3FMBA

Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'YFQGMVKHIVLFKLRDDVPVEEKLVVMNSFKEAIEALPAKISVIRKIEVGLNMNPGETWNIALYSEFDNLDDVKFYATHPEHVAAGKILAETKESRACVDYEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimeric protein of unknown function and ferredoxin-like fold
publication title Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (YP_212648.1) from Bacteroides fragilis NCTC 9343 at 1.85 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fmbA01
2IFXA 2QLWA 2RSQA 1W2IA 3HF5A 1SI9A 2XMKA 3CJKA 2EW9A 2OFHX 3QMQA 2KKHA 3FGVA 3HDSA 1N5SA 1YJRA 2QYCA 1GXUA 5F0WA 2FTRA 2HFOA 1SQEA 4QOTA 2GGPA 2JDJA 3MCSA 1Y9OA 1Q53A 1CPZA 5A6PA 4A48A 3UDCA 3BDEA 2XMWA 1V3ZA 1YJTA 3WDOA 3HHLB 2VH7A 2ASYA 2W4CA 1CC8A 1OQ3A 1JK9B 1TUVA 5T7LB 5B0EA 3HHLC 2ZDOA 2OKQA 3TOQA 2OD4A 2FIUA 2XMTA 2BJDA 3IWLA 3KKFA 1YRXA 3BF4A 2ROPA 2VV5A 2OP5A 3KG0A 2AP6A 1Q8BA 1Q4RA 4OIXA 1OSDA 2K7JA 5A6WA 1FE4A 1OQ6A 4OJHA 4NPOA 4ZOSA 2GGPB 4HH1A 4EFAC 4F67A 2RU9A 3BB5A 1P6TA 2GV1A 4A4JA 2XMJA 1AW0A 1AFJA 1TR0A 1APSA 4U9RA 1TZ0A 3MZIA 2HQIA 2QIFA 2N4DA 2GCFA 3KNGA 1JWWA 3HX9A 2AJ1A 2CRLA 2OD6A 1Y3JA 2QLXA 1GXTA 1X7VA 2L3MA 1XBWA 4Y2KA 4YEAA 1Y3KA 3FRYA 3K7RA 3T9NA 2HLUA 4HI1A 5B0AA 5IXUA 3BM7A 3F44A 2LQ9A 4DL0C 1KVJA 1S6UA 3DCAA 3HHLD 2OFGX 2ZDPA 1RJJA 2K1RA 3QGPA 5B0DA 3CJKB 1IUJA 3TRGA 4DPOA 2AW0A 4FNIA 2BUNA 4HI2A 2HFNA 5B0BA 2KT3A 2ACYA 5K9FA 2W4PA 2BJEA 1TL4A 2KT2A 2PGCA 1FEEA 4HL9A 2IYIA 1R6YA 1SB6A 2GA7A 3DXSX 2IYGA 2GFFA 4HH0A 2RMLA 2HIQA 3BR8A 1MWZA 1MWYA 2ROEA 2K7KA 2ROGA 5B0FA 2PD1A 1FVQA 5B0GA 1U7LA 3BN7A 2G9OA 1YJVA 2KYZA 1OPZA 2Q3PA 3LGMA 1VQSA 1N5QA 3E8OA 2N4CA 3HHLA 1Y0HA 5B0CA 1ULRA 2RILA 2XMVA 5F0UA 3IWXA 3BGUA 4OJ3A 5T7LA 3TNVA 4DN9A 2OAUA 2OMOA 1KVIA 1FESA 3HFKA 1Q8LA 3LGNA 1N5TA 3VTIA 1YG0A 1FD8A 2BYCA 4Q2LA 1YJUA 3KG1A 1KQKA 2FB0A 1AFIA 1N5VA 2N7YA 2K2PA 1X0PA 1FE0A 3FMBA 4OJGA 2LDIA 2W4DA 4A47A 2GO8A 4Y2IA 5B08A 1TL5A 3I9ZA 5B09A 1P8GA 1WD6A 1X8DA 3LO3A 2BBEA 4YDXA 1URRA 2XMUA 2AJ0A 4NL5A 1LQ9A 5KAKA 2FHMA 4Q2MA 4ZA1A 4A46A 2HLTA 2LXFA 1VQYA 4Y2MA 3GZ7A 2K1RB 1FVSA 1QUPA 4FNHA 1K0VA 1CC7A 2XMMA 4OJ1A 1S6OA 2LQBA
chains in the Genus database with same CATH superfamily
3IBWA 2D3O1 3HULA 3K8VA 4EMDA 4I7FA 2FPHX 5LMUJ 2V2ZA 4PXEA 3THPA 2RKIA 3BO4A 1AUDA 4P75A 1EZZB 1FTRA 4O4GA 4EGLA 2ADCA 2V94A 4IOBA 4PQAA 3W2VA 5L9NA 5A8KA 3BSAA 1OYEA 2XGPA 2DD8S 4KKOB 5B0DA 3MEGA 2IJNA 5CCMA 2E5JA 5D0EA 4ZVFA 5C25B 3G2XA 4IQXA 2HHPA 5HMZA 3MEEA 5ETSA 3M1VA 2EVZA 2MLXA 2A6MA 1NDPA 2UU9J 1FFWB 1FD8A 4DV0J 3KK3B 2QMXA 5F3ZA 3PYFA 3K5OA 4GMKA 3O6QA 4UQGA 3TAMA 4QR1A 2PA3A 4ER8A 2L9WA 3CUNA 4LQ9A 3W65A 5IT9U 3R2CJ 3DOKB 3KHGA 2EFGA 3DMJA 2CPZA 1IKWA 5KT7A 5EWEA 1NK8A 2HW3A 3KYLA 2HNDB 2WRMA 4ZIVA 1OSDA 2B9EA 2RU9A 2HHSA 1B0TA 1SKWA 4U9RA 5LMNF 2IVYA 2DHXA 3BZQA 2L3MA 2HURA 3HD2A 3IR7B 3PY8A 4RNFA 4A8SA 2KM8B 1LW0B 5D4LA 1LK7A 2RS8A 2RU3A 1QSYA 2IMWP 2HRUA 2DHHA 3BN7A 3GCXP 1RAGB 2JEIA 1JLCB 1HNWJ 3ILIA 4J9MA 1S7IA 2UP1A 2QLBB 4OV1A 2N7YA 2R2TA 3T1HF 3F41A 1WD6A 1X8DA 4ED1A 5KFJA 1VYAA 4GKKF 4YB7A 4YHHF 2CNNB 5LJ3Y 4G1QB 2XZTB 1O8BA 2ATLA 2V5HG 4ZS6A 3NG8A 2DRAA 1SKUB 3DXBA 3ET6A 2JJ4D 2OPQB 3OL9A 4IRDA 2EKYA 3GIJA 2DB1A 5E5NA 1UVJA 1CJKA 3BF4A 5KFSA 2GW8A 4HHUA 4OV6A 1S49A 1HKAA 5BR8F 4DCJB 4ZVGA 2PA8D 3T9NA 4PQUA 3C66A 4F4AA 4LRAA 1KS2A 5GVQA 3T5JA 4JI0J 4X62F 3W9IA 2GFFA 2XY5A 5M2UA 3MR5A 4ES2A 2G9OA 1FRLA 4KT0C 2Q66A 1U45A 3D1OA 3Q23A 3I0SB 4LR7A 1RA7A 3NWRA 3TVZA 3UDLA 2QG9B 1JXVA 2K8GA 2J0QD 2WB4A 2AGOA 1UEVA 5J1PA 2VFRA 3B4DA 5H9FJ 3NNAA 3V4IA 2BV3A 3R1LA 1IKXB 3ZZZA 3R8YA 5HK4A 1S0MA 4DG1B 1HWLA 2FZCB 3IGNA 5K8PA 1VRUB 5A6WA 1MG7A 4DV5F 3FMWA 2I38A 2AJ2A 4NCGA 4FF4A 3M9MB 1N54B 5JMNA 1U6FA 1LW2B 4U95A 2EXUA 4JV1A 3NL0A 3RG6A 2ZOFA 2BXJA 5I4MA 1L3KA 4P10A 1X9WA 1ZM9A 1TL7B 2XNQA 3H5XA 1U7LA 3I56S 1NDLA 1EB0A 1NEEA 5HVHA 2DY1A 1Y0HA 2FDNA 1RQ0A 2GMLA 1IKVA 2BOAA 3MECA 1SC1B 3MPDA 3RGIA 2N3OA 2GJIA 4ELUA 2HHWA 3SCJE 2AU0A 2AJ0A 2GQ2A 3M8PA 3K89A 4E8UA 1TUGB 4DMZA 2VDIA 1S9EA 3PR5B 5LMNJ 2SXLA 3I5CA 1KOHA 3H40A 3U1MA 4C8MA 3U1NA 3JSMB 3SDEA 3VR1A 2XGQA 3KLHA 2XMTA 4OHYA 4DPUA 1X4CA 2HHQA 2OP5A 2NQPA 2F8MA 1E6VA 2XMJA 2BANB 1SVDA 1FFSB 1BE4A 4DDFA 4NCBA 1O6XA 3OFHA 3MAHA 1CJUB 2AMCB 5L1IA 3UCUP 4ELVA 4HDGA 3DRYA 3T1HJ 4OX9F 5G0RA 1UWBA 2HHVA 5KFLA 2F4VF 4GKKJ 3M05A 4A8FA 3CIZA 1H6KX 3UCGA 4IFVA 2DTJA 2JX2A 5IT4A 1P1TA 3KJQB 3LGNA 4AYBD 4RW4B 4QIWD 2RJZA 2VG7A 1BY9A 1SKSA 4TYAA 5EDWA 1JMTA 2MMYA 4NOHA 4FP9A 3DYAB 3M8QB 1Q1KA 5KFKA 2VQFF 1VFJA 5BR8J 1WF2A 2ZNYA 2P9EA 1YSJA 1X9SA 1U2FA 3GG0A 3NCPA 4K7QA 3WC2A 3ITHA 5F41A 1KDNA 1B7FA 3W5YA 3MMBB 3QLHB 2EPIA 1HNVB 2W9BA 4X62J 2J0SD 1JLBA 4ZITA 4DCPB 2P5VA 1KEKA 4OJHA 4PPDA 3LOUA 5KG2A 1T05A 2KTQA 1M1HA 2G0JA 4WP8A 2HFVA 2B51A 5GAGI 2A6OA 4J9PA 4Q0BB 3MAQA 3M2VB 3AA9A 3OBIA 2KM8C 1WEYA 3G8SA 4ZVUB 3AY0A 1L3VA 3EX7B 4RW9A 3BJYA 4CWBA 2HZCA 2R8JA 1ELOA 3CJ5A 3LW5C 4DFMA 1XTZA 3BQ2A 1MMDA 3QZ8A 4J9SA 4EBCA 2HVEA 3TYTA 1T02A 1R0BG 2Z8QA 3MOZA 2A3JA 1I5OB 4DV5J 3WBZA 3US5A 3KLGA 2HBRB 3DM2A 2R2UA 1TQLA 2RSQA 1NJZA 2KFYA 