3FMBA

Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
YFQGMVKHIVLFKLRDDVPVEEKLVVMNSFKEAIEALPAKISVIRKIEVGLNMNPGETWNIALYSEFDNLDDVKFYATHPEHVAAGKILAETKESRACVDYEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimeric protein of unknown function and ferredoxin-like fold
publication title Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (YP_212648.1) from Bacteroides fragilis NCTC 9343 at 1.85 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fmbA01
1JWWA 2BJDA 4U9RA 4DN9A 3VTIA 2BBEA 2VH7A 4OJGA 3TOQA 2K1RB 3HHLB 5B09A 3BGUA 2KT2A 2OP5A 2RILA 3DCAA 1CC8A 2KKHA 1AFJA 2N4DA 3KKFA 4FNHA 4HL9A 5B0FA 1YRXA 1JK9B 5B0GA 3TNVA 3DXSX 2HLUA 1GXTA 1YJUA 2K1RA 3HHLA 4A46A 2CRLA 2W4PA 2BJEA 1X7VA 2HLTA 3FGVA 2G9OA 1N5QA 1Q8LA 3HHLC 3HX9A 1X8DA 1KQKA 2BUNA 3GZ7A 1APSA 1KVJA 1Q4RA 3F44A 1MWZA 1YJVA 2ZDOA 1Y3JA 3CJKB 4ZOSA 1R6YA 5IXUA 1KVIA 5A6PA 5B0BA 1N5SA 2OMOA 1AFIA 1MWYA 2W4CA 3FMBA 5B08A 2N4CA 3QGPA 5F0WA 2ROGA 2XMWA 1SB6A 4QOTA 1ULRA 1OQ6A 1Y9OA 2OAUA 2ACYA 3E8OA 3HFKA 3I9ZA 2IFXA 4HH1A 3CJKA 4OJHA 3IWXA 4Y2IA 2GA7A 2QLWA 3BF4A 1Q53A 1FD8A 2ROPA 1X0PA 3KG0A 2LQ9A 2ZDPA 3LO3A 2QIFA 1Q8BA 2GGPB 4Q2MA 1URRA 2LDIA 2XMMA 2XMVA 4DL0C 3MCSA 1OPZA 3BN7A 1SQEA 1S6OA 2XMTA 2ROEA 5A6WA 2GCFA 3HF5A 2AJ0A 3TRGA 3LGMA 1YJRA 2HQIA 2RSQA 3FRYA 3WDOA 1TZ0A 2OFGX 1N5TA 1VQSA 1Y0HA 2GGPA 2VV5A 4YEAA 2AP6A 2OD4A 3BR8A 5T7LB 2BYCA 1FE4A 1TUVA 2L3MA 2OD6A 2OFHX 4EFAC 2K7JA 3T9NA 1GXUA 2FIUA 1TL4A 5B0AA 2GO8A 2OKQA 2RU9A 2XMKA 2QYCA 3KG1A 1XBWA 2IYGA 1K0VA 2FTRA 2KYZA 2LXFA 1TL5A 1QUPA 1FESA 2FB0A 2N7YA 2AJ1A 5T7LA 1CPZA 1OSDA 4A47A 1TR0A 2K7KA 1U7LA 1CC7A 2W4DA 1V3ZA 4Q2LA 2Q3PA 3K7RA 5F0UA 5K9FA 4F67A 4OIXA 4FNIA 4Y2KA 2LQBA 3BB5A 1SI9A 2PGCA 3UDCA 2GV1A 3HDSA 1FVQA 3IWLA 1RJJA 3BDEA 4OJ3A 2K2PA 2QLXA 1IUJA 1FE0A 4YDXA 5B0DA 3QMQA 5KAKA 1YJTA 1FVSA 4ZA1A 3BM7A 4HI1A 2XMUA 2HIQA 3MZIA 4HH0A 2HFOA 3KNGA 2GFFA 4HI2A 1AW0A 1FEEA 1N5VA 1P6TA 2KT3A 1W2IA 2PD1A 2XMJA 1OQ3A 1YG0A 3HHLD 4NL5A 5B0EA 1P8GA 2RMLA 5B0CA 2FHMA 4NPOA 4OJ1A 1LQ9A 2HFNA 4DPOA 3LGNA 2JDJA 1S6UA 4Y2MA 4A4JA 2AW0A 1Y3KA 1WD6A 2ASYA 2EW9A 4A48A 1VQYA 2IYIA
chains in the Genus database with same CATH superfamily
1N8RT 3R2CJ 3LQVA 1BXNA 1SJ1A 2YWGA 4M5KA 3OFFA 2R8JA 4FPRA 3CEDA 2A18A 3NGKA 3Q0AA 1VRTB 1O8BA 1KKHA 1RWUA 2WOMA 3MGJA 2Q66A 3LOUA 3M2VA 1V6HA 3CDWA 1KHVA 2MY8A 3NGUA 5HVGA 2R2SA 1RHQB 2E7WA 2DR7A 3F56A 2VA2A 4LFCF 3DM2A 1Q82T 5F3TA 3D6FB 4OI4A 4KSEB 3ITHA 1NPPA 3CIZA 2XCAA 2XMTA 1PSDA 2FC8A 2WRMA 1NZAA 3JSMA 2P8IA 4DCJB 3K0JA 2QT7A 3DU5A 4RUBA 5HL7Q 2RQMA 1N52B 3IO1A 2BQRA 1JNRB 3ZZPA 4NI2A 2YNFA 1JKHB 3TZWA 5C2GA 3EXYA 4ZP6A 2E7VA 2E66A 3THVA 1S1WB 3DU6A 5CZXA 3KDOA 1O0PA 1QAXA 4DEZA 2B0GA 4NYOA 1HFEL 1UW4A 3R9LA 4WYWA 4QU7A 1X5OA 1Y00A 3F73A 2V5HG 4B9NA 1RT5B 2CAJA 5GAEU 4L72B 5E3QA 1IBKF 4KO0A 5JVGQ 2E5IA 1P1LA 4PWDB 4ZLPA 3EPGA 4X66J 4LQ3A 4NCGA 4KQZA 1VBXA 2H9ZA 1C2PA 4O3PA 5CYMB 1FK9A 3D6MB 2VICA 4HKQA 1FRJA 4QPTA 3LP0A 3DLEB 5EUHA 4B9MA 1VIOA 3R6GB 5LT5A 4TU7A 2HQFA 2N3LA 2AEJA 2IM1A 2W9CB 3BYPA 4A8QA 1M5KC 2IM0A 3LANA 2PN6A 1SL1A 3GB0A 5KFBA 2M88A 4WE1B 1WTFA 3K8WA 4FZVA 2QL9B 3KK1B 4EUVA 3OUYA 1YITS 5D4PA 1HW8A 4L6V3 4RU2A 5L9XA 5B09A 4WFAQ 3T1YJ 2MKJA 2HIYA 2W2PP 2XM3A 4XO0A 1NDKA 4MKVA 4USTA 4GKKJ 5I3QA 1L5UA 3EVMA 4DS4A 3S6EA 3R5JB 4KHPJ 1RYRA 3OR1B 2EBEA 1GQEA 4GKJJ 4EGLA 3OL8A 3E8OA 2RRNA 1LV5A 2GX8A 3NOCA 3J7YU 2DGUA 1Y5NB 4LFAJ 2W9AA 2V2QA 5IS2A 4ES3A 5D3GB 3TX8A 1W25A 1NZ8A 3A13A 1YZ7A 3MD1A 5A8WA 4YP3A 1HI1A 4OYIA 3OLAA 4F67A 4QIWD 1TL1B 4JI5J 3EJMA 1RP5A 3EMTA 2VDHA 1I5OB 2DR8A 5DQIA 2B43A 2YX4A 3ZZOA 3GU0A 2KG1A 3VGUA 2DGOA 3MM5A 1QLNA 4OI6A 2HNZB 2VKZG 3ZZUA 4WFYA 3ZNJ1 2K1RB 3P3DA 5HJXA 5A8KB 3IM9A 4IRKA 4W4MA 1XR5A 4NLRA 3NRBA 4LVNP 2R2UA 1WWHA 2JEIA 4LVOP 5E2QA 1SXLA 4DI6A 1KS2A 2W8KA 2VU5A 2HQ3A 1AFIA 2JVOA 5RUBA 4KTQA 5A0YA 3QIPB 3HFKA 1YBAA 4J9VA 4K7QA 2V69A 2VZ9A 3TZXA 3KXDA 1RBOB 3NWRA 3DDKA 2HGMA 3VZIA 1LWCA 3QIDA 2Q43A 1VQSA 1MMDA 3KLFA 5T7LB 2NLWA 3M8PA 2PMWA 4R0JA 1BQMA 2EFOA 8AT1B 4DG1A 3M6XA 2AZ1A 4XPEA 1XR7A 4CO3A 1UFKA 3C19A 4K8RA 1YDLA 5GMKa 4P74A 1JXLA 2KT3A 4FS2A 1V3SA 3R5BA 4NZ0A 1GX6A 2LKZA 3MEEA 3L09A 4N8NA 2FJXA 1RLDA 2J7KA 3OTBA 3KMQA 2ZJRQ 4KGVB 3S8SA 3BDPA 1PILA 2DH7A 4J9PA 4K2JA 2GNKA 2F4FA 1TKDA 1IJEB 4X4RA 3OVAA 1HI0P 1H38A 1HNVB 1JLAA 2CVEA 3RW6A 5ETSA 2EFNA 1RTJA 2F7VA 1JLBB 4H4KC 1QE1B 4X66F 3CD0A 2WVDA 3DLGA 5GADI 4P75A 2LFVA 3GG1A 1U1KA 3EZOA 2JX2A 1RCXB 2RUGA 3TZZA 4Q44A 2PMHA 2CFXA 2EFQA 1VK3A 4UW2A 2VA3A 4KE5A 5KFOA 1X60A 2HFSA 4X2BA 2K7KA 3IN5A 1UZDA 4DV0J 5I4MA 4FXVA 4DX7A 2UP1A 1PYSB 3TUJC 2NR0A 1S1XB 5KFVA 3BYRA 4QYRA 4NLTA 1YJ9S 2BEFA 1YBUA 5KFKA 2GJFA 4CTAA 1S1TB 3BBCA 4PRFA 2G0JA 2H54B 3IBWA 2RDJA 3OR2A 1QVFR 4H54A 1RAAB 4DL2A 3T1YF 1UCNA 2BVZA 2OELA 2WSFC 2J0SD 3I0RB 1RA7A 3FCWA 3KG4A 4GKKF 1WF0A 1RWXB 1N5QA 1ZBTA 4HEA9 3LGHA 3HLUA 4C4WA 3KLGA 4KHPF 5B0BA 3PVXA 3PIPQ 2BE7D 3K59A 4GKJF 2B9WA 3V81B 2IRYA 2CPEA 1R43A 2PA3A 3MUMP 4ZPVR 5A6WA 3DLKA 1X5TA 4KGMA 1KEKA 3BSCA 4TNOA 2DXEA 4UQTA 2ADCA 2FIUA 4BHQA 5ETQA 