3FMBA

Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (yp_212648.1) from bacteroides fragilis nctc 9343 at 1.85 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
YFQGMVKHIVLFKLRDDVPVEEKLVVMNSFKEAIEALPAKISVIRKIEVGLNMNPGETWNIALYSEFDNLDDVKFYATHPEHVAAGKILAETKESRACVDYEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dimeric protein of unknown function and ferredoxin-like fold
publication title Crystal structure of dimeric protein of unknown function and ferredoxin-like fold (YP_212648.1) from Bacteroides fragilis NCTC 9343 at 1.85 A resolution
rcsb
source organism Bacteroides fragilis
molecule tags Structural genomics, unknown function
total genus 26
structure length 103
sequence length 103
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3fmbA01
1X7VA 5A6PA 2HFNA 2QYCA 1URRA 4Y2MA 5F0UA 2HQIA 2KYZA 3CJKA 3LGMA 2FTRA 3HHLD 3BN7A 3T9NA 2G9OA 2IYIA 2RU9A 3BF4A 3FRYA 2RMLA 4HL9A 1FE0A 3E8OA 2FHMA 2GA7A 2IYGA 2OAUA 3HFKA 4A46A 2GGPA 1FVQA 1OQ3A 4YDXA 3HHLB 4A48A 1YJTA 1XBWA 1ULRA 1FESA 5B0FA 1Y3JA 1FEEA 1YJUA 1GXTA 2RSQA 1MWYA 4OJHA 2GO8A 1QUPA 2W4DA 2K1RB 2L3MA 5F0WA 4DN9A 1K0VA 3QMQA 4Y2IA 1RJJA 1YRXA 2N4DA 3BDEA 1N5SA 1FE4A 2K7KA 2OFHX 4OJGA 3UDCA 1YJVA 5B08A 2OKQA 1S6OA 4Q2LA 2W4CA 5B0CA 2OD4A 4A4JA 1TUVA 1N5QA 3TOQA 1TL4A 2OMOA 3HHLA 1CC7A 1Q8LA 1Q53A 1KQKA 2XMJA 2BJEA 3DCAA 2N4CA 3IWXA 1OQ6A 2FB0A 5B0GA 2Q3PA 5A6WA 2GFFA 1IUJA 2KT2A 2K1RA 2HIQA 2ROGA 3BM7A 1CC8A 3HX9A 2AW0A 2GCFA 1X0PA 2K7JA 3DXSX 2CRLA 2VV5A 2PGCA 2W4PA 3LGNA 2QLWA 3K7RA 5B0AA 1U7LA 1X8DA 2XMVA 1SQEA 1Y0HA 3HF5A 1Y3KA 2XMMA 1CPZA 2OP5A 3FGVA 3BR8A 4DL0C 2KT3A 4F67A 4ZOSA 2LXFA 3MZIA 2HLUA 2BBEA 1AFJA 1TZ0A 2OD6A 1YG0A 