4X4SA 1Y00A 2MGZB 1XNRF 2N82B 4DI6A 2J7UA 1WC6A 1S6QB 2YWGA 3UW1A 1S9GB 3GG1A 4BBYA 2VG5A 4Y34A 4CT8A 4OI0A 3T41A 1HNIA 1PAUB 3KG0A 3PFOA 3CDEA 1NSAA 4YFUA 2VIHA 3KJVB 3F0NA 1FA0A 2AEMA 2UV8G 2P6TA 2RHQB 2CJKA 3MM9B 4DQIA 1VOMA 4RLEA 5L38A 4ZVSB 2IAJA 1CSJA 2MZTA 5DLFA 1C0UB 2EKNA 1WORA 5D15A 3BO2A 2ZH1A 1YJVA 1S5ZA 3GJRB 1KSPA 4HEA9 3IWXA 2YKMB 1FWPA 4ZHRB 1YJUA 2V4QA 5HLFB 2OEMA 1FRIA 4IDKB 1DQ9A 4CLPA 4MIAA 4NLRA 5D4OA 5FD1A 4MIWA 4HT5A 2HMIB 1RYSA 2JWNA 1UZDA 1H0HB 3RJMB 4ZVEA 4PEOA 3D1HA 2NPIA 1LEOA 1SPBP 1KQFB 2MDAA 1NZAA 4OX9J 2OPSB 2CNOB 2F4VJ 2VJUA 4JOUA 3HP6A 3G8QA 5CYMB 3MOJB 2X51A 4WCEQ 2R7RA 2AJ1A 5IT0A 4Z2XA 5DDOC 2XLJA 1KVKA 3Q8VA 4QJVA 2E1MC 2W4PA 1TMJA 2CWXA 1J27A 1BUXA 3PHTA 4EBEA 3K2YA 1NJWA 8AT1B 3G71S 2DPJA 1SC3B 2VQFJ 3U7JA 3KOAA 1IWGA 2FJAB 2ZZTA 1XN9A 3NGUA 4QIGA 1N5TA 1Q8KA 1SJ1A 2IRUA 1S1WB 1Y4ZB 4WU2A 3K5PA 5JUMA 1X60A 4JUZA 2C2ZB 3LPEA 4LR9A 4DPTA 1J5EF 2FHMA 5KG1A 3E01A 4H4MB 2HNZA 2Y1IA 4OI1A 2DNHA 1F3FA 5E3PA 2BJ9A 3ZZOA 1HWKA 1U1PA 2FVRA 4PXDA 5HATA 1NDKA 2LEAA 2BJ3A 2QMUB 3CT9A 3PCOB 3MTJA 3CJRA 4URSA 2QTWA 3OFGA 4J9KA 3DHXA 4LF5F 3K7RA 2R7SA 1HHQA 2LCWA 4A8QA 1AXQA 4MIBA 4C98A 5BYRA 3R97A 1GMWA 1S1UB 2H5EA 2GO9A 2HK2A 3MM6B 1MWZA 2X7IA 1CLFA 3T19A 5FIIA 1D0EA 4C2MA 5KFXA 1VK8A 1WEZA 4OX6A 1AUSL 2CQPA 4NLVA 1XNRJ 1YWXA 3KK2A 3GFXA 5BYSA 3LP1B 3MM8B 3GIMA 4AT1B 1VQKS 4C11A 1P8GA 2VPWB 1MWQA 4FBUA 5KG0A 2K1RB 1RISA 8ATCB 2V8PA 3M8YA 4IRKA 2R7QA 1YZ7A 4CLZA 3PVXA 2FTRA 2R8GA 1TKZB 3RB3A 2XY6A 3B82A 4P73A 4BLGA 4C9DA 3KHRA 1IBKF 1OO0B 3CCWA 2CG4A 5AXLA 3P3DA 3UD4P 1Q4RA 3NS6A 3BBCA 4EI2A 4A4JA 4PUOB 2WOMB 3EUNA 3OV7A 1JLEB 1P9QC 4LFCF 1N88A 3VVUA 4ED8A 3PIPQ 4DR4F 4CO2A 3FVYA 1LOUA 4RUAA 2GIRA 1JLAA 3B6BA 3W9HA 3UN2A 1VIOA 3X1LB 1TL1B 1FVQA 1FERA 1RCXB 2EK6A 1F60B 1WKKA 4V1Ak 3DRRB 1RT3B 2I8EA 2ZE2A 1DRZA 4WFYA 2WBMA 2QA1A 1KBRA 4GO5X 2IJFA 2ABYA 1KHWA 5H9FK 1K47A 2YKNA 3WC0A 4OZNA 2AJFE 4ZPTR 4KKOA 2XMKA 3Q8PB 1FX4A 2JZ5A 4RUHA 2YPYA 4RW7B 3GYNA 3H7HB 1RWWB 2K7JA 2FJVA 4ZOSA 1WHYA 3JB9k 3A8EA 2GCFA 4PG5A 5KFMA 2QLXA 2IBOA 4IFYB 2CFXA 4M5HA 1X5SA 4V19J 3DOKA 5AXNA 1SL1A 1KTVA 2AKWB 3GV5B 2QLJB 2O66A 4O3RA 4NLDA 5B0GA 2DNZA 2HNDA 2MKSA 2FZGB 5AE3A 4WE1B 1Q86T 1DAXA 1HMVA 3OQ2A 3OTBA 4Q2LA 1FNMA 4WTYA 1LWFB 4DQRA 5E3AA 3N6NA 3TZWA 2XULA 5AJ3F 1VRQC 5KFGA 3Q86A 2XLIA 2D9PA 3X3UA 2WHOA 3M32B 2UUAF 5JVHQ 1C0TB 1LW0A 1GXUA 4LF5J 4FYWB 4HHHA 3HHDA 4WIIA 4DPWA 5LXRA 4MFBB 1HL6A 4RNOA 1BC6A 1TELA 1OQ6A 2KVQE 1NO8A 2YQ0A 4YS2A 2MPUA 1WJ9A 3CD0A 4DLGA 2NPFA 3P4UB 5IXUA 2LQ9A 2VJVA 3DCAA 2JL9A 1AZSA 3LANA 4G1QA 5AE1A 3AXKA 3NBPB 5C24B 3AQPA 4WF9Q 2V63A 3QPIA 5K5MA 2YH1A 2OPQA 3AODA 3KLFA 4M5LA 1RWUA 1EP4A 4QCLA 1HYSA 2HEKA 1X9MA 1IBKJ 3W2WB 5B08A 3LQVA 1U6BA 3MI7X 2MQQA 4ZN1A 3NAIA 3QWPA 3RAQA 2ZC4A 2ZD1B 2ZZMA 3M2UB 1U1OA 1SC4B 2YNFA 3I32A 1QUVA 1MW7A 2AZ1A 1FWKA 3CJ3A 2OSQA 4LFBJ 4LFCJ 4DR4J 3G87A 4UUXA 3JS9A 1Q5VA 2XMAA 3BPDA 3M7VA 4C48A 3JSBA 3T1AA 3PRBA 1HLWA 4Q45A 2GGPB 1VQ5S 5HSPA 2EFOA 3PW0A 2V0NA 3DLEB 3KNGA 3VAKA 5DLGA 2QFJA 1UJ6A 4FKXA 1LV5A 5J2NB 3FBFA 3LF0A 4X4OA 3OXGA 3D67A 2BQRA 1HA1A 4DQSA 1U26A 3RBDA 4QWCA 1FRHA 2YKOA 2PEHA 1IKXA 1K8AT 4P72A 5HP1B 4DG1A 3VTIA 1VRUA 1SUQB 2FUG9 4LUBA 5IQ6A 4NI2B 1VBKA 4WFBQ 3T3FA 2ZH3A 2W24A 4WU3A 4J37A 5KOWA 4I64A 1YJ9S 1RBLA 3NCRA 1TL7A 5ETTA 1HQUB 4ZVOB 3M6VA 1B0PA 4J91A 3D6MB 1TKXB 2DNLA 3NGKA 6FDRA 3FCWA 3L9ZA 2KYXA 5J2QA 4X4UA 5F8LA 1PJ6A 4G6VB 4UZBA 4QPTA 1TK5A 1LXJA 3M2RB 3GE9A 3OLAA 1RU1A 3W7BA 3VHQA 4UZCA 4FXDA 2RS2A 4RW8A 1YVFA 5AJ3J 4ID5B 4PYDA 1HD1A 3UE2A 2UUAJ 2GNKA 2XSFA 4ZLJA 3HVTB 3HZGA 1IM6A 3JSMA 2AIRB 4P2XA 2LU1A 3P96A 4UOGA 3LPYA 3SIPB 1AFIA 2K2PA 3LA0A 1CVJA 1UVMA 2BANA 4MTPA 3A12A 5DO2A 2KXFA 1CJUA 1YQHA 4OX7A 3L3CA 4NE9C 3KLVA 4ZIWA 2F9DA 2KRBA 3HO1A 2CAJA 1S0NA 1XMOF 3CJ2A 1U0HB 2O3DA 4ZKAA 3WHIA 3KLIB 4KRWA 4CNZA 4L74A 1UEUA 1KR4A 4HVZA 1U48A 3E2EA 1REVB 2ZHAA 2FY1A 3RTVA 1OIAA 3ZNJ1 2CQ1A 4RW4A 2UVWA 4LVOP 3QGGA 1UJ5A 4ED5A 2W2PP 3KLEB 4ZCIA 2QJ3A 1BD6A 1RBOB 4YOEA 3ETMA 2QO3A 2MLZA 3MTKA 1IN0A 4IQMA 4U7UD 1BXNA 5B7WA 5KFAA 3RR7A 2XCPA 3VGVA 1ICEB 4CO1A 2GO8A 4K0KF 1MU2B 1URRA 2XO6A 4DLEA 1U2RA 5KT4A 1XC9A 3W5ZA 1ITPA 3CW2C 2PI5A 3JAMU 1R43A 2F4FA 3M2VA 3W63A 3TI0A 2CPYA 1IR2A 2EW9A 2V34A 4RWWA 1X4HA 2ZKTA 2W7AA 3R1HA 2QA2A 3CTRA 3VGSA 2LMIA 2RQCA 5GAEU 3I9V9 3TO8A 1QLNA 3DLJA 1G2EA 2HVHA 1ZH5A 2VD3A 2Y1JA 4TU8A 1P6TA 2GV1A 1JKHB 4PKDB 1VIXA 2FYXA 2ILYA 1QVGR 1GH8A 3H2VE 1FO1A 1WI6A 1GAOA 2VBWA 3GFYA 5CQGA 1RA6A 2ZH6A 4OYWA 3HHEA 2ALYB 1R6YA 3J7A1 1RZMA 3LALA 3OR1B 2HNYB 2MGZA 1XK8A 4OMFG 1FHTA 1Z1ZA 2QFIA 3K5LA 2OO4A 5IQQA 5IV3A 2RILA 4WYWA 4OJ3A 7FDRA 2ZC3A 2ACMA 4P71A 1RHMB 2Y8WA 1KLNA 2IA6A 1U25A 2A0FB 3KJVA 4Y2CA 2BJ8A 4LSNA 4Q2MA 5U47A 4DL7A 4I2PA 3NRBA 4LF9J 3CCVS 4A8YA 3MM9A 2DH8A 1W2IA 2MHEA 4Y28C 1W26A 1UFLA 1HNZF 1SQFA 2A18A 4IH7A 1C0UA 1NPPA 4NA1A 1Q5YA 3M8ZA 5GMKa 3K0JA 5EWGA 2M52A 3PO5A 5GAHU 2PC6A 2RQ4A 1L3UA 4MK7A 2YKMA 4L6V3 2Y9HA 4LF7F 1WOOA 5HLFA 3D68A 3NOCA 5E33A 2VA3A 3PYGA 5KT3A 2DR9A 2R42A 3MMJA 2I1RA 4F3MA 