 2J9XA 3F1QA 3E02A 2ISSA 4NT0A 1RPXA 3EX3A 3O16A 1ZAIA 2ZQ0A 3G1DA 4LRSA 1WA3A 3NQVA 1HO4A 2ZDRA 1FDYA 2ZTKA 4CNOA 3W23A 3TJLA 1A5AA 4HNVA 3GKAA 5FEPA 4M5PA 4FXRA 1DORA 5F2MA 3QPZA 4A22A 4RX0A 4M6PA 4O11A 2KZHA 4MFDA 5F2GA 3P62A 1KLYA 4O54A 5EPDA 1LZOA 3KRUA 1JVNA 2F84A 5K4ZA 4CNNA 1S3HA 4JIQA 2A21A 3PWAA 1A5BA 3U8GA 1DL3A 5CSRA 4ICNA 4P61A 3GXTA 2V2DA 3P8JA 2ZBTA 2EPHA 1OFPA 3DFQA 1OF8A 3LTSA 1G6CA 4UTTA 1OG0A 4AHPA 1TV7A 2A2IA 3KOFA 2QF7A 4IMEA 3C2FA 3N73A 3W7QA 3DAQA 1HG3A 1H1ZA 2PRHA 1H7RA 2V81A 2PRLA 4JD4A 3L2IA 4NXKA 1BTMA 4IXHA 1VLIA 4JX4A 4FO4A 3WJSA 3GAKA 3LHUA 1QR7A 1GWJA 2JBMA 4ONVA 5E93A 2BZNA 3SSJA 3E12A 5AHNA 4AMAA 4RLIA 1RD5A 4O28A 4JTTA 2VFGA 5HUPA 1SR9A 3VI2A 1AW2A 5D03A 3SZ8A 5BMWA 4IXXA 1ZAHA 2F7FA 5T26A 5F4XA 1F5ZA 3B0UX 3MO7A 4JYDA 3EB2A 2C19A 1JQVA 5CPMA 4JNMA 2ABAA 4IGHA 3LI0A 2ZFAA 1S5VA 5KZMA 1TPUA 1FWNA 2J6XA 3PR2A 1R2SA 3GR8A 1MEIA 4QQ3A 3FKRA 2ISVA 1D3HA 4HNUA 4BI7A 4RV8A 3SGZA 1QDSA 1FWRA 3CM4A 3HQ1A 4NJHA 1JCXA 3PUDA 4AXKA 3W7MA 1QNVA 5KZEA 3VKJA 1F7BA 3F03K 3KHJA 4CQ9A 4NU7A 2GVJA 3NA8A 3G1YA 3NQ2A 4FNUA 1KA9F 1F74A 2A6LA 4UMCA 4Y90A 1K02A 3AO0A 3R13A 3PULA 2Y7EA 1XBYA 4Z0SA 4E2DA 2J9ZA 3D0CA 2PC4A 1I2NA 3BV4A 5HQEA 4N02A 2DZSA 1NF0A 1CX9A 3DKLA 1THFD 3CIWA 3S5OA 1SFLA 2OT0A 3M47A 2QEZA 3T40A 4PEKA 1Z48A 4MZYA 5K9XA 1GVQA 3SJ3A 3PB0A 1H1YA 2YPIA 4OQVA 3R8RA 2JKAA 2GVGA 3EWYA 2ZA2A 7TIMA 2A1YA 2ZZ5A 3LERA 4FNPA 5A8GA 1VHCA 2ZTJA 4MFEA 3P80A 2FQIA 4O1BA 3UWUA 3PAJA 2WQPA 1WQ5A 2BWGA 3EXRA 1TQXA 4E38A 4UMBA 3W1AA 1Z42A 4EF8A 5I3HA 2HSAA 5C54A 3THQA 3RK8A 3TROA 4HNNA 4UMAA 4C1KA 3GDLA 1SZFA 4AWSA 4OGZA 3UPWA 2RKXA 5CZJA 3BW3A 2G5WA 4CLMA 3TK7A 1KV8A 2DZPA 3S1XA 4FNSA 2VFDA 3Q37A 2RFGA 1OK4A 2RDUA 4R7JA 3G18A 1N7KA 4O53A 5KMYA 3TQVA 2J9YA 3FIGA 3W1TA 1SO5A 3MI2A 4ORIA 3LRLA 4PTNA 4S2CA 3BVJA 5LSMA 1TJRA 4LUJA 1TPVA 1XI3A 5CG7A 5LNWA 4JTUA 2CLHA 3G24A
chains in the Genus database with same CATH superfamily
6TIMA 1KO0A 2B7OA 1J5SA 3ICJA 4NZ3A 3A47A 2W62A 2HE8A 3TKFA 7CGTA 4OFCA 1A3WA 3WK3A 2I5GA 3NYDA 3LPPA 1TWDA 4ADTA 1FHUA 3AZSA 1LOSA 1T5AA 3PFMA 2O4QA 4UNLA 4NRRA 3PZUA 1W3NA 2C3ZA 3EB4A 3RXZA 1KW1A 4PMZA 4JIRA 3MCNA 2DJXA 3EX4A 4Z1AA 1XIJA 3PZMA 2ZA3A 1V3KA 1X98A 1E6PA 1E6NA 1ZJBA 3M64A 4UFHA 3K4AA 4JQ3A 4QTGA 3UWVA 1RVGA 2ACUA 5FF7A 4K1WA 4C6JA 3QV8A 5F2IA 1W17A 1LWHA 2YA2A 1B90A 3UWYA 2BVTA 3E0LA 3L9CA 3RM8A 2I57A 3VXGA 2PAJA 5EMYA 5FAJA 5IBXC 3FGCA 4FXSA 4IX0A 4NJGA 2AKMA 2EQDA 4ZOBA 4RXGA 3SEPA 4R27A 3NQMA 3RJYA 2RDTA 2QUTA 5CBIA 4MDOA 4DJFC 4L4MA 1QVBA 3NOEA 3HPXA 2VNCA 2ZUMA 3QR0A 4B5SA 3HN3A 5FOOA 4JTLA 4FF7A 3W25A 3JZUA 1XISA 2QAPA 2CKRA 3VIFA 2PDHA 4S3DA 3FAXA 2A3LA 1JZ6A 4AB4A 1QOXA 3QQ1A 5FEZA 2VELA 3A4XA 1IIGA 1W3IA 2E9LA 5CJMA 1V93A 4I7UA 1KLZA 3B0PA 3UPMA 1US2A 3TWBA 1C7SA 3HG3A 3CS2A 3EX6A 1OIFA 2AKZA 4FAMA 3A22A 3PBYA 1TWSA 4DRSA 1OGSA 2HS6A 2XVGA 3GVGA 1PAMA 4PMYA 3CMJA 4XIAA 1BKHA 3I3BA 2FZNA 3CHDA 1HJUA 1BRLA 3A13A 2ZOXA 1J2WA 3S2CA 2ZICA 1UUQA 1PWLA 2DSUA 1DWIM 3VIJA 1VBRA 4F79A 4K2SA 1TG7A 1MW0A 5K3VA 2FGZA 3GIPA 1ISYA 2O56A 1P1XA 1UHVA 5CPOA 1XGEA 2FZMA 1AH0A 1FH8A 2ZRXA 4DNMA 2WK2A 1D7KA 3NQEA 4LF1A 1M6JA 3N14A 2PGEA 5LA1A 3Q67A 2XN2A 4AIUA 2YDAA 4PH6A 1UZ1A 3QV9A 5DO8A 4B5TA 3USZA 3FGCB 1XIMA 2NXGA 1H50A 1NTHA 2WANA 4IHCA 3TQKA 2NT1A 4DWSB 4KPLA 2WMKA 1MEWA 2DIJA 2CBVA 3HGJA 4FOJA 2JF7A 1I4NA 1YBQB 3VD7A 1AW5A 3BW4A 3V3WA 1Q7MA 1XIDA 3GH4A 5K2ZA 1JRCA 3WQOA 4OHQA 2Z29A 3EMQA 4UZSA 3BC9A 1VKFA 1LL4A 2GUYA 5AHFA 2I9EA 2C1GA 4B92A 3S5ZA 1PJ9A 1QAPA 4MB4A 4H4IA 3MSGA 4WJEA 3B0VC 