3GZ7A 4FNIA 2QLXA 1WD6A 4HI2A 4QOTA 2ZDOA 2AP6A 5K9FA 1APSA 3F44A 1KVJA 2ZDPA 3BB5A 4Q2MA 1VQSA 1Y9OA 4OJ1A 3VTIA 1P8GA 2AJ0A 3TNVA 1AFIA 1OPZA 2EW9A 1W2IA 2AJ1A 2OFGX 2XMKA 3BGUA 2K2PA 4YEAA 5T7LB 1JWWA 4EFAC 1N5VA 4Y2KA 1VQYA 3MCSA 4HI1A 2BYCA 2GV1A 3I9ZA 3WDOA 4OJ3A 1SI9A 2XMTA 4HH1A 4OIXA 1YJRA 2N7YA 5B0EA 1FD8A 3KNGA 4DPOA 3KG0A 2KKHA 1MWZA 2LQ9A 1N5TA 4NL5A 1LQ9A 1S6UA 5IXUA 1GXUA 1FVSA 1OSDA 2FIUA 4HH0A 1R6YA 2IFXA 2HFOA 2ROPA 1V3ZA 3TRGA 3IWLA 1JK9B 3HDSA 1TL5A 3CJKB 1TR0A 5KAKA 3QGPA 5B0BA 2LQBA 5T7LA 4U9RA 2QIFA 3KG1A 2BJDA 2ACYA 1Q8BA 2ROEA 2VH7A 2PD1A 2GGPB 2RILA 2XMWA 3FMBA 1KVIA 5B09A 3LO3A 2HLTA 3HHLC 4NPOA 2LDIA 1AW0A 1Q4RA 2XMUA 2ASYA 2BUNA 4A47A 1P6TA 5B0DA 3KKFA 2JDJA 1SB6A 4FNHA 4ZA1A
chains in the Genus database with same CATH superfamily
1URRA 2JEJA 3TAMB 2Z2MA 1MU2A 1IWGA 1RLCL 2E7WA 3M8YA 2E1MC 3G86A 1FVQA 3UPFA 1RLDA 3KWMA 2KHCA 4K0KF 1DLOA 2G0JA 1BQNB 3M6XA 2M88A 4GMKA 3I0SA 4UQTA 2HMIB 2W8LA 4URQU 1GH8A 1X4EA 1E6YB 1KKHA 3ILOA 3JSRA 1BUXA 4B17A 1FFSB 5E41A 2PFDA 3T6JA 3GR1A 1IR0A 4ZVRB 2AEMA 1SJ3P 1LWCB 1FJGF 1SKUB 1RCXB 1Y3KA 1F9HA 1JLAA 4PPZA 2YWHA 1L3UA 2AP6A 3MTKA 4RW7B 2HNYB 3AD8C 3KDOA 2RQ4A 3IRWP 2GQ2A 4OYPA 3OSNA 1RP5A 3KG0A 1HR0J 2RQKA 3H5XA 4V19J 2R7VA 4PYDA 1TL3A 2ZWOA 3KLGB 1RAIB 3FQKA 2F65A 2Y3YA 1FT8A 5E5NA 3GG1A 1J2VA 4UTGA 4WU3A 2HQCA 2KYZA 4FS2A 3G82B 1TK5A 3I96A 3I87A 2XYGB 4LF6F 4F0HA 2GO8A 2M52A 2IAJA 1RWMB 4EBEA 3E2EA 2VG7B 5EWEA 2I8EA 3OD2A 2IJFA 2AWZA 5L1JA 3JB9k 1H74A 1T03B 2QL7B 3H59A 5HROA 3OFFA 5F8GA 5LJ5Y 3UVJB 1FX4A 3SEOA 4B9SA 3R27A 3J7ZT 1R0BG 2ZBQA 4HTJA 3MPWA 4W90B 4C48A 1TKTA 4CCHA 2DTJA 1RZMA 1ZETA 3TZYA 1WTBA 2CQHA 4RNNA 2N7CA 4JI7J 2KZMA 