4UUWA 4ID8A 5ETKA 2E1AA 1BMQB 1BQMA 3HHLD 2HMIA 5B0BA 3IN5A 4USTA 1REGX 4JI5F 3HPOA 3Q8QB 4HH0A 1U02A 3T6JA 3CCUS 4LR8A 3ADAC 4Q8EA 4YQWA 1VS3A 2HHUA 1XMOJ 2JNJA 3WX8A 1QE1B 4YB5A 1T3NA 3HSGA 1WWHA 3DOLB 1HARA 1U49A 4NYOA 3C19A 2CPJA 1R31A 2V69A 3OUYB 1G6BA 1CJVB 2IDEA 2DHGA 3AOCA 4UT4A 3I55S 4ATNA 2I2YA 2GHVC 4DUYF 3I0RB 2J0WA 1YJTA 4LF6F 3UR3C 4WXOA 1RABB 1AT1B 1R8AA 1RWVB 2NXEA 4X64F 1WG4A 1XR5A 4OIXA 1VQ7S 4ZJLA 4I7FB 4DF4A 2I6WA 1S1WA 4CCHA 2V9KA 2RNEA 3TZZA 2OD6A 2RKIB 3IMQJ 1G4CA 4AL5A 2GQQA 4ZPBA 3D6TB 4O4GB 4H4MA 4K0KJ 5CXTA 3PX0A 4J7CA 3GQCA 4OI4A 3W2VB 2Y1LB 5A8KB 2UUCF 4YB1P 5IWAF 3BH7B 3RB0A 1MLAA 1DBDA 1VI7A 2XWXA 1VC5A 4TXSA 4DX7A 3JTPA 1HBUA 3PXGa 3H2LA 1AA1B 1KQKA 2CQ0A 4E0DA 3H4DA 3MEEB 3FMBA 2RE1A 3M1VB 4DR7F 2M70A 2AJQA 4DXLA 1F3VA 2G2ZA 1WTBA 4OZ0A 1QAIA 2CVIA 1NLKL 4KR0B 4LQ3A 2AWZA 1N5SA 1T9VA 3TAMB 1JJ2R 1S1UA 2BA9A 4P74A 3MM6A 2HGMA 1B7YB 4WFAQ 3DMJB 4TKTA 3UR0A 1IKWB 3MD1A 2MZJA 2AYGA 1Y5NB 5DQGA 5G4DA 1VLYA 3MM8A 1MSWD 1H3DA 3OSPA 2KL8A 3C6TA 2CQ3A 3GPAA 2HLUA 3WQPA 2F3JA 2K1RA 2KG0A 3MMAA 2UVRA 1N4LA 4M63A 4QU6A 3EICA 4C7QA 4YR2A 1S6PA 1VR6A 2CJYB 4KHMA 2ZHOA 4C3MA 2XS5A 2H65B 3TAQA 1HNZJ 3A8IA 3CIMA 2XZDB 1ZTWA 1S97A 4PUOA 1C1BB 2WOMA 3ZTPA 4QWBA 3RUBL 3TVYA 1JLEA 3EGWB 1A7GE 1TP7A 1ZBTA 1M5HA 4CNYA 4LF7J 3MEDB 4F4ZA 1KQGB 3QRPA 1SI9A 3AQOA 3DKDA 1RLDA 1LFWA 3SSRA 3Q83A 3KXDA 2J8AA 2GMJA 1Q82T 1TL1A 3FQKA 3SMZA 2BABA 4X4PA 3PW5A 2BKPA 4JI5J 2RHSB 3GILA 2NUUG 1QSLA 2PN6A 3VWSA 1CJTA 5HQMA 4LBIA 1Z2LA 4MKVA 3OSNA 1FWLA 1M5SA 2AV5A 1RJJA 2E66A 3PW2A 4CO0A 3G9CA 3UPFA 4P7VA 1WG1A 4PQUB 2J0XA 1URNA 4UY8T 2IM0A 2QLFB 4OQJA 4GC7A 5KG6A 4USVA 3Q8YA 1R7IA 2YWHA 4LF6J 1F2GA 1NH7A 1B0VA 3L7OA 4O0NA 4I0WA 2F7VA 5HANA 4X64J 1WACA 4DS4A 2JHEA 2ZVIA 1DY3A 1NH8A 1UVLA 4LMZA 4CT9A 3EE3A 4IFYA 3SCIE 4ZVPB 1PILA 3UD5A 2J6SA 2KZMA 4L72B 1Q78A 1SIWB 3CC4S 2OPRB 1CQNA 3IRXB 3S01A 1U1LA 2B5JB 1DTTB 3V4IB 3RBXA 1B64A 2V8VA 2UUCJ 2V8DA 2FLPA 2KT5A 5IWAJ 5EN1A 2EFNA 2LXIA 4LRBA 5I3UB 1LWFA 4CM2A 5RUBA 1RWKB 2NSCA 2ZH7A 3DU6A 2DRBA 5KFRA 2E9RX 5H9EJ 3DN9A 4LIWA 4L76A 2K3IA 5DJBA 3M32A 4OYIA 2VOOA 2R7TA 4NCGB 1KLMB 5CABA 4PWUA 4DR7J 2IYIA 3CGIA 2Y0SD 3GR0A 1C0TA 3BEGB 5F8HA 3GWCA 5FDLB 1F9HA 3BYPA 5F0UA 5A2QU 4U7CA 2E9ZA 4EZ6A 1U8SA 3HHNB 3SXLA 1N5VA 2CPIA 1HBOA 2YXLA 4NZ6A 4DSFA 1VJQA 1VCTA 3T1YF 1RBAA 4IO1A 4DL4A 1IKVB 2QMWA 3GFZA 3OTEA 3MECB 2I5JA 3D9BA 3QSIA 2G2OA 2FLNA 5KG7A 1KNZA 5F0WA 1UL3A 1V3RA 4NLOA 3ZZYA 2HS3A 2CADA 4WBFA 2O1PA 5AXMA 4J9RA 1S9EB 3NKYA 4WXWA 1D9DA 2ATCB 2YPZA 2MQLA 3N6LA 2PSZA 3MMCA 4BWMA 3W2WA 2K06A 4RUCA 1NUEA 1IVZA 4ECQA 5THWA 5DGAA 3V2UC 4BDPA 4IRCA 2PIIA 4E2FB 4FNIA 3C6UB 4ZPCA 3SQOP 3I5AA 1DFDA 4FYXB 4J9VA 3TJAA 4CH0S 1SJQA 2HKEA 2YNGB 3E51A 5G0RB 5D3GA 2C2KB 4TQSA 1UEKA 4HKQA 5IT9Y 5F8JA 1LQ9A 2AEFA 1RP5A 2MSSA 4WK1A 2RH3A 3PKYA 5ETMA 1R6VA 2NXNA 1RAHB 5A0YB 3MFHA 2CQHA 4NLGA 4K59A 3PJWA 3SYZA 3BBFA 1RT5A 2HVDA 4PG8A 4RNHA 4M5NA 3SSSA 1SL2A 3C16A 5KFIA 3JYTB 3T5HA 1TZ0A 3ITHB 4HHJA 4NLUA 2W9BB 3GJTB 3WIVA 4JV5F 3ZZUA 3M6XA 4NI2A 2MKJA 2WVDA 2XI3A 5D4NA 3V4MA 4IR9A 2CQIA 4ELTA 4RBVA 4C4WA 4XPCA 3JXOA 1LWXA 5CCLA 1UMJA 4C3LA 4DHVA 1VJWA 1DLOB 2C3YA 3GIRA 1Y7PA 2R3VA 2OMOA 4B9VA 4KB7A 1TKXA 5DQIA 4DR5F 3LGHA 4ETXA 3C2PA 5MAOA 1S72S 2M7SA 2XWYA 1Q81T 2LQJA 2UUWA 4D3GA 1ACMB 4R25A 3ZFVA 3G8TA 2ZH8A 5C2GA 5EX0A 4I69A 1OS5A 3MDFA 1YZ6A 4ID5A 3OPKA 4M5DB 3GYXB 4QQBA 4C0OC 2ILZA 2MKCA 3KLGB 3DM2B 1EX8A 3HVTA 5LT5A 3UDVA 1S4FA 1GMVA 2GMHA 3DFEA 1X4BA 4QW9A 2VFSA 4CLTA 1M5KC 5LSLA 1BLUA 3KTQA 1HNIB 3R5CA 2DNPA 3A4TA 2HQ3A 2WAQD 2PO4A 4EEYA 3T1YJ 4M95A 5KFFA 1DQ8A 1U0HA 3IG1B 1W25A 3QFWA 5B0CA 2H1YA 1RAIB 3ZTRA 2MJUA 1FXRA 2YY3A 4H4KA 2C2EA 2EEYA 4U96A 2DXEA 4FN5A 3KLEA 4YR0A 1YITS 4PCQA 2CG8A 1G7CB 2W7OA 4KIAA 4OYBA 3J80Y 3UDCA 3KK1A 3W5XA 3KJFB 3EGZA 5CD4A 1WC1A 3EM1A 1SV5B 3POTB 5E3CA 1TVRA 3HKZD 3QATA 4ECUA 4NLTA 2DGWA 4DSIA 3DHWC 2KO1A 1X7VA 1Y3KA 1MU2A 4O3OA 3UN3A 1UWAA 4P9SA 4RKUC 1UKUA 2DR5A 4JI3F 4G65A 2HZVA 3R7BB 2R2SA 1N56A 3HD1A 3KUHA 4KBIA 1EHWA 5A8RB 1JNZB 2OEJA 4ZN3A 1SH3A 4KE5A 3VAFA 3CNQP 1VK3A 3OTCA 2ZZNA 2W4DA 4MJKA 1HPZB 1TL5A 3DGVA 3EZOA 3OR2B 4NL5A 3DLGA 1UFWA 1DHMA 3PG9A 3M8SA 4UF4A 4C8LA 3I96A 5ETPA 1GTHA 3OTOF 1XWLA 1FKPB 4M1KA 4KH0B 4NCAA 1RU2A 1YBAA 2RUGA 3HDSA 4USUA 2G2YA 5LSOA 1EARA 4JV5J 3EVWA 3DLBA 4I67A 2HNZB 1V3ZA 2HNYA 2XMWA 2DR6A 4NLSA 5J2PA 4QU7A 3UNYA 4DOZA 2ZDOA 2KHDA 4JI6F 3NGTA 3TQEA 1LWEB 2VG6A 2HFZA 2D9OA 4ZLLA 1VC6A 2O67A 1WHWA 4X66F 1BWEA 1XNQF 2FGCA 3Q0AA 4DR5J 4CTAB 4JI1F 2U2FA 2XHWA 1LKZA 3HFZB 3MHYA 4ECWA 2MHNA 2M0GB 5ETRA 5IM0B 7AT1B 3G4SS 4KFBB 2J7KA 3CDBA 1U1KA 3TA1A 3K17A 1W2BR 2DCLA 4TLQA 3LO3A 3OT9A 4NASA 3J81j 4AXJA 4QZVB 2B8PA 3MUVP 3KHHA 3WIUA 2W8LA 3DNCA 4C11B 4I2QB 5CAAA 2MYFA 4NWBA 2IM2A 3FKBA 1OQ3A 3ILLA 1WOPA 4TY8B 1R8PA 4B3SF 1VDHA 2MXYA 2AP6A 3AD8C 4FKYA 3LTOA 4DL3A 1RT6A 4L73A 2F1FA 1Y5LB 5DQHA 1QE1A 4KH1B 3MFIA 5F9LA 4IYQA 3FBCA 3DOLA 3OVBA 3VGTA 1GX6A 3HSDA 1NNDA 1C2PA 1N8RT 1RTDB 4FYDA 5HN0A 1F9FA 1RWOB 1NM2A 4LBHA 1NHVA 3CD5A 4FPRA 5K8MA 