3FMBA

Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
YFQGMVKHIVLFKLRDDVPVEEKLVVMNSFKEAIEALPAKISVIRKIEVGLNMNPGETWNIALYSEFDNLDDVKFYATHPEHVAAGKILAETKESRACVDYEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (YP_212648.1) from Bacteroides fragilis NCTC 9343 at 1.85 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
molecule keywords Dimeric protein of unknown function and ferredoxin-like fold
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fmbA01
3TNVA 1SB6A 4YDXA 1VQSA 2OKQA 2LQBA 1OQ3A 2GA7A 3CJKB 2RMLA 2BJDA 3UDCA 1MWYA 2OP5A 1FEEA 4F67A 1APSA 2LXFA 1FVQA 3FMBA 5B0GA 5B0DA 2XMTA 3FRYA 2ACYA 4NPOA 3HX9A 4QOTA 4ZA1A 1Y3KA 2IFXA 2LDIA 2W4CA 5T7LA 2GV1A 1FD8A 1X0PA 1AFIA 1W2IA 4Q2LA 2GO8A 2OD6A 1Q4RA 2GGPB 2N4DA 3F44A 1TL4A 2IYIA 1FVSA 2GGPA 3BF4A 1ULRA 4A47A 1N5VA 2AJ1A 1URRA 3BR8A 2AW0A 1N5SA 2IYGA 2QLWA 1R6YA 1TR0A 2AJ0A 1CC7A 4DPOA 1N5QA 5KAKA 1Y3JA 4DL0C 1FE4A 2ROEA 1V3ZA 2XMMA 1KVIA 1OSDA 1YJRA 3BM7A 2RU9A 2QLXA 1Q8LA 2OAUA 1LQ9A 3BN7A 5IXUA 1JWWA 3VTIA 2OFHX 1Q53A 2HFNA 2QIFA 3FGVA 4A46A 3KG0A 2HFOA 2K7KA 3BDEA 3LGNA 2CRLA 4Y2KA 3TOQA 1FE0A 3IWXA 2XMUA 2ZDOA 3BGUA 1S6OA 2FHMA 4HI2A 2GCFA 1U7LA 1RJJA 4OJHA 1QUPA 3MCSA 5B0FA 2ZDPA 5A6PA 4OIXA 1Y0HA 2BYCA 2OFGX 2BUNA 2HLUA 1YRXA 3KKFA 2JDJA 2LQ9A 1KVJA 1X7VA 3GZ7A 4ZOSA 5B08A 2HIQA 2RILA 1YJUA 2ROGA 2RSQA 3LO3A 2XMJA 1MWZA 4FNIA 4A4JA 2OMOA 5B0CA 5B09A 5B0BA 1GXUA 2FB0A 1WD6A 2QYCA 4FNHA 4Y2MA 2K7JA 5B0EA 4OJGA 3K7RA 3QMQA 2ROPA 1S6UA 3HF5A 1X8DA 2XMWA 3QGPA 1YJVA 4OJ3A 3CJKA 2W4DA 2KKHA 2L3MA 1SQEA 2PGCA 3E8OA 2W4PA 5F0UA 1Q8BA 4HH1A 1P8GA 3HFKA 1N5TA 2BBEA 3HHLB 2OD4A 2VV5A 2BJEA 3IWLA 1GXTA 4U9RA 2HQIA 2K2PA 3KNGA 1TZ0A 2N4CA 3HHLC 3I9ZA 5A6WA 1AFJA 1K0VA 3KG1A 2PD1A 1OQ6A 1TUVA 2K1RB 5B0AA 4Q2MA 1P6TA 4A48A 1XBWA 1IUJA 2GFFA 3DXSX 3MZIA 2AP6A 4HL9A 4Y2IA 5T7LB 1KQKA 1Y9OA 2EW9A 4YEAA 2Q3PA 1VQYA 2HLTA 2K1RA 2XMKA 4DN9A 1YJTA 4EFAC 1JK9B 1FESA 2KT2A 4HI1A 1YG0A 3HDSA 1SI9A 2VH7A 3BB5A 3TRGA 2N7YA 1CC8A 2KT3A 3HHLD 1AW0A 2G9OA 2FIUA 2KYZA 2XMVA 4OJ1A 3DCAA 1OPZA 1CPZA 3LGMA 2FTRA 5K9FA 3HHLA 4HH0A 3T9NA 3WDOA 4NL5A 2ASYA 1TL5A 5F0WA
chains in the Genus database with same CATH superfamily
4G65A 3EPIA 1VQSA 2XZWA 3HI9A 2LQBA 1SKSA 1M5OC 1D9AA 4UQGA 2HNDB 2XBPA 1HWLA 4K50A 1T05B 1XR7A 2FLOA 2M5YA 1HLWA 2BR0A 2HFUA 3CJ3A 2ACYA 1NH8A 2GS8A 3R7NB 5K8OA 2C2NA 4RPFA 2BE7D 3QGGA 5CYQB 4D3HA 3CCQS 4ECRA 1OY9A 2EG1A 1WC1A 3PTWA 4IH6A 4AFFA 2FJWA 1M1KT 1HNIB 1WOSA 4EUVA 1S0OA 4F2SA 1FKOB 2XCPA 5F3ZA 2NXEA 5ETPA 4CLWA 2MKHA 2EBEA 1SVDA 2OPRA 2YKMA 3A8IA 4I64A 1KHVA 3A8JA 3OJUA 2E29A 2MZSA 3UDLA 1TU0B 3MHYA 3MM6B 1LEOA 2CQCA 4ZJOA 3ZTQA 5KAKA 1N32J 2K3IA 4CLFA 3DRPA 1HHQA 2BABA 1BD6A 3DDNA 4LIWA 3UW1A 1LXNA 3DLGB 1A9NB 4N7TA 1D8YA 1Q53A 3OHBA 2NREA 1I51B 2HURA 4A46A 3JB9k 4O3PA 3IA0A 5LL6d 3P3DA 5L9NA 4PEOA 1LK7A 1WELA 2MHNA 2A10A 2YKOA 3A13A 3J7YI 2PDAA 3Q23A 4QZVB 3A8KA 1O5JA 5E7OB 3R9LA 3B6BA 2NS1B 2XS7A 2CAJA 5C24B 1G1XA 4F7VA 2CNOB 2CJXB 3QFHA 5DDPC 5LT5A 4MAKA 2XQCA 2Y3YA 2ZM6F 3VF0B 3J81j 1FNMA 1XMOJ 2DNQA 3RZAA 5CYJA 1HD0A 1TL1A 3L4BC 2VUGA 5KFGA 3KWMA 3J81U 2UXCJ 3T1HJ 3IWNC 4RW4A 2ZHAA 1Y11A 1KP6A 1QAJA 2RSQA 1WC3A 2W2OP 2XMJA 2ZH7A 2J6SA 1VK3A 5KG5A 4LFBJ 5B09A 3NNCA 2V8GA 3AJ1A 3UCUP 4RX6A 4G6VB 3CDUA 4YB5A 1WD6A 1VBYA 1S0VA 4NA2A 2HRTA 2R2TA 1D1UA 2JEJA 2K7JA 3D0IE 1WORA 5J2QA 4LF6F 1R8HA 1WACA 3JTNA 3K7RA 2IM2A 4Y3CA 1S6UA 1QVGR 1NXIA 1TAQA 2XYPB 2OPPB 3CXCR 3CE8A 1GTHA 4JBCA 1VQ8S 1RT4B 4TVAB 1X4HA 2B9YA 2QA2A 3W64A 3LW5C 2Z8QA 1NSKL 4TQSA 1NSAA 1RT1B 1P1TA 1X4GA 3FK4A 3QLHA 1JIHA 4EZ6A 1ROFA 3I32A 2BOPA 4LREA 4JV1A 4N77A 1JKHA 3IWLA 1FJ7A 1GTEA 2BA9A 4DR5F 2IRUA 2L9WA 1K0VA 4KC5A 4HDHA 4BC9A 2EFVA 3KG1A 1TL3A 1S1TB 3BSAA 3Q2SC 3ULHA 4ZIVA 3DI6A 5HBMB 3MMJA 3CD0A 1SH2A 1YZ6A 3IRWP 1Z4UA 3GIJA 4A48A 3VAMA 4I6YA 4PPDA 1H3DA 4LJMA 3Q8SB 3V6DA 1S1VA 5T41A 2HRYA 4ES2A 2JHEA 1UVKA 1WWHA 2XG8A 3OFGA 2OMLA 3RRKA 2HLTA 3LP1B 4Y00A 3ZTOA 1PGZA 2DNMA 4ZLLA 4USWA 3V6KA 1F6TA 2CYYA 3FC9A 4IQMA 2E5JA 2RDDA 3KJFB 4NX9A 3UD5A 1NJYA 1NKCA 3FMWA 2ZOFA 3WIVA 4M5IA 2LFVA 3T19A 2KYZA 5F8HA 3I55S 2X51A 3IG1A 4JB8B 3I4HX 4LBPA 2ZJRQ 5LMNJ 2F7VA 4DUYF 3OTOF 4HH0A 4KGVB 3M8PB 3MCNA 4NL5A 2W8LA 3TNVA 2DGWA 3EUNA 5D6GA 1PJ5A 3UCZP 2MQQA 1UZHA 4LVNP 3SV4A 1MWYA 4CNZA 1T8EA 1CLFA 3VGTA 2DNGA 2JH3A 4CO0A 5B0GA 3MCMA 3GSDA 3VZIA 3HX9A 5C7PA 4JI7F 2IFXA 1WF0A 2XMAA 3N6NA 5DQIA 1T02A 2ZBIA 3IR6B 5IT4A 3CMES 2ZITA 5D3GB 3E3XA 2M88A 4PQUB 4RNOA 1FRLA 4DR1J 1F5CA 3A12A 2GGPA 4MK7A 3TEGA 4CQ1A 4CO1A 1R27B 1KTVA 4NLTA 2N3LA 4U8YA 4I67A 3M32A 3JAMU 4X65F 1FWLA 1BWVA 2FQQB 1YBTA 4YOEA 4C3LA 5FIIA 3V2UC 4X62F 1TK0A 2FJAB 1FFSB 1XWLA 2VPXB 4UOGA 2PIIA 2J9EA 5IXUA 1UVMA 2RHQB 2APOA 4ZP8A 3CCES 1UJ5A 3HT0A 1LW2B 4LF8J 1S9FA 1C1CA 3G2XA 3QSIA 5D4PA 4JI5J 2VONA 4DV7F 4M5DA 2FHJD 1H72C 5IT9U 3C16B 4FYVB 2WVDA 3TA1A 1RT7B 1RT4A 2KRRA 4IG3A 3R1HA 4K4VA 2DNOA 3CB4A 4DQIA 5DG9A 4F02A 3KMQA 2JC1A 1NPKA 4ECXA 3HSGA 4C0OC 4DX5A 4WFYA 2Q6BA 2WVEA 4JYAF 5I3QA 1SL0A 3N6MA 4J9LA 4HTJA 2DXEA 2B8PA 3HSDA 4ILRA 