4FF1A 4DOZA 5CYQB 2HHUA 4O3RA 4BLGA 1RWNB 3CCUS 1HW8A 5F9LA 4OZ5A 4CO5A 2GGPA 5CZXA 1FESA 2PT0A 4KHMA 3D6TB 2E5HA 3KLHB 1SL0A 1FKAF 4WZQA 3R2CJ 2YPYA 4Y00A 4F4WA 2MSTA 3O8WA 1FERA 1G2EA 1S1WA 1Q53A 3PRDA 3V6DB 2RRNA 3DLJA 3QQCD 4CLYA 2DNKA 3H4BA 1X8DA 1Y0HA 1FEHA 3UCZP 3BYPA 4ID5A 3VTIA 2DHAA 1Y00A 4ZPAA 5ETRA 4R0EA 4KQZA 4FS1A 3HMJG 2WTFA 4JOUA 3US5A 4ELTA 1M5OC 2VODA 4IYQA 2DBBA 4JI2F 5IT9Y 2HNDB 2H1YA 5D3GA 2V8VA 3HVTA 2LXIA 4LRFA 1QE1B 2HFNA 1G6BA 4BHQA 2V8DA 5LT5A 3V6JA 2HHHJ 2UUCF 1QTNB 1NJYA 3IWNC 3E8OA 3O6QA 3CPWR 1FRXA 1MN9A 2K7KA 2C2OB 2J7KA 1J27A 4WTYA 2VPYB 2GVDB 3DI6A 2YKOA 2COLA 3N79A 3U1MA 4Q44A 3LP1B 2ZOMA 1REVA 3OW2R 3FBFA 4P52A 5DM7Q 4DV7F 1HIYA 4LUBA 2HWHA 1FTRA 1WSVA 4RBUA 1K44A 3OL6A 2ZH5A 1BD6A 5K20B 2P2CB 4GKJJ 1TP7A 1XMBA 1XMQF 1S7HA 4DV2J 2R8JA 2FZGB 3H2UB 4FBUA 1IBKJ 1LQ9A 2AGQA 3LUYA 2E9ZA 3BGRA 5CQGA 1S6QB 4LSZB 1UETA 2JEFA 2ILZA 1ZTWA 2QL5B 3DLHA 1HBOA 5HO4A 1AZSA 2FDNA 5LM7E 4LF7J 1WC0A 3R7SB 1UWAA 3H25A 2OAUA 1S9EB 3IGNA 1RKJA 3J7A1 2A3JA 2BMBA 1MWYA 2O01C 1NSQA 4B3MF 3OVSA 5C42A 1RT5A 2ZD1B 4PRFA 2R2UA 1N5YA 3U1NA 3J81j 1M1GA 2ADCA 2GCFA 3K57A 4ECVA 1IWAA 3DM2A 2BABA 4PXBA 2PIIA 5IFMA 4IKAA 1VOMA 2OI2A 1KFDA 2UXBF 4RZRA 2W2PP 1T0TV 4J7CA 1R6VA 1VQSA 2XI3A 3C8YA 3MM8A 1IKVB 4KPCA 2OMLA 2QO3A 1U0HA 3VAFA 1G4CA 4IDKA 1TK0A 2CQGA 1XEZA 3QT8A 2HGMA 2XY5A 2JC0A 4P71A 2VPZB 1SQGA 2XC9A 2D7SA 3CD7A 4NXMF 4CO0A 5LMUF 4NLQA 5F8LA 2J6SA 3KJFB 1VRUA 4IFYA 1JKHB 2GNKA 4PKDB 1NH7A 1ZBTA 3CCTA 2XI2A 4LFBF 2Q6CA 3B8HA 1S57A 2GA7A 3DLLQ 2G4BA 1GXTA 1YTYA 2HYIB 1RABB 1ZOTA 3SFUA 4EZ6A 3PNIA 2KZZA 4FKYA 1FTCA 1HNWF 2BANB 1C0TA 1CJUB 3CMAS 2W4CA 4ZVFA 4TKTA 1RAAB 5HLFB 2OMOA 1C0UB 3C6TA 1VMBA 