2FQQB 2B4PA 1ZOTA 1DURA 3EGWB 3DHXA 4JI5F 3TUPA 2NUUG 5HBMB 3N5FA 3DOKB 3I56S 4IOBA 4RNMA 4RNFA 1UFWA 2AW0A 1F9HA 4DX6A 5HK4A 3EYZA 3CB4A 2M5YA 2N4DA 4DFJA 2XSFA 2RIJA 3NS6A 1FD2A 4ANEA 3CD5A 5AT1B 2FUG9 1XEZA 1GXLA 3CW2C 4DR5J 4W98A 3D9BA 1VMBA 4WK3A 2RF2A 4LIRA 1HD1A 1S6PA 4NX9A 3FCHA 2KN4A 3AJ2A 2UVWA 1I1GA 2XI3A 2LDIA 3HCXA 3OW2R 2ROEA 1X9SA 3TJ9A 5JUMA 2OD4A 3MTJA 4ZPDA 1VISA 4ZJOA 4X84A 3R8YA 3DRXA 4DV7J 2NS1B 2QYCA 1U1QA 2M0GB 1N48A 1RTDB 2D74B 4LR9A 3IRWP 2JC1A 1RU1A 1F0XA 2KH9A 3D1QA 4WFBQ 2K2PA 5F8NA 3VALA 3HVRA 1QM9A 5J1PA 1CQMA 4LMZA 3MMCB 4ED2A 5F8MA 5K14A 4I2QB 2DHAA 3N6MA 3JS9A 2QMUB 1RAEB 2DBBA 3H2LA 4K4TA 1U1MA 1SJ3P 4Q7AA 1S1UB 4J9SA 1N36J 2P6SA 3HSJA 1UJ4A 4MMOA 4EEYA 4FYVB 5HANA 1R89A 2DNRA 3OFHA 1RAJA 2W4CA 2IVYA 1SQGA 4LF7J 3QGPA 2H3EB 4N77A 5FLXY 5BYRA 2LP4A 5GAGI 1XMOJ 3W5YA 4NWBA 4UOGA 1WOOA 1MROB 5L39A 2EI5A 3MCSA 1SQEA 1IQTA 4IDKB 3NNHA 1KTVA 3PACA 3UN3A 5DQHA 2DHSA 1HNXJ 1SCJB 4M1KA 3GONA 3WHIA 3SSQA 3CCJS 1SPBP 1A6LA 1Q78A 2YNGA 2E1PA 2UV8G 4OHVA 3OXLA 3PJXA 1DLOB 4DV0F 4OJ3A 3G9CA 1FI4A 4YMEA 1WACA 3GYXB 1KBRA 2O1PA 1PJ7A 4KJIA 3AOAA 2KO1A 3FMWA 2WB1D 1UWBA 3PYGA 2Z2ZA 3VTIA 4QJVA 3MDFA 1WOPA 1IBMJ 1PYOB 2Z8QA 4OHWA 3J7A1 2GQ2A 3AOCA 3CCTA 1RT1A 4USVA 3R1LA 3O1LA 1YX2A 1PCAA 2AKWB 2ZBRA 1AUSL 3J81j 3NBPA 4I1TA 1T95A 3FZ2A 4CLZA 4KH0B 1YK9A 3Q89A 2HS0A 4EFAC 2V4QA 1UPMB 1S1VA 4U8VA 1FDBA 2UXDJ 5M2PA 3SCIE 4JYAJ 1YJNS 4MT1A 3UWTA 3J7ZT 3SZ2A 3QT6A 2CZVC 3QT7A 5GVQA 2GMLA 4LRAA 4CRJA 5B0CA 2ZD1A 1HQEA 3M30A 2BDPA 5FIIA 1K9MT 2G0IA 3MEGA 1GK8A 4DR4J 2W24A 2HSEB 2LQ8A 1ZM9A 3Q8PB 2LEPA 1WDDA 2WZ1A 3NNCA 4K4ZA 2R7WA 2BZ2A 1KR4A 1BC6A 3MURP 3KK3A 2R7UA 1APSA 4YB1P 4DR5F 1YRUA 4J37A 1F5BA 2I5JA 2JHEA 2KJVA 4A8MP 5HMYA 1VC5A 2FJEB 2QV6A 2GW8A 2ZH5A 2ZWOA 2YQ0A 3DRSB 3NWGA 3UVJB 1FCAA 1RWOB 4DFKA 3VAGA 3NCRA 3G86A 1TTHB 2R4FA 1HWKA 4Y0FA 5ITHA 3MM5B 3HI9A 3KUGA 1C0UA 4DV7F 3AA9A 4DR6J 2V63A 1N32J 3QBCA 5A76A 3IG1B 2J0WA 1HARA 4J9KA 2J8SA 5D4OA 5J2MB 3CDUA 3W62A 3Q8VA 2GC8A 1FNOA 3PYFA 4ILLA 2JEFA 5CYQB 1KVKA 2Z2LA 4OX6A 3CC7S 4NLSA 3V4MA 1KOHA 2CNLB 2FHMA 1RT4A 4MFBA 1VGYA 1L3KA 3MOZA 2MHNA 1Q5YA 4L74A 1LXNA 4RW6A 1T05A 2M9KA 3QSIA 1J5OA 2M3DA 1HHSA 1VI7A 4C0OC 3VQSA 4WCEQ 2BJ1A 3MCNA 4YB6A 4JI6J 1L3UA 3MEDA 2F40A 1U4BA 1N36F 1HBNA 5EWFA 4P9SA 1URNA 3R7NB 1TK5A 2V8VA 1TL7A 3UNYA 1F9FA 4LF7F 1FFSB 3W1YC 3CTRA 1UEUA 1U6FA 1XMOF 4LSNA 3CCRS 5ETOA 2XMVA 2DPIA 1E6YA 1LXJA 4CYUB 2AJFE 1X4HA 3QT5A 3WDOA 1HWUA 3M2RB 5C25A 3WX8A 4ERDA 1HNXF 3CE8A 1U2RA 2C3MA 3GQCA 5GADU 3NAHA 1XBWA 3QLHB 1F2HA 3OXFA 8RUCA 1NB7A 1UP1A 2M7SA 1EJ7L 2KFNA 2PEHA 5MLCV 1IR1A 2PIIA 5BYQA 1M1KT 1CJUB 4CO4A 1RCOB 1U1LA 2BE2B 4WK1A 3GWCA 1VK8A 5EX3A 3SDEA 1WC4A 4AT1B 1AROP 2VH7A 3TEHB 1R8HA 1T3OA 3HMJG 1IBMF 5J1EB 4KFBB 3AT1B 2CRLA 3KLEB 2WB4A 3CDBA 1KVJA 1GAOA 3C6UA 4EI2A 2EVZA 2CJYB 5IZHA 3UFCX 3PO5A 3A3PB 4I6YA 1EAYC 2HWHA 2XBPA 1YJ7A 4K4YA 2DRBA 2NREA 2BW7A 2E5HA 2IC3B 3HVAA 1B64A 4UOCA 3IS9B 3LALA 2QMWA 1Q16B 3TYTA 3M6UA 2UXDF 2C3PA 1DRZA 5KFYA 3ZC4A 4JYAF 3RBZA 2Y1RI 4AXJA 1S48A 1IQZA 1JLQA 4ZPTR 2MQOA 2YH0A 5LJ5Y 4WU3A 5DLFA 3KDNA 3HSDA 1D09B 3I55S 1V5VA 4KR0B 4DF4A 1RHRB 1S6UA 3KLHA 4FVCA 4M5MA 1LWEA 1PG5B 1WHXA 3CUNA 2X3DA 5KG2A 1WSVA 3ISND 4DR4F 4PYAA 1ZZFA 1FDAA 4I2PB 3FSXA 4JI8J 2ATCB 3PKYA 2KYXA 4UZBA 1FO1A 2XS7A 4G1PA 1HQ2A 2QTWA 4WU2A 1W7WA 2E1CA 1VQ6S 1REVB 1RKIA 1DTQA 2HHUA 2ZC3A 3H5YA 3QJLA 2LQ9A 3OSPA 3CCWA 1L3TA 4NCAA 2GGPB 4NOHA 4LUBA 4NEZA 3WX4A 3BN4A 4DFMA 1CULB 2ZFHA 3D6HB 4I4BA 5HATA 3T9NA 3KUHA 1U49A 1TVRB 3VAFA 1BQXA 4DR6F 1N32F 4FS1A 2RU3A 2Q3PA 2RQKA 1YWXA 5ETNA 1KQFB 1JLGB 3HULA 2FVPA 3FBCA 4M5DA 4J5OA 1Q7YT 1T03A 2YNIB 1AZSB 2XHWA 3W9JA 3PY8A 1K73T 2ZM6J 4K0KJ 3HHLA 1D3WA 3MR3A 4DV5J 4FF4A 4JI6F 3P5BP 5KFLA 3TVKA 5KT5A 1Q8LA 3GG0A 1MNEA 3G4SS 3V5RA 1YJVA 1U24A 4ZDNA 2CIMA 2E9TA 3HO1A 4RNOA 4FF1A 2FLNA 2B8QA 1X0PA 5KG0A 3MXHP 3FBFA 4HT7A 1YJWS 3TWZA 2RKIB 4TXSA 4E8UA 3LUYA 3M1VB 4AD6A 5GAGU 5KFFA 1JLFA 2WVEA 2CQGA 1RTIA 5FLXU 3RB0A 3W63A 5C2CA 2J8AA 2WONA 2RD5C 5IQ6A 4RW7A 4IG0B 1EHWA 3MZIA 2AJQA 1N0VC 4B9SA 2CPHA 2H1YA 2R7XA 3CCES 1P8GA 2O67A 3AXMA 1NEEA 4ZLLA 2CPIA 3HKZD 5THWA 2LQ5A 1T0TV 3CD7A 4OZLA 5B0GA 2C22A 1FFGB 5HVHA 5L46A 1NHUA 3BPDA 2FDNA 3IAM9 4ANCA 3ILIA 1N56A 3M9OB 4B3RJ 3RB3A 2MKKA 1LW0B 1WEZA 1FWLA 2DO0A 3D0GE 1ZA1B 2FLOA 4C8YA 1XK8A 4LBIA 2YWFA 1GTEA 2VFVA 2E5GA 1N34J 2G2ZA 4P52A 5EWEA 2FVQA 1GXUA 2R2TA 2VPWB 2B5JB 2V6AA 2HZAA 4A47A 4IG3B 1VRUA 1QUVA 4FP9A 2B9EA 2ALZA 1NSKL 2XMJA 1BQNB 2X1BA 1KD1T 4NPOA 5HI7A 4K4XA 4PQUA 3R27A 4JP8A 1RWNB 1DHMA 1SJQA 3BGRB 3L3CA 4PWWA 4NASA 3ZTPA 4K2XA 4RL1A 2HNYA 2KJWA 2ZBCA 4RW9A 3HZEA 4PEOA 4JI8F 1CVJA 1JJ2R 1WG4A 1ZZNA 2XNRA 1FFWB 1MWZA 3J7AN 2CQ2A 4ZOSA 3Q8SB 5B08A 2HMIB 4KB7A 3BQ0A 1K0TA 1D1UA 2MYFA 2I0XA 2WVCA 2JFKA 3LW5C 1SC1B 3DGPA 4B9VA 2I2YA 2EC0A 2ZE2A 3OQ2A 4ER8A 1PC5A 2V9KA 1RAOA 1H74A 2DPJA 1IUJA 1A9NB 3IXQA 1SVDA 3UO0A 2HNDB 1LW2A 4DV2J 3DLJA 5SZTA 3J7Z5 1WC0A 4ZIVA 2RJZA 2OPSA 3EVOA 3GYNA 3W3SA 4A48A 1U0HA 4OYPA 1R0AA 1RHKB 2IBKA 3B78A 3SYZA 