2MZQA 4KH1B 3WC0A 3J81Y 5D15A 2AEFA 4OI4A 3CUNA 3WC2A 4TY8B 3T1YF 5KG6A 1XC9A 2COLA 2DBBA 2VF3A 4FDFA 2WBMA 4EYIB 1OPIA 3D6HB 4DV2J 3D66A 5LJ3Y 2PN6A 3HJVA 2DGQA 2F8MA 1VJWA 2MJUA 4NCAA 2DNYA 2HGMA 4ZPTR 4ZDNA 4PQAA 4YB7A 1LWCB 4NCBA 4NLYA 3C6UA 1X8DA 2C28A 3NL0A 1M5KC 1T95A 2M0GB 5J1EA 2W9BA 1HHTP 3CVKA 2AYGA 3LPEA 3TX8A 1UW4A 4ZCKA 4NA1A 1ZBTA 3CNQP 3TJAA 2E5GA 4RUCA 5DQHA 1IBKJ 1H2VZ 2KO1A 4DPYA 2HZAA 1TK5A 1SH0A 3PX0A 3W65A 3JSMA 2RQKA 2AZ1A 5F8MA 3DRPB 2F8HA 4DR5J 3OQ2A 3OR1A 4ZVPB 2YXLA 5FLXY 3MUMP 2E1CA 4F4KA 4TY8A 3IBFB 4X4PA 1XBWA 3M1VA 1RABB 1SJ3P 2DYAA 2AP6A 2J0QD 4W92B 2C2RA 3HPOA 1Y9OA 2K1RA 4HT5A 4MK9A 1DZ5A 3TX0A 1H2UX 1DJ0A 3H5SA 4HI1A 1YG0A 3UVJB 1MSWD 5L39A 4GO5X 4M5KA 4RU2A 4LF7F 2KT3A 3LP2B 4EMDA 4WU2A 2Y9HA 2BQ3A 1B3TA 1AW0A 2IJFA 2PE8A 4IG3B 4KO0A 4LF9J 2RE1A 2YQ3A 3M9OB 3T9NA 2GHWA 4Y65A 3UR3C 1HWJA 2Q6CA 3R5BA 4IRKA 2IY5B 4B02A 4GRSA 2QEXS 3L09A 2Q79A 2RRAA 1RKIA 1LW2A 1M5SA 3BBCA 1Z1ZA 2X7IA 3MOZA 4LRAA 3ENQA 3GPAA 3PRVA 5KT6A 1QSSA 2XLKA 5HN0A 1WKJA 5L8RC 1CJVA 3W5ZA 4BHQA 4C3MA 3MOJB 2GQ2A 1L3TA 1TKTA 1FHTA 4NPOA 1S48A 2FJDB 2M9KA 2EC2A 4ZA1A 2XO7A 2IM0A 2RKIA 3G71S 2B51A 2CZVC 5CYMB 5E41A 1NNDA 5FDLA 3J7YU 3FDSA 3N6LA 3ILJA 4Q2LA 2GGPB 2VFRA 1KFDA 1SV5A 4X4OA 1FEHA 1B99A 2W2QP 3U1LA 2CA9A 3FRZA 2DGXA 4QIVA 4LSNA 4OI3A 4A47A 2AJ1A 4R5PB 2WVBA 1WG5A 2CZ4A 4O3OA 4IO1A 2RRBA 2A18A 3FJ2A 4O4GB 4QYZJ 2HBZB 4CLSA 4RLEA 1S59A 5JVHQ 3X3UA 3PW7A 1NPPA 1QY7A 1UMJA 2XMMA 3LPYA 4WFAQ 3OLAA 4FF1A 3KLGA 2BANA 3CPWR 3EZOA 3VCDA 4BS2A 3TW0A 4DFKA 3K8VA 5DM6Q 5KFJA 4X4QA 2GHPA 1JNZB 1RU2A 2BW7A 1IKVB 1R0CB 3Q8QB 2XYGB 4EBDA 1X4DA 2FZKB 5HMZA 4M5MA 2CRLA 1S1WB 4BLGA 4O44A 3AFGA 3R1LA 1HI0P 2E7XA 4HLBA 1KDNA 3JQMA 5KFPA 1NK7A 4FYXB 5KFOA 3NGUA 4Z2XA 5IWAJ 4PWUA 3NGSA 2YKAA 3LP1A 4F0MA 1PBAA 1RWWB 4WFNQ 1K44A 2ILZA 4HYKA 3AJDA 2ZH8A 2XGPA 1M0SA 3L7PA 4M94A 2JDJA 3ZZRA 2LDYA 1B0TA 2WB1D 1QVFR 3G82A 5B08A 4IFVA 2AD9A 2I1RA 2ROGA 5HBMA 2IMWP 4F36A 5CD4A 2V8VA 2ZVSA 3G8TA 4IR9A 3HMJG 3ISND 1WKLA 2DGVA 2P6TA 3ONQA 2PSZA 1JKHB 3DRRA 1HMVB 1ACMB 1MMNA 3KHGA 4JI0J 3GG0A 2JRSA 2ZD1A 1RT1A 1WTFA 3DC2A 3AB2B 3QT7A 5H9FK 1VBKA 3QGPA 4WXWA 4USTA 5HAOA 5DGAA 2IIHA 4YN3B 3UN2A 3OBIA 3OL7A 3K57A 1J2VA 1UA0A 5U47A 1SJ1A 3RRGA 4Q44A 3E8OA 5J2QB 3NNAA 1Q82T 2AHOB 4GVBB 4MIBA 3QZ8A 4B9VA 3NAIA 4AYBD 5GMEA 3PIOQ 1NK0A 1FWPA 1RBOB 1VYAA 3MM5B 4YP3A 1KNZA 3PRDA 4K4WA 1HBOA 4ER8A 1AZSB 1GT8A 1KTQA 1TUVA 1V5VA 3HHDA 2P9GA 5B0AA 2EG2A 3QIPA 4WIQA 2IC3A 4KPCA 3M6WA 3Q8YA 4CTAA 4DV1J 1U1QA 1NUEA 2B9WA 3D9BA 3MFIA 3HXMA 2GMHA 4ECVA 3C3LA 4DQQA 1YDLA 3NS7B 4ZVHA 1KC8T 1WOOA 2VFVA 1Q16B 5DZ6A 5E5NA 1KQKA 2K8GA 3D6TB 5A8WB 4QBUA 4DR1F 2YWGA 5C42B 1S97A 1YLXA 4EO6A 2I2YA 2DO4A 3DLKB 3FBFA 4R8UB 1JLQA 3AOCA 3FSYA 4P6QA 3HHLD 2GQQA 3M8QA 3MEDB 3NP5A 5KFRA 1D8ZA 2W01A 1XMQF 2DNZA 4GVBA 5IOLA 1HR0J 4LUBA 4YR0A 2VG7B 4ECZA 5E33A 1YI2S 2PT0A 3PO5A 4KR0B 2E66A 4CM2A 4QWAA 3QJLA 3QQCD 2R9LA 1X4CA 2MSSA 2OGUA 1U6ZA 4USUA 5HMWA 2V94A 5L1KA 3UDCA 3OVAA 1Q78A 4F67A 2R7TA 3O8WA 4UY85 1B0PA 5B0DA 3DRRB 4DV0F 2KFYA 1HHSA 4KSEB 4QYRA 4BC7A 4K4UA 3MD1A 4N41A 5ETLA 1NKBA 1NAQA 3E01A 3F56A 3RR7A 1VRUB 1W2IA 3TQEA 2CPHA 1ICEB 4CRJA 2MKCA 1YGYA 3IFEA 3G82B 4CCHA 2H9ZA 2G0JA 1S6QA 3GCWP 2BKPA 4IYQA 4HKQA 2MY8A 4YR3A 5F8NA 1AUSL 2NXCA 4V1Ak 3RB6A 3WQPA 2E9ZA 2ZZMA 1R6YA 2CPDA 5HK4A 2BQUA 2UVVA 1E6VB 3ZZZA 4ZVEA 1YJNS 2O1PA 3OTBA 2QA4S 3PY8A 1YJRA 4RUAA 1KVIA 3BV8A 1NO8A 2FJEB 1U47A 1H6KX 2DO0A 4WKYA 1LQ9A 3LP0B 4CNYA 4DV4F 3V6JA 1J5OB 1JQGA 1I6JA 1QM9A 2VOOA 4DSJA 2YBVA 3IP0A 3K5OA 4RZRA 2RQMA 4NEYA 2F65A 2RQ4A 4U7UD 1XNRJ 1IKVA 1KR4A 2MQOA 2CJQA 3ENVA 2WW8A 3LGNA 5E0OA 5AXKA 3KLFA 2F4VJ 4C98A 2NUHA 4PWDB 2DR6A 3BGUA 1S6OA 3LAKA 3ISNC 3D28A 4UTGA 3U27A 3AD8C 3O6QA 1IXKA 1RJJA 2MTLA 1U1RA 4QIWD 3EGNA 4LF6J 2CJAA 1GX6A 3OVBA 1HQEB 2GQCA 2V4JB 3IR7B 1NJIT 4NLOA 4BCAA 1JLAB 1BQMB 4L3KA 1KQSR 1R31A 1IR1A 3DDIA 3T1AA 1H0HB 4J9NA 1WNEA 2OHDA 2HQFA 1RWPB 4LSNB 2CNKB 3CJ2A 5ETNA 3ILOA 4TY9A 4AXIA 4OLOA 2FLPA 2BOAA 4TKTA 5BR8F 3QO9B 4B3MF 1AXQA 1GFWB 2DISA 1MLAA 5A8KA 3PYGA 1ZAVA 4K5RA 4DEZA 2VPZB 3Q86A 3L95X 3AXKA 3SBMA 2GNKA 1N4LA 1RWMB 2YNFA 2FB0A 2XZDB 3S1TA 3LWMA 2J9DA 2YWHA 5HJYA 5KG1A 4Y28C 3UDVA 4WIIA 2CPYA 1PJ7A 2HGLA 3P49B 5D8HB 2J6UA 2ROPA 3K8WA 1T11A 4PYAA 2O5DA 4MK8A 1PKUA 4WWSA 3HSJA 3KG4A 5KFSA 2FJBB 4Y2AA 4LMZA 1KONA 1MWQA 3IM8A 3JQJA 3M8YA 4I69A 4DX6A 1FXDA 4WP3A 4CLZA 3NY0A 1S1UB 2QE5A 1IWGA 4JOUA 5HP1B 3BPSP 3PACA 2VV5A 4KQZA 4FF4A 2RS2A 5JJBA 3CCUS 1BQNA 4WE1A 1FWKA 2LU1A 3US5A 3SSQA 4X4RA 2K1RB 2GJ2A 5M2UA 4RNMA 4EEYA 4LF1A 2LVWA 2EK1A 4C48A 2B4PA 2QLFB 1HNXJ 1IBKF 4X4VA 2MGZB 4JYAJ 4F0KA 2VFTA 3THPA 3CMQA 5EWEA 2CQDA 4C0HA 1L3VA 3IRXB 3M4XA 2ZOGA 3LGHA 4UW2A 5LOQA 4NLGA 1UWBB 3NG8A 1WI6A 4CH0S 3OV7A 1C0TA 3T3FA 4TLQA 5AXMA 3TJ9A 1JJCB 4KGZB 2VDIA 3DCAA 2DXDA 2JJ4D 2GJIA 2C3PA 1RZMA 4DV1F 1ZTTA 2DRBA 1HPZB 2H51B 2W24A 2MEWA 1VISA 4LF4F 1MG7A 2VG7A 4I6WA 1B7FA 1LK5A 1NZAA 2IRXA 4DCPB 4ECQA 3C15B 3HVAA 3C6UB 1K1QA 1R8PA 1VRTB 1VLYA 1YTYA 4C8MA 2RMLA 3PNIA 2WTFA 5L1JA 