3KLIB 2LEPA 2CZVC 3JSBA 5AE2A 5B0GA 2H65B 1S1WB 1LK5A 1UA0A 2LYVA 1DBDA 2CKWA 3DU5A 4R0JA 1KLNA 3W9IA 1Y5IB 1TZ0A 1S59A 2CJQA 2GW8A 2W8KA 1YKWA 2U2FA 1VQYA 1RISA 2K3KA 1N52B 3D5MA 1DRZA 1HI1A 4RWWA 4M5DA 5KFWA 3SQOP 2G0IA 3FNNA 4YY3F 2ZBPA 2CVIA 3EXCX 1FJ7A 5D3GB 3OLBA 4AUKA 3HHNB 1RE1B 2WK4A 1IQTA 2IJRA 4HTIA 3UDVA 5HQMA 4DR5F 1DTQB 2BM1A 4RKUC 4ES2A 4AXJA 1D3WA 5CHCB 4WYWA 7AT1B 3CMES 3ELHA 3BV8A 5T14A 2R7TA 3HULA 3R5AA 2JEIA 3BSNA 3TUIC 4USHA 2GC8A 2KJVA 4ZPDA 3EMTA 2BJEA 2Y1IA 3DOKA 1Y4ZB 1NK9A 1FRMA 1X4CA 3X3UA 2PGCA 1YHQS 4OZ1A 2KT3A 4F67A 1F5BA 4AL6A 1AFJA 1HMVB 4GVBB 2ZBRA 1N32F 4P75A 2G1DA 1IR2A 3OJSA 2DYAA 4DX8H 4Z2XA 4ZVPB 2BYCA 3DC2A 3H4DA 4X66F 1N36F 1TQLA 2BQ3A 1UVMA 1WC4A 3BBCA 4CLLA 2GMJA 1EAYC 1Q81T 3M8QB 3UNYA 3ZNJ1 4NX9A 3HPOA 4M95A 5E33A 2JLGA 1HBOB 1ZM3A 1NKEA 2X3GA 4DV0J 5C7PA 1S0VA 5CCMA 1FRJA 2D3UA 3BQ0A 1R8AA 3I55S 1NK8A 2FLLA 4DL2A 1C1CA 4WP8A 3W64A 3TWZA 3MCNA 2W1BA 2MDAA 3WC2A 3RYLA 1RSCA 1K8AT 4MFBB 3RR8A 1DJ0A 5HANA 1I94J 3T1YJ 3DRPA 4YN3B 3DM2B 4LR8A 2AYBA 1RT2A 2M8HA 2WAQD 4IRKA 2QMUB 1RBOB 1SH2A 2C22A 4J9RA 3CCQS 2HHTA 3N6LA 3M32A 3JYTA 2L9WA 1ZM4A 5GVQA 4GO5X 1Q8IA 2BQUA 1SXLA 7FD1A 4K4WA 4MAKA 1REGX 4D3HA 3NP5A 4ER8A 4RBTA 2VG6A 2CADA 2DNRA 2A1BA 2HQGA 2G9OA 2MHNA 1OQ3A 2Y0BB 4UZCA 3RAMA 2LQ8A 1YZ6A 1XNQJ 4DCOB 2VBXA 5DDRC 3C16A 5GAGU 1EETA 4N7TA 2BRLA 3KMSA 5KG6A 2HQFA 2ZH3A 4G65A 4B9TA 1B0TA 2DNHA 4G1QB 2CJ9A 2E44A 5C2CA 1UFLA 3PY8A 3GFYA 3MWBA 2C3PA 4C11B 1HD1A 2VA3A 2ZDPA 4USVA 1D09B 4I2QB 1GXLA 1T9XA 4NLUA 1B4SA 2I38A 4H4MA 1DTTA 4DFKA 2ACMA 2DCLA 2F4VJ 2XMTA 3LP2B 3N6MA 5JVGQ 4ED8A 5CYJA 1NXIA 1VQNS 4OFZA 3RAQA 1TFWA 2NUUG 2VBZA 2ZH2A 5B09A 2ZJRQ 1U49A 2DK2A 3Q23A 