2Z4PA 5F9NA 3G82B 4XIUA 2ZM6F 4K0KF 3T6JA 2VFRA 4DV5F 1NAQA 1HW9A 1SIWB 1CLFA 1Y3JA 2RNEA 1FKOB 1FKPA 1H72C 3HVWA 3I4HX 4BC7A 4HYKA 3E3XA 3UI3A 2HGLA 1U2FA 4C3LA 4OJHA 1ZS6A 3C6TB 1U45A 4LJMA 4CH7A 5G0RB 4YB5A 3G96A 1EIYB 5KT6A 4LSLA 1N6QA 4X4UA 1X5PA 1J5EJ 2R9LA 2BANA 3M2UB 3NNAA 3MFHA 2L3MA 1UVNA 2DNNA 3KFWX 1D9FA 2CNNB 4IYQA 1HMVA 1U2CA 3K57A 1SL2A 3U27A 3W2WA 1TR0A 4U67Q 2QA4S 4USJC 3CJ3A 2NQPA 4C98A 3LPEA 3CDEA 5K8MA 2KT5A 4R8UB 3CO9A 4NZ7A 1RB0A 3SQGA 4PPDA 3RBEA 2KM8B 1IKXB 3R5CA 2HK2A 4OI2A 3SFUA 2F8EX 4X4QA 2HYIB 3ENQA 2V2ZA 3M9NB 3UDEA 2YWEA 2XYGB 4ECSA 1S7IA 1FRMA 1C0TB 3OBIA 1K44A 4BWJA 3GSIA 5HROA 5JVHQ 3D28A 3MPVA 3R1HA 2Y8WA 4DSFA 2WW4A 5U47A 3QRRA 2R7SA 1ZAXA 3GYGA 1ZAVA 1BMQB 1UVJA 3MPWA 1IJFB 1JLEA 2ZNZA 2ZJQQ 2V2VA 4B3RF 3TJ8A 2DIUA 4IFYA 2JEJA 4O44A 4LF9J 4QW8A 2YPZA 4MKYA 4ZITA 1GT8A 1MU2B 2HHTA 1VBYA 3PM9A 4R5PA 3ULHA 2D3ZA 4MAKA 3DOLA 1S9EA 3D4JA 3TRGA 1VIXA 2C3OA 1QSYA 3Q2TC 2LCWA 3KJNB 1N34F 1VQKS 4ETZA 3CJ8A 3CJ4A 2G4BA 3B82A 1YLXA 3V4IA 2JZ5A 3OXGA 2V4RA 2MXYA 4CLLA 4P71A 1PYTA 1HPZA 3IWNC 4P2MA 1YTYA 2ZH4A 5F3ZA 4OHZA 3PW2A 2V8GA 2CDRB 2Z57B 1B0VA 2NXUA 3IR6B 1U1NA 2Z58B 1I51B 4P2XA 1K1QA 3W8GA 1PO6A 3MAAA 3DOMA 2NZCA 3KOAA 1X4FA 2LU2A 1AXQA 5IV3A 3W2VB 1SV5B 1TKXB 3UDLA 4LFBJ 1O6XA 2O3DA 4IRDA 1H73A 4K59A 2DITA 2EPIA 3MECB 3AQPA 2AEFA 2EC2A 1OPZA 2XSJB 3D2WA 2FHKA 3H40A 2ZH2A 3QO9A 2LYVA 5L9NA 1HQUA 4WP3A 1FESA 1NBEB 3AH6A 3KHLA 3PCOB 4HACB 1WC6A 3DMJA 1LFPA 4J9MA 2C2DA 1RBLA 2CPZA 1KC8T 4JV1A 3QYYA 4DV2F 3CCSS 4NA2A 2GZOA 3DRPB 4ILRA 2B6AB 1JLCA 1Q8IA 2MQPA 4OYOA 2MZ1A 2HWTA 2QL5B 1F5CA 3BGUA 5I42B 4PXBA 2XI2A 3OHBA 5F9LA 4QYZK 4F04B 4I6WA 3KJVA 4C8LA 2GAHC 3PHTA 4DZDA 2NSCA 4ZP7A 1RAHB 3V6JA 2VQFJ 2UXBJ 3ONQA 2XTJP 2ZOFA 2VG6B 3UCZP 3N0VA 1D9DA 4B17A 4JI1J 3SEOA 3T3FA 4BLGA 5H9EK 1S5ZA 2DGWA 1J5EF 3K17A 2VDIA 2VG7B 2B4UA 3MD3A 1TL3A 4UTGA 4C8ZA 1WHWA 2MGZA 4P7VA 2HK3A 5KFQA 3GFZA 4ECZA 4O3NA 1KSPA 2PFDA 4F7VA 3HD1A 2KM8C 1M5OC 1CJTB 3NGSA 2OTLS 2Y1IA 2PD1A 2ZBIA 4ED4A 2QA4G 3MPUB 3OJUA 2BM0A 2VC0A 3GR1A 1WEYA 2AGOA 2KRBA 2Z56B 3HZGA 4Q8FA 4CNZA 4ZN3A 3UN2A 4C7QA 2OPRA 5HMXA 4Q0BA 3L7UA 1S0NA 3V6DB 2FY1A 3CCLS 2B9YA 4G1QB 2PT0A 1VC0A 2UUWA 2V2KA 4DWIA 1VRTA 3RRKA 2ASJA 3ADAC 2MMYA 2XQCA 4I69A 2PE8A 1LNQA 2KU7A 1D8YA 2VF3A 4CI0B 4LF9F 1X31C 4CH1A 4JUZA 3DXBA 2HVDA 1FJCA 4Y6IA 5DM6Q 2XLIA 2AQ4A 1RSCA 4XK8C 3P4UB 1TELA 3TAQA 2JLGA 1QUPA 1OO0B 1EETB 5K9FA 4OLOA 5LSOA 1REGX 2A1BA 4DJBA 3RAQA 1S7HA 1JKHA 3MEKA 4B9LA 3TVZA 1GNKA 2JH3A 3DC2A 1L3SA 4UOHA 2IY5B 5E3PA 1YIJS 2IA0A 4PXDA 4OJ1A 1S1WA 1DQAA 3FUYA 1WC3A 2GS8A 2BXJA 4ZCMA 2FGCA 2H5JB 1TK0A 5KFPA 2EFPA 2ZUGA 2YX1A 3GILA 4A46A 2WHOA 1AUDA 4JV0A 4RBUA 5EHHA 1RT5A 1FWKA 3CCQS 5IXUA 2OLWA 3E01B 2FGOA 4LFBF 5T14A 2BQUA 4QOTA 4G3IA 2L08A 4PWDA 3DI6B 1C1BB 2VOPA 2MQMA 2AGPA 4LF5J 4JI2J 3GE9A 3KUEA 1Q8KA 4CWBA 5CYMA 2CXEA 4TN2A 2XB2D 2MQLA 4JV2A 4O3OA 1K8AT 2DYAA 4HHUA 4JI7J 3DLEA 5F0UA 2HNYB 1CJVB 4B3SJ 1SBRA 5C5JA 1VYAA 3TUIC 5KAKA 1RHUB 2KG0A 2W9CA 2IAJB 4P73A 4KRWA 5B7WA 3HT3A 4WE1A 4QQBA 2XG8A 3KK1A 3ZFVA 3O5TB 3GIMA 3M8YA 4D3HA 5B0FA 1NKBA 2QRRA 3IRXB 3D3CJ 5IT4A 4KC5A 4F2SA 3MM8B 3HFVA 2CQ3A 3GZ7A 3RG6A 3C2PA 2VQFF 1E6VB 2UXBF 5DDQC 1X4BA 1WG5A 2HHVA 3IWXA 1NSQA 4OI1A 3LO3A 3OR1A 4ZVEA 4JI1F 4RR5A 1RAFB 1OWXA 1OY9A 4ZJQA 2CQIA 4OYMA 1S6QB 1PGZA 2K8GA 5ETTA 3CC2S 3I82A 1S9FA 2HVHA 1QTNB 4HTJA 4KPCA 5D3GA 5L1LA 5GMEA 1SI9A 1BWVA 1FE0A 2FY8A 1TL1A 4QWEA 3RGIA 1FRIA 3POTA 4J91A 4NL5A 5D78A 2AJ2A 4OX7A 4RWWA 1FHTA 2XEXA 4DV6J 4NLYA 3J7YI 2J9DA 4TU9A 2HNZA 3L7OA 5LM7E 1B70B 2K1RA 2BOAA 5A8KA 4DCPB 2BJEA 4Y28C 4DL5A 4ITSA 3QGIA 2ZZNA 4M5LA 3DRRB 2D1CA 1FKAF 2OSRA 5AE1A 4GO7X 1G6BA 3ELHA 2PI4A 4DL4A 3W5XA 2D3UA 1U48A 1SJFA 5CXTA 5M2UA 3QIPA 5KFDA 1TV6B 1RABB 2MPUA 3LP2B 2E7XA 3IAS9 2EFVA 1X4CA 3H59A 3BO3A 1S0OA 2ZVSA 2B3TB 5BXIA 5LJ3Y 4F3MA 2KFYA 1KWMA 1NKEA 9ATCB 2LXFA 5T7LA 2FPHX 3RW7A 5KFNA 4ECTA 5KFCA 4OIXA 4IO1A 4TY8B 1FRLA 5LSLA 1S77D 4N5SA 4DSKA 5G4DA 4GO5X 2M8HA 4ENOA 1JLEB 3NS7B 1WC1A 4GVBB 3PW4A 1N5YB 3N01A 3NEKA 2D69A 4H4MB 1EQMA 5F8GA 2CQDA 3HVTB 2GMJA 3FEXB 4OJGA 1TUGB 2YNHB 4PG4A 4FF2A 1VQMS 5KFMA 2DK2A 2YQ3A 1CS4B 2P9CA 1KQKA 4Q43A 2OSQA 1B99A 1KVIA 5DM7Q 5A6PA 2PDAA 4OLPA 2GJIA 2X3GA 4NLGA 1HNVA 3KHRA 3ICLA 1B7YB 3CWJA 1JLBA 2BA9A 1T11A 1QE1A 4LF5F 4JI2F 1HBOB 2BYCA 1FE4A 1RT2B 3LAKA 3ETOA 4DN0A 2AJ1A 2CNOB 4QR1A 2UUCJ 2ZUAA 4JI7F 1P27B 4B3SF 4ICLB 3G6XA 2YTCA 4OYBA 2DNZA 1S1XA 4I68A 4ED8A 4GC7A 2C2RA 1WI6A 1GEHA 1S1TA 2KT2A 1AFJA 2WVBA 2H65B 2FZKB 1FJEB 3I9V9 4PUOB 2G1HA 4DPWA 4J90A 1XMBA 3LAMA 3I0RA 3H2VE 4F4XA 2CPYA 4DF8A 2Y8YA 4LIWA 2CADA 5F0WA 3FKBA 3I9ZA 5D4NA 2JLFA 1KDNA 2IPOB 2N7CA 1RT7B 3V81A 1F3VA 1TP7A 1VS3A 4U7UD 1OY8A 1N5TA 2XO6A 1U6BA 2AZ3A 4FKXA 2AT1B 2NXEA 1NDLA 1AB8A 2C28A 4YR0A 3TP2A 3T19A 3ZZTA 5J2QB 2V94A 1Q95G 3G8QA 2W25A 1KLMB 3BQ2A 1IKYB 2Z2YB 2PA8D 2XMUA 4LBPA 4MK9A 2VODA 2BW2A 3DYAB 2VC1A 3MMAB 5HBMA 3KNAA 4U96A 3DOKA 4CO5A 3MUTP 3CJRA 4FYYB 5HAOA 4DV6F 2CPDA 3RJMB 1UKUA 4A8YA 3BBFA 2DIVA 2OP5A 3O6QA 3OTOJ 2QGFB 2DO4A 