1XQIA 1JLAB 3EGVA 4OHVA 2WK4A 2CQ2A 2UV8A 4O44A 3ILJA 1Q95G 2Y3YA 2CPXA 2WB1D 4ZA1A 1VQ9S 1QUPA 2ZE2B 5CYJA 3TVKA 2RT3A 3A3NB 4FF2A 1WF1A 2VODA 2Q1LA 2ZUAA 4HYKA 2M5YA 2YNHA 3MCSA 2X1AA 1Q7LB 4KGVB 2YKNB 3O5TB 1NRKA 4JI3J 1GTEA 4FPIA 3GFHA 3TOQA 5KFBA 2RRBA 5A6PA 3NLCA 4F67A 1TL3A 2JLGA 1APSA 1VGYA 2AX0A 2GVZA 1RTHB 2DXFA 2DISA 5K14B 5H9EK 1QAXA 5GAEI 4LF8F 5E7OB 2OELA 2C2MB 2DJWA 2OSRA 1JIHA 1WTFA 5CA5A 2OI2A 4WFXA 4DN0A 2IBKA 1F0XA 5H1SV 1UETA 1WSVA 5A76A 1VQOS 4CLKA 3OTOJ 4N77A 2IC3A 3LGMA 3MPWA 1JLGA 2MSTA 3EPIA 1IBLF 4H54A 4N47A 1T03B 4N76A 3VAJA 2UXDF 2ZOMA 2V9WA 4JI6J 2VBXA 1CBKA 2DHAA 1CC7A 4ETZA 1HMVB 5HL7Q 2LA6A 4X66J 4CYUB 1XNQJ 3D3CJ 2JDJA 1BGXT 5F9NA 1UPPA 4JI1J 3QSYB 3JQKA 1O5JA 1JWWA 4DR6F 2H48B 4MT1A 2W2QP 1C1BA 3TUJC 5GAHI 3QGPA 3V81B 3HZEA 2IDLA 3BGRB 2KT3A 4ALZA 3BKTA 4N8OA 3MEDA 3G96A 3EDRB 3FSXA 3LAKA 1UP1A 4M8LA 2CJQA 2CQ4A 3S6EA 1ZZFA 2N7CA 1SJRA 5M2RA 1AZSB 3E8OA 4DPYA 2LA4A 2XMVA 5L39A 3J7ZT 1KVIA 2HHTA 2NXJA 3HFKA 4J9QA 2RQMA 2HVZA 2M88A 2KVIA 3NNCA 2M3DA 3NGRA 1S0VA 5DRKA 1SXLA 3KLFB 3VAHA 4B3SJ 1EP4B 2HLTA 2CDQA 1HYSB 2CIMA 4NZ0A 2G1HA 2RQKA 2YNIA 2B7CB 3BQ0A 4XO0A 1QY7A 4ANCA 2YNFB 3MD3A 2VUGA 2DO4A 3KKFA 4OLPA 1FE4A 4HH1A 1FRKA 3A13A 3OXFA 2KG1A 4ED2A 4CP5A 2CRLA 1S1VB 1XBWA 4CH7A 2DKOB 1RAOA 1H2UX 2EFQA 3CJKB 2G13A 1QAJA 1RACB 2DH7A 1FK9A 3VAIA 3AA8A 3NY0A 2P9GA 3D0GE 2Q79A 2LXUA 1SJ4P 2J76E 2HHHF 2VB6A 2OPRA 5J1EA 2P8IA 3IRXA 4LVNP 4R8UB 4ECVA 3PR4A 1HI1A 2B5JA 1DTTA 4DCOB 5KT6A 2LDIA 3KMQA 1H74A 2FJEB 3SCLE 5I3UA 1N5YB 3BYRA 2DR8A 2J6TA 1MMLA 4S0MA 5F8NA 3PDNA 1S6OA 3D5MA 4JBCA 2KJWA 4WJBA 4QWEA 4F26A 4J90A 1KLMA 5KFWA 4LF8J 3TEGA 3OVSA 1RHRB 3IM8A 4Z37A 4DZ6A 1JQGA 2W4CA 5FDLA 1KN6A 1RAAB 3UVJB 1N6QA 3IWLA 2MKKA 2D69A 1M0SA 3DDNA 2KB2A 1XMBA 2W25A 2NSBA 3LWMA 2ZWOA 1IBLJ 4P52A 1FKOB 4BC9A 2XZWA 3GR1A 2H54B 2UXDJ 2JEJA 5J2QB 4FXWA 1T3OA 5HI7A 5L1LA 2B6AA 2E5HA 2PGCA 3LAMA 1BHNA 4KJIA 3L95X 2ZHBA 2IY5B 3WX4A 1OPZA 4GKJF 2AGQA 3ETOA 4RW8B 4RJVA 2DR7A 1TK8A 3JQMA 1U24A 2FVQA 4LRCA 1NSPA 4DR1F 4B17A 1UTAA 2ZBIA 3PX4A 1WKJA 1U2CA 2BE7D 1KC8T 2JOQA 1S77D 4WZQA 4ED0A 4DR6J 5C7PA 3AD9C 3C6UA 1WI8A 2Y1RI 1RT4B 2YNGA 5B0EA 2XI2A 4GVBB 1IR1A 1NJYA 1NB7A 2H4WB 1GX5A 3R3TA 1NK6A 3BR9A 4RZRA 5F8GA 5I3PA 1IKYA 1QJHA 3CB4A 1QD1A 4YHHJ 3CC7S 1HBNA 4PXBA 2OGUA 2B4UA 3OL7A 3MR7A 2LDYA 2HYIB 2AZ3A 3RRKA 2OTJS 3VCDA 5A0YA 4H4OB 4DFJA 1VHIA 1MWYA 3RRHA 1U09A 4JI7F 4B3TF 4F0MA 5HAOA 1KFDA 3FK4A 3ZNUA 3JYTA 2PT0A 2EFVA 3OHBA 4ZVRB 4OJGA 2FD2A 5KFOA 3QT6A 4RBUA 3MEKA 2MKHA 1PIEA 4EYHB 2W2MP 3SSQA 2VQEF 1F5CA 3GTYX 1R8CA 1FI4A 2KFNA 1K1SA 4WWSA 3RW6A 3LUYA 4B9NA 3MCNA 1CC8A 1DLOA 2CPDA 2COLA 4HTIA 5DG7A 2NZCA 4M5KA 2O01C 5DZ7A 3G82A 1RT2B 4K8RA 4B9UA 2HHHJ 1HWJA 2HIYA 2C2RA 3HX9A 3S1TA 1TUWA 2PMHA 2V67A 4OZJA 3J7Z5 4NEZA 3PO4A 2NLWA 5K9FA 4HTJA 1TL4A 2V6AA 1LWCA 5D78A 4RWXA 2L48A 3N5FA 4M5DA 4QW8A 3V6DB 2DYAA 2MLYA 5E3RA 2MTLA 3D2WA 3QRRA 3C46A 1XR6A 3DDIA 1ZAVA 2BACA 2B4OA 1FJ7A 2YWEA 3FC9A 1SIZA 3CWJA 3PM9A 4ZP6A 2LQ8A 2BE2B 1NK7A 3MR6A 2IPOB 5FJ4A 4LSNB 5IOLA 2DHSA 3MCMA 2C3MA 4I2PB 5J1NA 3FUYA 3IG1A 2BZ2A 2DEIA 1NSKL 3M30B 2QL9B 2MZ1A 2DRDA 3C15B 3P6YC 4GKJJ 2ASDA 3CF5Q 2VONA 3IBCB 2JRSA 1WDTA 2J9CA 1BQNB 4RO0A 4TN2A 2BW2A 2EK1A 4DR1J 2W2OP 1IJEB 6FD1A 1OY9A 2MQ8A 4A8MP 3ELHA 1WC4A 4C8YA 1BQMB 2EG2A 1VQSA 2KH9A 3JSYA 3L09A 1D3WA 1SV5A 3POTA 2AJ4A 3GIKA 2LXFA 2A2DA 2HFSA 4FNHA 4MKAA 2J6UA 3R5JB 5HBMA 2IFXA 2KKHA 1Y10A 2B56A 4ZLNA 3ISZA 3C14A 1V5IB 1C4AA 4C6AA 2F5GA 1NSQA 2E5LF 5A8RA 7FD1A 1I6JA 4QIFA 2RD5C 3FSIA 4JI7J 1RDRA 4XK8C 4CLFA 3H25A 1AW0A 4B3TJ 3UDEA 3ENQA 1K9MT 4DQPA 1HPZA 4W98A 1XIQA 5ETLA 4DF8A 3OR2A 4DL2A 5K8NA 2HFUA 1S6UA 2ZDPA 2V2QA 4KQZA 5KFHA 1FKPA 3CJ0A 4WK3A 3HSZA 3HM9A 2LKZA 2VQEJ 2AT1B 5DDQC 4NA2A 2FHKA 2DXDA 1LWEA 2UZAA 2OUGA 2NYHA 2GIFA 4RW6B 1HBUB 2VBZA 2DBBA 4O4RA 3JQJA 5HVGA 3CO0P 4CTAA 4USJC 2B3TB 2HSEB 1TV6B 2W1BA 4GRSA 2LECA 4YMEA 5SZTA 5IM0A 4X4VA 4KFBA 3ZZRA 1G3OA 1NK4A 2CA9A 4WPAA 2WVBA 3J81Y 2EWHA 3B8HA 5KFQA 3GB0A 2LEBA 1NDCA 2FGOA 3AAWB 2OFGX 2HHXA 1VHFA 3CSKA 3CDAA 3QIPB 2VL1A 4HL9A 3C6TB 3UN5A 3ONQA 4I2QA 2C1EB 3NWGA 1RI7A 5I42B 4OI3A 4TY8A 3BKUA 5L9XA 4YN3B 2BYCA 5C42A 3MMAB 1Y11A 5KT2A 2B4VA 2B9WA 4A47A 3BO3A 5B09A 2DEJA 1S6PB 3HHKA 2IM3A 4BS2A 3GV8B 3PEHA 4KTQA 1VRTB 2YWFA 1HW8A 2HRTA 2QL7B 1ZPWX 3LP0B 1V6HA 2WW8A 2Y8YA 1RTDA 1KQSR 4DX8H 1ZM2A 4WP9A 3CVKA 3N4WA 3EPGA 2B8QA 4EFAC 1M5VC 4FS1A 4WKYA 3NCQA 1UW4A 1Y3JA 3MPUB 1NKEA 3BM7A 3F44A 1OSCA 4MK9A 3BGLA 2HZAA 4F36A 1VBXA 2BEFA 3V5RA 2U1AA 3PRDA 3HFVA 1CJTB 2BKNA 3DXSX 1VLOA 4A8KA 4RL1A 3UI3A 2ROGA 4OZ5A 3PKMA 2QA4G 1HQEB 3GV7B 2WW4A 2JEFA 2BW7A 3Q24A 2WVEA 2D1CA 2FY8A 1QVFR 4BCAA 1TFYA 3TNVA 3BGOP 4ILMA 2Z57B 3LWLA 1M1KT 2R8HA 4OFZA 1Q8IA 1R0AB 2KFZA 2YKAA 2E5LJ 3Q2SC 2H3EB 1RTHA 5K14A 2QE5A 5EX3A 1CQMA 2QZ8A 3EJMA 4B3MF 5ETNA 4P2MA 2QGFB 2DIVA 4X2BA 5LJ5Y 3T5KA 1CG2A 1F2HA 3P5TL 2DNOA 3AJ2A 1FX2A 4ILRA 2ZH4A 1TMMA 3CD7A 1J5EJ 3MM7B 2Z4PA 1T03A 3NGSA 2RRAA 4ERDA 1WC5A 2I0XA 1VQLS 2V68A 3FBEA 3RB6A 1VQ4S 2EBGA 2DPIA 3OW2R 