1RAEB 4LBPA 3DRYA 5LXRA 2FGOA 4YB1P 3GTYX 3PYFA 4KHPJ 3MM5B 1U1NA 4LF8J 1XC9A 1PYSB 5BXIA 1WEYA 4J37A 2RQMA 4JI7F 4X4RA 2YXLA 3TI0A 2IIHA 5ETMA 3UD3P 2BKNA 3MM7B 2GFFA 1X31C 1YWXA 4G1IA 1NNDA 3IRXB 4DI6A 2VONA 2ASJA 3GMGA 5IM0A 2DGUA 3ZZRA 2RB7A 1ELOA 3SDEA 2KT5A 3QIDA 3QSIA 3IBCB 1NKBA 1RHKB 1JLQA 3S8SA 4DPTA 2M5YA 2XSJA 4P2FA 1T9YA 4R25A 3GIKA 1S1TA 1RWPB 5KT3A 1W2BR 2QLBB 4IO9Q 3KUEA 3MR7A 4DV4F 4YB7A 1D8ZA 4QIFA 1TELA 1DURA 4A47A 2LDYA 4DV5F 2KXFA 2KRRA 2ATCB 4QWEA 2MQ8A 3LTOA 3GIJA 3M8WA 1PIEA 4GVLA 2P9EA 3GPAA 4OZ3A 1UA1A 1K9MT 3EDQB 5KFJA 4ZK7M 4X4UA 3OR1A 3J7AN 4UOHA 2QMXA 2K06A 2R4FA 3GE9A 2BOAA 2FJXA 1K47A 4ED3A 1OMSA 4M1KA 4LFAJ 3DGPA 3MAQA 3T9ZA 2HHHF 1DHMA 5E3CA 2DH7A 2C3OA 2W24A 2M9KA 5B0AA 1HWLA 3BR8A 4DL0C 4ECYA 3O3LA 4RNHA 3CEDA 2HVHA 3B82A 4W4MA 1WG1A 3TJ8A 2QYGA 2EW9A 4I1TA 4WE1B 2H51B 3CXCR 2RDJA 1OY6A 1DARA 3N01A 1YJRA 3CDAA 2E7VA 2KKHA 4ZLNA 2CUYA 1PAEX 3VQTA 2ASDA 2YWEA 2Z4PA 4BWJA 2LFVA 2DH8A 3HLUA 3UI3A 1KHWA 2VFRA 1KTVA 4UY85 1SB6A 3R7BB 1FDNA 3ITHB 1R43A 4ZLLA 1T05B 5HP1B 4K4YA 1FD2A 3CWJA 1IBKF 5E0OA 5ITHA 2AYEA 1JLFB 4J9QA 4JI8J 2K1RB 3LW5C 1G7CB 4AL5A 2OO4A 1RJJA 3PW5A 2DIUA 2E29A 2KL8A 5J1EA 3CW2C 2RH3A 2XSFA 5DG9A 1RAJA 3O1LA 3P5BP 4NYPA 4IFVB 1KDNA 4LF7F 5KG3A 3ZTQA 4DDFA 3ZZYA 4LT6A 1QUVA 2QEXS 5KT5A 1P27B 3EWGA 4RUCA 1E6VA 4ZN3A 4K4UA 2LU2A 4DG1A 3BGUA 5ETKA 1WOPA 4XO0A 3LH2S 4LSLA 4IRCA 3FSIA 1TL1B 4KR0B 2VZ9A 2R3VA 1WF1A 5GADI 1WDTA 3DN9A 5D6GA 4Q43A 3CJ5A 3IR7B 2BW7A 4NRUA 2R8KA 1N33J 2HQ3A 3PX6A 3FMBA 3ET6A 2YKMA 2IVFB 2C3MA 3VF0B 4X4PA 3C15A 2R7SA 1AB8A 2RU9A 2OTLS 3VAIA 2DNLA 2HHWA 4DSLA 1M1KT 2MXYA 3HXMA 4R5PB 1NHUA 1YBTA 2QL9B 2EG1A 4F26A 4F4YA 4ZVGA 2CQ0A 