1UVLA 3MM7B 2GO9A 2GMHA 2FVRA 2YWHA 5KG1A 2POKA 4C6AA 3OL7A 2W8LA 2BRKA 2BR0A 3OTCA 5IQQA 2HHPA 3DLBA 3UR0A 2CA9A 3BF4A 1B4SA 3QJJA 3PRVA 4F2RA 4F4WA 2DTJA 2DNHA 5HLFB 3FBBA 4ZJLA 2DXFA 5IFMA 3OTDA 2VBZA 3PX0A 1FX4A 4GMKA 1RTDA 3BS9A 2ZZMA 1M5HA 1SKSA 1P6TA 2BJ7A 3TZYA 2RMLA 4DUYJ 1NDPA 3MMCA 3MHYA 2RS8A 5AE3A 4WKYA 4I2QA 3HPOA 1RE1B 3VQTA 2KVIA 4CLSA 2DRAA 1U26A 4TQSA 3PRDA 1BY9A 3W9IA 3LWLA 1S1UA 2HVIA 1YSJA 2JVRA 2BUNA 2GVDB 2WCXA 4A8OA 2MKSA 5AXKA 3H42A 1KRPA 1IBLJ 4ZN1A 3SMZA 1OYDA 2JC0A 1MROA 3AD7C 3G2XA 1Q86T 1GH8A 2I1RA 3TAMB 2XS2A 6FD1A 3JTPA 4IDKA 3EUNA 3IFEA 1MLAA 2IDLA 5E33A 3WIUA 3ET6B 2XMKA 3CCVS 1TL5A 3T6BA 2QLFB 1LK7A 2JWNA 5E3CA 3UD3P 2QA1A 4NLXA 1BD6A 3R5DA 2UUCF 1UPPA 1FDDA 1WF2A 1DLOA 2YH1A 3AAWB 3MI7X 4JV5J 1Z4UA 1CSJA 2RDDA 4X4NA 4Y2MA 2DGVA 1XR6A 4P10A 2GFFA 1RT6B 5KFIA 2HHXA 3T41A 3OT9A 3FQKA 3W5ZA 1V9OA 3ZZ0A 1T9YA 2H4YB 1XWLA 4LSZB 4U95A 1NPKA 1MWYA 1R8PA 1Z2LA 2HFUA 4NLOA 2XMWA 2UZAA 2ACYA 1GMUA 5CH7B 2APOA 3GJTB 1M0SA 2FVSA 4C8OA 4PKDB 5LMUJ 3SQOP 1SIZA 1SQFA 4XAKA 3TR5A 2UXCJ 2QEXS 3L9ZA 2HEKA 1GX5A 4QWCA 4ED0A 1QAJA 1SC6A 4N41A 3G71S 2QLJB 4ZHRB 2ZH1A 2HAFA 4DCOB 2JEGA 1LQ9A 3DLHA 2MQ8A 4AL6A 4C9DA 1RXOB 1GMWA 2X51A 1U02A 1HBMB 3MCOA 2HQCA 3P5TL 3TVYA 3NAIA 3LH2S 5M2RA 1CC8A 2P5VA 2EWHA 3OTOF 3K58A 1NNDA 3W64A 1JQGA 4LBHA 1Q1KA 5F8IA 4NZ6A 1NRKA 3H25A 1FERA 1ZTTA 4ZVPB 2NPIA 4WBFA 4BDPA 3EGNA 2C2NA 3JQKA 2V9WA 1M5SA 3SV4A 4LF6J 2CJQA 2HGNA 4E2FB 2MY7A 1MN7A 3DRSA 1XERA 3UVJA 3BH6B 3IR5B 3POTB 4ECVA 1FRHA 2VFUA 4P72A 5L1JA 2YKOA 1S72S 5HQLA 1NU4A 2FC9A 4F3QA 1RT3B 2GIQA 2EKNA 2W1BA 4B02A 3IG1A 3SFGA 1FVSA 5A8RB 3K5NA 5J2MA 5D0EA 4ANDA 3BV8A 1VLOA 1JJHA 5F8LA 5CYQA 1T9TA 3X3UA 4DUYF 2K06A 2JLEA 4AQYJ 3OPKA 1F9EB 4RBVA 4CH0S 2UU9J 1NUEA 4ZCKA 3GV8B 3OJSA 1WELA 3UCGA 1OYEA 2Y9HA 3C66A 5T41A 2KXHA 5IM0B 1IM4A 3TO8A 4YDDB 3MAQA 4CM0A 2OAUA 1IBLF 1S0VA 2MQNA 5KFJA 5KFTA 1BHNA 4RO0A 5DDRC 1SH3A 2ZEJA 2CQ0A 2VV5A 3TEGA 3CXCR 1TK8A 5IOLA 1IKVB 3GV5B 2HPUA 4CYUA 1ZAWA 2R8HA 1ZM4A 3M2RA 3HP6A 4WJBA 3FFIB 2CPFA 1NJIT 4AL7A 3Q8UA 3QLHA 2AU0A 5DJBA 2J9EA 4ID8A 1X9MA 3MM9B 2DXDA 7FDRA 3BKUA 2QJ3A 3KJFB 2XHCA 2BRLA 4JV5F 1CJUA 2KZZA 3D66A 2BE2A 1C4AA 2F5GA 3RUBL 1JWWA 5D15A 3FDSA 4UT4A 4ZLNA 3A3OB 3WC2A 4O0IA 4L73A 5L1KA 5J1EA 4KFBA 2EK1A 3JYTB 3KLEA 4HHHA 1RHJB 3BZQA 2LXUA 4C8NA 2CWXA 4XTTA 1ZH5A 4FKYA 3EDRB 2NXCA 1OSCA 1S6OA 2PEBA 3BH7B 1Z1ZA 5LMUF 3VZHA 4ALZA 3SV3A 4IFVB 4RX6A 4DX5A 2Q6CA 2AD9A 3OFEA 2IC3A 2GIFA 5LXYA 3IS9A 3ZTSA 2UXCF 2RS2A 1G4CA 2P6TA 1VQOS 4DSJA 3P6YC 2B51A 5KFXA 1RWWB 4Y2AA 1TKTB 1A7GE 3CCMS 2PMZD 4OV6A 4ILMA 2O5DA 3GTYX 3EICA 4PQAA 4CLKA 2MKCA 1RKJA 2UVUA 4F4AA 4LRDA 2CKWA 2K3IA 3A8JA 4KV8B 1IXKA 3C16B 5KG3A 4WIQA 2DRDA 1P9QC 3DXSX 3L95X 3K2YA 3Q83A 4MIAA 3FGVA 4DUTA 1AYEA 4I2PA 3PIOQ 3UCUP 3M32B 3OLBA 1RZMA 4LFAF 4N47A 2J5AA 5DQGA 1Q53A 1REVA 4LF6F 3QNWB 3LPYA 2DR9A 5C42B 2KXNB 3HF5A 3ZZRA 2GGPA 4F50A 1T8EA 4HTIA 1MSWD 3M4XA 2VBXA 2DNYA 2QA2A 4U7UK 1I94J 5J2NB 1CULA 4PG6A 1OSDA 3NGDA 1F2GA 1RWVB 5KFUA 1TVRA 5ETMA 3UDCA 1NKCA 4CIOA 2P2CB 1FDNA 2VG5B 4F4YA 3BGOP 3QZ7A 2L41A 4LF4J 2FJBB 3JAMU 1JLGA 1KQGB 3ZZZA 3GFHA 4OHXA 3MFIA 3MF5A 2HVZA 1X5SA 4AQYF 3CCZA 2YNIA 3TARA 3BKFA 1XQIA 1AZSA 3K5OA 2UU9F 3ISNC 1R0CB 4GRSA 3T5HA 2C42A 5IV4A 1WORA 3ZNUA 3HHLC 1QSSA 1KN6A 2OEMA 3VAHA 4DLEA 2WTFA 4NLPA 1RDRA 1Q81T 1S97A 3ENWA 2B4OA 2DY1A 3QWUA 2F1FA 3I5CA 1DQ9A 4F36A 4DN9A 4KHMA 4PXEA 3DDIA 1URRA 4F3OA 4LRCA 1BWEA 1R31A 2AJ0A 3BR8A 3B4MA 2J0XA 3A1YG 3GSDA 2KFZA 4QCLA 4YFUA 2RKIA 2GQQA 3M1VA 1SC4B 4OV1A 4OYWA 2AX1A 5F8HA 5AXMA 1V5IB 4K4VA 2LQBA 1S57A 1TKZB 3CJ0A 1G1XA 2IVMA 1YZ6A 5KFGA 2Z0GA 1NLKL 3N79A 4IG0A 4BWMA 1JMTA 3GJQB 3R5AA 2PC6A 2VJVA 3CDAA 1S4FA 2VBYA 3PEHA 4ED3A 2LXIA 4DL7A 2HRUA 5KT4A 2HS4A 3ZO7A 3N9UC 3W60A 1ZM3A 4B3OB 2WSEC 2EFGA 2HAIA 3R2DJ 4DSLA 3VAKA 4TVAB 3U02A 2E1MC 1ULRA 2YKPA 1MMLA 5HMZA 4OYAA 4YN3B 1LW0A 1XTZA 1T9XA 2HFZA 3IC1A 2J7WA 4ZVUB 3IGVA 1YVFA 4DV1J 5KT2A 1RTHB 1SL0A 2FHJA 3GV7B 2YKNB 2V8DA 2CNKB 3D5MA 4JB8B 3AJ1A 2KVQE 1CJKB 2B5JA 2QSFA 1CG2A 3VR1A 4IG3A 1HIYA 6AT1B 5EN1A 3S01A 3IR7B 3HJVA 1BQNA 2CJAA 3D6TB 3FVYA 2G2OA 2QX0A 3BGRA 3NGRA 4XPCA 1IBCB 5HP1B 4C8KA 1NK5A 3EXCX 4I7FB 2DY9A 4ZVRB 1R27B 4CLWA 1BE4A 4ZPBA 3PYEA 2BX6A 3HSZA 2A2CA 4Y2IA 3CVKA 1WKLA 2F4VJ 4USKA 4C3KA 2HMIA 3AODA 1QD1A 2OPPB 3VF0B 4NCBA 1R8AA 4CNYA 1LWFB 5B0AA 2F8MA 1I94F 1ZPWX 4IR1A 3UR3C 1UWAA 4PG7A 4ZCLA 1S9GB 2XLKA 2HHQA 3H0PA 3MMJA 4ZA1A 1RI7A 4V1Ak 1NB2A 3QGGA 2AV5A 4LF4F 2HNDA 2M70A 2DH9A 1HYSB 2R7QA 4UQGA 2BV3A 4QU6A 4PXCA 3ZTOA 2IYIA 5DZ7A 2ZHOA 5D0GA 5LOQA 2VPXB 2IJNA 4TYBA 1NK6A 1JK9B 3PKMA 4CO0A 5IT9Y 3C14B 5BR8J 2XZWA 3EDQB 3GCWP 3G82A 4H4OB 3ILLA 3CJKB 2DCLA 1NK0A 4DQPA 5FDLB 2BKOA 4LQ9A 1Y10A 1FKOA 3BR9A 1UW9A 3MR7A 5IC4B 3NP5A 3PW7A 3C6TA 1TZ0A 5G0RA 2WW8A 3RBDA 4LT6A 2BACA 3M2UA 4PG5A 4G6VB 2A10A 4K50A 4DQIA 4KPYA 4EMDA 1TUWA 1V3ZA 2DGSA 4O23A 4OI0A 1WKJA 2GV1A 3NGTA 3SIPB 5H9FK 3B54A 4O4GB 5A2QY 4OX8A 4RNHA 4R8UA 4O3QA 1FEEA 8ATCB 5KOXA 4WP9A 3RAMA 4OZJA 3Q23A 3J81Y 3RB6A 5K8NA 