3PWIA 1V6WA 5C9ZA 3OIXA 5C2XA 2A7NA 2WMJA 3R11A 4UQAA 3UZWA 2XYLA 4KWSA 1EIXA 1R9XA 1O5QA 1YXCA 2F6UA 3WDRA 3HMJG 5T9CE 4RL3A 3U2CA 3WF2A 3KS6A 1Z8AA 1R38A 4TQTA 3NM1A 5IM51 4M29A 5EA9A 3CZJA 5IHSA 4JYFA 3BCFA 1WOBA 1U30A 3HPZA 2XZ7A 1EHAA 1V3IA 3E5PA 4UUIA 1OCBA 4B4FA 4AD2A 2CYGA 4FALA 2PLKA 2FFCA 1J01A 2CLOA 3AIQA 4CGTA 4FF5A 2OSWA 2Q6ZA 2E09A 3NQAA 5MKGB 1DWHM 5FJUA 4AH7A 5HAOA 2V3GA 1B3YA 1R46A 2KAUC 4JQ2A 1XQKA 1ECEA 2OQYA 5HNTA 4H6KA 2FYMA 5BRPA 1OX6A 2OQHA 5D2TA 1VCGA 2PP3A 2E5BA 2OLHA 1JXKA 4MB1A 3WH6A 3FYOA 3BDKA 4RW3A 4QE1A 2OB3A 4NF7A 1UOKA 3ARRA 3MT1A 2OPJA 3LDVA 4ECLA 2E77A 3CZEA 1YE6A 1Q13A 4B5VA 1BXBA 1NDZA 4CCCA 3A64A 5FSEC 4AZGA 2B7QA 3ZLFA 1VJZA 4BHYA 3ARQA 3LLDA 2BGNE 2I17A 2E4TA 4QEEA 2DQXA 1HO1A 2OMAA 1ME9A 1CXFA 3BURA 3THUA 4NVTA 5I6SA 1QMLA 1MUMA 3ID7A 3EWWA 1V51A 1N55A 1W2PA 4OKDA 4IFOA 3NOYA 2G50A 3DKJA 1XCXA 1XL9A 2CZDA 4RDYA 3K8KA 3PBVA 3GXNA 3PPGA 3W73A 1ISZA 1XLIA 5FL0A 1FCQA 1NARA 1EYEA 2VVNA 4ACYA 3QV7A 5AZ1A 5G2HA 5IBXA 2P3EA 3BG3A 2NX9A 2PDGA 2WNQA 3DCPA 3VNYA 1RJRA 1RXOB 2XH2A 5DY2A 2VZSA 2R9RA 4E4PA 5A95A 1A5CA 4RKAA 4C1NA 1KBKA 1YMYA 4WDUA 1EP3A 1FWTA 3GU2A 3TJXA 1PDYA 4ZR8A 1H09A 4AZ6A 3MJMA 3DBNA 3WQ5A 1UR9A 1YTDA 4C65A 1CDGA 2E5DA 1FHVA 2OGYA 1NFPA 4Z08A 3LX9A 1L6YA 1PBGA 2MANA 5M03A 2PDJA 4U28A 1K3UA 1V6XA 2QPUA 4I7WA 3VA8A 2FTYA 4GI6A 4LVDA 4XKYA 1OM0A 3WBEA 3C2YA 3EOEA 3DFSA 4QLKA 1XP3A 4PMXA 2YJQA 1S5NA 2WJZA 3A5VA 2CERA 4X0VA 1VR6A 1N2VA 1OZQA 3W1XA 4U31A 1M1BA 3GVVA 3PJUA 1DJZA 3TMLA 1XH2A 3ARSA 4AZIA 1PCWA 1HVXA 1OIMA 1E6RA 1EQCA 2ZRYA 5CKSA 4R3UA 1UP2A 2ON3A 1V5XA 1S1RA 4QJ5B 1G4PA 1QRQA 3TAOA 3U5UA 1J93A 3OVRA 4OT7A 4AEOA 2XPKA 3NXLA 1QT1A 4DO4A 3VTRA 5C2GA 4S39A 2NVDA 2J78A 4WHBA 2G95A 3WZ0E 1GPWA 5A2AA 2ZZ7A 3N04A 5XIMA 3GTXA 3ELFA 4GQBA 2X1UA 3YPIA 3WG6A 3I7QA 2FIQA 4XZMX 1PCKA 3CPRA 3ZR5A 1LBMA 3MBFA 5A6TC 2D3LA 2WO5A 2XFWA 1U83A 1HJSA 1L6SA 4GVFA 2PWEA 3VE7A 3HF3A 4M24A 1UD4A 2VRJA 4KF1A 1WKYA 3WFLA 2YFNA 1KKRA 3GU1A 2PTDA 4PRWA 2CKSA 3QHOA 1Q3NA 4IGSA 3ES7A 2YDRA 5FF2A 3NDOA 1E40A 3EDJA 5JBDA 1I45A 1LG1A 3GKFA 4CU7A 3GVRA 1LOQA 4EOUA 4GX9A 1JRBA 2EPOA 1M7XA 1C29A 2PD9A 3WL1A 4E3TA 5JMUA 4U3CA 1EPXA 2WB5A 3CUGA 4NZ1A 5EFDA 2GFTA 5G4EA 3UZYA 2FKPA 1GOMA 3ARWA 1UA3A 3DI1A 4CQDA 4ZO6A 4Y9PA 4GO9A 1KBLA 4UTLA 3TW7A 3GIQA 3GWQA 1BWVA 4B91A 1YBQA 1HTIA 1GZ1A 2NWRA 4LW7A 3C86A 1JDCA 3DHFA 4NI8A 3CWOX 2CHNA 5DY3A 4CN1A 4GKTA 1R2RA 4NILA 1LUCB 3RUBL 3K30A 4C6KA 3DG6A 4LANA 1AG1O 3V0SA 3NNTA 4ORMA 4AC1X 4M0XA 4Z2HA 1FCBA 1HKWA 4IIHA 1Z9AA 4YTTA 3W83A 4ADUA 4LQ1A 3JS3A 1ITQA 2Z28A 3LGGA 4I6KA 3WD3A 2CETA 5C7VA 3UXAA 3NL5A 4JTKA 1G67A 3S42A 4INFA 4NNCA 1B57A 1KBIA 4HPXA 4O1AA 2B81A 3TTEA 5J04A 3P2VA 4M82A 4Q6XA 3W2NA 1TTIA 2UY3A 4IGNA 1X97A 3RO6A 2O7SA 3A21A 2WHMA 3TYZA 4L65A 4H7CA 5FA5A 4LT9A 1W1PA 2OZ0A 3ORWA 1Q5MA 2W67A 3VNIA 3W02A 2ZADA 1R3SA 3U7VA 3W7HA 2CXEA 1SYTA 4XAFA 2BY1A 7REQB 4ADSA 2PDFA 3TQ0A 4GA8A 3B9NA 2OXNA 2WWDA 4XZHA 1LLWA 4MPKA 1X1ZA 3ITYA 2VX6A 3MC5A 3SAZA 4F48A 9XIAA 5K7JA 2XM1A 4DJDD 1J11A 2VVSA 3KVKA 4EP8C 2GSJA 3W84A 1GYNA 1Y5VA 1ZJHA 4YVVA 1LLZA 2FMOA 4LYRA 3T8LA 3QQ0A 3S1GA 2EXOA 1DBTA 1Q8AA 4JZ5A 4UR8A 3L7RA 3PG8A 2WC7A 1A5KC 4K36A 2HTMA 1FWGC 3U48A 3W72A 1CENA 3W38A 2PE4A 1QTWA 4HHPA 3ZVHA 5AFDA 3M7WA 1IT8A 4AC7C 3HQNA 1KCLA 3LB0A 3ZZ1A 5C2CA 1VBGA 1PS9A 2H3BA 4UFIA 2GWNA 2VQTA 2C71A 1DWJM 4J7RA 3GTHA 3U3HA 2WM0A 3V7PA 2CHRA 2XGZA 3VMPA 1JIBA 4HB7A 1O5XA 1XLLA 1IEQA 1E55A 3M07A 2Y4SA 1LWIA 4NIRA 1YNPA 3OYZA 1DHKA 4J9JA 3SCTA 1K8XA 2TYSA 4A4AA 2BHYA 2Y1HA 1QCWA 