5E0OA 4RX6A 4NLWA 4CYUA 2ZH2A 2Q43A 2XLKA 3O1LA 3ZTOA 1FRJA 2V4JB 5FLXY 3KG4A 2AGPA 4LF1A 2XS7A 3HT0A 3W1YC 3OHAA 1M5PC 2R7UA 2MQOA 4N56A 4UOHA 2Q6CA 1N34F 2QYGA 2Q6BA 4XAKA 3EVOA 4F4XA 1BWVA 2AX1A 2POKA 4K2JA 3D0IE 3V81A 4G1IA 1HBOB 3RBZA 3BGRA 4F3QA 2GX8A 3ISND 1FF2A 1SH0A 4O3QA 4A48A 2EC2A 3SEOA 2G0CA 4KGXB 2X1BA 3HI9A 2I5JB 2BJDA 2XYPB 1S79A 4K2XA 2BMBA 2ZM6F 3E3XA 2KDOA 4USMA 5HMYA 4B9SA 3WZ0A 3TANA 1JLFA 2CPEA 3R9LA 5B0AA 3DRPA 2M8HA 3AB4B 4NZ7A 3DOMB 4EK2A 3MMCB 2QSFA 1V3SA 4QYRA 2KT2A 4QIVA 4DUTA 2QC3A 2KJVA 2E44A 5DDPC 2KHCA 1RAEB 1IQZA 2QX0A 1UZHA 2X1FA 4CO4A 1RTJB 4HACB 1HR0F 2Z2YB 2ZOGA 1UVKA 4AL6A 4IKAA 1YG0A 3CEDA 4N8NA 2CJBA 4ZP7A 1U8WA 1HQ2A 3QAEA 4OI6A 5JXSA 1HI8A 3H5SA 3R6LB 5D3GB 1RWXB 1S1VA 3SBMA 3A1YG 3GU0A 3I5BA 4I56A 2ZBRA 1VBYA 4TYBA 2DNYA 3CJKA 1T9YA 1Y9OA 2DNKA 4ECSA 1GFWB 2VC1A 2WSFC 3KMSA 1FT8A 4URGA 1JK9B 3AJDA 5T7LB 1JXLA 3G6ES 3D3BJ 3EGNA 2Z2ZA 2BQ3A 2VFUA 4R8UA 1RT5B 4F0KA 3RU0A 2W01A 1DJ0A 3DRSA 4RPFA 1GQEA 5T41A 1YI2S 3FRYA 3C16B 1N5YA 1IUJA 1JJHA 4X4RA 2VA2A 2GIQA 2L9DA 3AT1B 2M4MA 5BYQA 2YX7A 4EU0A 2D41A 4K4VA 4ZVQB 4B3MJ 4BWJA 4UTGA 3H90A 2V2VA 3UVJA 2VPXB 3KG1A 4HR2A 1KONA 2FB0A 3OXLA 1N48A 1YJWS 4M5JA 3SCKE 1PAEX 3VZHA 1FKOA 2C3UA 1F6TA 3GIIA 4K4ZA 4C3KA 3FGVA 1FNXH 2MZQA 4PZVA 3SI8A 3HKWA 3TAPA 4KV8A 4BC7A 2CPFA 3U02A 1YKWA 2CZ4A 1Q8BA 4ZCKA 4FVMA 4CZCA 5I3QA 4LF4F 5EGYA 1R3NA 1PC4A 3N9UC 2R8IA 2HBQB 3J80U 1H38A 2W2NP 2A1BA 1N34J 3IAS9 4HDHA 2IYGA 1RCOB 3FQLA 3BN4A 1B3TA 3OFFA 2A2CA 5HROB 2K3KA 5D0HA 1RT4A 4M5MA 2X3DA 4GVBA 2F8EX 4UOFA 2C22A 4DV6F 4EO6A 3FZBA 3QJLA 3W61A 3W9JA 1IWAA 4CH1A 3TQ1A 3A3OB 1VQYA 2ZM6J 1F5BA 3T9ZA 2XTJP 1KHVA 4QR0A 1YJRA 2D74B 1X4DA 4QOTA 2R2RA 1IBMF 4H4OA 2GS8A 3IBFB 3PACA 4AXIA 1KFSA 1LFPA 1C1CA 1YBTA 4OX8A 1FDBA 3IM9A 3CJ8A 3KK1B 3MR3A 1HR0J 1EQMA 1RWNB 3DLHA 1HBMB 3CDWA 2ZBPA 4YY3F 1F1BB 1RKIA 5T14A 1U0SA 1TVRB 1T95A 1SH2A 5A2QY 4TU7A 3HMJG 2RMLA 2FLOA 3H20A 1X4FA 3CMQA 2YKPA 4LREA 2H9ZA 1Q16B 4CQ1A 3AOBA 2B7BB 2HVIA 4KAIA 2OAUA 4A8WA 1Q8LA 2DGUA 2E7WA 1UA1A 2JFDA 2KZZA 2PDAA 1J5OB 1RT2A 1H2VZ 4NXNF 2D3UA 3IA0A 2JVRA 2AQ4A 4J9OA 2HS4A 2WONA 1CULA 2HGLA 1S76D 1FD2A 1ZS6A 2APOA 3ISNC 4P6QA 3DLGB 2H4YB 2EFPA 5CH7B 4PWDB 2VH7A 1HHTP 2W9CB 1TUVA 3MPVA 2HQFA 3V6DA 2XO7A 3CJQA 4NLQA 3FSYA 1NJXA 2UUBF 3MPYA 2C28A 2JSXA 1N0UA 2AYEA 4X4TA 2VFVA 5J2PB 2C3OA 4EWTA 4R5PA 3CDUA 4OYXA 4ZPWR 5A8WA 3VALA 4W90B 2MY7A 2VG6B 2Z30B 1RKJA 4W92B 1D8ZA 3P49B 3FFIB 3R5DA 4JI8F 1FEEA 2BE2A 4QR2A 3T5LA 1JNRB 4XIUA 1VMBA 1EETB 4GVLA 3NGDA 4TLRA 5LOQA 3QFHA 4X84A 1T8EA 4KGZB 1RK8A 3EDQB 3M30A 2G4BA 3W60A 2FJBB 1E6YA 3C15A 3ZTQA 1V9OA 4B9MA 2CPHA 1BQNA 1TU0B 4DX5A 4LF4J 4AFFA 2DVIA 2J9EA 5J2MB 1RHQB 3EZUA 2IVMA 1HFEL 3TA0A 3ZZPA 4ZJOA 2OMLA 2W8KA 4I4BA 4G3IA 2RIJA 5IFMA 4AD6A 1Q79A 2RF2B 3HHLB 2BE9B 4ICLA 4ZVTB 1FRMA 2CWKA 2OKQA 4I6YA 4DX6A 5D0GA 4IR1A 2QRRA 2OPPA 5KFUA 3AHPA 1NK9A 4J9NA 3G6VA 4PRFA 4KHRA 2XYGB 1PCAA 3J7YU 2R7VA 2CJXB 2WSEC 3BKFA 1RT6B 3KHLA 4DV6J 2XG8A 1RLCL 4P7TA 4E98A 1OMSA 4DL6A 1S59A 2R7XA 4ECRA 3RW7A 1D09B 3HCXA 2KYZA 3HJVA 1MMNA 5BJRA 2QV6A 1IBMJ 2CKWA 3KWMA 4ED3A 2V50A 3SV3A 3I9ZA 5KFTA 1S48A 3QGIA 4MMOA 2YX1A 3HLUA 4O44B 4U8YA 2NCKL 2L9NA 1PYOB 3OLBA 4YY3J 2OLWA 2X3GA 1YJNS 3TZYA 3EXYA 4K5RA 4LSZB 2DK2A 2JEGA 3NS5A 4LSLA 2YNHB 4OLOA 3DGPA 1ZM3A 1L3TA 2RB7A 2LP4A 1GXTA 4J9UE 3QAUA 2MJNA 2D3OR 1U1NA 1KVJA 2HBZB 1WC3A 4RW6A 1TL3B 2VKZG 4Y2AA 1DURA 1HNXF 3FEZA 2R7OA 2J7WA 3R5AA 3BSOA 2GVZB 4NXNJ 3CJSA 4F25A 3W62A 3M6WA 4Y65A 1TV6A 1P27B 3PEJA 4KY3A 1NAQA 2WTFA 2BVZA 5LM7E 1RSCA 2YBVA 1PC5A 2PFDA 3G86A 1UVIA 1QAYA 3BGUA 1ZA1B 2CXEA 4LRFA 4PABA 1SC6A 2HG4A 4USKA 8RUCA 1PG5B 1SBRA 2EBEA 2IC3B 1LXNA 4NMLA 1K73T 2OH2A 2QEXS 1JLGB 2PI4A 3F56A 4Y6IA 2UUBJ 3UCZP 1FVSA 3QQCD 3DLKB 1U4BA 4WIQA 1HWUA 2XB2D 3QT7A 3QIPA 4WFNQ 3EYZA 1M90T 4YB6A 2XEXA 3D66A 1FRXA 4USIA 2CUYA 2HAIA 2GJ2A 1D1UA 4NX9A 3RBEA 1UVNA 2DT9A 4JI8J 4B9TA 2FLLA 2EG1A 4LIRA 1CS4B 5I42A 2BRKA 1A9NB 4PG7A 1LNQA 4O3SA 4F02A 3IXQA 4O3NA 4C8OA 1S12A 1PJ5A 3W8GA 3PNIA 4Y2KA 3QYYA 1K44A 1HI0P 1HWIA 2QSWA 4DEZA 2DH9A 2EI5A 4YUDA 1VRTA 1SJ3P 3BR8A 2ROEA 4I6WA 3LP0A 4ENOA 3CCJS 2N4CA 1D9FA 2UUTA 2H5JB 4IG0B 1YJ7A 1FJGF 2WVFA 3NNHA 4ANEA 4MKYA 1S9FA 2HPUA 2DNQA 2XMUA 1JLQB 2LU2A 5D4PA 2ZNZA 3CULA 4F7VA 2XS2A 1A0OB 1XR7A 5CZVA 1T9TA 4AL7A 2R7WA 1CPZA 6AT1B 3B78A 4M5IA 5CYQA 4X4NA 1HQEA 4NLYA 5DGBA 3PIOQ 1IJFB 2YNIB 3K58A 3MZIA 5LSRA 1UFKA 3CMAS 1R0AA 3PRVA 1ZZNA 3MCOA 3KNAA 2IJRA 3NMRA 3G6XA 5AXKA 3FBBA 2HFNA 4IUFA 4DUYJ 1OYDA 1TTHB 1U6ZA 5DS7A 2Q3PA 4LFBF 3EMTA 1YDLA 1AB8A 4B02A 1NJIT 3CMES 5JVGQ 2J9DE 3CJTA 1FK9B 2YTCA 1HD0A 1ZA2B 1NKCA 5K20B 3MM7A 4F4YA 5J1EB 2QA4S 1NZ8A 3GLJA 4AE5A 1GEHA 9ATCB 1S1XB 2GAHC 1QSSA 2YQ1A 1UPMB 1D9AA 1Q7YT 4F50A 1ROFA 2ZFHA 4NRUA 3R6GB 5E41A 2IRYA 2ASYA 1HNXJ 3FCHA 1NCLA 3HHLC 2HK3A 4ITSA 4RBTA 3BSCA 2E7VA 2V4JA 4TNOA 2C2OB 2C3PA 4OYAA 2CYYA 2DGOA 4KO0B 5ADZA 5BXIA 3CCZA 2JFKA 4TQRA 5C25A 2H5IB 3QO9B 2YH0A 3CCSS 1PGZA 1N6QB 3AJ1A 5ETVA 1RT7B 3KUEA 1WDDA 1ZOTA 4RU9A 3FEXB 3AXMA 3HVAA 3L4BC 