1IKXA 2JDJA 4S0MA 1HR0J 2R7TA 4CLYA 1S4EA 3NG8A 3IMQJ 2HZVA 1VBKA 4B9UA 2GVZB 2NXJA 3KLVA 1C0TA 2RRBA 3UQSA 1WI8A 3TQ1A 2RHSB 1VQNS 2FYXA 1NXIA 2CYYA 4O0NA 2W2OP 1NJZA 4DOZA 2CPXA 1N5SA 4NXNJ 2N4CA 4URGA 1BGXT 4OZNA 1YKWA 2OEKA 2E5LJ 3W65A 2W7PA 1DQ8A 4PCQA 2V4JB 3HD2A 3FRZA 2M8DB 1MU2A 4OYZA 5LXRA 4B3TJ 4JBCA 2QYGA 4DV1F 1FXDA 5D77A 5E3RA 2AP6A 1DY3A 3FEYB 2DVIA 1VR6A 4Q5VA 2OKQA 2OTJS 1CPZA 1JNZB 1CEZA 5EWGA 2GJ2A 2QL7B 4RW4B 4U7CA 3PJWA 3TJAA 1QJHA 1NSPA 2HFOA 4LF2A 3S1TA 1N5VA 2M2BA 1TFYA 3NOGA 4F26A 3DGVA 3HK2A 1XN9A 2MZQA 1N0UA 3JB9k 2K3KA 3SBMA 1FNXH 1VQYA 2ILZA 2QFIA 5ETLA 5K5MA 4ZPCA 4QIGA 1XMQJ 2WVFA 1G2EA 3KKFA 1JIHA 2L9DA 2ZH9A 1RU2A 4DQQA 3KK2B 2R2RA 2VIHA 3GJSB 3W7BA 3KLIB 1Q4RA 1KFDA 3W2VA 1SV5A 2I9SA 1TKXA 3T1AA 4ECRA 1M1HA 3ZTRA 4NLQA 1YHQS 3B4DA 1FT8A 1OPIA 3HSGA 2F4VF 5FD1A 4ZP8A 3MCMA 3MECA 4ES1A 2OFHX 2XSJA 1UVMA 3M8WA 2CVIA 2NUHA 2DJWA 4Q2LA 4Y00A 4A8SA 2LA4A 4RUHA 2GHWA 1HL6A 4LR8A 3P96A 4IRCA 4HACA 5CQGA 4HI2A 3BPSP 1X0FA 3HHLD 1EP4B 2UV8A 4U8YA 3LGNA 3WIVA 4QW9A 2MKYA 2ACMA 5HJYA 1SJRA 3DRPA 2DISA 2B6AA 2V0NA 4ATNA 1HBUB 4JI3J 3U1LA 5I42A 3T5JA 4FPIA 1XC9A 5BR8F 2IRUA 3AFGA 2VQEJ 3GMGA 4NRUA 2UVRA 4NLWA 2XYPB 2M4MA 2COLA 3N5BA 3BEGB 3CJTA 3MM6B 3VWSA 2HBZB 1TAUA 4ETXA 2FLPA 5E5NA 1JB0C 1DBDA 1OMSA 2VG6A 2F3JA 2HKEA 2ZDPA 1VQLS 2MQQA 2CG4A 2OFGX 3D68A 4YOEA 4I6AA 3UE2A 3KMSA 2BABA 2VG7A 3C15B 4RW8B 1H98A 3JTNA 2IBOA 4C8MA 3VVUA 3CCUS 2PI5A 2CQBA 3GR0A 4WTYA 4DV4J 1CJTA 3T9ZA 4X62J 4ZS6A 1FA0A 2MHEA 4PPZA 2ASYA 2ILYA 3M8QB 2B7CB 1RADB 1HR0F 1S49A 1C1CB 5D0RA 1QTMA 2YQ1A 4A8XA 2B7BB 4FYXB 3MMBB 5C24B 1EX8A 4IQXA 4DHVA 1FXRA 3V6DA 4G1QA 3I0SB 3X1LB 2H5IB 2W2QP 2YKQA 2YXLA 3TANA 1Q7LB 4ECQA 2WSCC 4ECXA 3IBFB 4YQWA 2JJ4D 4NXNF 3SSSA 1IKWB 1OQ6A 4A8FA 3KG0A 2E5LF 2EK6A 4UOFA 4MKBA 4TU8A 3Q86A 3SCKE 5KFAA 1VC6A 1JXEA 4IH7A 2F9JA 1H2TZ 1W26A 4B3TF 2W9BB 4WYLA 3MUVP 4WIIA 4NLUA 1NHVA 4M5HA 2U1AA 2IYGA 2N3OA 2V68A 3G8SA 1N33J 5EDWA 1OIAA 4G1IA 1PC4A 1EETA 4EK2A 5I3UB 1AW0A 2D9PA 4IOCQ 3A12A 1Q5VA 1R8CA 2E1RA 4C11B 1HHQA 4CT9A 1KTQA 3G6ES 1XMQF 4HL9A 4JI4J 2CG8A 2HLUA 4NLDA 4DFPA 4HR2A 4DL3A 2R7OA 4CO2A 2YKMB 4TKTA 4NXMJ 3CIMA 4KGKA 2CQCA 4OZ3A 4AYBD 3H5SA 3IGNA 2W2NP 3E01A 4DSIA 1X4DA 2OGUA 2ASLA 1VBZA 4ID5B 3VVTA 3DI6A 4IOAQ 1C1BA 2BJ3A 3US5A 4LREA 2FVCA 3T1HJ 2FTRA 2N7YA 1PJ5A 4M8LA 2W2MP 2FZCB 1G7CB 1ZPVA 5AXNA 1FVQA 2HQGA 4DV3J 3JQJA 2QLXA 1CJVA 2C2ZB 4BCAA 5HN0A 3THPA 4WZQA 3UW1A 3TAPA 2ERRA 4A4JA 3N4WA 1WD6A 3CJ5A 2IAJA 1MG7A 2KXFA 1NK9A 4CDIA 3M9MB 1DZ5A 1DTTB 2ZBQA 1SJ4P 3VGTA 2HBQB 4JI3F 2QLBB 3IRXA 4USUA 2AYMA 2VQEF 2QN6B 3MM8A 1NMEB 4RZRA 3BGLA 1NJWA 1Y5LB 2WAQD 4F0KA 3CJQA 3MR6A 2VL1A 2ROGA 1IR0A 1Y9OA 1E6VA 1WC5A 2IFXA 1K47A 1S12A 1MN9A 1ZA2B 5IT9U 1QDUB 4DXLA 3BN7A 3A8KA 3EE3A 3R7SB 2A2DA 3VAIA 3FJ2A 3V2UC 3TQEA 2XY7A 1S6QA 3R7BB 2YVSA 4Z7YA 4HT5A 5L38A 3H7HB 3N6NA 2N82B 3K5LA 3W9HA 3RRHA 1HNZJ 2OIHA 3PFEA 1XIQA 2ZHBA 4FYDA 4DV4F 4X62F 4EZ6A 4QZVB 4CT8A 2WBMA 2DR5A 1V3RA 5A2QU 3OHAA 4PAAA 1HNIB 4OYXA 2W4PA 2BKPA 3LP1B 5J2PB 2G9OA 1YBTA 3J81U 5LMNJ 2J6TA 4ZCIA 1NK7A 1MMNA 1LWXA 1U25A 5FJ4A 2Y0SD 3DRRA 3EZUA 4CLUA 4ZK7M 5ADZA 9RUBA 1BLUA 2AWZA 3QFHA 4EBDA 2QIFA 4R0EA 1SUQB 1TV6A 3LP2A 1G3OA 4KAIA 3GPAA 2P9EA 2X1AA 2VONA 4WF9Q 1N33F 2NZ4A 4FNIA 2DNQA 1MWQA 4WWSA 2FZGB 3IWLA 5ETPA 2RVJA 4TY8A 3Q24A 3KNGA 4Z37A 3A3NB 3C3LA 4KKOB 1YG0A 2OPQB 3NMRA 2CJKA 2G13A 4M5IA 3I6PA 1X4GA 4XDDA 2D41A 4OX9J 5KOWA 4GVBA 1N5YA 5IT0A 3W61A 4H4MA 2WOMB 4WXOA 3HVTA 3QRQA 3M2VB 2KHCA 5KFWA 2J6UA 1AT1B 4JI4F 2YNHA 4A8WA 5DGAA 5IC6B 5CZVA 1PJ6A 3DM2B 4MKAA 1CS4A 1XJWB 2D7SA 4LRFA 4NXMF 3ITHB 4DR3J 5HQ8A 1PAUB 1SB6A 1KONA 2XY6A 4DMZA 4O3RA 2R3VA 2R8KA 2G1DA 3JSMB 2BMBA 2XMMA 1VQ5S 2MZTA 2EKYA 4O4RA 2D9OA 2MB0B 3EWGA 1RISA 4NI2B 5E41A 2YNFB 1HBOA 3T1HF 5CD4H 4IH6A 2NSBA 1RT2A 3U7JA 3ZXWA 3NY0A 1X4EA 2VPZB 4N7TA 2EG2A 4DV3F 4WPAA 3BM7A 1W2IA 4ICLA 3L7PA 3FBEA 3HHDA 1SC3B 5BJRA 3MR5A 5GAHI 1UVKA 3L4BC 1FRXA 3EX7B 3D7SB 4YHHJ 4BBYA 2UUTA 5DDOC 3HHKA 2MJNA 3CNQP 1B3TA 2C3YA 5IWAJ 5DG7A 4KO0B 2C2OB 2HURA 3VGSA 4ED5A 1LFWA 4PUOA 4J9QA 4NCGB 4EBEA 5E7OB 1WKKA 4F4ZA 5DZ6A 1OY6A 3W66A 2LU1A 1M5PC 4M94A 4DSEA 1ICEB 1FK9B 2W01A 4K5SA 5JMNA 3LP0B 5KFZA 1RT7A 4FYWB 1O5JA 3ZTQA 3OVBA 3QJPA 1KOOA 4WP8A 3FK4A 3D0HE 4WKRA 2ASDA 2BQ3A 3GIJA 3OL9A 4J7CA 2ZH6A 2HWIA 1HNWJ 1HNZF 5J2QA 4HI1A 4HH0A 2ZBPA 1KLMA 2NYIA 2MLZA 3OUYB 1IKYA 2A0FB 3MR2A 2ZOMA 4ELUA 4N56A 3OD2A 4IO9Q 3DYAA 3QQCD 2CJXB 3KJQB 3MMAA 4QYZJ 4B08A 4PR6A 2LECA 1N88A 5DDPC 3KHHA 3RU0A 3NS5A 3NXZA 1F6TA 2C2MB 3LWMA 1R3NA 2XGQA 3G6VA 2NPFA 3MM7A 2VJUA 2FJVA 5H9EJ 1H2UX 5LMNF 2JL9A 1HWJA 4Q45A 3DKDA 3ILJA 4DL0C 1FD8A 4CLPA 3F41A 3V6KA 1KP6A 2BJ9A 2MKHA 2Q1LA 1NJYA 3FSYA 4FVMA 5KG4A 4KY3A 2PO4A 2VOOA 4EWTA 2KHDA 3UNGC 3M8RA 5A8WB 3VAJA 1TL4A 1TMMA 4ES2A 2KYZA 2LMIA 1OS5A 4UUWA 5CCLA 5HLFA 2B8PA 1ZM2A 2DNKA 4DQSA 3QMQA 1D8ZA 1ROFA 4CZCA 4ZP9A 2I38A 4EU0A 4AE5A 4TLRA 1KNZA 2IM2A 5ETKA 1U1RA 1CQNA 4C97A 4DPOA 1S76D 1CBKA 3JSBA 4OX9F 3BBBA 4MK8A 1VQ8S 1X4AA 1AA1B 2FD2A 2EEYA 2KKHA 5D4LA 5DETA 