4M56A 4GINA 2NQLA 2G3JA 4P7NA 3QVQA 3OTRA 4YVPA 3TYBA 3FAWA 3AFBA 4CD4A 3KVJA 2PTXA 3ITLA 3S5NA 4IQLA 2OLSA 3AALA 4WOQA 4LWWA 1ZJAA 4H2CA 5HMDA 1S2AA 4GIEA 3UCDA 4ZQRA 1P6WA 4JDYA 2G3NA 1XYLA 2ONEA 1H3GA 2PI6A 3ZXWA 2VCAA 1W9UA 1MDLA 1ESWA 1F05A 4FB7A 4WGHA 3H2FA 1GT8A 4BFAA 4UTWA 2XH0A 2HPMA 4YWSA 4B3ZA 2ABBA 3BLOA 3ITTA 3DESA 1XF0A 1I2RA 2XN0A 3TR9A 3W7GA 4D1IA 2EGZA 4GQRA 4DJFA 4PMJA 1Z6KA 2E67A 2C7FA 3OP2A 2ZUVA 1QHOA 1CGVA 1U22A 3TVAA 4D6CA 3QEZA 2ODOA 3MUZ1 5E9AA 3MP5A 4GJJA 2NXIA 1FQ0A 5DCEA 3LN3A 7PTDA 4LV9A 3VABA 9XIMA 4HYVA 1L2UA 2NV9A 4D6HA 4REQA 3GRIA 1AFSA 2BOEX 4IMGA 1OJXA 3UJSA 3WF1A 2PDLA 4OIFA 3TCSA 3OW1A 5B80A 3A5FA 2WZMA 3SUUA 3VDHA 4CEXC 4WCJA 2AL1A 3VE9A 5L9FA 2ACSA 2VTFA 4WDXA 3S6OA 3TDFA 2PFHA 3NQCA 2Z1SA 1QWGA 1B0IA 1PKNA 4FIQA 3TC6A 3JUGA 2D0HA 2CEQA 4TU1A 2RGLA 3PZOA 1YQ2A 1ITCA 2PGRA 3W76A 3QKZA 1EO7A 2ZVRA 4MKNA 2E68A 3RNDA 1GKQA 2DU2A 2F38A 2E3ZA 2ASHA 3QQWA 5J5DA 1S5WA 2XGIA 3TC7A 4PUMA 4DVOA 4I5RA 3MWCA 3I7RA 1A49A 1C8QA 3IK2A 4O17A 2WMGA 3W81A 4WXYA 3F4NA 2BOGX 1MYRA 1BQCA 1J12A 3T07A 1VF8A 1ZBVA 4RZBA 3CQKA 5AYZA 4OU1A 1P7TB 1YPIA 2IPWA 1W9BM 1UZ4A 1JPKA 4QNWA 1ALDA 3POHA 4TIMA 1HGYA 1H41A 2NLIA 4YTSA 1EP2A 5C70A 3MKKA 3K8LA 5LNUA 1XDLA 2WHLA 3G3DA 1TE6A 4O52A 3H22A 4DBUA 2CLIA 2YLAA 3Q94A 1UKOA 1UZHA 1GKRA 2D2OA 2QLYA 4L6DA 4LUSA 5FAGA 3U9IA 5LXEA 1YXYA 1EOMA 2PDKA 1OFQA 1HJVA 4Q8TA 2D2GA 2HXTA 5AC8A 4J5NA 4KKXA 1W8SA 4H9TA 5AOUA 4TVCA 2DSWA 3AIWA 2EPMX 3NPVA 4YLWA 2J7EA 2J8GA 1H5VA 2TSYA 1ICSA 1Q45A 4HTYA 1E15A 4AD3A 4NSBA 1HL8A 2EBNA 3GZAA 3CZGA 3GH7A 2A6NA 3W7JA 1C8YA 4A6GA 4KIRA 4KRTA 1RBLA 4QX4A 3TH6A 4M6VA 4D71A 2GSEA 3OBAA 3TQPA 2C18A 3S2NA 3TMQA 4R33A 1GGOA 2G3IA 3ZR6A 3SI9A 5BU6A 1GOQA 4UOJA 2VR5A 3N2OA 1J5TA 4DJEC 3D6NA 3WNMA 1I2PA 1MMFA 4NAEB 1L0PA 1F8MA 3DENA 3H4WA 3IPWA 3WQPA 4Z17A 2CU0A 2FLIA 5D2WA 5HINA 4HBKA 4DYEA 2BNJA 3BQ5A 2GGGA 8XIMA 5EGRA 5AB3A 4PUKA 2DZVA 5EU9A 2VFFA 1CXLA 4QIUA 3VIMA 1V6VA 2EPNA 3VM7A 5BXPA 1XUUA 1HF6A 3I65A 3QXBA 5HR6A 4NZCA 4FLRA 3U2EA 4NAFB 4RCXA 3ZWSA 3CU2A 2A3AA 1IF2A 4XAZA 4IOTA 1WZAA 4J3TA 3VVGA 4H9ZA 5D09A 1X6NA 4X2RA 4E0CA 1L6WA 4X0NA 1ZBCA 4HA4A 3VCRA 2DV0A 2V63A 1Y8BA 2P5NA 1Z69A 3NVDA 1W9PA 4A2SA 2I7GA 4M7TA 2PC8A 2Y7DA 1D3GA 3R0KA 3M0IA 1XRTA 2XTKA 3E0FA 3B04A 2PP0A 3DDMA 4TR9A 3L67A 4ATWA 3D3AA 4MTVA 3RLGA 5A2BA 2J79A 2EEXA 3R1ZA 2PWDA 3HV9A 3TEVA 2Z1BA 4GMEA 5AC6A 6PTDA 2WNNA 2ZE0A 2V2CA 3QGAC 1FXPA 3ZS4A 1XRFA 3DXIA 2QGHA 1RALA 1BAGA 1GEQA 1EZ2A 1OGGA 3HTWA 4XISA 1E71M 1QI5A 3MI3A 5LXXA 5GJMA 3HURA 3SCUA 2YBUA 3W24A 1XW8A 4QNEA 4IUOA 1X96A 4JIEA 2WHJA 1OD0A 4Q4QA 3VKCA 4FR6A 3IIVA 2FB2A 4L7ZA 4L4OA 5LHEA 3W1RA 3C5QA 4A8NA 2GVYA 3WLNA 4MADA 2QCMA 1VJSA 1WNOA 1JPIA 4HCHA 2BV9A 3AYRA 1EEXA 1DPMA 1Q8JA 4GG9A 3MKVA 4IH3A 1OYBA 3PVFA 1JCJA 3GW0A 2OKTA 3WKZA 4TO8A 5BZAA 3LS9A 3M0HA 2PBGA 3LRMA 4GZJA 1JNEA 2HV5A 3RMEA 1Q6CA 1GYLA 1L9WA 4L4LA 3KDNA 4MWAE 3GZ3A 3SCWA 2PPGA 4DLFA 4HU0A 5J8LA 2Y5EA 2J7DA 3E2QA 5ABEA 4W7WA 3B9EA 4MJ4A 1E1CA 5CC3A 1VBJA 3ZLHA 1XYAA 1LRNA 3FA4A 4C6BA 1T96A 6REQB 3STPA 4E8GA 3FX4A 3HFYA 3PBGA 2Y5JA 1OHLA 4XZLX 1RBAA 1BWKA 3V16A 1XFBA 4MJZA 2VRKA 3NVTA 1W1VA 2DY3A 4JFVA 3T0BA 1ITXA 4UTMA 3RLVA 1VFUA 4HHMA 2HZGA 2W91A 5K9DA 2DT1A 1GQLA 4W85A 5HJXA 3KWXA 1JCYA 1UR1A 1H51A 4IIGA 5DCDA 3WNPA 2FPYA 2IKJA 1W56A 3GH5A 1SM9A 2SFPA 2ADAA 3RU8X 1U1UA 1AVAA 3RLUA 5BCAA 1TRDA 4PCNA 3TA9A 4RZ6A 3G1RA 1FVPA 4Q8WA 2HWGA 1DJXA 1S2TA 3UXIA 8CGTA 1A53A 3UWWA 1NDWA 1B2YA 1LRQA 2E6DA 1XLFA 4ZO7A 3P81A 3JR2A 3BOFA 3LLXA 3OIHA 5DMLA 1FY6A 