1EX8A 2UU9J 1MMNA 5J1NA 1LFWA 3NS5A 3M9OB 3ZZ0A 3AAWB 1TKZB 4YB5A 3CCVS 3PRVA 4AXIA 1FX2A 1MW7A 3K5NA 3C2PA 4AD6A 4F2SA 3HFVA 4A8QA 4NLPA 4K4XA 1VBZA 2ATLA 1TAQA 1X4FA 1IKYA 3BH7B 3TYTA 1M5VC 2ZM6J 2AZ1A 3QFHA 4LVOP 1UVLA 2HQDA 2VBWA 1F6TA 3GQCA 2HWIA 1JLQB 1RK8A 3CF5Q 2L9DA 3T1AA 2HS3A 2QA1A 2VPXB 4FYYB 5KOXA 3HSZA 1RT1A 1FFGB 4RJVA 3OHBA 4OLOA 2EFOA 2YQ3A 4BC7A 3MEGB 2DNOA 4WFBQ 1VI7A 3DLBA 4USTA 2W2QP 4K4ZA 3SIPB 1IKXA 3SV4A 2O1PA 2IA6A 4YDXA 1XMOF 4OI3A 3T5JA 1S77D 2IM3A 1JLGA 2P6SA 4XAKA 3D6FB 4MMOA 4N8OA 4NXNJ 2Z30B 4A8FA 2ALZA 3A8EA 4O4GA 3FJ2A 2FY1A 1F0XA 4DMZA 2EKYA 1CC8A 4I68A 1N34F 1ZA2B 3NS6A 1PYTA 5EX3A 3L3CA 1DZ5A 3HO1A 1U02A 4P74A 1HNIB 2BQRA 1TKXB 4ED6A 4FXDA 1LW2B 4F8RA 4NLVA 3K58A 1O5JA 1S4EA 4QIEA 2ZUAA 5DZ6A 2KG0A 3EUNA 1WEXA 4TN2A 2DHHA 2HFOA 4PWDB 2WVBA 1RWUA 1RWXB 3H0PA 1CS4A 1SC4B 3LF0A 2J9CA 4K4TA 2DT9A 4KV8A 2A10A 3PYGA 2XYHB 2K3IA 1KHVA 3HD2A 3OT9A 2WONA 1SH3A 4DHVA 1T7PA 4PXDA 1MG7A 2I0XA 3TVYA 4KIAA 1FE0A 4RX6A 4E8UA 1YITS 4L6V3 2EG2A 2VDIA 5I3UB 1RT3A 2RSQA 2XCAA 5D4PA 5JXSA 2HPUA 3RRKA 3PKYA 2OPPA 4M5GA 4WCEQ 1G1XA 1K0TA 4L74A 3W2VA 2AGPA 2PA3A 3WHIA 3UR0A 1IJEB 1UP1A 2Q3PA 1VQLS 1OSCA 2ROGA 2Z8QA 2W7PA 1ZZFA 3BKFA 2PI5A 1LWEA 4NYZA 5KG5A 1F3FA 1N56A 3NGKA 4IH7A 4ZVOB 2AJ2A 4QBUA 2UUBJ 2CPJA 3BN4A 4Y34A 5LSOA 2VHGA 3I5BA 1GMUA 4UOCA 2N7YA 2FC9A 4LSLB 4LRBA 5KFSA 2W9AA 3PW0A 1TR0A 1LWFA 3W65A 5HVGA 3T1YF 1W25A 1XWLA 1EB0A 1X5OA 4PQUA 1A0OB 1RHUB 4OYOA 2B5JA 2HHVA 3BJYA 1FKOB 2FD2A 2IVYA 4A8OA 2LMIA 3R5JB 1HHSA 2FJVA 3T5HA 2RHSB 4KFBA 2MQOA 2FZKB 1CJTB 1RT6A 2WB4A 4QR2A 3L7OA 4OL8A 5GMKa 3W5ZA 4WWSA 2CPHA 3IM8A 1Q8LA 3QWPA 4ZIVA 3QO9A 5KFPA 2RRAA 2AV5A 5HMXA 3LP0A 4J9VA 1MN7A 