3MWBA 3C19A 3HVTA 3M30B 2RIJA 5KFBA 2V50A 4GO7X 1TP7A 1IBMJ 4DXLA 2MZ1A 2JZ5A 3N4WA 2QG9B 4FVCA 2GV1A 1HWIA 4RUBA 3VGSA 2OTJS 3CWJA 3R5AA 3O1LA 1VLOA 1DTTB 2LKZA 4UT4A 2H3EB 4IOAQ 3F44A 2IAJA 1AZSA 2R2RA 1RYRA 2R7WA 2AKWB 2V34A 3PHEA 3PJWA 1ULRA 4F3QA 3H40A 2B5JB 3KLIA 3KUHA 4OZLA 1NKEA 3BR8A 3HVRA 4FN5A 2UXDJ 1E6YB 2FVPA 3KK2B 1U09A 2LQ8A 2AJ0A 4ZVOB 4DPOA 2KH9A 3LTOA 4QQBA 2IMOA 2RNEA 2ROEA 2XI3A 4DPUA 5K8MA 2QFJA 2VC0A 4C11A 5KFNA 1QE1B 3P96A 2B56A 2OAUA 2HNYA 4OZ3A 2JEFA 1RU1A 4IDKB 4CYUA 2OTLS 4WBFA 1Q79A 3GJQB 3RB3A 2R8IA 4JI1J 2XM3A 3JSRA 1HMVA 2ZHBA 1ZZNA 1OO0B 2HS0A 3TOQA 3W5XA 1OJ4A 4QR2A 1M5PC 4DSLA 4RNNA 1I94F 2IVYA 4DV5F 1YVFA 2GCFA 4R0EA 5KFHA 1NK6A 2ZH9A 1WG4A 2GVZB 2KI2A 2QTWA 2R8HA 3BPDA 2KG0A 5B0FA 3HT3A 3UI3A 4QYZK 1YRTA 4OZ5A 2B9EA 1NPRA 4QWEA 4PG4A 2GIRA 4I2PA 1XNRF 2D9OA 1QDUB 2CQPA 4NLUA 1C2PA 2E5LF 2OJ3A 2Q1LA 4LFCF 4YDDB 5D3GA 1EQMA 1LWFA 1ZYQA 2AF6A 4RL1A 2C3UA 3SQOP 4DX8H 5B0BA 1X5OA 2DIUA 4MFBA 3W2VA 4C8ZA 2KTQA 1DTQB 3M2RA 2HHUA 2DPJA 4KB7A 2ZBQA 1NHKL 3M2UA 3DLEB 3BS9A 1T9YA 2HBQB 4Y2MA 5GAEI 3JAMY 1L5UA 2R8JA 2BJ1A 2ZE2B 3DRSB 3RRHA 1Q5YA 2HQGA 2XMWA 1RISA 2A2CA 3FBCA 3H5UA 3LALA 3MEEB 2W4DA 2IDLA 4L74A 4CDIA 2J9DE 3R5JB 1F2HA 1QAXA 3M8PA 1RAEB 3W9IA 4H54A 4ZK7M 2ZH6A 4LF7J 1WEZA 2KFZA 1RT5A 1NK9A 3IG1B 3UD4P 2U1AA 1ZAXA 4DHVA 4DI6A 5E3AA 3H42A 5ETKA 3V4MA 4JV2A 3QATA 2K3KA 3TUJC 2PD1A 3MM7A 4CO3A 2BQRA 5ETQA 1B4SA 4CH1A 2R7XA 1SV5B 2E5HA 2CQ4A 2MKIA 2ALZA 1N6QB 1ZPWX 5AJ3J 4G3IA 3V6DB 4DSKA 5K8NA 1LFWA 1TELA 2CADA 2OPSB 1BGXT 3KHRA 3CDBA 3P5TL 1CJKB 2Q3PA 3CJQA 1VQ9S 1TFYA 3B82A 4CZCA 3SI8A 4QW9A 3N28A 1N0UA 2YH0A 2YQ0A 2ZKTA 2CWKA 4PXDA 2Y1IA 4ED3A 2H54B 4QWDA 4K0KJ 1FRIA 2VU5A 3NBPA 3D5MA 4OYPA 2GIQA 4KYZA 1B7YB 1JXVA 1YWXA 3H2UB 1JLFB 4P2FA 3A3NB 1KQGB 3OT9A 3HSZA 2ASYA 1TL5A 2QFIA 1JLCB 1R0AB 4ZVGA 4U96A 4ILLA 2FPHX 4PXCA 2GA7A 3CJKB 1WOPA 4DV2F 2B43A 1P9YA 1DARA 3HZEA 3C14A 3NS5A 1FVQA 1XTZA 3T9ZA 4WKRA 3IR5B 3T1YJ 1WF2A 4R25A 2OSQA 2C42A 2OH2A 3AODA 1NEEA 3GJTB 2KU7A 3ITHA 3M1VB 1HL6A 3Q22A 1TMMA 4OI6A 3NMAA 4HHJA 1YRUA 2KXNB 3KDNA 2F63A 2YWEA 2I9SA 1DURA 1U0HB 1FVSA 2V5HG 2YNIB 3MR7A 4ECSA 5I42A 2NR0A 3JSMB 2UU9F 4DR4J 4DR7J 1MN7A 3POTB 4Z7YA 4PCQA 4DN0A 3DOMB 4JI0F 4LFAF 2EFGA 3MXHP 3EGWB 4ANDA 2ZWPA 1Y5IB 2Z4PA 4NYZA 1BHNA 4JI2F 4M95A 2AYBA 3DGVA 1NCLA 2RDIA 4K7QA 3Q24A 3GCXP 3U1NA 4NCGA 4V19X 1T9VA 2ALYB 3BN7A 5J1EB 2ZBPA 1SKWA 1XNQF 4OHZA 3BR9A 4OHWA 2YWKA 1RHKB 3IAS9 4F4YA 2BJ3A 2YNHB 2MZTA 3KG0A 1S9EB 4URGA 2DNHA 1F3FA 2HFOA 3OSPA 1ZM9A 4OYOA 5LSOA 4JV0A 1NLKL 5KG7A 1PSDA 2ZEJA 2E9RX 1FE0A 2DHAA 4MIWA 4B08A 4LQ9A 5BXIA 2W9CB 1RAJA 1SL1A 1NDCA 2UXBF 2YTCA 2XI2A 5LSRA 2CG4A 2V67A 5L1LA 1MMDA 3FUYA 3PEHA 4BWMA 4E8UA 3W3SA 4RW9B 2DRDA 1PC5A 4UOHA 3GJRB 1UZDA 1OMSA 2AV5A 1CQMA 2NSCA 2ZKUA 4OIXA 5J2NB 4PRFA 2KJWA 3BGOP 3KKFA 4YY3F 5GADI 3ZTPA 2QSWA 1H74A 5J1PA 2ZC4A 4ZOSA 2WBRA 1XIQA 3C14B 3MR5A 2V4QA 5CCLA 2FGCA 1UWAA 2HMIA 4MKAA 2G0CA 1MWZA 4PXBA 3NCPA 1N52B 2V2QA 5IM0B 4X4NA 1P9QC 3AA8A 1UCNA 2DPIA 1SC1B 5L1IA 4IG0A 3R6GB 3SEOA 1JLBA 5JXSA 4BWJA 2ZHOA 4FNHA 4DQRA 3OLBA 2WONB 1N33J 4QPXA 1T05A 4OJGA 4E98A 4DUYJ 2D41A 2D3ZA 2VG5A 5IQ6A 4UUXA 3OW2R 5I3UB 1DQ9A 1IM4A 1VQ7S 4OYAA 4Q0BB 1GX5A 2M8HA 4CLTA 2JEGA 1RI7A 1TUGB 1WC4A 1RWVB 2LQ5A 4KHMA 1RTHB 3HFKA 1RADB 4LSZB 1IR0A 2FC8A 3DMJA 3HHLB 1GNKA 4PUOB 1VIOA 2D69A 1EAYC 2HNZB 1VC6A 3MPDA 4B9TA 1V5IB 1ZS6A 1NRKA 4RNHA 9ATCB 1U1OA 1RAOA 1P1LA 4NI2A 1DY3A 1AFJA 5AE2A 4KTQA 3MM7B 1HBUA 4H4MA 1SC3B 1YK9A 3I82A 3U1MA 3OXGA 3GYXB 3RU0A 5DG8A 3EZ5A 1WSRA 4LRCA 3NAHA 4I56A 2R8GA 3BQ2A 2CJBA 3CCSS 3TA2A 4LF9F 1FDAA 1QUVA 2EW9A 4YB1P 3V4IB 1N5YA 2XMKA 1Q7YT 1KS2A 3VAIA 4ANEA 4HVZA 2M2BA 3A1YG 3JXOA 5KFYA 1BUXA 2BE9B 1N34J 4B9NA 2ZE2A 2FHJA 1X4BA 4NLQA 4OJ1A 3EXCX 3SQGA 1A0OB 3CMAS 4A8MP 3CD6S 1VFJA 3DLEA 5K9FA 2C2EA 2AYEA 4XDDA 3WDOA 2Q43A 2L48A 1K9MT 1MROA 5GADU 3T5HA 2WSFC 4AL6A 3HD1A 2FVRA 5ITHA 3CCZA 2BJDA 4KGKA 2KM8B 3GWCA 3AA9A 3SCIE 1IVZA 4WP9A 4ZPDA 3GB0A 3UN3A 3H5YA 2JLGA 1VK8A 2VBWA 3MPUB 3Q8UA 2V8DA 1IKXA 4QOTA 1XR5A 4I2QA 1HW9A 1OS5A 4MIAA 4B3OB 3K17A 2YWWA 4OYXA 5A0YA 5HQ8A 1UA1A 1VR6A 2XY7A 3DOKA 2RAQA 2GMJA 3EGVA 3GP9A 4LRDA 1IN0A 1JLEA 3W9JA 1TL3B 5GVQA 2I38A 3AOBA 3U7JA 3UNYA 2UUBF 1HWUA 2WAQD 5IZHA 3I0SB 1UFWA 1URRA 5MAOA 3AXMA 3AD7C 2IYGA 4FBUA 4B3SF 1ZTWA 4RJVA 1CC7A 2HPUA 4YR2A 4ZLPA 4ICLB 4F26A 4F3MA 1REVA 1LWFB 3HFZB 4CO5A 3RW7A 3M2VA 2HNYB 4LF4J 2J8SA 1K1SA 5C5JA 4DS4A 4OYWA 4LSLB 3Q89A 3ZNUA 2Y8WA 1S7HA 5IFMA 3QIDA 1PJ6A 4DL2A 1FX4A 7AT1B 2XC9A 2QMXA 2E7WA 3H90A 3HP6A 2AQ4A 2FGOA 3R2CJ 3OPKA 1PBUA 4FYDA 2KFNA 3UE2A 1FKAF 4DU7A 4YMEA 7FD1A 1SKRA 2HHQA 2DNPA 1N88A 2VBXA 3DLJA 1J5EJ 1HNVB 2HSEB 3MTKA 4GC7A 4JI6F 3CDEA 4IDKA 5HQLA 3J7A1 3LUYA 1U0SA 3EXYA 3W61A 4O3SA 2B3TB 2V2KA 1YJUA 2CDQA 3C6TB 3I5AA 4MYTA 2ABYA 1TL7A 1RHJB 3MDFA 4LFAJ 4ZP7A 4DZDA 4WZMA 1FXLA 4OV1A 2PMZD 1E6YA 1RA6A 4F50A 1VC0A 3SSRA 3NOGA 2MKKA 4XPEA 3MAQA 2JEIA 4JI8F 2EFQA 1FTCA 4O3RA 1SUQB 3D1HA 3FVYA 3GFZA 4NRTA 1C0TB 2JL9A 3J80U 2HQ3A 2NLWA 3I56S 1UWBA 2KKHA 