3SCVA 5HPOA 4D72A 1TZ7A 3EWBX 3MZNA 2NSXA 3L2MA 3MVIA 3BCJA 5BU9A 2WBKA 1NVMA 4LY8A 1AH3A 3QTGA 4P7RA 5A6JA 5FJPA 3RYSA 3BK0A 1AJ0A 3ITGA 3FYPA 2X42A 2XSBA 5I77A 3AIBA 4WK9A 3MCMA 1DJYA 1T7LA 4MWAC 4QFUA 3R4IA 3U7BA 1Q4WA 1B1YA 3TW9A 4S3BA 2BVWA 1B9BA 1WOAA 2D73A 3WUEA 3PAOA 3A3HA 3CPGA 3VYLA 1P0NA 3UR8A 1T8XA 1V6UA 4LC8A 4Q8MA 1TFVA 4JEJA 3WLJA 3GU9A 4QG6A 3WBWA 4EWND 3WK1A 3AC0A 4UTUA 3WYZA 1G0CA 2BHZA 3GYCA 4FR1A 2HDJA 4B9ZA 4HMCA 4WSKA 1XLBA 3S1VA 3OO2A 2PUZA 4GYFA 1TV4A 4P7QA 2OR2A 2FDSA 5HR7A 3VNMA 3LCIA 6ALDA 1V0NA 1ZP4A 1E4LA 3QY7A 4LVAA 2FZBA 3CH0A 4PEEA 3WLMA 3BARA 1S2CA 1HJWA 1VYSX 2VR2A 1AQMA 3HFTA 3AIUA 4FNRA 1GVEA 3NSNA 4UTFA 2ZUTA 3C52A 4RZ5A 3W74A 3G1XA 3IV8A 2J9XA 3ARYA 3LQLA 2GOKA 1W91A 2ISSA 4NT0A 5FSDC 1RPXA 5DRIA 4ICCX 4Z2GA 3VOJA 3G1DA 4LRSA 1NM9A 1HO4A 1ADDA 4F2BA 1FWEC 2ZDRA 3KRBA 3MO4A 1HP4A 1FWBC 3TJLA 1A5AA 3UGRA 2VD8A 4A22A 4V1YA 4K1GA 1VENA 4XAPA 4O11A 2KZHA 2WJDA 5T91A 5F2GA 1XGDA 4CVUA 3RCNA 1NOWA 2QXWA 3I6TA 4O54A 1LZOA 3KRUA 5K4ZA 4J1OA 4LX4A 1DL3A 4DY1A 4IJRA 3UERA 2V2DA 1OFPA 3DN5A 1G6CA 4D6JA 3CBWA 4H04A 1O1HA 2A2IA 3RDKA 3KOFA 3AS3A 2QF7A 3H26A 2TAAA 3OGSA 4IMEA 1FFQA 3BAYA 3DAQA 3EWDA 5CBJA 2V81A 4NXKA 3WJSA 4KIEA 4WDWA 4DUWA 4H6RA 3UG8A 2FFIA 4JTTA 2VFGA 5HUPA 1KR0A 4Q8VA 1AW2A 5CH9A 2DZAA 3N15A 4DWSA 4OUEA 3TWAA 1WUFA 2F2HA 4MAVA 4YVXA 2CCRA 1F5ZA 1EDTA 1F3XA 2C19A 3EB2A 4NZ5A 1JQVA 1J0ZA 4R85A 4IGHA 1XCWA 1BG9A 3LI0A 4C7FA 3F4DA 3GR8A 3DOPA 4MMWA 4QCEA 4QQ3A 5JU6A 3K46A 1Q63A 2GLKA 2EO7A 4WSHA 1UKPA 4Y2WA 1HKVA 1L2QA 4EANA 1HT6A 4V15A 1BLIA 1J0YA 3W27A 3KHJA 4CQ9A 3KOZA 3VO0A 5DMNA 4U33A 1EJTC 3CV1A 3MB9A 1UROA 4UMCA 1K02A 3T4WA 2V68A 3PULA 4L1XA 1SJBA 1IEVA 1DE6A 4UQDA 3N29A 1NF0A 3S5OA 1SFLA 4H41A 4MZYA 1OQFA 1VEOA 3PB0A 2IPGA 2JKAA 2GVGA 1XICA 4GNVA 3EWYA 2ZA2A 7TIMA 3UR2A 3L4WA 1RCQA 2ZZ5A 3C8NA 3R6IA 4QG8A 4FNPA 5A8GA 2VGFA 3AXMA 4MFEA 2Z7GA 4ZOAA 4O1BA 2WQPA 1C7TA 2BWGA 3H24A 3EXRA 1Q65A 4IT1A 3LZ3A 1EYWA 3OZMA 2Z25A 3HPFA 5C54A 1OINA 4C1KA 3NZPA 1CGYA 1SZFA 2RKXA 2WQDA 1H0GA 1GOKA 2DZPA 3IWPA 3C3UA 3F2CA 3GXFA 4O53A 3WQVA 4PTMA 3FIGA 4H8VA 1JAEA 2ZIDA 3HM7A 5IDZA 4I8YA 5LNWA 1XI3A 2CLHA 3G24A 1NOUA 1HQTA 1JZ5A 1VIWA 4DWSD 1DTNA 5G2IA 1G4EA 2CBUA 4W8BA 3H7UA 1OFEA 4JYEA 3CEPA 4JDBA 3GHRA 3IUHA 1S5MA 4F3HA 3AZRA 5G4WA 3MANA 3H53A 1TVNA 1A4LA 2YBTA 2X8RA 3GTNA 2CZVA 1DIOA 4BR1A 4IZGA 3CO8A 5D04C 3EPMA 1BFNA 1NP0A 4RE4A 3G0SA 3KOYA 1W1ZA 3PS7A 2DT0A 5C9XA 3M0ZA 3G0XA 3SIMA 2VKZG 2QDHA 3HJZA 1J6OA 5CSYA 4P7LA 4CCEA 2PTZA 2RH9A 2E9MA 4P8VA 1W1A1 3H6OA 4IF2A 3J7HA 4BQ2A 5HUOA 4TXEA 3RR4A 1RP8A 1EGZA 2CZ5A 4GBUA 3WQFA 1U1JA 3UD6A 3M9YA 4XAYA 3S6TA 4N9DA 4X3ZA 4HU8A 5I09A 2HROA 3GTIA 2ZX8A 1XJBA 1K8YA 4A2RA 1VFTA 2FVMA 1PHWA 3N3TA 3DX5A 3IGUA 2EKCA 4ZQMA 1K9EA 1Q7ZA 1EF3A 4PB4A 3USBA 3BZGA 3KCLA 4JGDA 1N8FA 5LNSA 1I0DA 1IQ8A 4C6LA 3TSBA 3FY1A 4A21A 1XRSA 4JTAA 5I06A 1E0UA 2QUUA 4XD5A 4TTGA 4AYGA 3BW2A 5D37A 1FP9A 1TV8A 3ECQA 3AS0A 3LI1A 3SB0A 1TPWA 3L5MA 4N2YA 1F6PA 3GBDA 2PWUA 1FA2A 1GG0A 1RBOB 2Z1KA 3IAPA 4XBSA 1WBHA 1PX3A 3L4XA 3PSVA 4Y8FA 3H55A 4Q8OA 1IXOA 1J0JA 4URIA 1XM3A 3W7PA 2RDXA 1UR8A 1UWTA 3OU8A 4GCAA 2IQDA 3F4WA 1TB3A 1IIHA 3E2VA 4DO6A 2Z6IA 4EPBC 1R30A 4OBRA 4PMVA 1LORA 2RHGA 1A0CA 1D3CA 1EA0A 1KTCA 4O4VA 1GOIA 3CMFA 4UFLA 4RJEA 4TOQA 2WCSA 5HNNA 1ICQA 2C13A 2QCDB 3AMKA 4C91A 1HN1A 2OSYA 1Y7VA 1VP5A 1H2JA 3E3HA 2VGBA 3P61A 3GO2A 2X09A 3N6HA 3B8TA 3NZ1A 1MW3A 5CXPA 5AC4A 1T6MA 1AL7A 3TAKA 2H6RA 3P67A 4GVIA 3GDRA 5D30A 1VPXA 4ZTYA 2QJIA 2QDDA 5EL1A 5REQB 3C2EA 1HXJA 2R91A 3FJLA 