2HRYA 3TANA 3AJ1A 4ZOSA 5GMDA 4ATNA 1H7XA 4JYAJ 4CNZA 3PCOB 2GJIA 2NUHA 3EX7B 2XLKA 4XIUA 3KHRA 4ECUA 2XHWA 4DBQA 4HI1A 4BC9A 1RHRB 5FJ4A 3RTVA 4USMA 1YJNS 3AOBA 1B0VA 2KFNA 4ES1A 4KGVB 5GADU 5HL7Q 2ZH7A 5HQ8A 1DFDA 1ZA1B 1HWUA 1XIQA 1NPRA 4WJBA 2Y1RI 3GIRA 3BKTA 1NDKA 3ZZTA 1CJVA 3HFKA 3ZTRA 1R7IA 2W9CA 4K8RA 5I3QA 1KLMB 1S1VA 2XLIA 3QGGA 6FD1A 2OPQA 4KB7A 2CQ2A 3LPYA 2CG8A 3VQSA 1RTIB 2F9JA 5CD4H 3Q8VA 1QSLA 1HBMB 2XMMA 4KHPF 4KH1B 2OLWA 4LF8F 3EPIA 3V5RA 2YNHA 2EFNA 4NLDA 4OQJA 4QR1A 1OWXA 4CLFA 1U1KA 3FZBA 2QLJB 3H98A 4HH1A 3QNWB 1U48A 3QPIA 5BYRA 1UWBB 1N6QA 1AA1B 2MZTA 4ZJQA 1VCTA 1RU2A 1BWEA 1X5SA 3QLHB 1XQIA 4ECTA 1QAJA 2JSXA 2DHXA 2GJ2A 2MB0B 3W3SA 2UXCJ 2E5LJ 4RU9A 4TXSA 2IYIA 3MFHA 1Q5VA 2B8PA 3KJVA 5CYMA 1B3TA 3OTEA 5HMYA 1RI7A 3I9V9 1X9MA 2FYXA 3PVXA 3PEJA 2HBZB 3TARA 4CWBA 4L73A 5AE3A 1ZS6A 3RBDA 1BC6A 1IVZA 1Q8KA 4DPXA 5SUHA 4QYZJ 3I6PA 1T9WA 4H4KC 3AHPA 2DRBA 2B7CB 1WG4A 2DY9A 2GQQA 4P73A 5IV4A 2RHQB 2E1AA 1F3VA 1JWWA 2MTLA 4ZN1A 5I42B 4DZ6A 3GSDA 3RW7A 3N5BA 1HQEB 4LFAF 2UXDJ 3DMJA 5EUHA 3RW6A 4QYZK 2LLZA 1N0UA 5DDPC 4BCAA 5KG0A 3HHLC 4ZPBA 3GWCA 4LR7A 4M5KA 1ZPWX 4Z37A 2IDEA 3G6XA 2DEJA 4CI0B 2G13A 4ZHRB 3PRBA 3KK1B 2QFIA 2Z2ZA 2KJWA 5D0RA 2GZOA 5LJ3Y 1IM6A 3M9MB 1RYRA 5ETVA 3RUBL 1VQPS 2KM8B 5BYQA 2L41A 1CULA 3AD9C 3DRSA 2CNLB 2CQPA 3ENWA 2WSFC 2OD4A 1U26A 1XNRJ 2QTWA 1WDDA 4OI6A 2CNKB 4XDDA 4O4RA 3KHLA 3D67A 4A8SA 1UVNA 1T8EA 1VQ6S 2V2ZA 5IT0A 4JI8F 3ETMA 4QW8A 4WBFA 2YNGA 2HKEA 3ZTPA 2HW3A 3L4BC 2PE8A 1EQ0A 3JTPA 2D74B 4K59A 2R7OA 3UN5A 3IM9A 4I2PA 4WKYA 4DPUA 2H4YB 4DWIA 3PR4A 2FY8A 1TVRB 1S9GA 2OH2A 4PR6A 3FEZA 1GMWA 2WBMA 4IG0A 4ANCA 3TUZC 3MR5A 3J7Z5 4TY9A 1BY9A 1LOUA 4I6YA 