3VV2B 3H4BA 1ZETA 3M6VA 2UVVA 4X64J 1O51A 1YQHA 2HLTA 4AUKA 2HW3A 2CUYA 2XY5A 6FDRA 5A0YB 4JOUA 2L9NA 1T9UA 2GVDA 4DR3F 5AJ3J 4KBIA 1FTRA 3NKYA 3OTEA 1LWCB 3B6BA 1HWLA 3KLFB 3T5LA 4O3SA 1T02A 3M8PB 1BQMB 3DLLQ 4DG1B 2ZZTA 3VCDA 2VFTA 2H51B 1W2BR 3TI0A 4NEYA 2Z30B 1U8WA 2DGTA 3TAMA 3QWPA 3O44A 2ZKUA 1HHTP 2MZSA 4ZVOB 2YY3A 3ET6A 1U09A 1LEOA 1EZZB 1FF2A 2NCKL 3RR7A 4ZVTB 3HDSA 4ZPWR 2IA6A 1RWPB 2F63A 4UY8T 3W8PA 2PFFB 4DPTA 2OJ3A 3MEEB 2WK4A 4F0MA 1WJ9A 1F60B 1RQ0A 4ZIWA 1RUSA 3BREA 1NK8A 1R6VA 2RHQB 1S79A 2G2YA 3I96A 3PXGa 4GVLA 3RRGA 4QPXA 3BJYA 1RT6A 3OVSA 4YHHF 1HA1A 4RBTA 5KG6A 4PWUA 1JLAB 4ECWA 5IWAF 3AA8A 2V34A 3DDNA 1ZTWA 3V6HA 2AGQA 2CWKA 1RTJB 1UMJA 4EYIB 4H4KA 5F8JA 4RUAA 3DLGB 3PHEA 4QR2A 1FEHA 2I8EA 1T9VA 1K1SA 3DFEA 3ISZA 1Y5IB 2LVWA 2LQJA 2CZ9A 3HM9A 4PABA 4OFZA 3K7RA 4FDFA 1HNWF 2HFVA 5D0HA 4CTAB 2DHHA 1JX4A 2JFDA 4DS5A 3UD4P 3OR2B 4ZHRA 4B3MJ 2R42A 3DRYA 4MIBA 4I56A 2ZITA 3I4PA 1HBMA 5CAAA 1I3OB 1YRXA 2RRAA 3TNVA 4F8RA 1KQSR 2F65A 1FWPA 3KLGB 5F41A 3IA0A 2ZH7A 2LEBA 2DNOA 3RYLA 3BO4A 2CPJA 2XS5A 1RACB 3VAMA 1RLCL 1M5VC 2OH2A 3DLKB 4DUZJ 2CZ4A 2CDQA 3HFZB 2B4VA 2IM3A 2R7VA 3HHNB 4NA1A 1D9AA 4DZ6A 1H7WA 3CJ2A 4W90B 1FNMA 4J9OA 2DB1A 5KG7A 2R8IA 1FRKA 3Q2SC 3ETMA 2MZJA 1RT3A 2R8GA 1TMJA 2D3O1 3EM1A 4WXWA 5A8RA 3PO4A 4RKUC 4X4TA 1EARA 4WTOB 1S59A 3CULA 2HHSA 2IMOA 3HXMA 3TX0A 3UPFA 3DCAA 3PFOA 1VQ7S 1OJ4A 1DJ0A 4X64F 2RF2B 2W7OA 2HHHJ 4L76A 3AD8C 3AB2B 2J7UA 1S6PB 2C2EA 1J27A 3THTA 5CD4A 4ZMMA 4Q2MA 5IM0A 5AJ3F 2OMLA 4EBCA 3PEJA 2RQ4A 1M90T 4ECUA 4P6QA 2JNJA 3FRYA 3MAHA 3ZZYA 3AQOA 3AHPA 2RU9A 3KG1A 3FNNA 1IKVA 4QR0A 4UZCA 5H1SV 3H2UB 1LOUA 1WHVA 2C3UA 3M6WA 3FFIA 1UA0A 4OZ0A 5K14B 2BE9B 2HIQA 3BO2A 1UEVA 1RAGB 2J0QD 4RNNA 4OI3A 1KLNA 3MM9A 4MK7A 5EX0A 1U8SA 2CQ4A 3HHEA 3M7VA 3QAUA 2BBEA 1B7FA 3EGZA 2J9CA 1WSRA 4K5RA 3LA0A 1H0HB 2E9RX 5MAOA 5GAHU 3SCLE 2ZDOA 1Q0NA 3I5BA 1NHKL 2RUSA 1RTZA 3JYTA 1EKRA 5SUHA 1WOSA 1B0PA 3VHQA 3SI8A 4QIEA 1DARA 1TAQA 4HDGA 1KFSA 2ZHAA 3LGMA 1VDHA 3RBXA 4YEAA 2YNGB 3R6LB 4ELVA 4DPYA 4IFVA 4OZ1A 3WZ0A 3G87A 4USMA 4NLVA 1RJJA 2QO3A 3BDEA 2VASA 2J6SA 4PZVA 4KH1B 3HJFA 2GHVC 2XWYA 3BGFA 2U2FA 3PV8A 1IVZA 4OL8A 1TKTA 4CQ1A 1UWBB 4G65A 2A6MA 2HG4A 4B3MF 4USHA 2X1FA 4M5JA 2VKRA 4FF3A 4ZPAA 3CMES 2FJDB 2YBVA 2GHPA 3EGVA 1RT1B 3I32A 4KV8A 3O8WA 2J76E 3C16A 2ZOGA 2M52A 3FZBA 5DRKA 3I87A 3IP0A 4K4SA 2IRXA 2Y0BB 4DR2J 3NBPB 4W92B 4LRBA 4MYUA 3LTOA 3M32A 4ZLJA 3PYDA 2ZH8A 4ZVHA 5HQMA 4DUZF 1Y11A 1PBAA 1A0OB 3QRPA 3JSRA 4RLEA 1S1VB 3OSNA 2LDYA 2BKNA 4HVZA 2EG1A 5C42A 4YR3A 3J80Y 2K7JA 4QBUA 2BOPA 3CMAS 4P2FA 2MJUA 3UDVA 2UUAJ 5J2NA 4N8OA 4JI0J 3S7RA 2IDEA 3NLCA 2ZD1B 3WQPA 1YI2S 1HQEB 3M30B 2AMCB 5DG8A 3GIKA 3UD5A 2VG5A 1RHMB 3MEGB 2GAGC 4V19X 2CJBA 1Y3KA 3AXKA 1IM6A 2OUGA 4FBUA 4OMFG 1H7XA 2E9ZA 2LEAA 3KK3B 4DX8H 4OHYA 1QY7A 1SKWA 4NYPA 2I5JB 3HX9A 2HHHF 1X8DA 1PIEA 3NCPA 2B56A 4FXWA 3Q22A 2KZMA 1WNEA 4X65J 1FJ7A 1VQ4S 3QSYB 3JAMY 1UZHA 4K4WA 4OZ5A 2DKOB 1VOMA 2XGPA 4UUXA 2FLLA 2RSQA 1C0UB 3GCXP 4DU7A 4ED1A 3KWMA 2KL8A 3P8BB 3G6YA 1TQLA 2GO8A 2CJ9A 2QC3A 3M05A 3H8YA 4RPFA 2VB6A 3VGVA 4P7TA 4X4PA 2WBRA 2ZC4A 1FJGJ 2KDOA 5EGYA 4B9TA 4X4VA 1RT4B 3DN9A 1TKZA 4MFBB 2VUGA 2FJAB 3Q8RB 3CSKA 4GC6A 5HVFA 3PZPA 4NA3A 4RW6B 1T05B 2XZTB 1ACMB 3AY0A 1J5OB 5KG5A 2DEIA 2L9WA 3TOQA 3BSAA 3PR5B 3G8TA 3MEDB 2HS3A 1WTBA 1HBNB 4KGZB 2XWXA 3JTOA 1IN0A 1UJ5A 3PJ9A 2IJRA 3QFWA 1NJXA 2AYGA 1TL7B 1I6JA 1RBAA 4B3OA 4DLGA 2OMOA 3HKWA 2W7AA 4LSNB 2KB2A 1E6YB 2GA7A 1QVGR 1Q8BA 4LF1A 5C25B 3K5MA 3BSOA 1S0MA 2GCFA 2H4WB 2X1GA 4CCHA 4QIVA 3OV7A 4FXDA 1UAWA 2QE5A 3QGHA 4PYDA 1RTHA 1K0VA 1SH2A 4UF4A 3CPWR 2ALYB 4OZ2A 4WFXA 1VJQA 2YKNA 1GMWD 2DNMA 2V8HA 1CJKA 1ZYQA 1U1PA 1C4CA 2OO4A 3SDEB 3H20A 1S99A 2HFNA 4UY85 2QFJA 4ECYA 2DT9A 1QSLA 2AYBA 3QAEA 4ELTA 4TYAA 1MW7A 2MLXA 5DGBA 3C6UB 2JOQA 5HP1A 3A4TA 4DU8A 4I7FA 3JQMA 1YRTA 5HO4A 4BC9A 3JXOA 4DR2F 3BKTA 1FX2A 4AXIA 2JRSA 2ZVIA 3QPIA 4LF8J 3RAXA 1RAIB 1H2VZ 4HH1A 4ZVFA 2LLZA 2YPYA 1T7PA 4NYZA 3FSIA 4HHJA 4DDFA 4WZMA 1NH7A 2OEJA 3MPYA 3OFGA 4E98A 1X9WA 4AFFA 3MOJB 2AHOB 1TUVA 3I31A 3DHWC 4J9LA 2OPPA 4USIA 2FB0A 2V50A 4KHRA 1JLQB 1LWFA 3CGIA 3CMQA 2UUAF 2O01C 4JI0F 1S9GA 3D1HA 3KLHB 1RA6A 3F0NA 1ITPA 1LWEB 3E51A 5DO2A 3H98A 3EZ5A 3P45B 1UEKA 2AX0A 1NO8A 1BUXA 1T9WA 4Z7CA 4R25A 1HYSA 3A8IA 2KI2A 4M95A 2DNPA 3GFXA 5DLGA 1VRQC 2X7IA 3B8HA 2NYHA 1X7VA 2HRTA 1VCTA 3C14A 1NK4A 1DTQB 4FN5A 2RDIA 1R6YA 5CHCB 5K20B 4H4OA 1F5AA 5E3AA 3K5PA 3D3BJ 3CJKA 4X65F 2RQCA 4KIAA 5FDLA 3TW0A 3ENAA 4IUFA 5LL6d 1WUUA 4ED6A 5KT3A 4N76A 1DFDA 1U1OA 4MIWA 1HLWA 1VLYA 4DPXA 2E1AA 3TUZC 3GIRA 3BB5A 2PGCA 4ZVQB 5B0DA 7FD1A 4M5DB 5KFEA 1FJGF 3UN5A 2DEJA 3CC4S 4L3KA 1T03B 5JXSA 2FJWA 5K8PA 5KFSA 2HRYA 3PNIA 4O4GA 4U6PA 4F4KA 3FC9A 2R7RA 2W4DA 2VPYB 4YY3J 3U1NA 5CCMA 4QWDA 4KT0C 5CA5A 4K4UA 3HHLB 1H6KX 1RGVA 1WHYA 2Y3YA 2P9GA 3IM8A 3QZ8A 4Q8EA 5CYJA 2GVZA 2XO7A 4F02A 2E5JA 5AE2A 3A8EA 1RWKB 2CQHA 2ZWPA 1HI8A 2IVFB 4AL5A 1DAXA 3R97A 1R0BG 2E44A 5CABA 1JJ4A 3QT8A 1UJ6A 1VJWA 5L1IA 2AJ4A 2RE1A 4NMXA 3PW0A 2O66A 1JLFB 2V4JA 