3WLHA 3CNYA 1WPCA 1E3ZA 2Z1XA 3LD5A 3L4UA 1PB0A 2EHHA 1K6AA 2OJPA 4JN8A 1SO4A 4D1JA 1V0MA 1PPIA 4JTRA 3QGVA 3GUWA 2X40A 4UCFA 4FLSA 5KSWA 5IHRA 5U4NA 2PP1A 1GVFA 1NWTA 1QI0A 4WGXA 5ECUA 3BUVA 2ZUWA 1I9CB 2DUZA 3H21A 1E51A 2QZRA 5CSSA 3WD2A 2OZ8A 3N11A 4NJKA 4MM1A 3PZIA 3RM4A 5LNRA 3QC3A 1QXLA 3WMCA 3GDKA 3BJTA 2OO6A 4I5UA 3SO7A 4Z2LA 4L9XA 3KX6A 4AD0A 3HOJA 2HNHA 1KM2A 2GPTA 1AA1B 1IXNA 3JVAA 3N2XA 1ZALA 2UY2A 6TAAA 4A3YA 5G2WA 3PP7A 3B9OA 4ZGYA 1TX2A 5JIWA 4JQ1A 3LPFA 4A8LA 5G1MA 3MUXA 1QK0A 5EYWA 1E9LA 4AIBA 3LBOA 3S4TA 2VEPA 1IR2A 1TQJA 4Q4OA 1MVYA 2QVNA 3TIMA 4HVXA 3IVSA 4UNKA 1BSLA 5E70A 1W5NA 5E0CA 4GQ0A 4ZQOA 1ONXA 1KD0A 4AHQA 3GBEA 1TA3B 2X30A 2ZX7A 1TZ9A 3CH9A 3LHZA 3O6YX 4PMNA 3QTPA 3W2KA 1ZCCA 1DTUA 4W87A 1KQYA 2BY3A 3KOXA 2FGBA 3LUTA 3KL0A 2YA1A 3GK0A 1P4CA 1BG4A 3PFRA 3T4CA 3CQJA 2QV4A 4C7DA 1O68A 2DGAA 2ATMA 4UBPC 4YTUA 4CNPA 3UETA 4YN5A 3MTWA 4EAYA 4KERA 3XIMA 3FA5A 3T78A 4ZL1A 1K8ZA 5JUVA 3KL5A 2V5JA 3LA4A 1E0WA 3B05A 1KGXA 4NX5A 4LU0A 2VEFA 1I2QA 3W1NA 2PODA 4GOAA 3B0YA 1L6FA 3VKDA 5GJPA 1LWJA 3LCGA 2P10A 4BK9A 4HMDA 1BF6A 1XIBA 4DZHA 4W89A 1ML1A 3U6WA 2QCCA 3IJIA 2Z2BA 4B15A 4HD5A 5D2YA 4H3DA 4N6FA 5H91A 4DWDA 4NRSA 4HQVA 1WZMA 4GCXA 4HZ8A 1RUSA 1S38A 4PB5A 4NASA 4D9PA 3PTDA 3W01A 5I03A 1JG9A 2BXZA 3GXDA 3DZ1A 4PSRA 3WLPA 4I5XA 1IWPA 3IJQA 3FNDA 4LGXA 1K7FA 3C56A 5HDRA 1EXPA 3G1VA 4MY1A 3NSXA 1ADSA 4J27A 5DT7A 5IOBA 2W66A 3VC6A 5DCBA 2RJGA 2AQVA 3AAMA 5AYXA 1KWGA 3GDBA 4JICA 1PIGA 5CAKA 2GQ8A 2YW3A 2E8ZA 3HMCA 2FJKA 2OYKA 2J24A 4RZ4A 4B5WA 1DQXA 4GO8A 1WYIA 3DECA 2B0MA 1HJQA 3IRSA 4D6EA 1A5SA 2QCDA 3KTSA 4H9XA 1KB3A 3GG8A 1OEPA 1J18A 4HN8A 4KCWA 1TPC1 4ZBCA 1ZSXA 4MNJA 1B3WA 1R3YA 1DWFM 4U10A 1UH2A 1S5TA 3VNJA 3VNDA 2V5LA 2BGSA 4J2PA 1FWHC 4H8UA 5AKQA 4F0KA 3KFTA 2NSOA 2QIWA 5KITA 1OABA 1SFTA 4L9YA 4WEVX 4NUWA 1R5YA 4PUWA 4Q8NA 1Q2SA 4US6A 1TKKA 4Q7BA 2OU4A 2XGBA 3M41A 5IFTA 2A3BA 3FSTA 3VNZA 5IXEA 4GXMA 3LV6A 5AZ0A 3GG0A 2VO5A 1OD8A 3TX9A 2F6KA 1NH6A 3N12A 4UXDA 2QJJA 4O1FA 4QSHA 3VIKA 5K4XA 4WY0B 1XG4A 1KCXA 2YCJA 2QCFA 4XVDA 4B5NA 4HNCA 3VX1A 3NURA 3MHGA 4JTJA 1H7PA 1RSCA 1D2KA 4H6EA 5FEXA 1JJKA 2ZYFA 5JVLA 4GIYA 3R0DA 3MSDA 2Q8ZA 3L5AA 2JIWA 2BFGA 2Y88A 2HPIA 4LCSA 1K03A 3GSMA 3W6YA 4QITA 1IEXA 1F4HA 2PZNA 4J40A 1RQEA 3AHZA 3E96A 4AX7A 5FJTA 4F40A 1US3A 4DBDA 2PS2A 3HU7A 4LJ3A 3R7MA 2X1SA 1PKLA 1F76A 1JI1A 2IQTA 4N9BA 2V3FA 3NPUA 2QJGA 4ZZ9A 5FACA 4AD5A 2JQXA 1QPNA 3T2QA 1U5JA 1VZWA 1PVNA 1VFOA 1O7AA 5I3IA 2YCLB 3BGJA 2PDWA 4V1XA 1XYCA 1FH7A 1A5NC 1MUWA 4CVWA 1UR2A 3NL6A 2YGYA 3ZIZA 4LNYA 3WK2A 3V0TA 1OCQA 4MUZA 2ALDA 2RJHA 4Q4KA 2DSVA 4TMBA 1ICPA 3RU6A 1SGJA 5LIWX 5FF0A 1RP9A 1QU4A 4WUIA 2VXNA 3EGJA 4QM1A 5HMEA 4DM1A 2VCBA 1E1FA 4FXFA 5JQ9A 3R10A 1FWIC 3DG7A 2PRMA 4Q33A 4EK7A 1JAKA 2OZ3A 1RCXB 4W86A 3O15A 1MRAA 3II1A 4CCZA 3ME3A 3RRXA 3U2OA 5CAHA 3MW7A 2C14A 3SQLA 5LGZA 1UJPA 4MKVA 1XG3A 4S3FA 3DERA 4L64A 4U3AA 1SQ7A 1W1IE 1RK5A 3M1ZA 3N4FA 3PTQA 1NY1A 3WDQA 2E6YA 1N8IA 2X0HA 2PU1A 3LNMA 1E0VA 1TJ0A 3IJ8A 3IVUA 1QO5A 2B7PA 1JNDA 1TE1A 4RDWA 3BWWA 1PZ3A 3V75A 4AQLA 1D9EA 5LNVA 1KXHA 4Z42C 3S0CA 2J7FA 4R9OA 1MNZA 4JR5A 1WZKA 1KBJA 3LHTA 2J8TA 4M7SA 2YR1A 3B06A 3GB6A 1ODZA 4ZFCA 3EDEA 3VDCA 5E9XA 4LNCA 2ZA1A 1GTHA 1TMLA 3E0WA 1XKYA 1PTAA 1XLCA 2PF0A 2QMJA 2A3CA 4WQ6A 3VC5A 1GYMA 2AAAA 1AMKA 1EDGA 3SQMA 2QF8A 4QQUA 4XBKA 4UTKA 3H2MA 3KVLA 1AZ2A 2Y7FA 4TV6A 3AI0A 1RY0A 2P8CA 3BQ6A 4DO7A 3P5ZA 1Q4NX 4ML9A 4NNBA 1J10A 5BOEA 3MSRA 4JFSA 2C1HA 2P50A 2W4XA 3HA1A 1TTQA 2WSKA 4FPSA 2OKOA 3URAA 3EXSA 3UR5A 3WNOA 