4CLYA 3KK3A 1RT1B 2IVFB 3MM5B 4EZ9A 3H42A 2ZJRQ 4OHXA 1XJWB 3K57A 4IOAQ 4ZP8A 3KDNA 2B6AB 3HXMA 4DBQA 2DGSA 4PR6A 1PYTA 2VICA 1NK0A 3H2UB 1ZETA 2IHR1 4ZMMA 1KTQA 4J5OA 4JV2A 5IC4B 4M5GA 3BQ1A 1H7WA 3FZ2A 2DO0A 2FJWA 2WCXA 3DI6B 4IH6A 4PG4A 3DOMA 2GJFA 2J8SA 4C8NA 4ZLPA 5EWFA 3NP5A 4KSEB 5HJXA 4P2SA 1PSDA 5F8IA 1RTJA 4HACA 3THVA 1KWMA 3PYDA 3PTWA 3PV8A 4LRDA 2CNLB 4U6PA 3BB5A 1C4CA 2Z2MA 1RAFB 4DR2F 3LP2B 1MROB 1OWXA 5KTQA 4WZMA 1FJGJ 3SQGB 1QM9A 1TKTB 3TRGA 2YKQA 4DPOA 1OY8A 4B3OB 1IKYB 3VQSA 3MGJA 3PW7A 1JLCA 2JH3A 2E5IA 1HBNB 3C8YA 1YLXA 3OL6A 3IGVA 2VOPA 1K1QA 5IS2A 1RUSA 5T7LA 4CRJA 1UA0A 1U1RA 4K4SA 4GO7X 2J9DA 3GSDA 3TJ8A 1S99A 4X4QA 4A46A 2GQCA 3M4XA 1K0VA 4K5SA 3KDOA 2F8HA 3QMQA 1RHJB 2L41A 3S8SA 3P8BB 3TP2A 3UWTA 3FJ2A 4WFZA 2E1RA 1UJ4A 4Q5VA 2RVJA 4DPXA 3N6MA 2HBYB 1JJ4A 3EXCX 1MN9A 4OYOA 3R5GA 2VF3A 2F9JA 4FYVB 4KPYA 1OJ4A 3JTNA 4ECTA 1RB0A 2ZBQA 3I4HX 3G82B 3LH2S 2WSCC 4ED7A 3I0SA 2B9XA 2WZ1A 3OVAA 2RAQA 4JI2F 1PO6A 2HIQA 1KRPA 2JC1A 1G1XA 1VQMS 1QTNB 4IOCQ 3HJFA 2MKIA 3AFGA 4Q7AA 2CQGA 4FYYB 4B08A 1LWCB 2CJ9A 2GZOA 4O3PA 5ITHA 2HWTA 5D0RA 3UO0A 2BDPA 3CCLS 4V19X 1KP6A 2CQCA 3TUZC 1A6LA 2MZSA 2ALZA 2HRYA 3QWUA 2IMOA 1U1MA 1FCAA 1WSRA 2LFVA 5KFPA 3RZAA 3RB4A 1X31C 3H59A 2OFHX 1VQNS 2NUHA 3ZO7A 2FQQB 3R7NB 1S10A 2P9CA 1AYEA 1LW2A 4K4WA 3CE8A 5HROA 1O51A 1N33F 2ZKUA 1WF0A 2IIHA 2YX4A 2DNNA 4TVAB 2XNRA 3D0HE 4L3KA 3CXCR 2MZRA 2L08A 4CM0A 4DV7F 4RR5A 2H51B 3VF0B 3QT5A 1EKRA 3JTOA 1EAYC 4PAAA 3VAMA 4DWIA 3P5BP 4NEYA 2ACYA 2IA0A 2F65A 4LF9F 1SB6A 2LYVA 4FXVA 2K7KA 2XSJB 3ENAA 3OD2A 1SQGA 3PZPA 2LLZA 4WP3A 3FEYB 2YQ3A 4ED4A 4M94A 2NZ4A 2KXNB 5LL6d 2BBEA 4YDXA 1S57A 2ZITA 2OEKA 2CQDA 1HBMA 4F4WA 4LFAF 1TAQA 1TFWA 5LXYA 4DR2J 4DSEA 1XEZA 1QTMA 2KRRA 3J7AN 1L5UA 2ZH9A 5D8HB 1NK5A 3QIDA 1RGVA 5HBMB 4B9LA 3RR8A 5F8MA 1YRXA 3B4MA 2VV5A 5CD4H 3ENVA 3TJ9A 3C3LA 2VFTA 3FRZA 1AFJA 2YVSA 1YGYA 2N4DA 3C14B 1X4AA 1J5OA 2CZ9A 4OZLA 3D6HB 4P2FA 4Q43A 3CD6S 5KG4A 2NS1B 3R5BA 2GHPA 2ADBA 2BJEA 5GADU 3SFUA 3EZ5A 2PD1A 4R0EA 3HVRA 4RNMA 2VPZB 2R4FA 3PJXA 4PWDA 2W9CA 2WVCA 3DYAA 3M8QA 3J81U 1NHUA 3W66A 1VBZA 4U8VA 5IZHA 3PW4A 2RUSA 1SL0A 4F4KA 4WKRA 2OIHA 2XMMA 3MMBA 3QLHA 3QJJA 1HNVA 3Q8RB 4ZJQA 1TAUA 4DR3F 4TU9A 3FFIA 3I4PA 4KC5A 4Q0BA 1EETA 3AOAA 1PKUA 2UXBF 3GYGA 4JI2J 3HVWA 1GXLA 4NPOA 4KGKA 2BM0A 1B70B 5IC6B 4QYZJ 4PYAA 5HQ8A 5KFCA 1Z4UA 4OYMA 5M2PA 2E7XA 3CCTA 2XHCA 4AQYF 3GJQB 3TR5A 1HHSA 2BR0A 5J2MA 2V8GA 3AB2B 1H72C 1YHQS 2ZBCA 2KI2A 1RTIB 4OYPA 2VDHA 3NAHA 3CJ4A 2RF2A 3F73A 3HHLA 4ZCLA 4Z7CA 4CLSA 2BKOA 4K4UA 4JI4F 4YDDB 1NBEB 3N0VA 2FVPA 1FE0A 3SV4A 1GK8A 3M6UA 2ZUGA 1UCNA 2YWKA 2FHJD 1N33J 1S6QA 3M9OB 5KG5A 5C42B 3QGHA 1S9GA 2XQCA 2HAFA 1X4GA 4JP8A 1I94F 2GC8A 1IM4A 2VZ9A 3FCVA 4DV7J 2E1PA 3IS9B 4C8KA 4KPCA 1UAWA 1JJCB 4YR3A 2AYBA 3CCQS 1XMQF 1S1TB 1XERA 5ETQA 2P6SA 4HLBA 1RE1B 2FIUA 3H5YA 2QL5B 3M9NB 3FNNA 4WTOB 2E29A 4C8ZA 2HQIA 2DGVA 9RUBA 2BQUA 2OJ3A 1T11A 1N36F 4ZHRA 1S4EA 1VQ8S 3O2IA 4LFAJ 3MAAB 1V5VA 4IDKA 4JB8B 1FTCA 1YBUA 3QBCA 5KFDA 2VBYA 3W3SA 2MKYA 1X4EA 3CCES 3I31A 3BREA 4C97A 2FHOB 3DRXA 1WEXA 2N3LA 2GVDB 3N01A 4KYZA 1OPIA 5HMXA 4UOCA 3VVTA 1RWPB 1YRTA 1H2TZ 1Q0NA 2OPSA 1ZAXA 3PFEA 4FS2A 3A8KA 1YX2A 3N5BA 1F9EB 2C42A 3FDSA 4ZVHA 1FFGB 3A3PB 5CYMA 5FLXU 2UVUA 3BDEA 2VU5A 4DJBA 4RU2A 4N7TA 2DNMA 3V6JA 1ZAWA 2CNKB 1O0PA 2RDDA 4F2SA 4DSLA 2XC9A 4IG3B 5HQLA 3DDKA 2AEJA 1IBCB 2WBRA 4DSJA 4KHPF 2MQPA 2JVOA 4EYIB 3ZZTA 1NPKA 1DTQB 4MYUA 1LK5A 2HQGA 1KOOA 2DGXA 3DLKA 1KKHA 1R89A 2PEBA 3AD7C 4ES1A 2HWIA 3QZ7A 3N79A 2IRXA 3THTA 3U1LA 2W9AA 3T6BA 3W64A 3D4JA 4DR3J 3RRGA 3HSJA 4OZ2A 1CS4A 1X5TA 3GMGA 4I68A 2NREA 4Y2IA 2VKRA 4NLXA 1KD1T 2DNRA 2ASLA 2UXBJ 1DZ5A 2FZKB 4OZ1A 3G6YA 3GZ7A 3MEGB 3D7SB 2C2NA 1AROP 1WOSA 3RYLA 2QLWA 4ES3A 2VHGA 1RHKB 3IR5B 1TKDA 2KU7A 3MWBA 4AQYJ 4QPXA 3PYEA 4FF1A 3I6PA 1FJEB 1HW9A 3IR6B 5MLCV 1DQAA 2B4PA 1WC0A 2AD9A 4IG0A 5D77A 4UQTA 3IAM9 4U67Q 1RWMB 1F5AA 4DV2F 2CDRB 2Z0GA 2JLFA 2MQNA 2XBPA 1IQTA 1JLQA 1IR0A 4JI4J 4ZCMA 3TA2A 5CHCB 3O44A 1WHVA 1R0CB 5KFEA 4H4KC 4CIOA 1JLFB 5DG9A 2DGQA 3LP1A 2R9LA 3DRPB 3J7YI 4EO8A 5KFNA 3ENWA 4DV4F 1I94J 3PJ9A 2QT7A 2Z56B 4DSKA 5C5JA 3H0PA 1Y5IB 1XMQJ 2DIUA 1N32F 5JJBA 3I82A 1BQXA 1TKZA 4DQQA 3N28A 3TW0A 4Y2MA 2E9TA 5KT5A 1YIJS 2VPYB 4HT7A 1HIYA 4CLWA 4OZ3A 4IO9Q 4QIEA 1U1QA 4Y0FA 2BJ1A 1T0TV 1N36J 1T94A 5HMWA 4LJMA 3KFWX 2M8DB 3RAMA 4ZP9A 4NXMF 1FDNA 2UVVA 2NXUA 4HI2A 1S1XA 4KGMA 4J9LA 3DRSB 4PPZA 3DRRA 1RT3A 4ZK7M 2ZEJA 2GA7A 4A8XA 3ET6B 3ULHA 1EKSA 4RUBA 1FKAF 2UXCF 1JXEA 1CJKB 3L7PA 5AE2A 1P1LA 2FJDB 4OHZA 4IH5A 5DZ6A 4FZVA 2YWWA 3TUPA 1X0PA 3TX8A 5EUHA 4KO0A 5AT1B 2VC0A 1EQ0A 1FNOA 3QO9A 5KFYA 4RW7A 3OFEA 1RT7A 1DARA 3GONA 4KHPJ 2NXCA 2LEPA 4ECYA 4NA3A 5GMDA 2ZWPA 5GAGU 1RT1A 3WDOA 3MM5A 3UNGC 4DV1F 2I9SA 1RADB 4KV8B 3SFGA 1U47A 3UFCX 4X65F 4LBPA 2XY7A 4ECZA 3U27A 2MB0B 4L3NA 4JYAF 2D3ZA 1NKBA 4WE1A 3VGUA 4ZPAA 3OL8A 3DI6A 3BPSP 2BM1A 5B0FA 3TZXA 3CPWR 3TARA 1EIYB 1PJ7A 1QDUB 2G1DA 2HQCA 4CLLA 4ED6A 2FVSA 3CC2S 3GJSB 3KJNB 3M8RA 3LP2A 1MROA 4Z7YA 4OL8A 3R7SB 3M8WA 