1RT3B 2GX8A 4XPCA 2Z2ZA 4ED1A 3I5BA 4J9MA 2FD2A 5ETRA 3IBCB 2NUUG 3BYRA 4NLPA 4PG6A 1TV6B 3RJMB 5J2MA 4KY3A 2QJ3A 4KPYA 3N5BA 3BGRA 4RW7A 3OR2A 3OUYB 2WOMA 3QWPA 3AD9C 4OFZA 3SCLE 1XK8A 2B4OA 2ZUAA 4NLRA 4M5NA 3WX4A 1XN9A 3KK1A 2XS5A 2BM1A 5B7WA 6FDRA 1S1XB 2CDRB 2DNNA 3I0RB 3RBXA 1BQNB 2CPIA 3D67A 4R0JA 1NHUA 2KYXA 5HI7A 1T9WA 3EVWA 5KT3A 4C8KA 2B7CB 2Y0SD 3ZTRA 4EFAC 4ZP9A 3CIZA 1IR2A 1YJTA 5KG2A 2XZTB 4HDGA 1FESA 4LR8A 4U95A 1L3KA 4ECUA 4RKUC 2HVIA 1FKPB 1SI9A 1GK8A 2BX6A 1H7XA 4ID5A 1K73T 1IBCB 2E7VA 2MGZA 2X1GA 4NXMJ 3I96A 4AUKA 3CJ0A 3W2WA 4C3KA 1U1MA 1L3UA 3D7SB 3R5GA 1HNWJ 4FP9A 4B3TJ 1V3RA 3MM9A 2UP1A 5C2GA 3UNGC 2YKPA 3UCGA 2XGQA 3M7VA 2DB1A 1Q95G 4MKYA 1I1GA 1RCXB 2DJWA 4O0IA 4FXWA 4A8WA 4NWBA 3K58A 1ZA1B 2ZBCA 1LW0B 1Q0NA 2AGQA 1JMTA 2EC0A 5T7LA 2BE2B 2XSJB 1RT6B 5KFLA 1FD8A 1X0PA 1SH3A 1HQEA 2JLFA 2V4JA 3KFWX 4ZPAA 1LWXA 4F4WA 3QPIA 2W8KA 2ZJQQ 2QC3A 1HNZF 2OIHA 1FTRA 4JUZA 3HD2A 3W7BA 3MCOA 1LV5A 2H4WB 1G6BA 2YNFB 4ECWA 2IA0A 1RA7A 1UVLA 3GMGA 2D3O1 2HHSA 2Z0GA 1X5SA 2AEJA 1ZZFA 1NB2A 1F1BB 1SPBP 1V3ZA 1KVKA 3BM7A 3MEGA 1DLOA 4KHRA 4MKVA 3OVSA 4CO4A 3TJ8A 4JI4F 4B3RF 4B3MJ 1J5OA 2PA8D 2YY3A 3FQLA 1RT6A 4NXMF 2XSJA 3O3LA 3O5TB 1TKZB 1HI8A 3VWSA 3UR0A 1E6VA 3BH6B 2NPIA 1JLAA 3AH6A 4N5SA 2Y1RI 5JVGQ 1CJTB 1V9OA 3PO4A 2NZ4A 4ERDA 3CCTA 1OY6A 3P45B 2QRRA 3CJ5A 1NJWA 3FEXB 1IJEB 3LOUA 4PWDA 1FK9A 2XNQA 5F3TA 2KXHA 4ZIWA 1VQ4S 1TKDA 3M9NB 1VRUA 2JX2A 2Y1LB 2ZDPA 4TXSA 4WCEQ 4MH8A 3KHHA 2CKWA 1CULA 5JMNA 5RUBA 2H48B 3DOLA 3R5DA 2B4VA 3VAKA 1KVJA 2Z30B 2RU3A 4RBUA 3JQKA 2ZH4A 3FQKA 4QWCA 2M70A 3KUGA 3L7OA 4OYIA 5IT0A 1W25A 1EKSA 3MMBA 3CULA 2QO3A 3CC7S 3HULA 5K5MA 2DITA 1KOHA 2GAGC 4G1QB 1S1XA 2ZH2A 4FYYB 4DPTA 1N34F 2CNNB 3I87A 4J9PA 1CJUB 1BWEA 1M90T 1XERA 2R7RA 3DLKA 4FXDA 1DBDA 2DGOA 5C42A 2JC0A 4HHHA 2VICA 2W4PA 3H20A 5HROB 2ZH5A 1RACB 1YBUA 4P74A 3D3BJ 3I6PA 5CQGA 3PIPQ 4NLDA 2I0XA 2BJEA 4DV0J 4LF5J 1CPZA 3RW6A 1U2RA 1K0TA 3DGPB 3LWLA 1HARA 2ZNYA 4YB6A 3F41A 4CTAB 2KG1A 4DR2J 2IDEA 5D77A 2UUAF 2Z58B 2AGOA 1X5TA 2ZNZA 3RUBL 3SYZA 2CVIA 3WIUA 2J0XA 4LBIA 2N7CA 3R6LB 4DV6J 1VQYA 1JLQB 2VJUA 2XULA 3EWGA 1UVJA 4KBIA 4ED0A 5THWA 2XHWA 2B4UA 3BGFA 1YQHA 2I5JB 1KHWA 3PYEA 1R89A 2W9AA 1RTIA 2QV6A 1HNVA 1HBNB 3PRBA 4HEA9 4P2XA 3CDWA 5F9NA 5HROA 2WB4A 3BO2A 4ZITA 4BDPA 4OZJA 2RUSA 5KFCA 2ZFHA 2FLLA 3PCOB 4JI2J 2UVUA 3MM5A 2UUAJ 1NH7A 2LXUA 5HL7Q 3H2VE 2YH1A 3I9V9 4J9SA 3SFGA 4IRDA 1APSA 4YY3J 1S7IA 1WG1A 4WTYA 1RP5A 2X3GA 5F8IA 4ED7A 4AL7A 5J2PA 1YBAA 4G1QA 4I7FA 3VZHA 4CLKA 5HO4A 1VQ6S 2XWYA 5DG7A 4M8LA 2HW3A 1RWOB 1HKAA 2G1HA 4WJBA 2R7OA 1HD1A 2PMWA 3QBCA 1HIYA 3TAMA 3FBEA 2J7UA 3F73A 1U2CA 4OYBA 1S1WA 2AJFE 4DV7J 1RLDA 2DGUA 2VG6A 4NOHA 4DV3F 4P7TA 4CLUA 5IC6B 2HKEA 4HTIA 5M2RA 1KEKA 5A8RB 4HHUA 1RAHB 4OQJA 3E2EA 1U49A 4K4SA 1BY9A 3DOKB 4C8OA 1RAAB 2FVQA 2BANB 4B3OA 3VTIA 2OFHX 2ZWOA 3EMTA 1UAWA 1PAEX 2HFNA 3C8YA 4Y34A 4DG1B 1VQOS 1SC4B 4GKKF 2K7KA 1KQFB 3OTOJ 5LMNF 4DR7F 3CSKA 4R5PA 3R3TA 1S12A 3OTCA 1G3OA 5L46A 1LNQA 2R3VA 1IQTA 2QL7B 5D4NA 9RUBA 1MROB 2MQPA 3PW5A 4J5OA 1X0FA 2HBYB 4EU0A 2C3MA 3OTEA 5LMUJ 1SBRA 4F4ZA 4CI0B 1D9DA 3V5RA 5A6PA 1O0PA 4KFBB 3G96A 5KFMA 2UZAA 4K5SA 1S5ZA 2CPXA 3B78A 3T5JA 2LEBA 3UO0A 3RYLA 2FY8A 1I3OB 3GYGA 4OLPA 1A6LA 3A4TA 3KLGB 2VOPA 2ZOMA 1UEVA 2RJZA 3EE3A 4FKYA 4L73A 3ZZYA 4DUTA 4Z7CA 5SUHA 1KKHA 2OMOA 4ZMMA 2MZRA 3FZ2A 3W5YA 3BYPA 1RTZA 4ES1A 1QAIA 3G6XA 3MD3A 5H1SV 3BSNA 5G0RA 2BE2A 4KJIA 1HWKA 1ZM4A 4K0KF 4NE9C 1LW0A 3FCVA 3FFIB 3SIPB 4DU8A 4AQYF 1Z2ZA 3HF5A 3MECB 4ETZA 4C2MA 4DFMA 4K4ZA 3PJXA 2HNZA 4PXEA 3UVJA 1FRXA 5GAHU 2H5IB 2O67A 3R8YA 4B9UA 4UUWA 2RQCA 1FF2A 2AX0A 5AJ3F 1L3SA 5D4LA 3CCLS 3QRRA 1GXTA 2OEMA 4U9RA 2K2PA 4B9MA 1TZ0A 2CJ9A 5I3UA 2G4BA 2VG5B 1S9GB 5E3PA 3C46A 3CDAA 2N82B 2CQ1A 1RWNB 2EFOA 5CAAA 3GR0A 1JLBB 2WVFA 4FXVA 2KHCA 4KO0B 4RR5A 5KTQA 4IG0B 4DQSA 2DHSA 3TARA 4E0DA 4UY8T 4OHYA 5IM0A 1UL3A 2BRKA 1LXJA 4QWBA 1I94J 3VGUA 1NK8A 3NCQA 2HG4A 3D0HE 3SDEB 5GAHI 3I4PA 2VPWB 2FVCA 2VC1A 4RW8A 5K14A 4DF8A 2H5JB 3TP2A 4KHPJ 3OL9A 1RUSA 1H38A 2UUCJ 3C66A 3DU6A 2QA1A 4IFYA 5DLFA 4DL3A 3TUIC 2OUGA 3TWZA 3M8ZA 3KLEB 2HAIA 4ED2A 3OR1B 4TYBA 2F40A 4TLRA 2W9CA 3N5FA 4K2JA 4OHVA 3D4JA 1QTNB 2JOQA 3BBBA 1WDTA 2IVFB 4J9KA 2EFPA 2J5AA 3VQTA 1H73A 3KLEA 2ACMA 1F9EB 2CG8A 2V9KA 2R2SA 2XMTA 3NCRA 1N48A 4TYAA 1HR0F 3OL8A 3TUZC 1DRZA 2BMBA 3MGJA 2ASLA 3GR1A 2BEFA 3N0VA 4GC6A 2W9BB 2C2OB 4XDCA 5DJBA 2EBGA 4RW8B 1DQ8A 4DF4A 4ELVA 2KZMA 2ASDA 3QGIA 4KGMA 3K5NA 1PYSB 3CC4S 1FXRA 5LXYA 3GILA 1N5VA 1NBEB 3ILIA 3NGRA 1FNOA 1WI8A 1FDBA 2QSFA 2J8AA 2MQMA 4TU8A 1VBXA 2DR5A 2AIRB 3KK3B 1NB7A 3FEZA 1T9TA 1U0HA 2EXUA 3C2PA 4WF9Q 2F4FA 2RB7A 3PDNA 4HACB 4ITSA 1RAFB 3VVUA 2ASJA 4DJBA 2YKQA 1RWUA 3EM1A 3PX6A 1P27B 4ZJLA 4ZHRB 3AY0A 1EHWA 3MR2A 1WC5A 5LXRA 2AX1A 1RYSA 1R43A 1RBAA 3KLHA 2FY1A 5KFKA 2GZOA 4P71A 2MHEA 2XLIA 4NYOA 1TKXB 4DBQA 2CQ3A 2HFZA 4OX7A 4URQU 1WSVA 2HFSA 1XMQJ 1HI1A 4N47A 2WSCC 1PAUB 1Y5LB 2RT3A 1Q86T 1JJHA 3VV2B 4AL5A 5GAGI 5D78A 3PR5B 2JNJA 4QW8A 2C3OA 1VJQA 3GJSB 3RAMA 5CXTA 2B8QA 