1CWYA 4NQ1A 1ZP3A 3KXQA 3T55A 3C2RA 1QBBA 2WC3A 2VZTA 1HKKA 4MKSA 4JTCA 2I9UA 2ZZ2A 3L21A 1XLDA 1ODUA 2D2HA 5I5RA 4QCFA 4B5UA 3CT7A 2YW4A 5A8NA 1VEMA 2XUCA 3B4UA 1ZBWA 4MY8A 5HNRA 4PMUA 4WZHA 3M46A 3L4VA 1UMYA 1KRBC 5CCZA 1UP3A 1YDYA 3LPOA 1ZU8A 5C9WA 3PF3A 3P0WA 3PN8A 1YNYA 3VGHA 3V36A 3T9PA 5CG0A 5A3HA 2ZUNA 2DVUA 3CAVA 3EEGA 5AHMA 2VZVA 1HKIA 4HJWA 1W37A 4FP1A 4XQ6A 4I9JA 3W2JA 4C7GA 3R25A 1KCZA 4S3EA 1PTDA 1DJWA 3GC5A 4JIHA 1HJXA 4BF7A 1JZ2A 1W54A 1BHGA 3W7OA 4E8DA 1CBGA 3P82A 3CO4A 5EMUA 5JIPA 2POZA 5DQPA 3W26A 5LIYX 3NYZA 1X6UA 2ZCGA 4B3LA 3N9KA 3R12A 1VBHA 1TPB1 2FH6A 3I10A 1TIMA 5D9MA 2GJRA 2BP1A 3COTA 5I0DA 4JN7A 4PB3A 3R5EA 3P8IA 1XBVA 2Y8VA 2GJPA 2WMHA 3EA1A 1M7JA 2J88A 2PURA 2GK1A 1A50A 5D8ZA 1WB0A 2AGTA 4KGJA 4AIEA 3WJZA 1OK6A 4HIBA 3EOSA 1XBXA 3N9SA 4DBWA 4IPNB 2D2JA 3OBEA 2VZUA 1MNSA 1U1HA 4C1NB 4CU6A 1LF1A 4JQ4A 3MJYA 3OBKA 3LPGA 2JKPA 1R86A 1GJPA 2WLYA 3M6DA 2YLLA 1YIXA 2OTDA 3LXAA 1D8WA 1JCTA 1R9YA 3EDDA 5U7SA 2HEJA 4C60A 3VUPA 2QCNA 2W92A 4Y9OA 3CUXA 2V9DA 2VP8A 1QO2A 3DHPA 2WSYA 4Z1CA 2Q01A 2Y7GA 3L0GA 4YJ5A 2CESA 1ZLPA 2QUVA 1H62A 4LY4A 3TN6A 2J47A 3NSMA 4LAMA 4XD3A 3O0FA 3THDA 5CZTA 3NEVA 4MB3A 3A12A 5JBFA 2F6XA 3KWSA 8TIMA 4UTIA 4QEHA 2QT3A 1AQ0A 4J3VA 2NQJA 4GIAA 2QQ6A 4N9CA 3S46A 2VURA 3L65A 2OLAA 1I1WA 5DMYA 2IPFA 5BMXA 1AJZA 1E1EA 4G7EA 2YCLA 3L4ZA 3N6JA 2W6RA 2DT2A 1FCUA 3CL8A 2BSLA 2V82A 1CW2A 3CK5A 3RGTA 2X1TA 4XZBA 8RUCA 4U5KA 3TUUA 5HJLA 2YYTA 2PDNA 3PZQA 3UG4A 4ALDA 1FUYA 3M44A 1IZJA 3ONCA 4M51A 1VC4A 1XC6A 1P1MA 4JTQA 3WNKA 2GQ9A 1RV8A 5EB8A 1Z44A 3DI0A 4R53A 4IICA 3LMZA 1K7EA 2D22A 3TCEA 3LYEA 1S1PA 2PDMA 3W37A 1HL9A 4WSJA 4UIOA 3DG3A 4JCMA 4S23A 4UZUA 1MFUA 2VC7A 4GC4A 3MMDA 4HK5A 2Z2UA 4GD0A 3ABQA 1Z41A 1OSEA 4N6EA 4KS0A 3W0KA 1A5UA 2CFFA 4GPNA 3U0HA 5GVJA 3DGRA 1FH9A 3M0KA 1YYAA 4Z1DA 2NZLA 2V8ZA 3LBCA 3APYA 1XIEA 3AMLA 3LGEA 3PJWA 3KAOA 4ZSUA 4NG3A 3P60A 4N4PA 2VJXA 3QOKA 4AWEA 1C9DA 1R7OA 1QNSA 3EXTA 5C55A 4GFIA 3APGA 1OZMA 4PUDA 2DZWA 2V5BA 4EPDC 3LNPA 3C0SA 5GPRA 3N4EA 5D9PA 1AD4A 1EEPA 4G6CA 3TN5A 1GOOA 3LBMA 1JDAA 3R0UA 3TYEA 4DPPA 4YNGA 3L23A 4U2YA 2R1LA 4XG1A 4AD4A 2QNEA 4FNTA 2WMFA 3P6LA 4GQGA 1XQLA 3LEPA 2NUXA 4HNLA 4WKHA 3G77A 3H2AA 4Z1YA 3VCCA 1K9FA 4MVAA 4Y8EA 4KCUA 1KNWA 3W7LA 2ISWA 3BO9A 5I07A 3M0LA 2H8ZA 4H9MA 3NAVA 1Y0EA 2GZXA 2WLZA 2R8WA 2DVTA 2VFHA 3UF9A 4EE9A 4GNKB 1LQ2A 2ZRUA 1KWKA 1B3VA 2C79A 1GHRA 4DXKA 4AEEA 1DXEA 4PFMA 4GWEA 5GNYA 3S9IA 1QI4A 3L0KA 1ZFJA 4Y96A 1QI3A 1RH9A 2PBOA 4GGHA 3WX7A 4H6QA 4HK6A 3FN9A 4HT3A 3K1DA 1EBGA 3K4DA 3I4EA 1KFJA 3WH5A 3AHXA 4KCVA 1U5HA 3URBA 1VGAA 2JGYA 3ABOA 1FKXA 3UY8A 2V6AA 1W1YA 2YKKA 1IT7A 4N4QA 2DZUA 5KINA 4LYKA 3ISIX 3FW6A 4KEVA 2A4AA 3EWUA 4H8HA 2PSNA 3AXKA 4DIAA 1E72M 1E9ZB 2BASA 3WQ8A 3ZVIA 2EG8A 3QFWA 4KEMA 5ABFB 1BEUA 1J0KA 3IGHX 1KTBA 5ECVA 4QBXA 3HPSA 4J3WA 3WLOA 3FDGA 5AYYA 1HL2A 2QDEA 1US0A 1VPYA 2O4MA 2RDWA 2I14A 3QZEA 4Z2KA 1E6XM 2GQ3A 3BGAA 3QSTA 1P0KA 3AISA 2INZA 1NSJA 3TXVA 4AD1A 2DFAA 1V3JA 4PTDA 1QFEA 3SY5A 3I7SA 2O9PA 3ARZA 5GNXA 1KFKA 4KMQA 4W7UA 3CZKA 2OEMA 1CECA 3W7NA 3TFCA 4A8IA 1CPUA 3STGA 1GZGA 1TJ1A 2PF8A 3BAXA 3U5YA 1B4EA 1ISXA 3ERPA 2E0PA 2NQHA 2BG5A 4H00A 5FL1A 4X63A 4BEQA 2J6VA 1LCOA 5HWJA 4ERAA 4PRRA 1EC7A 2P0OA 2VEKA 3BPWA 3UCQA 3NL2A 1QPOA 2Z2AA 1GVSA 4OUIA 1UWQA 3CB3A 2JFEX 1YDVA 1IEWA 3O06A 1K9DA 4JKKA 4IP7A 3UYIA 5ABFA 1JI2A 4OJYA 1R8LA 4WD0A 3A6OA 3CL7A 4O1EA 1WAUA 2Y2WA 1M5WA 4DM2A 4GC3A 4LAKA 4O10A 4IQEA 4L6OA 5I24A 4X22A 3M7SA 4XZWA 1QNQA 1YPFA 5J5RA 1PDZA 2EF9A 1W3HA 5C8BB 4Z0JA 1QJWA 1YDNA 