2PFFB 2B0GA 3IRWP 3SQGA 3PX6A 2LQBA 4MFBA 1TKTA 3NOGA 5HO4A 4B3OA 4DV2J 3MUMP 1SQEA 2Y0BB 1R8BA 4JV0A 3UQSA 3ZC4A 1VQ6S 3K5NA 3GP9A 3VQTA 2IM1A 4B3RF 4OI2A 1WNEA 1NU4A 5L46A 4DV4J 3M8PB 1ZPVA 3NBPA 5K8OA 1GMUA 5C24A 4RNNA 3OJUA 1C1CB 1H98A 2Z2LA 4HI1A 1X5OA 2RDJA 1P9YA 1B4SA 2C2DA 1D8YA 1N32J 4DL5A 2BUNA 2CZVC 1GT8A 4MKBA 4N5SA 5EHHA 1FDAA 2OHDA 1FEHA 3QRQA 2BRLA 3UD3P 2HS0A 3SDEB 2KN4A 3KLHB 1NB2A 3CO9A 2ZD1A 1L3SA 3MURP 4FF3A 3M2UA 1E6VB 4K4YA 3OJSA 3TUIC 3CCRS 4O23A 3ZXWA 2A10A 3VZIA 3V6HA 3TEHB 1PBUA 1UWBB 4Q8FA 4L75A 1RTZA 5SUHA 1GNKA 4NYPA 2R8KA 1ZM4A 2QYCA 1VQPS 1FJCA 2HFOA 3K8WA 2GGPA 4NXMJ 4OHWA 2AYMA 4FBTA 3DLEA 4IFVB 5F3TA 2AHOB 2WONB 1CULB 2XCAA 2J5AA 1M1GA 5J2NA 4QYZK 2UXCJ 2VG7B 4Y3CA 5E3QA 5L8RC 2QIFA 5D6GA 3D54A 4EUVA 4Q44A 4NRTA 3H98A 4YEAA 3K5MA 4LF2A 4DL0C 2E5GA 4WYLA 4DFKA 1I1GA 5HJYA 3VV2B 4C0HA 3H5UA 4N41A 2HQDA 5HP1A 4R5PB 3H4BA 1T9UA 2DY9A 1OY6A 3P45B 4AUKA 3AH6A 3V6KA 2O5DA 5A8WB 4TY9A 3I87A 4CO5A 1RYRA 1JLBB 1ZYQA 1SUQA 2V4RA 4G1PA 1T05B 3MF5A 3ILOA 2GAGC 2MY8A 3QT8A 4DV3F 1R27B 3DLLQ 4DV1J 3Q2TC 4QWAA 4F0HA 4FVCA 3NS7B 1SKRA 4GC6A 1HQUA 5CZXA 3BH6B 3GCWP 3IC1A 4X65J 1E6YB 2CQBA 2NR0A 4RW9B 4CI0B 4QWDA 3BGFA 4JYAJ 4ZDNA 4DFPA 2XSJA 2CJAA 4ZPDA 4MAKA 3ICLA 2ROPA 3M2RA 3PHEA 2B9YA 2FC9A 1B99A 4YP3A 2P2CB 4PG6A 4ICLB 3GSIA 1CEZA 1JB0C 3W8PA 2OPPB 4BHQA 1WG5A 3CCMS 3VAGA 1TK0A 1X5PA 5E2QA 2BX6A 3MUTP 3Q8UA 2DCUB 1T9XA 2Z58B 2HGNA 4I1TA 3L7UA 4Y00A 2VG5B 2V8HA 1PBAA 4UY85 1X0FA 4DN9A 2MQMA 1FXDA 2BOPA 5HVFA 2VASA 2JLEA 3BDPA 1WHXA 5KAKA 4B3RJ 3BBBA 1SCJB 4ILLA 3KLIA 5KFVA 3ZZ0A 3HF5A 4F8RA 2IAJB 2GHWA 5KFZA 1REVA 1N52B 4ZPVR 5KOXA 2HWHA 1FDDA 2ZJQQ 3SZ2A 3NXZA 2FVCA 1IXKA 1RXOB 2OTLS 3O8WA 4DUZF 4MH8A 3D1QA 1H7XA 1NHKL 4I6AA 1TR0A 2W7PA 3B54A 1NPRA 1T9WA 4LSLB 3DC2A 4CO3A 5LMUF 1YTYA 2AW0A 3DGPB 1RAJA 2D7SA 4MYTA 1WUUA 2V2KA 3DU5A 3NMAA 1I3OB 1YK9A 1K0TA 1MN7A 3R27A 1I51B 2PE8A 5DM6Q 1J2VA 4ECXA 4USHA 4DU8A 3D28A 3HT3A 4F3OA 4DU7A 3NEKA 2CVEA 4OJ1A 4MK8A 3Q89A 3OTDA 3R2DJ 4USWA 5IV4A 3D6FB 2UU9F 4C0BA 4O0IA 3Q8SB 4DV0F 4NLPA 1Q53A 1JKHA 2KXHA 4CLUA 1PYSB 1RTIA 4D3HA 3EVMA 5GMEA 1YRUA 2AF6A 4NYZA 2ZH5A 2OD4A 4FDFA 2DITA 3QJPA 3H8YA 1Z2ZA 1UW9A 4XPEA 3O3LA 3IWNC 3E01B 5ETOA 2FHJA 3OR1A 4QBUA 1T7PA 4PWWA 4DV3J 3JAMY 2EC0A 3KUGA 4EBDA 2BJ7A 2NYIA 3IS9A 1ZTTA 4UW2A 1VC0A 3JSRA 1RHUB 1S1TA 2FC8A 5DM7Q 1FXLA 4DS5A 2ZVSA 1JX4A 4XDCA 4F04B 3RAXA 2ASJA 4XTTA 2F63A 3Q22A 3TX0A 3HK2A 2RRNA 5L1JA 3IO1A 1GMWD 1HNWF 2QN6B 2DGTA 2FJXA 2E1CA 3MAAA 2RDIA 2PMWA 3MXHP 4PXCA 4OYZA 3KK2B 2M9KA 2F40A 4URQU 2LQ5A 2XYHB 1S7HA 3IFEA 2MEWA 1WELA 5CYQB 3QNWB 1H73A 4CDIA 1VISA 3BV8A 2XM3A 2GVDA 3TWZA 4W4MA 4DZDA 4K4XA 2DNGA 2ZJPQ 4XDDA 4ANDA 5DETA 5DDRC 3BSNA 3BS9A 1EJ7L 3MR2A 3ZTSA 2JC0A 1W7WA 1S0OA 2LVWA 2B43A 1N0VC 3S7RA 2X1GA 1WKLA 3IP0A 4LT6A 2G0IA 1NMEB 1MNEA 1N5QA 4F2RA 2PMZD 3K59A 1ULRA 1SJFA 1R8HA 5GADI 1FESA 1NXIA 5DG8A 4NMXA 2M2BA 5L1KA 4IG3A 3OUYA 3EWGA 4K50A 3A8JA 1CJVA 4JI0F 4R0JA 5KG3A 4A8OA 4K4TA 3I0RA 2ERRA 4DUZJ 1DTQA 4U7UK 1M5OC 5C2CA
chains in the Genus database with same CATH topology
3DI6B 4IH6A 2DH8A 1W2IA 3DOMA 4PG4A 2VQEF 1F5CA 1R8CA 2KFNA 1K1SA 2MHEA 3IBWA 4Y28C 3K8VA 4C8NA 1UFLA 4ZLPA 3RW6A 5EWFA 4I7FA 3LUYA 3NP5A 1HNZF 4B9NA 2A18A 2FPHX 4IH7A 4KSEB 1C0UA 4NA1A 4P2SA 1CC8A 1DLOA 4PXEA 5GMKa 3THPA 2RKIA 2CPDA 1PSDA 5F8IA 3BO4A 3K0JA 1RTJA 5EWGA 2M52A 3THVA 3PO5A 2COLA 5GAHU 2PC6A 2RQ4A 4HTIA 5DG7A 1AUDA 3PV8A 1L3UA 2O01C 4MK7A 2YKMA 4U6PA 1FTRA 4L6V3 4O4GA 3BB5A 1RT2B 4EGLA 2ADCA 1C4CA 2Z2MA 4LF7F 5HLFA 2V94A 4B9UA 1HWJA 4DR2F 2VA3A 5E33A 4IOBA 4PQAA 3LP2B 1MROB 3W2VA 3HX9A 1OWXA 5KT3A 2C2RA 5KTQA 2DR9A 3S1TA 4WZMA 5L9NA 3MMJA 2I1RA 4F3MA 4UUWA 5A8KA 3BSAA 4ID8A 2XGPA 2DD8S 2E1AA 3SQGB 1BQMA 2PMHA 1QM9A 3HHLD 4OZJA 1TKTB 4KKOB 5B0DA 3J7Z5 2HMIA 3TRGA 2YKQA 4DPOA 3MEGA 3PO4A 4B3OB 1IKYB 3VQSA 3MGJA 5B0BA 3IN5A 2NLWA 5K9FA 3PW7A 2IJNA 5CCMA 1JLCA 4HTJA 2E5JA 1TL4A 2JH3A 1LWCA 4ZVFA 5C25B 4JI5F 5D78A 4RWXA 2E5IA 3HPOA 1HBNB 4HH0A 3Q8QB 4IQXA 2HHPA 3C8YA 5HMZA 3T6JA 2L48A 3MEEA 3CCUS 3OL6A 3IGVA 4Q8EA 3N5FA 4M5DA 4QW8A 2VOPA 4YQWA 3M1VA 3V6DB 2EVZA 1K1QA 5IS2A 1VS3A 5T7LA 2HHUA 5E3RA 1UA0A 3D2WA 1U1RA 3C46A 1FD8A 1XR6A 3KK3B 4K4SA 2QMXA 5F3ZA 4GO7X 1QE1B 2J9DA 4YB5A 3K5OA 1ZAVA 2BACA 3GSDA 2B4OA 1S99A 4GMKA 3O6QA 4UQGA 1FJ7A 3TAMA 1T3NA 2YWEA 4X4QA 1WWHA 3DOLB 4QR1A 4A46A 2PA3A 2L9WA 1HARA 1SIZA 3CUNA 2GQCA 4LQ9A 3CWJA 3M4XA 4NYOA 1U49A 3PM9A 1K0VA 2CPJA 4K5SA 3DOKB 4ZP6A 3KHGA 1R31A 3OUYB 2F8HA 1G6BA 2BE2B 2EFGA 3DMJA 2CPZA 1NK7A 2DHGA 3QMQA 3MR6A 2L41A 5FJ4A 1IKWA 5KT7A 3S8SA 4LSNB 3TP2A 5EWEA 1NK8A 3I55S 3UWTA 3FJ2A 2HW3A 4WFZA 3KYLA 2E1RA 2DHSA 1UJ4A 4ATNA 2GHVC 2HNDB 2I2YA 2C3MA 4Q5VA 3I0RB 4I2PB 2J0WA 5J1NA 4DUYF 1YJTA 2RVJA 4LF6F 3UR3C 4WXOA 2WRMA 3N6MA 1JJ4A 1R8AA 3IG1A 3EXCX 4X64F 1WG4A 1XR5A 2F9JA 2BZ2A 4OIXA 1OSDA 1VQ7S 3M30B 4KPYA 2RU9A 2MZ1A 2HHSA 1B0TA 4I7FB 1SKWA 4U9RA 3JTNA 4DF4A 1S1WA 4CCHA 2V9KA 3P6YC 2ASDA 3CF5Q 2VONA 5LMNF 2IVYA 2RNEA 2JRSA 2OD6A 2DHXA 2RKIB 3BZQA 4ECTA 2L3MA 2J9CA 1BQNB 