1YKWA 2Z2LA 3S6EA 3LANA 3KNAA 3QRQA 3NGDA 2UUWA 4GKJJ 1C4CA 1IJFB 2OFGX 2HVEA 1R7IA 3KTQA 4IR1A 4M63A 1WJ9A 4DSFA 2HVHA 2LQ9A 1X7VA 5G4DA 3RAQA 3I0SA 2MJNA 2HIQA 2JSXA 3PG9A 4ZS6A 3G6ES 3JYTA 2XYHB 3ILLA 4USIA 3LH2S 4L76A 5KFZA 2VA3A 4A8OA 3BQ0A 1GXUA 3MF5A 2CQ0A 2QYCA 3TA0A 1T3OA 1IKXB 2HRUA 2VBYA 1KOOA 4K4XA 2KZZA 1M5HA 2UUTA 5B0EA 3R2DJ 2CQIA 4NMXA 4X2BA 5KG3A 1FO1A 1WHXA 4OJ3A 3GIKA 2C3YA 3ENAA 2V69A 3FKBA 1RDRA 2C2KB 2KN4A 5E3RA 2NXUA 1EP4A 2JFDA 2VKZG 3UQSA 1S79A 4WU3A 1SQEA 1SKUB 1WEYA 2MLYA 4W4MA 3BO3A 2XSFA 4B17A 4ZLNA 1VCTA 4DL4A 3CF5Q 1T3NA 1N5TA 1PC4A 4WYLA 3ZXWA 1K8AT 5IT9Y 2QX0A 3S8SA 3FNNA 6FD1A 3SQGB 2F1FA 3HHLC 1NSQA 4B3RJ 3EZUA 1FCAA 1R0BG 1OQ6A 1UVIA 3MUVP 2VZ9A 3M2UB 3OD2A 5KFXA 3G6YA 2YKNA 3RB0A 1DTQA 1GXLA 3M2RB 4NA3A 4LIRA 2JVRA 2RUGA 4EBEA 1V3SA 4HL9A 2DD8S 5A2QU 2V2VA 3H7HB 5KFWA 1Z2LA 2PEBA 2HQDA 1NK5A 5I4MA 4A8XA 4IOBA 4EWTA 4X64F 1GH8A 5HVGA 5DDOC 1EB0A 3KUEA 1RGVA 2BXJA 2D74B 2KJVA 3ZO7A 2P6SA 1RQ0A 2V0NA 5LM7E 3MTJA 4FKXA 1AYEA 4WP8A 4DZ6A 2ZJPQ 3T5KA 1N8RT 3ET6B 5DZ7A 4P2MA 4I7FB 1OPZA 4C4WA 2P9CA 3HHEA 1VI7A 3LGMA 2ILYA 3Q0AA 2HYIB 3HHLA 1IBLJ 3SFUA 1TKXA 3TZZA 4J9OA 1RTHA 2WSEC 2AJQA 2NXJA 3DI6B 2A2DA 3MI7X 4USKA 4UF4A 4U6PA 4P72A 3DRXA 5AE1A 1CQNA 2LA6A 4M1KA 1RHRB 1F5BA 4PR6A 2ADCA 3NMRA 1S10A 1KFSA 4J37A 3SMZA 4KRWA 2UXCF 1IKYA 2DNLA 2RF2B 4RW4B 2WONA 1RTIB 3QLHB 2CNLB 4J7CA 3FBBA 2YNGB 4P2SA 4CLPA 3MPWA 2LDIA 4PG5A 2MPUA 4Z37A 4RNFA 4YFUA 1TL1B 4CYUB 1UJ6A 1VMBA 2ZM6J 2E1AA 1F2GA 4ZJQA 3BEGB 4F04B 2E1RA 3OFEA 4X4SA 4ZPVR 4C11B 2M4MA 4YS2A 1F5AA 2HMIB 5HVFA 4C6AA 5IS2A 5KFEA 3PW4A 2HHTA 3BF4A 1TUWA 3KK2A 4FPRA 1Q8KA 3UFCX 3MFHA 3M9MB 8AT1B 1N5SA 4DLGA 2R7QA 2R7VA 2UVRA 3NWGA 2HS4A 3BREA 4JI5F 5KFVA 3J7AN 1Y3JA 1GMWD 3R27A 2HVDA 1URNA 2P9EA 4C97A 4E2FB 3IAM9 4WK1A 1Y10A 1ZETA 2J76E 2QLBB 5BYSA 4UZBA 1WHVA 2M7SA 4UZCA 3JTOA 4CIOA 4X66F 1U1NA 4URSA 5F8GA 1HW8A 4GKJF 2XNRA 2DCUB 2GW8A 3MAAB 2QA4G 2YNHA 3IC1A 4IFYB 2E9TA 3OTDA 1U2FA 5C24A 1KLNA 3KHLA 1B0VA 1X9MA 1WEXA 4EGLA 1CJUA 1HA1A 4HI2A 4EK2A 4WFZA 2G1DA 1GQEA 3CCJS 1U24A 5I3PA 4WK3A 3QRPA 3BGLA 4LR7A 5DDRC 4ECTA 4IOCQ 2FHKA 3EVOA 5CYQA 1CS4B 2MDAA 5ADZA 4GKKJ 3DOMA 2FHOB 3HO1A 2OO4A 2CQGA 3SXLA 2W2NP 3J7Z5 2EI5A 2PMHA 2GVDB 3M05A 3POTA 2C22A 1IBMF 2NCKL 4LF5F 4NZ0A 4ECYA 1I5OB 3LO3A 1RCOB 2ZZNA 2VB6A 3TYTA 3QJJA 2NPFA 2I6WA 2LQJA 4OV6A 1QTMA 1FFWB 1CULB 2LLZA 1VRQC 1JB0C 2HAFA 4L72B 5FD1A 3G8SA 3HJFA 1VC5A 4KH0B 2VPYB 1U6BA 1J27A 2IBKA 4NXNJ 1S49A 3DM2A 4NZ6A 4USJC 1OWXA 1HNIA 4DR3J 1YJVA 1RT2A 1R8BA 1KLMA 3CJKA 4NXNF 1NDKA 4LQ3A 4FF2A 3JTPA 2KB2A 7FDRA 4KGXB 1B64A 5DM7Q 1BXNA 1CJTA 3W66A 1R0AA 4J91A 5F0UA 1X9SA 3ETOA 4HH1A 2L9NA 2DY9A 3VHQA 3M8WA 1RSCA 4DDFA 5C25B 2OD4A 3QJPA 5KT5A 3E51A 2OPQA 5GMKa 2DH9A 3VAGA 3KNGA 2PFDA 4QCLA 4K2XA 4ZPCA 4PPZA 2YX1A 3OL6A 4QPTA 1PO6A 3P5BP 5J2NA 2B9XA 3KJVA 2WVCA 4X4UA 1Q5VA 2JVOA 3PJ9A 3M8SA 2R8KA 3QNWB 3Q83A 4OI1A 2CVEA 2YWFA 2OPSA 4F3OA 2B6AA 2MYFA 3ISZA 3TZWA 1MU2A 2BRLA 3CW2C 5KFDA 1X60A 1FERA 3IS9A 4ZLJA 3T6BA 1SJFA 1N6QA 2C2MB 4FZVA 1JK9B 4Q8FA 4L3NA 3CCWA 4ZCMA 3RB4A 1DHMA 5LJ5Y 1LOUA 2CUYA 3TRGA 2A6OA 2H65B 1HYSA 1YJ9S 3ZZUA 4F4XA 2FIUA 1NM2A 2XMVA 3CTRA 2P8IA 6AT1B 2DNKA 2CPEA 4HR2A 2ZBRA 2UVWA 3NOCA 2G2OA 4LRBA 4ANCA 1WTBA 1RBLA 3ELHA 3GFXA 1HBMA 1EKRA 4IH7A 2VA2A 1RT2B 4JV5J 4YDXA 1RHQB 2MKYA 1IKWA 2KT5A 1XR6A 3RAXA 2A6MA 2XTJP 5F8LA 3BQ1A 2I8EA 4I68A 3DRSA 5A8RA 2LXFA 1NHVA 4BBYA 3TVZA 2GHVC 3KLFB 3G4SS 1VQ5S 3MUTP 1NU4A 2UV8G 2XY6A 3DHXA 2VD3A 1ZPVA 2VG6B 3DN9A 2RD5C 3P6YC 2PEHA 4CH7A 2DIVA 4ID5B 2QL9B 4M5JA 3W2VB 4CLLA 3I5CA 1UPMB 3MMAB 2DHHA 1RLCL 2KHDA 5AT1B 1FA0A 4MT1A 2EVZA 2GVDA 3JS9A 3UDEA 3T5LA 2XHCA 4RBVA 4NRUA 2OEKA 2XS2A 2AW0A 2R4FA 1EETA 2FZGB 5ETVA 2V2ZA 1VOMA 1YJWS 2K06A 1FE4A 2JLEA 3Q8PB 1IM6A 1Q81T 4ED6A 2RU9A 2QLXA 1SJQA 2WOMB 1Q8LA 2CJYB 4QR0A 3RG6A 4QR1A 3T6JA 3BGRB 4KV8A 4O3QA 1QLNA 1IBLF 4O23A 3DLHA 5J2MB 1S0MA 2J7WA 3PM9A 4XO0A 3VALA 2DGSA 3VVTA 2H1YA 1N32F 5M2PA 1X4AA 4F8RA 4H4OA 2E44A 2V8HA 3EDRB 5KT2A 4FF3A 4C7QA 1RT3A 5CABA 1T9UA 3M6VA 2BKNA 4CT8A 4GMKA 5DS7A 1MW7A 2CQHA 2OELA 3FEYB 4X64J 4KHPF 4PZVA 4YUDA 2P2CB 4AQYJ 1U7LA 2RRNA 1T03B 1JXEA 1QE1A 5KFFA 2IHR1 3QFWA 3BH7B 5HQMA 3JSBA 4K59A 4YHHF 4F4AA 2BJ7A 3MPVA 3G9CA 5CZXA 2N3OA 5GMDA 2J0SD 1YRXA 1T7PA 5K8PA 3QWUA 2HHWA 1AA1B 2IM1A 4P10A 4XIUA 2B5JA 5SZTA 5KG4A 3C6TA 3PR4A 4WTOB 1VQLS 1H2TZ 1WF1A 3V81A 2IAJB 2OLWA 5B0CA 5A8WA 1NZ8A 2B7BB 4DOZA 1WUUA 3NS6A 4CT9A 1D09B 4DPXA 1RAGB 4LRFA 5K20B 3MR6A 1ZH5A 2GIFA 3DLBA 3S01A 1FX2A 4H4OB 1XMOF 5D0RA 1S4EA 5BYQA 2PI5A 2UXDF 3QIPB 3GE9A 4Q45A 5DDQC 2F9DA 3BO4A 2DVIA 5KFUA 1NMEB 2LA4A 2ATCB 5D4OA 1HNZJ 5LSLA 3V6HA 4A8FA 3EJMA 4USMA 3WBZA 3EYZA 2BDPA 4C8LA 4JI3F 1OYDA 2AU0A 2MY7A 1P8GA 3HCXA 1X4FA 1EETB 1HPZA 1W2BR 3ET6A 3NRBA 1XNQJ 4RWWA 3M2VB 4JI1F 1VS3A 2GJFA 3MMBB 1REVB 3TAQA 4LFBF 4ICLA 3EX7B 3D3CJ 3KOAA 2J7KA 4Q2MA 4V19J 2Y8YA 1ZOTA 1ZA2B 3MMAA 2VFSA 2EWHA 4NMLA 4ED8A 3P8BB 4NLXA 1S4FA 4Y2IA 3T41A 2YKNB 1UJ4A 3D6MB 5EUHA 3D54A 5L38A 5KFIA 1S6PA 2H5EA 3AJ2A 4IFVB 5KT7A 