3FLVA

The crystal structure of human acyl-coenzymea binding domain containing 5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
SMHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMIAYVEEMKKIIETMPM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA-binding domain-containing protein 5
publication title The crystal structure of human acyl-Coenzyme A binding domain containing 5
rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 3flvA00
1EF1A 3AU5A 4F7GA 3BINA 3EPYA 4NY0A 1MIXA 2CB8A 3FP5A 2COPA 3IVFA 2AL6A 3FLVA 4YL8A 2CQUA 1ACAA 2FDQA 1HBKA 1ST7A 1NI2A 3ZDTA 4DXAB 5IJMA 1GC7A 2D11A 3X23A 3AU4A 4P7IA 2ABDA 3WA0A 4CYEA 1Y19B 4EKUA 1GG3A 1MK9B 1H4RA 2LBBA 2EMTA 1NVLA 2AEHA 4ZRKA 1SGHA 4HDQA 2HRJA 2WH5A 2J0KA 3QIJA 1GC6A 3U8ZA 1ISNA 2ZPYA 1E5WA 3PVLA 1J19A 2D2QA 2YVCA 3U7DA 2I1JA 1HB6A 4HDOA 3PZDA 1HB8A 2RQ1A 2EMSA 3G9WA 2J0MA 1MIZB 2FJ9A 2J0JA 2I1KA 1MK7B 2D10A 2HE7A 1NTIA 4ZRIA 4ZRJA
chains in the Genus database with same CATH superfamily
3AU5A 3EPYA 1MIXA 2DIKA 3E9PA 2FDQA 1GC7A 4JK9A 1GG3A 2R82A 1NVLA 1SGHA 1GC6A 3U8ZA 1J19A 3U7DA 2RQ1A 3SBTA 4JKGB 2J0MA 1MIZB 4JKHA 4HDOA 2I1KA 2WH5A 1NTIA 3E9OA 4JK8A 4JKBA 3IVFA 1ST7A 1NI2A 1DIKA 3SBGA 3AU4A 4JKDA 4EKUA 3E9LA 1KBLA 4JK7A 4JKFA 3QIJA 1E5WA 3PVLA 2I1JA 3ZDTA 4ZRIA 2HE7A 4ZRJA 5JVLA 1EF1A 3E66A 4ILGB 4F7GA 3BINA 1VBHA 3FP5A 4JKAA 1ACAA 4JKEA 4YL8A 1JDEA 4DXAB 5IJMA 4P7IA 4JKGA 2ABDA 4CYEA 1H4RA 2LBBA 2EMTA 4ZRKA 2AEHA 4HDQA 2HRJA 2J0KA 1KC7A 3ENBA 2D2QA 1VBGA 1GGOA 4GXBA 2EMSA 2FJ9A 2D10A 4NY0A 2CB8A 2COPA 2AL6A 3FLVA 2CQUA 4ILHA 1HBKA 2D11A 2X0SA 3X23A 1Y19B 1MK9B 4JKCA 1ISNA 2ZPYA 4TKNA 2YVCA 1HB6A 3PZDA 1HB8A 4ILJA 3G9WA 2J0JA 1MK7B 3WA0A
chains in the Genus database with same CATH topology
3AU5A 3EPYA 1MIXA 2DIKA 3E9PA 2FDQA 1GC7A 4JK9A 1GG3A 2R82A 1NVLA 1SGHA 1GC6A 3U8ZA 1J19A 3U7DA 2RQ1A 3SBTA 4JKGB 2J0MA 1MIZB 4JKHA 4HDOA 2I1KA 2WH5A 1NTIA 3E9OA 4JK8A 4JKBA 3IVFA 1ST7A 1NI2A 1DIKA 3SBGA 3AU4A 4JKDA 4EKUA 3E9LA 1KBLA 4JK7A 4JKFA 3QIJA 1E5WA 3PVLA 2I1JA 3ZDTA 4ZRIA 2HE7A 4ZRJA 5JVLA 1EF1A 3E66A 4ILGB 4F7GA 3BINA 1VBHA 3FP5A 4JKAA 1ACAA 4JKEA 4YL8A 1JDEA 4DXAB 5IJMA 4P7IA 4JKGA 2ABDA 4CYEA 1H4RA 2LBBA 2EMTA 4ZRKA 2AEHA 4HDQA 2HRJA 2J0KA 1KC7A 3ENBA 2D2QA 1VBGA 1GGOA 4GXBA 2EMSA 2FJ9A 2D10A 4NY0A 2CB8A 2COPA 2AL6A 3FLVA 2CQUA 4ILHA 1HBKA 2D11A 2X0SA 3X23A 1Y19B 1MK9B 4JKCA 1ISNA 2ZPYA 4TKNA 2YVCA 1HB6A 3PZDA 1HB8A 4ILJA 3G9WA 2J0JA 1MK7B 3WA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 A;  3AU5 A;  4F7G A;  3BIN A;  3EPY A;  4NY0 A;  1MIX A;  2CB8 A;  3FP5 A;  2COP A;  3IVF A;  2AL6 A;  3FLV A;  4YL8 A;  2CQU A;  1ACA A;  2FDQ A;  1HBK A;  1ST7 A;  1NI2 A;  3ZDT A;  4DXA B;  5IJM A;  1GC7 