1AZ1A 4HZ6A 3AOFA 3KL3A 3MWAA 4AXNA 2ZC1A 1EQPA 3LG3A 2PDXA 2VL4A 4UQEA 4AVFA 4BWLC 4O50A 4QG9A 4EXAA 5K9CA 1FXQA 4LUYA 3O6AA 1G7UA 2QV5A 1SPQA 3KVMA 1C8VA 3N1AA 4W84A 5ABHA 3DYOA 1SO6A 4MOZA 2QAFA 1VYPX 1UYQA 5B7ZA 1M3UA 1XBZA 4F0SA 4W5ZA 4TUFA 3HG4A 2C91A 1F2JA 4M80A 5AYBA 1E9YB 3CQHA 4I3GA 4US5A 5FIPA 2WZIA 4LBSA 2NQ5A 2WBGA 3N4AA 1VEPA 4KETA 1S39A 4CQ8A 3W1LA 5GQBA 2VWTA 3E5BA 3NXFA 1NP2A 4RPPA 5BRBA 1VHNA 1UP0A 3VMOA 1AK5A 3C4UA 2D23A 1N8WA 3WDHA 5CQ1A 1XYZA 1FWSA 1HW6A 4O8RA 4YS1A 1XH1A 1B3OA 2VQUA 2CNCA 1T8QA 2D0GA 4KFOA 4BZYA 1HVQA 4JL1A 3WIJA 4Q3MA 5KETA 1B3XA 4EKJA 3A4JA 2WYSA 3FA3A 1R3TA 5F7UA 4YMZA 4JX6A 2VENA 3PBUA 1CGXA 4JTIA 1X7FA 1S2WA 3VUSA 3KM8A 3WENA 3CV2A 2YL8A 5BRQA 3CWHA 4AW7A 4NY2A 2ZQ0A 1WA3A 3AUJA 4HOWA 4XSMA 4PN2A 4QS5A 4D6GA 3SADA 4CNOA 5HATA 5E0FA 3GKAA 3OG2A 4FXRA 1PSCA 3IARA 3VIGA 4AZCB 4M6PA 4PTXA 4WLCA 4V33A 4MFDA 2XZ9A 5A8OA 3MCOA 3O9NA 5EPDA 2E25A 2J74A 2F84A 4CNNA 1BSIA 1S3HA 4JIQA 4U2ZA 2J62A 2ZUUA 3U8GA 4C6IA 4GGBA 5CSRA 4GBDA 4ICNA 4GXWA 4AYSA 3L4TA 2ZBTA 2E40A 3LTSA 6A3HA 1SMDA 4IJCA 1OG0A 1CT5A 3VD4A 3UXLA 4E2OA 4F66A 2Z1WA 5H6HA 3C2FA 4W4QA 1A5LC 1HG3A 1H1ZA 3PNZA 4FK9A 4HK7A 4JX4A 1PXGA 3LHUA 4NHVA 3TYUA 2QVHA 2PDPA 4J3UA 4ONVA 2EJ1A 2WKLA 3EEZA 4ROQA 5AHNA 3TJ4A 1RD5A 4ZE5A 2W9MA 1GQKA 3NIYA 4AVOA 5D03A 4IXXA 3UT0A 1ZAHA 3WNNA 3AYSA 4B2DA 5T26A 1BVZA 1OG6A 1EDQA 3H2CA 3G6MA 5CBBA 3OOQA 2JALA 2XH7A 1EKOA 2NT0A 1S5VA 3GHTA 5KZMA 3K5XA 3PR2A 2O55A 1R2SA 3BJSA 5HXMA 1D3HA 4BI7A 4RV8A 1JYXA 3SGZA 1QDSA 4A3QA 2VHLA 1FWRA 4NJHA 1ZQ5A 1P43A 3W53A 4XAGA 5CC5A 3VKJA 4NU7A 2GVJA 1PYMA 1XIGA 4OECA 1GOWA 4Y90A 3AMDA 3AO0A 3WQ6A 3CAKA 2BB0A 1KC7A 2XDFA 2Y7EA 3F4CA 4E2DA 3AS2A 2QW5A 4ZXOA 3D0CA 1S46A 4N02A 1HX0A 4IFKA 1XLHA 3CIWA 5AECA 2QGYA 4EPKA 3AYTA 2CXGA 4LBRA 2QIIA 3FHQA 4FLOA 1H1YA 2YPIA 3R8RA 1CCWB 2ZTJA 3EPNA 1MXGA 4Z2IA 3QR1A 4Q7NA 1BGGA 3W1AA 1MWOA 3VOCA 1P6BA 4H8NA 3RK8A 4HNNA 2HNEA 2C1IA 1M03A 3UPWA 2ISDA 3LGDA 3BW3A 4PMDA 2G5WA 4Y9NA 4F8XA 3B8VA 3CV7A 3DYPA 4B5XA 1CB2A 1JXJA 1R3VA 2J7BA 3IK4A 4IP4A 1W6TA 1IT0A 2OELA 3RG6A 2RDUA 1M04A 1XPYA 3MI2A 4ICMA 4LALA 4S2CA 3BVJA 3WLSA 5LSMA 4WR3A 4NYYA 3E6EA 5CG7A 1LLOA 3I6EA 3LCWA 4YXGA 4LAUA 3RPMA 3WLLA 1KKOA 2L5HA 2FTPA 2W0UA 4NJIA 1PV8A 5EMJA 3A4WA 3GNOA 3W6LA 1DHPA 1RA0A 3KBJA 3WO8A 4F0RA 1JDEA 4V2XA 1TV3A 1XR2A 1FDJA 2Z0IA 2WVTA 5LKYA 4AY8A 1OX4B 3O7UA 3SCOA 4ZE4A 4QLJA 1FCVA 5ENLA 4FNQA 3VILA 2DP3A 1VYRA 4C6NA 1NWUA 3NQFA 3PWGA 4MJMA 2VX5A 3OHMB 3A23A 3M16A 4TX8A 4UOQA 2W63A 4E6MA 3VZYA 1CTNA 1KQZA 4JIIX 3GHSA 1MW2A 3WK0A 4XZ9A 4TX6A 2HJPA 3PUGA 4ZQNA 3O07A 1GJUA 1VFHA 4XV0A 4WF7A 5TBOA 4PMQA 3EMZA 4YCOA 3AJXA 4O14A 1XH0A 2O9TA 3GW3A 2YIHA 5CEWA 1LG2A 3ALFA 3EPOA 2BODX 3S47A 3LTPA 3CASA 5CPLA 3WUGA 3EMCA 1V77A 5JXQA 4RNFA 1XD1A 4MYXA 1E4NA 1OYAA 3CV6A 2Y8UA 1V6TA 1T99A 3ZJ6A 2WNZA 4HU4A 4X60A 4XKMA 1OFAA 3C0QA 1P0BA 3SRDA 5CLTA 2ZZ3A 3TTYA 1YE4A 1VFLA 2OSXA 4D8AA 3OQ8A 3R79A 3KDOA 1JCMP 3AQUA 5C9RA 1KM5A 3FEMA 4RDZA 2VOMA 3CLWA 5A8MA 1GEHA 5FJRA 5FCZA 4JEQA 2FZ9A 4XB3A 4HNOA 3SUVA 4ZMGA 2C6QA 2P0IA 3TSMA 1WXYA 3MS8A 7TAAA 1SW7A 3IUDA 4JIPA 4DJED 1XDMA 4C6QA 3RR1A 3AHTA 1UWIA 4B4HA 1JR1A 2J27A 4JL2A 4HGXA 1QHZA 2WZTA 1ISVA 2YOCA 2DT3A 3WQGA 5DRCA 5D33A 3DIPA 2P3ZA 3S8HA 3WF0A 1EJXC 1R0MA 1K77A 1RVKA 3GX9A 3IEBA 1EJUC 5H1WA 1M65A 1TPEA 2AQOA 4JPGA 5E1QA 4LB3A 1PZ1A 3MHFA 1GHSA 3VNLA 4D8ZA 1ME7A 3KP0A 3CLMA 4PL1A 5I78A 3PHAA 2PDUA 3T44A 4XTDA 4CN6A 2WM1A 1NFBA 4K6AA 5MKGA 3QYQA 2E28A 3HIJA 3MMTA 3G1FA 3B8IA 4JS3A 2CW6A 2ZRZA 5DLCA 1ZJIA 