4WZQA 2A1BA 3HDSA 4TU9A 4J9QA 5EX3A 3PW0A 2N7YA 2VQFJ 3NGTA 5HMXA 2EK6A 5A0YB 4P9SA 3H25A 1WHYA 2DXFA 2G9OA 1VGYA 4WE1B 4JI8J 1QAYA 1HBMB 4L75A 3BJYA 1W26A 5HP1A 4ID8A 1CG2A 1S1UA 2WCXA 2V9WA 4OZ1A 4PABA 3PW2A 1VQMS 4FS2A 1Y7PA 3KYLA 1TKZA 3AHPA 1N36J 2XEXA 3HHKA 2D9PA 2DK2A 1PG5B 2LP4A 4DUZJ 5ETSA 3OXLA 3QYYA 1FDDA 1RK8A 3VAFA 1EARA 1YZ7A 2HWHA 2F3JA 4QIEA 3IS9B 4LF2A 3Q8RB 5HLFB 5HJXA 2EPIA 3CIMA 1CVJA 4MJKA 1GEHA 2HFVA 2IBOA 2W4CA 3LF0A 3RTVA 2CQ2A 4OZNA 3LAMA 4I1TA 4OYZA 3WZ0A 1QD1A 1TL4A 5A8KB 4DCOB 2M3DA 4IH5A 3G86A 4AE5A 2L41A 1S77D 3SCKE 3DHWC 5D0GA 2BW2A 4F0HA 5C25A 4K4YA 5HANA 3DFEA 1NJXA 2CPJA 2HZVA 1Y4ZB 3H4DA 4Q8EA 2MKJA 1FRKA 2BV3A 4A8KA 1KD1T 1OSDA 5KFTA 2DEIA 4ZVRB 1GAOA 2MKSA 1KLMB 2BM0A 3IM9A 1IWAA 3W8GA 1JWWA 1PYOB 2EEYA 3AQPA 1WC0A 3DMJB 5CYMA 3MM9B 3DM2B 5A76A 3AAWB 3RBZA 3HLUA 4OI0A 3R7BB 1R8AA 2QMUB 3QT5A 2E1PA 2EKYA 1CJVB 1LWEA 2LYVA 3QAUA 5CCMA 3W63A 4ZHRA 4ILMA 3R97A 3S7RA 5H9EK 1N54B 2DHXA 2U2FA 3BBFA 3GONA 3IWXA 1U1PA 2FHMA 1S72S 1F0XA 3N79A 2W25A 1RB0A 3TR5A 3IMQJ 5HSPA 1QUPA 1RHUB 4EYHB 3R7SB 2AWZA 2HHPA 4ETXA 5JUMA 4RU9A 3KJVB 4DL7A 3X1LB 1UETA 1Y0HA 2R2UA 4DL5A 3LA0A 1CS4A 3K0JA 1MN9A 1DQAA 2GO9A 2L9DA 3GZ7A 2R42A 3LP2A 4ZPWR 4CLYA 3I0RA 1JXLA 2DT9A 5E2QA 2RILA 3GIRA 3PFOA 1S6QB 1FD2A 5L9XA 4Y0FA 2KVQE 3KK1B 1LFPA 4FNIA 4ZPBA 4DR2F 3TANA 2IA6A 3OUYA 4RW7B 1ELOA 4ZVUB 3UN5A 2CJKA 4N76A 3MAAA 5KFQA 2XB2D 1U6FA 1TV6A 4A8YA 1YHQS 2FUG9 3RBEA 1RE1B 2OI2A 2V4RA 4KAIA 4JI6J 3G8QA 4J9RA 3QMQA 4DR6J 2AMCB 2HWIA 4YHHJ 2KVIA 3Q8VA 4Y6IA 2J9CA 4U7CA 2HHHF 4WPAA 2ZH3A 1N0VC 1N33F 2L3MA 1RTDB 1ZM3A 4Q5VA 3VR1A 1SUQA 1Q8BA 3KJNB 3ZZTA 1CSJA 2L08A 2HWTA 2BBEA 2FJXA 1G4CA 3CO9A 5EWGA 1PYTA 2HQIA 2HEKA 3HZGA 5K14B 2N4CA 2X3DA 4NCGB 4U67Q 3GU0A 2NSBA 3SDEA 2M8DB 1TL7B 3T1HF 4R8UA 1FDNA 5FLXU 1LWCA 2E1MC 4M5HA 4NEZA 1U8WA 3RGIA 2B0GA 2WZ1A 3N01A 4HT7A 2VKRA 4NLWA 5F8JA 2YNGA 3ICLA 2Q66A 1H7WA 2VQEJ 1UEUA 2YNIA 4PG8A 2RF2A 1IKYB 1SIZA 2HK3A 3OFFA 2IC3B 2QL5B 5DETA 4IUFA 4ZVFA 4JI4J 3QSYB 1BE4A 3BB5A 4ELTA 4RW6B 2G13A 3ITHB 4RUHA 2NQPA 2D3OR 4OX8A 1TMJA 1F9HA 2SXLA 5KFAA 3D1QA 1KN6A 5AXNA 3K2YA 1MMLA 4NASA 4LSLA 1XMBA 3MM8A 4QJVA 4DN9A 1U1KA 4F2RA 3VGVA 2VQFF 3AOAA 2OKQA 2VFUA 1AROP 1OQ3A 4JP8A 4LBHA 2CZ9A 1JLCA 3N9UC 3MURP 4USVA 5DO2A 3CCMS 5G0RB 2FVSA 3KJQB 2KM8C 2UU9J 4LFCJ 1C1CB 3FCHA 3NBPB 3PV8A 1VHIA 1AFIA 1FI4A 1FRHA 3TO8A 1WHWA 1C1BA 2OD6A 3DKDA 1FNXH 1X9WA 2CXEA 1JLEB 5EGYA 5DGBA 1CJKA 4DR3F 4W98A 2IPOB 2BJ9A 4KFBA 3KMSA 2J0WA 3KDOA 2FJVA 2D1CA 3O2IA 4I2QB 2W7OA 1YJ7A 3TQ1A 1TR0A 5ETOA 2HS3A 4C8NA 1YITS 3DXBA 2HGNA 4AXJA 4DL0C 2C2DA 4OL8A 1EP4B 3MPYA 2WRMA 1PILA 2M52A 2OEJA 3W9HA 2QN6B 2PFFB 4KE5A 1TFWA 1HQUB 2PI4A 1TQLA 2W7AA 1UVNA 1HNWF 4NZ7A 4O44B 4EO8A 2NYHA 2KL8A 4DG1A 4C9DA 2MQ8A 1C0UB 3TEHB 3K5MA 4P7VA 4EZ9A 2O3DA 5KOXA 1BC6A 4Y2KA 1EJ7L 3EICA 5IWAF 5EX0A 2XMUA 3BSCA 5D0HA 3JYTB 2VODA 3CJTA 4OJHA 2DR7A 1DAXA 5MLCV 2R7UA 1C0UA 1Q7LB 2BVZA 1AT1B 2FC9A 4MTPA 5IQQA 3W1YC 1UP1A 4OX9F 4LF8F 1DFDA 4MFBB 1SC6A 4C0BA 2BYCA 1YSJA 2BUNA 2HLUA 4O4GA 2DTJA 3A3OB 4LT6A 1HQUA 5IV3A 1HNXF 2HHXA 4WFXA 4J9VA 4X66J 3D6FB 1HBUB 4H4MB 4X65J 4FS1A 4A8QA 4N8NA 4NI2B 5D0EA 5BYRA 1JNRB 4I2PB 4DPWA 1WDDA 1U45A 5H9FJ 5EWFA 1Y5NB 3TZXA 5J2PB 3U02A 2RKIB 2HQCA 3FSXA 1PCAA 2ZC3A 2C2ZB 2GVZA 3PXGa 3KLHB 2MZJA 4ZN3A 1C4AA 1GMWA 4P73A 4ES3A 3M8RA 3K5LA 1C1BB 3J80Y 4RW6A 4Q0BA 1KBRA 5AXLA 8ATCB 3DNCA 2KRBA 4EBCA 2XWXA 4JI7J 1HFEL 4PKDB 2XY5A 4HACA 4B9SA 2AT1B 2MQLA 2UXBJ 4N56A 3ZFVA 1HBNA 1UFLA 4MMOA 3P4UB 3ZNJ1 1FRMA 3KK3A 1S99A 4ZP6A 3K5PA 4B9LA 2I5JA 3NEKA 4P75A 4ELUA 3VQSA 4J9UE 4ENOA 3NKYA 3UPFA 1FT8A 3PHTA 3WX8A 3TUPA 4WXOA 2MQNA 3BKTA 2IJRA 2QYGA 3MM8B 4K8RA 3WHIA 3VAJA 5BJRA 3GIIA 1RKJA 1IUJA 2GFFA 4G1PA 3DXSX 4UOCA 1XJWB 1D0EA 3KLIB 4I6AA 1KSPA 1EIYB 2UUBJ 2FDNA 1SIWB 5CHCB 1J5EF 4RW9A 3NXZA 3MEKA 1UPPA 1RTDA 2HHHJ 1TK8A 1M1HA 2VIHA 2YPZA 3QZ7A 2VH7A 2UV8A 3HFVA 3L7UA 1CC8A 3B8HA 4OZ0A 5KT4A 2ERRA 3KLVA 2FLNA 4OZ2A 3CGIA 2G2ZA 3GV7B 1FJGJ 5ETMA 3CJSA 3OJSA 3HVTB 3M30A 1S9EA 3EPGA 1OY8A 1SQFA 5F0WA 3QGHA 2RDJA 2KXFA 1VRTA 4K4TA 5DLGA 1BLUA 1W7WA 1S0NA 3I31A 2JFKA 4J90A 3MR3A 2LCWA 1FEEA 2LEPA 3NLCA 4M5GA 3TVKA 3B4MA 4DMZA 4DLEA 2POKA 3CO0P 3HM9A 4Y2CA 2ZH1A 4TNOA 3FRYA 1QJHA 1R8CA 2HIYA 1XQIA 1S57A 1Y3KA 3H0PA 4S0MA 2HVZA 3DLGA 4CM0A 2MXYA 1N56A 4C8YA 3GFHA 4X84A 4MKBA 2FYXA 1GMVA 1Q4RA 2GO8A 2N4DA 2RH3A 3PEJA 3Q2TC 2QZ8A 2HK2A 3IRXA 4MYUA 4O3NA 1S9GA 1O8BA 4ZKAA 5I42B 3IN5A 2CPZA 4DS5A 2ATLA 3H4BA 3MM6A 3PZPA 5FJ4A 3FZBA 1U4BA 1SCJB 1LWEB 2DKOB 2OSRA 2MB0B 4DQPA 2F4VF 2OPRB 2QLWA 1VBZA 3CJRA 4ALZA 2VBZA 1N5QA 1X4EA 2DCLA 3O44A 5HATA 3SCJE 2YX7A 3SSSA 1FK9B 3AB4B 2MSTA 3CCVS 4RO0A 5DQGA 2CIMA 3W62A 3MECA 5IC4B 2W1BA 2AYMA 3FFIA 3MAHA 1RT7A 3C16A 1F60B 2W2MP 1JLFA 1G2EA 4M5DB 4ZVTB 4DV3J 1AB8A 1H98A 3ENWA 3M6UA 5J1NA 1FJGF 5KOWA 1GMUA 3DU5A 1DLOB 3CEDA 2DRAA 2EFNA 2W2PP 2GMLA 5HVHA 1O6XA 2J6TA 3ADAC 2IVMA 2ZUGA 4PAAA 1RHMB 5AE3A 3M32B 1NJZA 3GLJA 2GAHC 4N8OA 1U02A 1JJ2R 4KT0C 3PX4A 2AJ4A 4TU7A 3IGVA 4B3SJ 3GQCA 3OFHA 4QU7A 