A;  2D11 A;  3X23 A;  3AU4 A;  4P7I A;  2ABD A;  3WA0 A;  4CYE A;  1Y19 B;  4EKU A;  1GG3 A;  1MK9 B;  1H4R A;  2LBB A;  2EMT A;  1NVL A;  2AEH A;  4ZRK A;  1SGH A;  4HDQ A;  2HRJ A;  2WH5 A;  2J0K A;  3QIJ A;  1GC6 A;  3U8Z A;  1ISN A;  2ZPY A;  1E5W A;  3PVL A;  1J19 A;  2D2Q A;  2YVC A;  3U7D A;  2I1J A;  1HB6 A;  4HDO A;  3PZD A;  1HB8 A;  2RQ1 A;  2EMS A;  3G9W A;  2J0M A;  1MIZ B;  2FJ9 A;  2J0J A;  2I1K A;  1MK7 B;  2D10 A;  2HE7 A;  1NTI A;  4ZRI A;  4ZRJ A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  3EPY A;  1MIX A;  2DIK A;  3E9P A;  2FDQ A;  1GC7 A;  4JK9 A;  1GG3 A;  2R82 A;  1NVL A;  1SGH A;  1GC6 A;  3U8Z A;  1J19 A;  3U7D A;  2RQ1 A;  3SBT A;  4JKG B;  2J0M A;  1MIZ B;  4JKH A;  4HDO A;  2I1K A;  2WH5 A;  1NTI A;  3E9O A;  4JK8 A;  4JKB A;  3IVF A;  1ST7 A;  1NI2 A;  1DIK A;  3SBG A;  3AU4 A;  4JKD A;  4EKU A;  3E9L A;  1KBL A;  4JK7 A;  4JKF A;  3QIJ A;  1E5W A;  3PVL A;  2I1J A;  3ZDT A;  4ZRI A;  2HE7 A;  4ZRJ A;  5JVL A;  1EF1 A;  3E66 A;  4ILG B;  4F7G A;  3BIN A;  1VBH A;  3FP5 A;  4JKA A;  1ACA A;  4JKE A;  4YL8 A;  1JDE A;  4DXA B;  5IJM A;  4P7I A;  4JKG A;  2ABD A;  4CYE A;  1H4R A;  2LBB A;  2EMT A;  4ZRK A;  2AEH A;  4HDQ A;  2HRJ A;  2J0K A;  1KC7 A;  3ENB A;  2D2Q A;  1VBG A;  1GGO A;  4GXB A;  2EMS A;  2FJ9 A;  2D10 A;  4NY0 A;  2CB8 A;  2COP A;  2AL6 A;  3FLV A;  2CQU A;  4ILH A;  1HBK A;  2D11 A;  2X0S A;  3X23 A;  1Y19 B;  1MK9 B;  4JKC A;  1ISN A;  2ZPY A;  4TKN A;  2YVC A;  1HB6 A;  3PZD A;  1HB8 A;  4ILJ A;  3G9W A;  2J0J A;  1MK7 B;  3WA0 A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  3EPY A;  1MIX A;  2DIK A;  3E9P A;  2FDQ A;  1GC7 A;  4JK9 A;  1GG3 A;  2R82 A;  1NVL A;  1SGH A;  1GC6 A;  3U8Z A;  1J19 A;  3U7D A;  2RQ1 A;  3SBT A;  4JKG B;  2J0M A;  1MIZ B;  4JKH A;  4HDO A;  2I1K A;  2WH5 A;  1NTI A;  3E9O A;  4JK8 A;  4JKB A;  3IVF A;  1ST7 A;  1NI2 A;  1DIK A;  3SBG A;  3AU4 A;  4JKD A;  4EKU A;  3E9L A;  1KBL A;  4JK7 A;  4JKF A;  3QIJ A;  1E5W A;  3PVL A;  2I1J A;  3ZDT A;  4ZRI A;  2HE7 A;  4ZRJ A;  5JVL A;  1EF1 A;  3E66 A;  4ILG B;  4F7G A;  3BIN A;  1VBH A;  3FP5 A;  4JKA A;  1ACA A;  4JKE A;  4YL8 A;  1JDE A;  4DXA B;  5IJM A;  4P7I A;  4JKG A;  2ABD A;  4CYE A;  1H4R A;  2LBB A;  2EMT A;  4ZRK A;  2AEH A;  4HDQ A;  2HRJ A;  2J0K A;  1KC7 A;  3ENB A;  2D2Q A;  1VBG A;  1GGO A;  4GXB A;  2EMS A;  2FJ9 A;  2D10 A;  4NY0 A;  2CB8 A;  2COP A;  2AL6 A;  3FLV A;  2CQU A;  4ILH A;  1HBK A;  2D11 A;  2X0S A;  3X23 A;  1Y19 B;  1MK9 B;  4JKC A;  1ISN A;  2ZPY A;  4TKN A;  2YVC A;  1HB6 A;  3PZD A;  1HB8 A;  4ILJ A;  3G9W A;  2J0J A;  1MK7 B;  3WA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...