4PA8A 1GONA 1A0EA 3NL3A 1GVYA 1VAHA 3TXZA 4CQAA 5E0KA 1K4HA 4LVGA 5C9UA 1D8CA 3QBUA 3TN4A 2HK1A 3TTQA 3LHVA 3SN1A 9RUBA 1JD7A 1UD5A 5GJNA 4L9ZA 4JBRA 3N3MA 4IFRA 1K8CA 5ABGA 3A24A 4HCLA 4S3GA 1W31A 3LENA 2WHKA 1QHPA 1UKQA 4KRUA 4OE7A 4BCEA 4M3PA 1UPMB 1BTCA 4U5IA 3CHVA 2PGFA 3RCMA 3RPTA 4TTUA 4Q4RA 1IXQA 1EBHA 3ARXA 1EWEA 3S1WA 1BQGA 1KR1A 4JTGA 2AMGA 2X41A 4MGGA 2EG7A 3H2OA 4PZVA 5FD0A 4AFYA 2EG6A 3OVQA 2XVKA 1EJ7L 1G9HA 3DC8A 1LT7A 5JBEA 3NEHA 1POKA 3KHDA 3WJXA 2HBXA 4LB4A 3L2LA 1ZNNA 2ZVIA 4FI4A 2ATSA 4IUGA 4PULA 4XIMA 1XLAA 3OG3A 1M7OA 1UR4A 4DPQA 1C8XA 4PUNA 3TN3A 2VFEA 1IZKA 1OFOA 3T8QA 3H8AA 4IFKB 2LLEA 2VEIA 3IIZA 1NDYA 2QCEA 2YBVA 1JQXA 1OT1A 3ZR4A 2IKHA 1SZEA 3RJXA 3E2RA 3WQ4A 3C2OA 2CLPA 1W3TA 4O1DA 4AZBA 3ANVA 3ZT6A 2DJLA 1P7TA 3EBVA 1LBFA 4LCQA 4QROA 4AVNA 1M68A 4UTTC 6XIMA 4AZ5A 1IXPA 3N19B 5F1VA 1JUBA 2J77A 2ZC8A 1J8VA 3WEMA 2ZXAA 2BTMA 2H9AB 1YNQA 3BTNA 2WVVA 2HS8A 3MU7A 3V4BA 5LA2A 1X7IA 4R34A 3SGGA 1EX1A 1JZ3A 1W0MA 1EUNA 1SJCA 3ABXA 2Z6JA 4HA0A 3QZAA 3M5XA 3KRZA 3MMWA 2AL2B 1O6IA 3LMYA 1TPH1 2Z27A 3TSDA 4GISA 7ENLA 2CLLA 3KZSA 4PE8A 3URNA 4EF9A 3GYEA 5AC7A 1F4AA 1ZTVA 3GS6A 4CU8A 1TVPA 1YXDA 3LTYA 5CPQA 1UB3A 3W71A 1VH7A 1XIFA 3M0JA 3T1GA 1W2VA 3C0JA 1G7VA 1MXDA 2ZRWA 3AS1A 3VIOA 2Z26A 2EJAA 1XKJA 1PTGA 4NX0A 4L1WA 5LA0A 1H60A 3TTSA 4IJBA 3NG3A 4PBFA 3WMBA 1FWCC 2OCZA 4LEFA 5EBUA 3DH7A 1UQYA 1G4SA 4HHHA 5E6ZA 5A1AA 2NVCA 2CLEA 1P0EA 1ZL1A 3SY1A 5CJ5A 3SDOA 5EFFA 2BOFX 3K4WA 4JFWA 3TZNA 2YL9A 5CJNA 3LQGA 5M2FX 4FOUA 1VLWA 2E7FA 5HJYA 1W8GA 1V3HA 5C5YA 3G0UA 4F9JA 2XFYA 1TCDA 2WOQA 3W1MA 1JCNA 4G56A 3AIVA 4FA3A 3SSZA 4O0QA 2ZZ4A 4MWAD 2VDIA 1FWWA 5GNZA 2G37A 3IJDA 3AHYA 5I3KA 3CQ0A 1R2TA 5M17A 1H1NA 4P8WA 3W22A 2Z7KA 3SQSA 3VD3A 3CJPA 1ZAJA 1TR9A 1TJ2A 4X61A 4G9PA 3AZTA 4Y6GA 4GUIA 4NJJA 5EKYA 4YHGA 3MP3A 3AICA 4GUJA 4Q8UA 2NV2A 5F2LA 4IIDA 3MUCA 2DDXA 3A3XA 1V0LA 4LYQA 1PKMA 4TVDA 5XIAA 3VGGA 3LHWA 4IWWA 5IFPA 2NX1A 3IUIA 7A3HA 2A3HA 4C5ZA 1GK8A 4A3HA 3KBMA 3PTMA 4X9SA 5KTLA 4AZHA 3GXMA 4G2DA 3TNOA 4ZVJA 5AHEA 3ARTA 4DN1A 3AWNA 5FF4A 1DWGM 1JUEA 3ARVA 5I3GA 1KGWA 2G97A 1W3LA 4GJ1A 1FWFC 2XJ7A 3BOXA 3PZVA 4EVZA 4QAWA 3THAA 4DF1A 1SW0A 2VUYA 2JEPA 3ITXA 3V35A 4K8GA 3DHUA 3WSUA 4ERGA 1X8FA 1I0BA 2OYLA 2Z4GA 1XX1A 4G8TA 4KCTA 2VGIA 5LHFA 4HSHA 4KFPA 2FB3A 1H11A 4RE2A 3SN0A 1RA5A 4E2VA 1ONRA 2DQWA 5M5DA 3DFNA 3B3DA 2VD9A 2XSXA 2XM2A 2WV8A 2XN1A 5HOSA 3CYVA 1M01A 3FSUA 2OWXA 5CPSA 2REQA 5D05A 1UOZA 1AW1A 1MEHA 1UPPA 1KGUA 4NZ4A 1UBPC 2IKIA 1YPXA 1HUVA 2PTYA 2REQB 2BVYA 2I16A 4NAEA 4HTBA 1HGWA 3RHGA 1UKTA 4F0HA 1PWMA 3U4FA 4HPHA 2QR6A 3ENLA 4H9VA 5HMSA 1TJPA 5A8PA 3W7DA 3H4XA 2WVUA 2FPTA 3B8DA 3TJIA 3UCCA 1VIZA 2CBJA 3BGGA 2TODA 4C6MA 3EAUA 5BYWA 3O05A 1E43A 1J4EA 4MY9A 1MQPA 5CC7A 1WKDA 4EIVA 3AUOA 3HBLA 2RUSA 3GTFA 3WD1A 2ZX5A 1VS1A 3HV8A 4GYPC 4A35A 1QWKA 1VQTA 1MSSA 3KTCA 4YCPA 4JX5A 5BXSA 2V69A 3U57A 3TOPA 4G7EB 4O1CA 3WUFA 2IXUA 4HZ7A 2PDBA 3MHUA 3DFTA 2J8FA 2E5CA 1FWAC 2XWEA 3ATZA 2E6AA 5LIUX 2A85A 4BF9A 1DJGA 3FV9A 5D9NA 1JD9A 4AISA 2VEGA 5DEZA 2DIEA 2TPSA 3H4GA 3S5YA 4J2MA 1LROA 1XSIA 2WW5A 3OPSA 1MUCA 1CLXA 1TMHA 2IS7A 3K8MA 3G2GA 3TONA 1BVWA 4AY1A 2IKGA 4G5DA 2V5KA 4UFJA 4BKNA 2YCEA 1DJNA 4WXZA 4IIEA 1XYMA 1LM1A 3UA3A 2CLFA 4J4KA 3NQGA 1Q6RA 4XX6A 1FP8A 3ITVA 4N0RA 4PUUA 3ABRA 3W7CA 4NL1A 1I8JA 2YA0A 1UH4A 1F3WA 4KT2A 1SW3A 3W1UA 3N2CA 5H8PA 4O57A 3KEHA 1RHCA 3PPHA 3BLPX 3IGXA 4UCGA 4GNJA 3GIYA 2D69A 3VNKA 3OLIA 1MQQA 1R3RA 1H5YA 4ZB5A 2H9AA 3NTYA 4MUPA 1JL8A 1E9IA 3EKZA 1ZHAA 3BICA 3PPCA 3BV7A 2BY0A 1R85A