4ATNA 2O66A 2BACA 4PQUA 5CD4H 1X5PA 2F8EX 3BN4A 3UWTA 2G0IA 3TAPA 2Y1JA 1JJ4A 1T94A 1UTAA 1QSLA 4W90B 1BQMA 4NYPA 4ZVSB 2FZCB 5CA5A 3GIMA 2DR9A 4JV5F 2Z2MA 1R3NA 4OI2A 4PYDA 3VAHA 1RT5B 3ZZPA 1U48A 3MMCA 1R6VA 3GSIA 5KG0A 1U25A 2VDHA 3DDKA 2CPFA 3M6XA 2X1FA 4FVMA 3BDPA 2IM3A 1HQ2A 4TQRA 3MEEA 1OIAA 8RUCA 1FJEB 5EDWA 3GV5B 3EGZA 5EHHA 1YIJS 1NDLA 3F0NA 5CZVA 4DWIA 2V6AA 4D3GA 2DH7A 2VL1A 1REGX 4U7UK 3PVXA 2W7PA 2CFXA 3GG1A 3CJ4A 5BR8J 3LP0A 4ZVQB 3PKYA 1FKPA 4WFBQ 3TAMB 2DEJA 2LMIA 3I9ZA 3KXDA 5A6WA 1O51A 4DFPA 4XK8C 4IQXA 4YQWA 1NDPA 1RTJA 5T14A 1TAUA 4FYWB 1N36F 3QT6A 4M5LA 2A0FB 1P6TA 3HVWA 1VQPS 4IO9Q 1WC6A 4OYMA 5F41A 2AEMA 1TTHB 4X62J 1KRPA 1A7GE 1S1VB 4FPIA 1FRJA 4OX9J 3IGNA 1NSPA 3AQOA 3ZC4A 2UUCF 2X1AA 3OXFA 2KT2A 1G7CB 1S6PB 2MLXA 3DYAA 2WW4A 3OR2B 1S1TA 3NWRA 4DV6F 4UOFA 5EN1A 2WHOA 1SJRA 3E01B 1WKKA 3JSYA 1VIXA 1U8SA 2P5VA 4KKOA 2DNRA 5ETTA 5C2CA 3J7ZT 2CWXA 1Y00A 3D2WA 1PIEA 1RXOB 2Z56B 4PG7A 2DY1A 4OHXA 2YPYA 3G87A 2A3JA 1SB6A 2WK4A 2AJ2A 4AD6A 3CC2S 3HKZD 4CP5A 2QGFB 2EKNA 2OPPA 2BKOA 3H8YA 4ED4A 3CCRS 3SV3A 4A8SA 2OP5A 3V81B 1M5VC 3IXQA 2BJ8A 3L9ZA 3QT8A 3FMBA 4AT1B 1OSCA 3D0GE 1JLGA 1Q1KA 1UW9A 2CQBA 1BMQB 4F25A 3BKUA 3CJ8A 3M8QB 4JI3J 3MEDA 1YX2A 5DRKA 3GTYX 2RS8A 2AGPA 2AZ3A 3ETMA 3IBWA 3THTA 4CWBA 4DR4F 4DL6A 1FJCA 1UKUA 3DLLQ 3FSIA 2IYIA 1UFKA 2O01C 1TVRA 3TI0A 3PKMA 1DTTA 2F9JA 1D3WA 3DGPA 1BQXA 2PA3A 5H9EJ 3K89A 1CEZA 3ZZOA 4H4KA 5HMYA 2D3UA 4NLSA 3TVYA 4X4TA 1ZM2A 3W8PA 1TVRB 3OSNA 1AUDA 2R7SA 4QIGA 4XTTA 3CD7A 4I0WA 1HBOB 1NK4A 3PYDA 3BZQA 3GYNA 4KV8B 1U1LA 4USHA 2H4YB 1T9XA 3C15A 1D9FA 2QIFA 3FGVA 1JLGB 4Q43A 3H98A 1K47A 3D68A 2RVJA 2JWNA 1SL2A 3BDEA 1U26A 2E5IA 1T0TV 2VJVA 4DV5J 1T03A 2Z2YB 1VHFA 3UD3P 3CD5A 1KWMA 4OX6A 2QT7A 2ZDOA 4QIFA 2HZCA 4WYWA 2XO6A 3W60A 2ADBA 4IRCA 1VQNS 4DR6F 1IQZA 1Q8IA 3A8EA 3EVMA 2ZD1B 1EZZB 4H4KC 2LECA 3NNHA 4I4BA 3MCSA 2IRYA 4XAKA 2G2YA 3TZYA 3DOLB 2VQEF 2DR8A 4FBTA 2V63A 1UEKA 3B54A 1VDHA 1CBKA 3GFYA 4KKOB 2DGTA 1S76D 1LKZA 2YVSA 2HHVA 2BZ2A 3IO1A 2YKMB 4RWXA 2QMWA 2D7SA 3DYAB 4Q7AA 4TN2A 1EX8A 4DSIA 4QU6A 4LR9A 1FKOA 3BSOA 4A4JA 3THVA 3LQVA 1IKWB 2YQ1A 3QAEA 4LVOP 3R5CA 2XLJA 3RBDA 3RR8A 1QSYA 2ZZTA 2VHGA 3PYFA 4U8VA 4OMFG 3D1OA 1SJ4P 2V8PA 3CT9A 1F3VA 4CO2A 3L3CA 1ZAWA 1M1GA 2XCAA 1RTJB 3SZ2A 5LMUF 3OHAA 3K59A 1HYSB 3NGKA 2HNDA 5GAGU 4DFJA 4DSEA 1XEZA 2LXIA 4L6V3 4RBTA 2X1BA 3B4DA 2GC8A 1FFGB 3MEGB 4O0NA 2F5GA 2HBRB 3ZZ0A 2PGCA 4DCJB 3G6VA 3HK2A 1MU2B 2ZVIA 2B6AB 4DUZF 4UQTA 1V6HA 3GV8B 1ITPA 5F9LA 4O4RA 2NXNA 1SQGA 3FCWA 5GAEU 4B3TF 3BKFA 3MMCB 2QLJB 1OYEA 2LU2A 1F9FA 2PC6A 3DRYA 3QO9A 4EI2A 5IV4A 4DV4J 4IKAA 3V4IA 1N5YB 1EQ0A 2YX4A 2OPQB 2E5LJ 5E3QA 4ZN1A 2MLZA 3MZIA 4ZCIA 2MMYA 5A2QY 2LEAA 2DH8A 1MNEA 2RHSB 2V68A 3HKWA 5T7LB 4YEAA 1RWXB 2DHGA 1VQKS 4P52A 3HHNB 3H5XA 3EDQB 2Z57B 4ZCLA 4DX7A 3AT1B 3PFEA 2VASA 2IJNA 2NYIA 3H59A 1B70B 1X31C 5E3CA 4G1IA 5FDLB 1SXLA 2KDOA 2NZCA 4PUOA 2FTRA 1TKTB 1RAIB 3H2LA 4PWWA 2PO4A 3W2WB 3ZTSA 4NLVA 1JX4A 1RWKB 2Y0BB 4KIAA 3A3PB 5CH7B 4ED5A 5HLFA 4GVLA 2C1EB
chains in the Genus database with same CATH topology
3EPIA 1VQSA 2XZWA 3HI9A 2LQBA 1SKSA 1M5OC 1D9AA 4UQGA 2HNDB 2XBPA 1HWLA 4K50A 1T05B 1XR7A 2FLOA 2M5YA 2BR0A 3CJ3A 2ACYA 1NH8A 5K8OA 3CCQS 4ECRA 4D3HA 3QGGA 5CYQB 2EG1A 4IH6A 4AFFA 1M1KT 1HNIB 4EUVA 1S0OA 4F2SA 1FKOB 2XCPA 5F3ZA 2MKHA 2EBEA 2OPRA 4I64A 2YKMA 1KHVA 3OJUA 2E29A 2MZSA 3UDLA 3MM6B 3MHYA 2CQCA 5KAKA 2K3IA 3DRPA 2BABA 1BD6A 3DDNA 4LIWA 3UW1A 1LXNA 3DLGB 1A9NB 1D8YA 1Q53A 3OHBA 2NREA 4A46A 3JB9k 4O3PA 3IA0A 5LL6d 3P3DA 5L9NA 1LK7A 1WELA 2MHNA 2A10A 2YKOA 3J7YI 2PDAA 3Q23A 4QZVB 1O5JA 5E7OB 2NS1B 2XS7A 5C24B 1G1XA 5DDPC 5LT5A 4MAKA 2ZM6F 3VF0B 1FNMA 2DNQA 3RZAA 5CYJA 1HD0A 1TL1A 2VUGA 5KFGA 3KWMA 3IWNC 4RW4A 2ZHAA 1QAJA 2RSQA 2XMJA 2ZH7A 2J6SA 1VK3A 5KG5A 5B09A 3NNCA 2V8GA 3AJ1A 3UCUP 4RX6A 4G6VB 3CDUA 4YB5A 1WD6A 1VBYA 1S0VA 4NA2A 2JEJA 2R2TA 1D1UA 2K7JA 3D0IE 4LF6F 5J2QA 1R8HA 1WACA 3JTNA 3K7RA 2IM2A 4Y3CA 1S6UA 1QVGR 1TAQA 2OPPB 3CXCR 3CE8A 1GTHA 4JBCA 1VQ8S 1RT4B 1X4HA 2B9YA 2QA2A 3LW5C 2Z8QA 4TQSA 1D9DA 3G9CA 1RT1B 1P1TA 1X4GA 4EZ6A 3QLHA 1JIHA 1ROFA 3I32A 2BOPA 4JV1A 4N77A 1JKHA 3IWLA 1FJ7A 1GTEA 2BA9A 4DR5F 2IRUA 2L9WA 1K0VA 4KC5A 4HDHA 4BC9A 2EFVA 3KG1A 1TL3A 1S1TB 3BSAA 3Q2SC 3ULHA 5HBMB 3DI6A 5DDRC 3MMJA 3CD0A 1SH2A 3IRWP 3QJLA 1Z4UA 3GIJA 4A48A 3VAMA 4I6YA 4PPDA 1H3DA 4LJMA 3Q8SB 3V6DA 1S1VA 5T41A 2HRYA 4ES2A 2JHEA 1UVKA 1WWHA 2XG8A 3OFGA 2OMLA 3RRKA 2HLTA 3LP1B 4Y00A 4F4YA 1PGZA 2DNMA 3V6KA 2CYYA 4IQMA 2E5JA 4NX9A 1NJYA 1NKCA 3FMWA 2ZOFA 3T19A 2KYZA 5F8HA 3I55S 2X51A 3IG1A 1CPZA 3I4HX 2ZJRQ 2F7VA 4DUYF 3OTOF 4HH0A 3M8PB 4NL5A 2W8LA 3TNVA 2DGWA 3EUNA 5D6GA 3UCZP 2MQQA 4LVNP 3SV4A 1MWYA 4CNZA 1T8EA 1CLFA 2DNGA 2JH3A 4CO0A 5B0GA 3GSDA 3VZIA 3HX9A 4JI7F 2IFXA 1WF0A 3N6NA 5DQIA 1T02A 2ZBIA 3IR6B 5IT4A 3CMES 2ZITA 5D3GB 3E3XA 2M88A 4PQUB 4RNOA 1FRLA 1F5CA 2GGPA 4MK7A 4CQ1A 4CO1A 1R27B 1KTVA 4NLTA 2N3LA 4I67A 3M32A 4X65F 4YOEA 4C3LA 5FIIA 3V2UC 4X62F 1TK0A 2FJAB 1XWLA 2VPXB 2PIIA 2J9EA 5IXUA 1UVMA 2APOA 4ZP8A 3CCES 