1RTIB 3MWBA 4C0HA 2OD6A 3FQLA 1H3DA 2WONB 3GJRB 1WG1A 4RJVA 3HT0A 4KYZA 4RW7B 2CQPA 2AIRB 3M8ZA 1XNQJ 4MTPA 3H5UA 3SCJE 1YJTA 3GIIA 2D3OR 4RW4A 3U1MA 2B9XA 3D67A 3WBZA 4NMLA 4DQRA 1NSAA 1P9YA 1U0SA 5KFHA 2J9DE 2H5EA 4CLTA 1WDTA 1VHIA 1FXLA 2EBGA 2ZJPQ 3RR8A 3O3LA 1TFWA 1UFLA 4I67A 4RWXA 3PW5A 2YWWA 2ZKTA 2NXNA 1B0TA 5HSPA 3KK2A 3D1OA 3K89A 3KLIA 3H90A 3R3TA 4LF8F 4YR2A 4FBTA 1JJCB 3IBCB 1R8BA 2XLJA 4USWA 3P49B 1WEXA 3PTWA 1Y0HA 2XMAA 1VRUB 2AYEA 4IR9A 1Y7PA 4YS2A 3PDNA 4WFNQ 4C3MA 3N28A 7AT1B 2A6OA 3BSNA 3C8YA 4DPUA 4ED7A 3ENVA 2DNGA 4PQUB 2Q79A 3J80U 4NRTA 3NL0A 4LR7A 2DCUB 2MDAA 2DD8S 5GAEI 3CD6S 1EP4A 1JXVA 1IWGA 4U9RA 1EKSA 2IJFA 2RH3A 1HKAA 1NDCA 4DR1J 4RW9B 5C7PA 2QMXA 4Y65A 2GIRA 1UVIA 1GXTA 2F8HA 2XCPA 2EXUA 1HBUA 5BYSA 1P1TA 4IH5A 2ZNYA 3GP9A 3FMBA 3FCVA 2C2KB 3GLJA 4J9RA 3MM6A 1ELOA 2UUBJ 2XC9A 3I5AA 1FTCA 1Y4ZB 3DGPB 1LKZA 3CO0P 3MPDA 1F3FA 2ZE2B 3Q8YA 4DR7J 4CM2A 4MH8A 4Y2CA 2YKAA 4EO6A 4C2MA 1LW2B 3C15A 4RW8A 4TQRA 1NCLA 1QAYA 1VQPS 4QIFA 2OPSB 5GMDA 5JJBA 2DH8A 5LSRA 1U0HB 2XZDB 2A3JA 1R0AB 4XDCA 4CLFA 4YY3F 3TA2A 4C48A 1EB0A 2VFSA 3M8QA 2HBYB 4FNHA 1Z2ZA 2I6WA 1C1CA 2HQDA 5K8OA 1J2VA 3AOBA 3Q8QB 1RYSA 1FKPB 3MMBA 5C24A 3SSRA 3RZAA 4EYHB 3N6LA 3F44A 1GMVA 4V19J 4CP5A 3CT9A 3I0SA 2FHJD 1HD0A 4MYTA 2LA6A 4LSLB 1N6QB 1IKWA 2BANB 2FHOB 1S10A 2MEWA 1F1BB 2DGQA 2HQIA 3K8VA 1GFWB 1HMVB 1XNRJ 1RK8A 1N54B 4F0HA 2MTLA 3W2WB 4A8KA 1PAEX 3JSYA 2MKIA 4TLQA 2W9BA 4YB7A 3RB4A 3H5XA 1U7LA 3T5KA 3CF5Q 3GFYA 1T3NA 3SQGB 3TA0A 2RT3A 1WF1A 4YDXA 1XNQF 2SXLA 1OQ3A 2HZCA 5I3UA 2DGXA 1NM2A 1UL3A 2KTQA 4C0BA 1U6ZA 5AXLA 5HROB 2YWKA 2YX7A 3H4DA 2HBRB 4C11A 2VBWA 4ZKAA 1YGYA 2ABYA 2PSZA 4RU9A 2F9DA 2OHDA 1SKRA 2QZ8A 4URSA 1L3VA 4WFZA 2Y1LB 1VFJA 4IFYB 4O44B 3R5GA 4EZ9A 4LFCJ 1TU0B 2IMWP 3EPIA 1EQ0A 4R5PB 2YKMA 3QATA 3M8SA 3DOLB 1S9EB 1UA1A 2RAQA 4NE9C 3KYLA 1PKUA 4J9UE 3V4IB 2AF6A 4E0DA 1HWIA 4ID5A 3CJSA 1UTAA 2VD3A 4DBQA 4QWBA 3ILOA 2G0CA 2XULA 4URQU 1HPZB 2DHXA 2V8PA 4M63A 4EO8A 4Z2XA 5J1NA 3LF0A 5KTQA 4M5GA 5B0EA 4L3NA 4L75A 4J9NA 2C1EB 2DHGA 2BJDA 3D54A 1IWAA 3AB4B 2Z2MA 4X4SA 2CQ1A 3MAAB 4DR1F 3DOMB 1U47A 2MSTA 1DTTA 4F25A 2H48B 3D0IE 3RTVA 4ZVGA 2Y1JA 1IBKJ 1QAIA 1NPRA 3AJDA 2DR6A 5D6GA 3NMAA 2GQCA 3KHGA 5DS7A 2QLWA 2ROPA 4IQMA 3O2IA 3EVWA 4RUCA 2UUBF 2BM1A 2MLYA 5L8RC 1LK5A 2AEMA 1YJRA 3QO9B 1HQUB 4DR7F 3SXLA 4IKAA 1VHFA 2OI2A 3DMJB 3AD9C 1CC7A 2E29A 2V67A 1T94A 4P2SA 2DNLA 4I64A 2HVEA 1JLCB 2QSWA 1SKUB 3FEZA 1RWMB 1N4LA 1D0EA 3OL6A 5ETRA 3PG9A 4M5NA 4ZVSB 2VHGA 2RILA 1VQ9S 5E0OA 4PG8A 3KJVB 2JSXA 4HLBA 2BJ8A 3BQ1A 3C46A 1YJUA 4DL6A 3WC0A 1KHWA 3KTQA 2ATLA 2MSSA 1HNIA 1GTHA 2IIHA 2IHR1 3LP1A 5DG9A 5J2PA 2QG9B 2ZH3A 3MTKA 2Q6BA 5KFRA 2XNQA 1SH0A 3PX4A 3E2EA 1NH8A 4I0WA 1Q79A 3DNCA 4OQJA 3PX6A 1TL3B 1M1GA 2MGZB 4CO1A 1UETA 2ADBA 2MZRA 4X4OA 1SUQA 1XNRF 5H9FJ 2L48A 5KT7A 5D8HB 1R7IA 3TA1A 4YUDA 5ETVA 3PR4A 4Y2KA 5HMWA 3NCQA 3PRBA 4TY9A 4Y34A 4BS2A 4KGXB 4D3GA 1PBUA 2KRRA 5I3PA 4MJKA 2RB7A 4HDHA 1IR2A 4Y3CA 2HHWA 4QWAA 2XYHB 4KKOA 2OPRB 2EW9A 2OPQA 4Q0BB
chains in the Genus database with same CATH topology
2CKWA 2K3IA 3I96A 3PXGa 1N8RT 3RRGA 4KV8B 4QPXA 1IXKA 3LQVA 2YWGA 1SJ1A 1R0AA 5KG3A 3BJYA 3OFFA 2R8JA 4FPRA 3CEDA 1RT6A 2IBKA 2A18A 3B78A 3NGKA 3OVSA 3Q0AA 3SYZA 4YHHF 1HA1A 1VRTB 1P9QC 2Z4PA 4RBTA 3DXSX 1O8BA 3L95X 1RWUA 5F9NA 5KG6A 4XIUA 3K2YA 2ZM6F 4K0KF 3T6JA 2WOMA 4PWUA 2VFRA 3MGJA 2Q66A 4MIAA 1JLAB 4DV5F 4ECWA 1NAQA 3LOUA 5IWAF 3FGVA 3M2VA 1V6HA 3AA8A 3CDWA 1HW9A 3DDNA 4I2PA 1KHVA 3V6HA 2MY8A 1ZTWA 2R2SA 1SIWB 3PIOQ 2AGQA 2E7WA 2DR7A 1RTJB 1UMJA 3UCUP 3F56A 4EYIB 4H4KA 1CLFA 3M32B 1Y3JA 2RNEA 1FKOB 2VA2A 3OLBA 1FKPA 4LFAF 5F8JA 4LFCF 4RUAA 3DLGB 3HVWA 3PHEA 3I4HX 4BC7A 4HYKA 4N47A 3DM2A 1Q82T 3E3XA 2J5AA 5DQGA 3UI3A 2HGLA 1U2FA 4C3LA 4OJHA 5F3TA 1Q53A 1FEHA 4QR2A 4OI4A 1REVA 2I8EA 4KSEB 3ITHA 3C6TB 4LF6F 1U45A 4LJMA 4CH7A 5G0RB 3CIZA 4YB5A 1K1SA 3G96A 3LPYA 5KT6A 2DR9A 4LSLA 5C42B 2XCAA 2XMTA 2KXNB 1N6QA 3HF5A 4X4UA 1X5PA 2R9LA 1PSDA 2FC8A 3ZZRA 2BANA 2GGPA 2WRMA 1NZAA 3JSMA 4F50A 1T8EA 3M2UB 4HTIA 3NNAA 3MFHA 1MSWD 3K0JA 3DFEA 2QT7A 3DU5A 3M4XA 2VBXA 3ISZA 2DNYA 5HL7Q 1Y5IB 2L3MA 1UVNA 2RQMA 2QA2A 4NCAA 1N52B 4U7UK 2DNNA 2LVWA 3IO1A 3KFWX 1D9FA 2LQJA 4IYQA 1HMVA 5J2NB 3K57A 4PG6A 1SL2A 3U27A 3HM9A 2BQRA 3W2WA 1OSDA 1JNRB 1TR0A 3ZZPA 4U67Q 3NGDA 2QA4S 4USJC 4OFZA 2YNFA 3CJ3A 1F2GA 3K7RA 2NQPA 5KFUA 1JKHB 4C98A 3CDEA 1TVRA 5K8MA 2KT5A 3UDCA 4R8UB 1HNWF 3CO9A 4NZ7A 3EXYA 1NKCA 4CIOA 4ZP6A 2E66A 1FDNA 2VG5B 4F4YA 3SQGA 3THVA 1S1WB 4PPDA 4CTAB 3RBEA 2KM8B 3QZ7A 1IKXB 3DU6A 2L41A 3R5CA 1JX4A 4OI2A 5CZXA 1O0PA 2F8EX 3SFUA 1QAXA 4DEZA 4X4QA 2HYIB 2B0GA 2FJBB 2JFDA 3ENQA 3M9NB 4DS5A 4NYOA 1JLGA 1KQGB 3ZZZA 3UD4P 3GFHA 3OR2B 1HFEL 4ZHRA 4OHXA 2YWEA 3MFIA 3MF5A 4ECSA 1UW4A 3DRYA 2HVZA 4MIBA 1X5SA 4AQYF 3CCZA 1FRMA 1C0TB 2YNIA 3TARA 4I56A 2ZITA 3OBIA 3K5OA 4WYWA 4QU7A 1X5OA 1Y00A 3I4PA 4BWJA 2UU9F 1HBMA 5HROA 5JVHQ 3F73A 1YRXA 2RRAA 3D28A 3ISNC 3MPVA 3TNVA 3R1HA 2V5HG 4B9NA 4DSFA 4F8RA 1KQSR 1RT5B 5U47A 3T5HA 3KLGB 2C42A 5GAEU 2R7SA 