3IR7B 3PY8A 4AL5A 2GQQA 4TN2A 4RNFA 4A8SA 4ZPBA 2BW2A 2EK1A 2KM8B 3I4HX 3LH2S 4O4GB 4H4MA 1LW0B 1IJEB 6FD1A 2WSCC 4ED7A 5CXTA 3PX0A 3I0SA 3GQCA 2B9XA 4OI4A 3W2VB 5D4LA 3OVAA 4JI2F 1LK7A 2RS8A 2RU3A 1PO6A 1QSYA 2HIQA 2IMWP 4A8MP 1KRPA 2JC1A 5A8KB 1G1XA 1VQMS 2UUCF 4YB1P 4IOCQ 2HRUA 5IWAF 3BN7A 4C8YA 1BQMB 3RB0A 2EG2A 1VI7A 1DBDA 2MKIA 3HJFA 1VQSA 2KH9A 2XWXA 1VC5A 4Q7AA 3JSYA 2JEIA 4TXSA 1JLCB 3JTPA 2CQGA 1HBUA 3PXGa 4B08A 1LWCB 3L09A 1D3WA 2CJ9A 3H2LA 4O3PA 4J9MA 5ITHA 1KQKA 2CQ0A 4E0DA 2HWTA 2UP1A 2BDPA 3H4DA 3MEEB 4OV1A 2N7YA 1SV5A 3POTA 3FMBA 3CCLS 4V19X 2R2TA 3T1HF 2CQCA 2RE1A 3M1VB 3TUZC 3F41A 1A6LA 1WD6A 1X8DA 2AJ4A 2M70A 2MZSA 2ALZA 2HRYA 3QWUA 5KFJA 4ED1A 4DR7F 2IMOA 2AJQA 4GKKF 1U1MA 3GIKA 1FCAA 4YB7A 2LXFA 2A2DA 4FNHA 4MKAA 4YHHF 5KFPA 2J6UA 5LJ3Y 5HBMA 3RZAA 1WTBA 4G1QB 4OZ0A 1QAIA 2CVIA 2IFXA 3RB4A 1O8BA 2ATLA 4KR0B 3H59A 4LQ3A 2OFHX 2AWZA 2KKHA 1N5SA 1VQNS 3TAMB 2NUHA 2V5HG 4ZS6A 3NG8A 2DRAA 1JJ2R 1S1UA 2B56A 1S10A 3DXBA 2P9CA 3ISZA 2JJ4D 2OPQB 3OL9A 2BA9A 3MM6A 2HGMA 4IRDA 2EKYA 3GIJA 1C4AA 1LW2A 2DB1A 5E5NA 4WFAQ 4K4WA 2E5LF 3CE8A 5HROA 1UVJA 5A8RA 3DMJB 7FD1A 1O51A 4TKTA 3UR0A 3BF4A 1I6JA 5KFSA 1N33F 2ZKUA 4QIFA 2GW8A 1WF0A 1IKWB 2RD5C 2YX4A 3MD1A 3FSIA 2DNNA 2MZJA 2AYGA 1RDRA 1S49A 1Y5NB 4XK8C 3H25A 1AW0A 2XNRA 5DQGA 3D0HE 5G4DA 1VLYA 3MM8A 5BR8F 1H3DA 3ENQA 3CXCR 2MZRA 3OSPA 2L08A 3C6TA 1K9MT 4DQPA 4DV7F 1HPZA 2CQ3A 4ZVGA 4DF8A 2PA8D 3OR2A 3T9NA 3VF0B 2HLUA 4PQUA 4DL2A 3JTOA 3C66A 5K8NA 1S6UA 3VAMA 2F3JA 4DWIA 2ZDPA 2K1RA 1KS2A 5GVQA 3T5JA 4KQZA 5KFHA 2ACYA 2KG0A 1FKPA 2IA0A 4X62F 4LF9F 1SB6A 2LYVA 4FXVA 2GFFA 3MMAA 2UVRA 3CJ0A 2K7KA 1N4LA 2XY5A 4M63A 4QU6A 4WK3A 2XSJB 4C7QA 5M2UA 4YR2A 3MR5A 4ES2A 3HM9A 2G9OA 1FRLA 3PZPA 2LKZA 2LLZA 4KT0C 1S6PA 2Q66A 1U45A 3D1OA 4KHMA 5DDQC 3Q23A 2ZHOA 4NA2A 4C3MA 3I0SB 2XS5A 2FHKA 3FEYB 1RA7A 2YQ3A 3TVZA 3TAQA 3CIMA 3UDLA 1LWEA 4M94A 1ZTWA 2NZ4A 2KXNB 2K8GA 1S97A 2J0QD 5LL6d 2UZAA 2BBEA 4PUOA 1C1BB 2WOMA 4YDXA 2ZITA 2WB4A 2AGOA 1UEVA 2CQDA 4QWBA 1HBMA 4RW6B 1HBUB 2VBZA 3TVYA 4F4WA 1JLEA 4LFAF 5J1PA 2VFRA 2DBBA 3EGWB 1A7GE 1TP7A 3B4DA 4O4RA 5H9FJ 1ZBTA 1TAQA 1M5HA 4CNYA 3MEDB 1TFWA 5LXYA 4F4ZA 1KQGB 1SI9A 4CTAA 4DSEA 4USJC 3NNAA 1XEZA 3AQOA 1QTMA 3V4IA 2KRRA 2B3TB 1L5UA 2BV3A 1LFWA 4X4TA 1TV6B 3SSRA 3R1LA 2J8AA 2ZH9A 5D8HB 1NK5A 1IKXB 2GMJA 3ZZZA 3QIDA 1Q82T 1RGVA 1TL1A 2LECA 4YMEA 5HBMB 3FQKA 3SMZA 1S0MA 5SZTA 5IM0A 4B9LA 3RR8A 4X4VA 2BABA 4DG1B 5F8MA 4X4PA 4KFBA 3PW5A 1HWLA 1YRXA 3B4MA 2VV5A 5CD4H 3ENVA 3IGNA 1G3OA 3ZZRA 3GILA 5K8PA 1NK4A 3C3LA 2VFTA 1VRUB 2NUUG 5A6WA 1QSLA 4DV5F 3FRZA 3FMWA 2I38A 2PN6A 4NCGA 3VWSA 4FF4A 1AFJA 2YVSA 2EWHA 3J81Y 3M9MB 1YGYA 2N4DA 1X4AA 1N54B 3B8HA 1U6FA 1J5OA 1LW2B 5KFQA 3GB0A 4OZLA 2LEBA 1Z2LA 3OSNA 4JV1A 3NL0A 1M5SA 4Q43A 3CD6S 2ZOFA 2FGOA 2AV5A 2OFGX 3AAWB 1RJJA 2E66A 2BXJA 5KG4A 2HHXA 2NS1B 1L3KA 1VHFA 2GHPA 3CSKA 3R5BA 5I4MA 3CDAA 3PW2A 3QIPB 2VL1A 2ADBA 2BJEA 5GADU 4HL9A 4CO0A 1X9WA 3C6TB 3SFUA 3G9CA 3UPFA 1ZM9A 4P7VA 3ONQA 4I2QA 1WG1A 2XNQA 3EZ5A 2PD1A 3NWGA 4PQUB 4R0EA 3H5XA 1U7LA 3I56S 2J0XA 1URNA 3HVRA 4RNMA 2VPZB 1NEEA 2R4FA 1RI7A 4UY8T 5I42B 2IM0A 3PJXA 1Y0HA 4OQJA 4OI3A 4PWDA 2FDNA 1RQ0A 3DYAA 3M8QA 2W9CA 4GC7A 5KG6A 1NHUA 2GMLA 4TY8A 5L9XA 1IKVA 2BYCA 5C42A 3MMAB 1VBZA 5KT2A 1R7IA 2YWHA 3MECA 1F2GA 1NH7A 2B4VA 2B9WA 1B0VA 3L7OA 4A47A 5IZHA 2N3OA 2GJIA 3BO3A 5B09A 4ELUA 3PW4A 2HHWA 4I0WA 3SCJE 2AU0A 2F7VA 1S6PB 2AJ0A 2GQ2A 1SL0A 3M8PA 1WACA 4DS4A 2JHEA 1NH8A 3HHKA 2IM3A 4F4KA 4E8UA 1UVLA 4LMZA 4CT9A 4WKRA 2OIHA 4DMZA 4BS2A 2XMMA 4IFYA 3MMBA 3QLHA 3GV8B 3QJJA 3SCIE 3PEHA 1HNVA 3Q8RB 4KTQA 1S9EA 1VRTB 3PR5B 2YWFA 1HW8A 1TAUA 1PILA 2SXLA 4DR3F 4TU9A 3FFIA 1ZPWX 2J6SA 3I4PA 3I5CA 1KOHA 1V6HA 2WW8A 3LP0B 3H40A 1RTDA 2KZMA 3U1MA 4KC5A 4L72B 1Q78A 1SIWB 4C8MA 3CC4S 1KQSR 2OPRB 3U1NA 4DX8H 4Q0BA 1CQNA 1ZM2A 3IRXB 3JSMB 3S01A 1EETA 3CVKA 3SDEA 3VR1A 2XGQA 3KLHA 2XMTA 3N4WA 4OHYA 2UXBF 1U1LA 1X4CA 1DTTB 2B5JB 3HVWA 2OP5A 3EPGA 3V4IB 2HHQA 1B64A 1GXLA 2V8VA 2NQPA 4EFAC 4NPOA 2F8MA 4KGKA 1E6VA 2V8DA 2BM0A 1M5VC 2XMJA 2BANB 2KT5A 2FLPA 5EN1A 2EFNA 4FS1A 2LXIA 4DDFA 4NCBA 4WKYA 5HQ8A 4QYZJ 5I3UB 1LWFA 5KFCA 3NCQA 3OFHA 1Z4UA 1UW4A 1Y3JA 3MAHA 5M2PA 1NKEA 2NSCA 2E7XA 2ZH7A 3DU6A 2DRBA 5L1IA 5KFRA 2E9RX 3UCUP 5H9EJ 3DN9A 3BM7A 3CCTA 1OSCA 3F44A 4MK9A 4ELVA 4LIWA 4AQYF 3BGLA 2K3IA 5DJBA 3M32A 4HDGA 1VBXA 2VOOA 2R7TA 3DRYA 4NCGB 1KLMB 4OX9F 3TR5A 1HHSA 5G0RA 3V5RA 2U1AA 4PWUA 1UWBA 2BR0A 3PRDA 5J2MA 2V8GA 2HHVA 2IYIA 5KFLA 2F4VF 3AB2B 3CGIA 3DXSX 2Y0SD 3GR0A 3M05A 1YHQS 1C0TA 4A8KA 3BEGB 3UI3A 2ROGA 4OZ5A 5F8HA 4A8FA 2ZBCA 3CIZA 1HQEB 1RTIB 2KI2A 3GV7B 2QA4G 3PKMA 3GWCA 5FDLB 1H6KX 3NAHA 2JEFA 3CJ4A 3UCGA 3Q24A 4IFVA 2DTJA 2JX2A 2D1CA 5IT4A 2RF2A 3F73A 3HHLA 4ZCLA 1P1TA 5F0UA 1QVFR 4BCAA 1TFYA 3TNVA 4U7CA 2E9ZA 4EZ6A 3LGNA 4ILMA 1U8SA 4AYBD 3HHNB 3LWLA 4RW4B 4QIWD 4K4UA 1M1KT 4JI4F 2R8HA 3SXLA 4YDDB 2RJZA 1N5VA 1Q8IA 3N0VA 2VG7A 4OFZA 2FVPA 1FE0A 1BY9A 1R0AB 2CPIA 1HBOA 1SKSA 2KFZA 3SV4A 2YKAA 4TYAA 3M6UA 4NZ6A 3Q2SC 5EDWA 4DSFA 1JMTA 1RTHA 2ZUGA