1UJ5A 1LW2B 1S9FA 1C1CA 5D4PA 2VONA 4DV7F 4M5DA 2FHJD 3TA1A 1RT7B 1RT4A 2KRRA 4IG3A 3R1HA 4K4VA 2DNOA 3CB4A 4DQIA 5DG9A 4F02A 3KMQA 2JC1A 4ECXA 4C0OC 4WFYA 2Q6BA 4JYAF 5I3QA 1SL0A 3N6MA 4J9LA 4HTJA 4ILRA 3WC0A 2MZQA 3J81Y 4OI4A 3WC2A 4TY8B 3T1YF 5KG6A 1XC9A 2COLA 2DBBA 2WBMA 4EYIB 1OPIA 5LJ3Y 2PN6A 2DGQA 2F8MA 1VJWA 2MJUA 4NCAA 2DNYA 2HGMA 4ZPTR 4ZDNA 4PQAA 4YB7A 1LWCB 4NCBA 4NLYA 3C6UA 1X8DA 2C28A 3NL0A 1M5KC 1T95A 2M0GB 5J1EA 2W9BA 1HHTP 3CVKA 2AYGA 3TX8A 1UW4A 4ZCKA 4NA1A 1ZBTA 4RUCA 2E5GA 5DQHA 1H2VZ 2KO1A 1TK5A 1SH0A 3PX0A 3JSMA 2RQKA 5F8MA 3DRPB 2F8HA 3OQ2A 3OR1A 5FLXY 3MUMP 4F4KA 2E1CA 4TY8A 4X4PA 1XBWA 3M1VA 1SJ3P 4W92B 2AP6A 2J0QD 2C2RA 3HPOA 1Y9OA 2K1RA 4HT5A 4MK9A 1DZ5A 1H2UX 1DJ0A 3H5SA 4HI1A 1YG0A 1MSWD 5L39A 4GO5X 4RU2A 4LF7F 2KT3A 3LP2B 4WU2A 1AW0A 2BQ3A 2IJFA 2PE8A 4IG3B 4KO0A 2RE1A 2YQ3A 3M9OB 3T9NA 2GHWA 4Y65A 3UR3C 1HWJA 2Q6CA 3R5BA 4IRKA 4B02A 2QEXS 3L09A 2Q79A 2RRAA 1RKIA 1LW2A 1M5SA 3MOZA 1Z1ZA 3ENQA 5KT6A 1QSSA 2XLKA 5HN0A 5L8RC 4C3MA 4BHQA 3MOJB 2GQ2A 1L3TA 1TKTA 1FHTA 4NPOA 1S48A 2FJDB 2M9KA 4ZA1A 2XO7A 3G71S 2IM0A 2RKIA 3CUNA 2B51A 2CZVC 5CYMB 5E41A 1NNDA 5FDLA 3J7YU 3FDSA 3N6LA 4Q2LA 2GGPB 2VFRA 1KFDA 1SV5A 4X4OA 1FEHA 3U1LA 3FRZA 2DGXA 4QIVA 4LSNA 4OI3A 4A47A 2AJ1A 4R5PB 1WG5A 2CZ4A 4O3OA 4IO1A 2RRBA 2A18A 3FJ2A 4O4GB 4QYZJ 4RLEA 3PW7A 5JVHQ 3X3UA 1QY7A 4FF1A 1UMJA 2XMMA 3LPYA 4WFAQ 3OLAA 3KLGA 2BANA 3CPWR 3VCDA 4BS2A 3TW0A 4DFKA 3K8VA 5DM6Q 5KFJA 4X4QA 2GHPA 1JNZB 1IKVB 3Q8QB 4EBDA 1X4DA 5HMZA 2CRLA 1S1WB 4O44A 3R1LA 1HI0P 2E7XA 4HLBA 1NK7A 5KFPA 4Z2XA 4PWUA 2YKAA 3LP1A 4WFNQ 4HYKA 2ILZA 2ZH8A 2XGPA 1M0SA 3L7PA 4M94A 2JDJA 3ZZRA 2LDYA 1B0TA 2WB1D 1QVFR 5B08A 4IFVA 2AD9A 2I1RA 2ROGA 5HBMA 2IMWP 2V8VA 2ZVSA 3G8TA 4IR9A 3HMJG 3ISND 2DGVA 2P6TA 3ONQA 2PSZA 1JKHB 3DRRA 1HMVB 1MMNA 3KHGA 3GG0A 2JRSA 2ZD1A 1RT1A 1WTFA 3DC2A 3AB2B 3QGPA 4WXWA 5DGAA 3OL7A 3OBIA 3K57A 1J2VA 1UA0A 5U47A 1SJ1A 3RRGA 4Q44A 3E8OA 5J2QB 3NNAA 1Q82T 4MIBA 3QZ8A 4B9VA 3NAIA 4AYBD 3PIOQ 1NK0A 1KNZA 3MM5B 4YP3A 3PRDA 4K4WA 1HBOA 1GT8A 1KTQA 1TUVA 3HHDA 5B0AA 2P9GA 1VC5A 2EG2A 3QIPA 4CTAA 2IC3A 1U1QA 3M6WA 2B9WA 3MFIA 3C3LA 3HXMA 2GMHA 4ECVA 4DQQA 1KC8T 4ZVHA 4GKJF 5E5NA 2VFVA 1Q16B 1KQKA 5A8WB 1N32F 2K8GA 4QBUA 4DR1F 2YWGA 5C42B 1S97A 4EO6A 2I2YA 2DO4A 3DLKB 4R8UB 1JLQA 3FSYA 4P6QA 5KFRA 3HHLD 2GQQA 3M8QA 3MEDB 3NP5A 1D8ZA 1XMQF 2DNZA 4LUBA 4YR0A 2VG7B 4ECZA 5E33A 1YI2S 2PT0A 3PO5A 4KR0B 2E66A 4QWAA 2R9LA 1X4CA 2MSSA 1U6ZA 5HMWA 2V94A 5L1KA 3UDCA 3OVAA 1Q78A 4F67A 2R7TA 3O8WA 4UY85 1B0PA 5B0DA 3DRRB 4DV0F 2KFYA 1HHSA 4KSEB 4QYRA 4BC7A 4K4UA 3MD1A 4N41A 1NKBA 1NAQA 3E01A 3F56A 3RR7A 1VRUB 1W2IA 2CPHA 2MKCA 1YGYA 3IFEA 4CCHA 2H9ZA 1S6QA 4IYQA 4HKQA 2MY8A 4YR3A 5F8NA 3RB6A 2E9ZA 2ZZMA 1R6YA 2CPDA 2BQUA 2UVVA 1E6VB 3ZZZA 4ZVEA 1YJNS 2O1PA 3OTBA 2QA4S 3PY8A 1YJRA 4RUAA 1KVIA 1NO8A 2FJEB 1U47A 1H6KX 2DO0A 4WKYA 1LQ9A 3LP0B 4CNYA 4DV4F 3V6JA 1J5OB 1I6JA 2VOOA 1QM9A 4DSJA 5FJ4A 3K5OA 4RZRA 2RQMA 2RQ4A 1IKVA 1KR4A 2MQOA 2CJQA 3ENVA 2WW8A 3LGNA 5E0OA 5AXKA 3KLFA 2NUHA 4PWDB 3BGUA 1S6OA 3LAKA 3ISNC 3D28A 1U6BA 3U27A 1U1RA 3O6QA 1IXKA 1RJJA 4QIWD 3EGNA 2CJAA 1GX6A 1HQEB 2GQCA 2V4JB 3IR7B 4NLOA 4BCAA 1JLAB 1BQMB 1KQSR 1R31A 3T1AA 1H0HB 4J9NA 1WNEA 4LSNB 2IA6A 4AXIA 3CJ2A 4TY9A 2FLPA 4OLOA 4TKTA 5BR8F 3QO9B 4B3MF 1AXQA 2DISA 5A8KA 1ZAVA 4K5RA 4DEZA 2VPZB 1N4LA 3L95X 2GNKA 2YNFA 2FB0A 3S1TA 3LWMA 2J9DA 2YWHA 5KG1A 4Y28C 4WIIA 2CPYA 2HGLA 3P49B 5D8HB 2J6UA 2ROPA 3K8WA 2O5DA 4MK8A 3KG4A 5KFSA 2FJBB 4Y2AA 4LMZA 1KONA 4I69A 1FXDA 1S1UB 2QE5A 4JOUA 5HP1B 3PACA 2VV5A 4KQZA 4FF4A 2RS2A 5JJBA 3CCUS 1BQNA 4WE1A 2LU1A 3US5A 3SSQA 4X4RA 2K1RB 2GJ2A 5M2UA 4RNMA 4EEYA 2FJWA 2LVWA 2EK1A 2B4PA 4X4VA 1IBKF 2MGZB 2VFTA 3THPA 5EWEA 2CQDA 4C0HA 1L3VA 3IRXB 3M4XA 2ZOGA 4UW2A 4NLGA 1UWBB 3NG8A 1WI6A 4CH0S 3OV7A 1C0TA 3T3FA 4TLQA 5AXMA 1ZTTA 3DCAA 2DRBA 2JJ4D 2GJIA 2C3PA 4DV1F 1HPZB 2W24A 1B7FA 4LF4F 2VG7A 4I6WA 1LK5A 1NZAA 2IRXA 3HVAA 3C6UB 1K1QA 1R8PA 1VRTB 1VLYA 1YTYA 4C8MA 2RMLA 3PNIA 2WTFA 5L1JA 3MWBA 3HVTA 3M30B 2RIJA 5KFBA 4GO7X 1TP7A 2MZ1A 2JZ5A 3N4WA 4FVCA 2GV1A 1HWIA 2OTJS 3CWJA 3R5AA 3O1LA 2LKZA 1DTTB 4IOAQ 3F44A 2IAJA 1RYRA 2R2RA 2R7WA 3PHEA 3PJWA 1ULRA 4F3QA 3H40A 2B5JB 3KLIA 4OZLA 1NKEA 3BR8A 3HVRA 4FN5A 1E6YB 2FVPA 3KK2B 1U09A 2AJ0A 4DPOA 2KH9A 4QQBA 2IMOA 2RNEA 2ROEA 2XI3A 5K8MA 2QFJA 2VC0A 4C11A 5KFNA 1QE1B 3P96A 2B56A 2OAUA 2HNYA 2JEFA 4IDKB 2OTLS 1Q79A 3RB3A 2R8IA 3JSRA 1HMVA 2ZHBA 1ZZNA 1OO0B 2HS0A 3TOQA 4QR2A 1M5PC 4DSLA 4RNNA 1I94F 2IVYA 4DV5F 1YVFA 2GCFA 4R0EA 5KFHA 1NK6A 2ZH9A 1WG4A 2KI2A 2R8HA 2KG0A 5B0FA 3HT3A 3UI3A 1YRTA 4OZ5A 4QWEA 4PG4A 2GIRA 4I2PA 1XNRF 2D9OA 2CQPA 4NLUA 2E5LF 1C2PA 2OJ3A 2Q1LA 4LFCF 4YDDB 5D3GA 1LWFA 1ZYQA 2AF6A 2C3UA 4DX8H 5B0BA 1X5OA 2DIUA 4MFBA 3W2VA 4C8ZA 2KTQA 1DTQB 3M2RA 2HHUA 2DPJA 4KB7A 3M2UA 3DLEB 3BS9A 4Y2MA 5GAEI 3JAMY 1L5UA 2R8JA 2ZE2B 3DRSB 3RRHA 2XMWA 3H5UA 3LALA 1RISA 2A2CA 3MEEB 4C98A 4IUFA 2W4DA 2J9DE 4ECQA 3M8PA 1QAXA 2KFZA 4H54A 4ZK7M 2ZH6A 1WEZA 1RT5A 1NK9A 3IG1B 3UD4P 2U1AA 1ZAXA 4DHVA 5E3AA 3V4MA 4JV2A