5F41A 3IA0A 1ZAXA 2ZH7A 2LEBA 1ZAVA 3HHLC 1QSSA 1KN6A 4L72B 5E3QA 3VAHA 4DLEA 2DNOA 1UVJA 3MPWA 1IJFB 1JLEA 1IBKF 3RYLA 3BO4A 2ZNZA 4KO0A 2WTFA 2ZJQQ 5JVGQ 4NLPA 2E5IA 1RDRA 1P1LA 2CPJA 2XS5A 1Q81T 4B3RF 1S97A 3ENWA 2DIUA 2B4OA 3QWUA 4IFYA 2F1FA 3I5CA 3VAMA 4PWDB 4ZLPA 3EPGA 2JEJA 1DQ9A 1M5VC 4LQ3A 4O44A 4QW8A 4NCGA 2OH2A 4DN9A 4MKYA 4KQZA 1VBXA 3DLKB 4KHMA 2CZ4A 1GT8A 1MU2B 4PXEA 2HHTA 2CDQA 1VBYA 3PM9A 4R5PA 3ULHA 1URRA 4F3OA 2H9ZA 2B4VA 1C2PA 1BWEA 2D3ZA 4MAKA 3DOLA 4O3PA 1S9EA 2IM3A 1R31A 2AJ0A 5CYMB 3TRGA 1VIXA 2C3OA 1QSYA 3Q2TC 1FK9A 2LCWA 4HKQA 3BR8A 1N34F 2R7VA 1VQKS 3HHNB 3B4MA 4NA1A 1FRJA 3CJ4A 4ETZA 1D9AA 2J0XA 3A1YG 3B82A 3GSDA 2G4BA 4QCLA 4QPTA 3LP0A 2KFZA 3DLEB 4YFUA 2RKIA 2GQQA 3V4IA 5EUHA 4B9MA 1H7WA 3CJ2A 1VIOA 4W90B 2JZ5A 3M1VA 1FNMA 3OXGA 4OV1A 2V4RA 2MXYA 4J9OA 2AX1A 2DB1A 5F8HA 5AXMA 5LT5A 4TU7A 4K4VA 2LQBA 5KG7A 1TKZB 2N3LA 3CJ0A 2IM1A 2W9CB 2R8IA 1G1XA 1HPZA 3IWNC 2IVMA 1FRKA 3Q2SC 4A8QA 1YTYA 2MZJA 2ZH4A 1RT3A 5KFGA 2R8GA 5F3ZA 1M5KC 2IM0A 2Z0GA 3LANA 2PN6A 1SL1A 3GB0A 3N79A 5KFBA 4OHZA 2M88A 4WE1B 1WTFA 3K8WA 4FZVA 4IG0A 4RKUC 4WXWA 5A8RA 4BWMA 4X4TA 3PW2A 3PO4A 2V8GA 3KK1B 4EUVA 1JMTA 3R5AA 2PC6A 3CDAA 3OUYA 1YITS 1B0VA 2NXUA 5D4PA 1HW8A 1S4FA 2VBYA 4L6V3 4RU2A 3CULA 3IR6B 2HHSA 1U1NA 3PEHA 4ED3A 2IMOA 2LXIA 5L9XA 5B09A 4WFAQ 3HXMA 3UPFA 3DCAA 4DL7A 2MKJA 1K1QA 2HRUA 5KT4A 4XO0A 1PO6A 2HS4A 3PFOA 1VQ7S 5I3QA 1L5UA 3DOMA 3N9UC 4X64F 1DJ0A 1ZM3A 2RF2B 2WSEC 2W7OA 4B3OB 3KOAA 1X4FA 2LU2A 1AXQA 3S6EA 4DS4A 3W2VB 1SV5B 1TKXB 3AB2B 2EFGA 3UDLA 2J7UA 2HAIA 1S6PB 1RYRA 2O3DA 4DSLA 3OR1B 2EBEA 2C2EA 1GQEA 3VAKA 3THTA 3U02A 4IRDA 2E1MC 4EGLA 4ZMMA 3OL8A 4K59A 2DITA 2YKPA 1ULRA 1MMLA 2EPIA 3E8OA 2RRNA 4Q2MA 5HMZA 5IM0A 1LW0A 5AJ3F 3MECB 1XTZA 1LV5A 3AQPA 2GX8A 2OMLA 4EBCA 3PEJA 2HFZA 2RQ4A 3IC1A 2J7WA 1M90T 4ECUA 4P6QA 1OPZA 3IGVA 1YVFA 3J7YU 2DGUA 2XSJB 3FRYA 1Y5NB 5KT2A 1RTHB 3MAHA 3D2WA 2FHKA 3H40A 2ZH2A 3ZZYA 2W9AA 1SL0A 2FHJA 3AQOA 5IS2A 3QO9A 3AHPA 4ES3A 3GV7B 2LYVA 5L9NA 5D3GB 2RU9A 3TX8A 2YKNB 2V8DA 3KG1A 1HQUA 3FNNA 1IKVA 1W25A 1FESA 3D5MA 4QR0A 3MD1A 3AJ1A 5A8WA 3AH6A 4YP3A 3KHLA 1HI1A 3OLAA 4F67A 5H1SV 2B5JA 3H2UB 1TL1B 4QIWD 1LOUA 2QSFA 1CG2A 3VR1A 1WHVA 2C3UA 3DMJA 3M6WA 4IG3A 3FFIA 1LFPA 1UA0A 4OZ0A 5K14B 1RP5A 4J9MA 2HIQA 2C2DA 2CPZA 3BO2A 1UEVA 1KC8T 4JV1A 3QYYA 2J0QD 4DV2F 4RNNA 4OI3A 1KLNA 3CCSS 3MM9A 2DR8A 4NA2A 5DQIA 2B43A 4MK7A 2YX4A 5EX0A 3ZZOA 3DRPB 5EN1A 2KG1A 2DGOA 3MM5A 1U8SA 2CQ4A 3HHEA 1QLNA 3S01A 4ILRA 4OI6A 2HNZB 2B6AB 3QAUA 3IR7B 1JLCA 1Q8IA 2MQPA 1BQNA 2MZ1A 2HWTA 2VKZG 3ZZUA 2BBEA 2CJAA 4WFYA 1B7FA 3FVYA 2K1RB 1F5CA 2J9CA 3BGUA 3P3DA 3EGZA 5A8KB 5I42B 4IRKA 3BGRA 4K5RA 4XPCA 1XR5A 4NLRA 4PXBA 5HP1B 4C8KA 3NRBA 3EXCX 2XI2A 1NK5A 4LVNP 2R2UA 4I7FB 3OHBA 1H0HB 5F9LA 1R27B 2E9RX 1WWHA 4I6WA 3KJVA 4C8LA 2JEIA 5MAOA 4LVOP 5E2QA 1SXLA 5GAHU 2NSCA 4ZPBA 1KS2A 3SCLE 4ZP7A 3V6JA 2W8KA 2ZDOA 3ONQA 3I5BA 2ZOFA 2HQ3A 1AFIA 2VG6B 3UCZP 2A2CA 2JVOA 4KTQA 5A0YA 3N0VA 3JYTA 3QIPB 1D9DA 3HFKA 4Y2IA 5SUHA 1B0PA 3CVKA 1YBAA 4B17A 2VZ9A 3SEOA 3SI8A 4QIEA 3T3FA 1DARA 1TAQA 4HDGA 4C3KA 2HMIA 3DDKA 1KFSA 2HGMA 2DGWA 3VZIA 2ZHAA 3LGMA 1LWCA 3QIDA 2Q43A 1VQSA 2OPPB 1MMDA 3VF0B 1J5EF 3KLFA 4YEAA 2YNGB 5T7LB 2NLWA 2VG7B 4NCBA 3M8PA 1R8AA 4ELVA 4R0JA 4CNYA 2B4UA 1BQMA 3MD3A 2EFOA 1LWFB 1TL3A 5B0AA 4IFVA 2F8MA 4OZ1A 1WHWA 3WZ0A 4C8ZA 2MGZA 4DG1A 3M6XA 4P7VA 1I94F 1ZPWX 4IR1A 4XPEA 3UR3C 3GFZA 1XR7A 4CO3A 5KFQA 4ECZA 4PG7A 4O3NA 4NLVA 4ZCLA 1S9GB 1KSPA 1RJJA 2QO3A 3BDEA 2KM8C 2XLKA 2HHQA 1M5OC 5GMKa 2VASA 2J6SA 3MMJA 2OTLS 4ZA1A 1JXLA 1RI7A 3HJFA 2GHVC 2Y1IA 2XWYA 2KT3A 4FS2A 3BGFA 2PD1A 1V3SA 2U2FA 2ZBIA 3PV8A 3R5BA 4NZ0A 3QGGA 2QA4G 1GX6A 2AV5A 2LKZA 1TKTA 2HNDA 4CQ1A 4LF4F 1UWBB 4OL8A 2M70A 3OJUA 2DH9A 1HYSB 3MEEA 2R7QA 2BM0A 2VC0A 4UQGA 2BV3A 3L09A 3GR1A 2HG4A 4PXCA 4B3MF 4QU6A 1WEYA 4N8NA 2IYIA 4USHA 2AGOA 2FJXA 2X1FA 2J7KA 2KRBA 2VKRA 3OTBA 4FF3A 4ZPAA 2ZHOA 3HZGA 3KMQA 3CMES 2VPXB 4Q8FA 2ZJRQ 2IJNA 4CNZA 3S8SA 4C7QA 3BDPA 2FJDB 1PILA 2OPRA 4TYBA 1NK6A 2DH7A 5HMXA 4J9PA 4Q0BA 2GHPA 1S0NA 3V6DB 1JK9B 2FY1A 2GNKA 1RT1B 3I32A 1TKDA 1IJEB 4KV8A 4X4RA 3CCLS 3PKMA 2B9YA 3O8WA 4G1QB 3OVAA 2J76E 2PT0A 4CO0A 2ZOGA 2M52A 3FZBA 5IT9Y 2XZWA 5DRKA 3I87A 2UUWA 2V2KA 1VC0A 4DWIA 1VRTA 3RRKA 2ASJA 4K4SA 1HI0P 1H38A 2IRXA 2MMYA 1HNVB 4H4OB 1JLAA 3NBPB 4I69A 2PE8A 2CVEA 4W92B 3CJKB 2KU7A 2DCLA 4MYUA 1NK0A 1D8YA 3RW6A 4DQPA 2EFNA 1RTJA 5FDLB 2F7VA 1JLBB 4LQ9A 4H4KC 4CI0B 3M32A 1FKOA 1QE1B 4X66F 3CD0A 4LF9F 3BR9A 4CH1A 3DLGA 4JUZA 5GADI 2ZH8A 4ZVHA 3GG1A 4DUZF 1U1KA 3NP5A 3DXBA 3PW7A 2JX2A 1FJCA 3JSRA 4Y6IA 3C6TA 4RLEA 1TZ0A 5DM6Q 1S1VB 5G0RA 2RUGA 2LDYA 3OSNA 2XLIA 4HVZA 5C42A 2EG1A 2AQ4A 4Q44A 4YR3A 2PMHA 2WW8A 3J80Y 3RBDA 2K7JA 2CFXA 2EFQA 4LT6A 4XK8C 4QBUA 2BACA 2BOPA 1VK3A 4UW2A 2VA3A 3M2UA 4PG5A 4G6VB 4KE5A 3TAQA 2JLGA 2A10A 3CMAS 1QUPA 5KFOA 4K50A 4DQIA 4KPYA 1OO0B 2MJUA 4X2BA 2K7KA 1EETB 3IN5A 1V3ZA 2DGSA 5K9FA 5I4MA 4O23A 4OLOA 5J2NA 4OI0A 4FXVA 5LSOA 2A1BA 4N8OA 2GV1A 2UP1A 3TUJC 4DJBA 3RAQA 4O4GB 1S7HA 5A2QY 2NR0A