3N6NA 1ICEB 3KHHA 2B6AA 3LAMA 2BJ9A 2PI4A 3SCLE 3W5XA 1JLEA 3CD6S 4RR5A 4PG6A 3MCOA 1TV6A 2GMLA 4I7FA 1RT4B 1ZAXA 2MKKA 4CO3A 2BA9A 1N33F 5HBMB 1NK0A 1SKSA 2NXEA 1KFSA 5KFXA 4JUZA 3JAMY 1S79A 4ZDNA 3Q83A 2QLFB 1U7LA 1VQ7S 1VC5A 3I82A 2HVIA 4JP8A 2DRDA 1RTHB 1Q5YA 2XBPA 3VVUA 3T41A 2Q66A 3GYGA 4B9NA 3ULHA 5HATA 3EPGA 2UU9F 2E9RX 4DFPA 4DPOA 4NL5A 3R5GA 5F8IA 1JK9B 2CPYA 2FVSA 1MROB 1FF2A 2YKPA 4KT0C 3TO8A 2UVRA 3D6HB 2CZ9A 3AXMA 2OEMA 2XMUA 2LCWA 5B0DA 2W9BB 2ZM6F 1JXVA 3HKZD 2CXEA 3R8YA 4TNOA 1RGVA 2OELA 3W61A 3IG1A 5E7OB 1M5PC 3AA9A 1U2RA 2EFQA 3GJRB 4JI3J 2NYHA 4NLWA 3S01A 3NKYA 5DGBA 1NSPA 4DLEA 4YS2A 5GMEA 4TQRA 2W7OA 4O0NA 1WNEA 1NDPA 1WKJA 2YNIA 2FJWA 3ZFVA 1D9AA 4RW9A 1VK3A 1LKZA 4RUHA 4NXNF 2AJ1A 2EWHA 4OV1A 4ICLB 3W5YA 1JLCA 4KHRA 4ZVEA 3QSYB 2BW2A 3C6UB 3I0RA 4WK1A 2J8SA 2FLOA 3FEXB 3NNAA 1FO1A 4IRDA 3C19A 3TJAA 3BGFA 5D0EA 4I4BA 3J7YU 4NCGA 3KLFB 2H54B 2NS1B 1YJ7A 4LR9A 3LGMA 1UW9A 3UD5A 5DS7A 1H6KX 2D3O1 3Q8UA 1PG5B 4F3QA 3F0NA 3P5TL 4AL7A 4CLPA 2YH1A 3CDBA 1S1XB 1GQEA 2AX1A 1CJKB 2FVRA 3NEKA 3MEDB 4ZCKA 3PJ9A 3UFCX 1U1OA 1YIJS 2P9GA 3QIPA 3HHEA 4MKBA 4WFXA 4CO2A 1YJWS 1GEHA 1Y5NB 1S6PA 4HACA 3IA0A 2KG1A 3BREA 4OYXA 1A7GE 3NBPB 3ETOA 3ISNC 3G71S 2FJDB 3BB5A 1QY7A 5HI7A 5D78A 2MKIA 1YQHA 3HZEA 3CCRS 1VRTB 4X4SA 2AIRB 2HZAA 4WFAQ 1Q7LB 3VGTA 1S6UA 4K4VA 4ZITA 2VC1A 3CSKA 2ZH6A 3B4MA 2FJEB 4NMXA 1I3OB 1JIHA 1KQGB 3C46A 3MM6A 3W7BA 1GAOA 2HGLA 3IS9A 4FNHA 2DHGA 3MPVA 3TAPA 2UUBF 3A3PB 3CJKA 2AQ4A 2NYIA 5KFAA 1HNXJ 2PN6A 2ZH1A 4DR1J 3TA0A 2D9OA 3TA1A 3K89A 2JFKA 1FXRA 3CB4A 4UUWA 4DR2J 4P2XA 2XZWA 2J0WA 1YLXA 1O0PA 1YBUA 2PO4A 4OZ2A 2FLNA 3QT5A 3KMQA 3OTBA 4Y3CA 4NWBA 2GVZB 2AW0A 2DH9A 3WIUA 2CQCA 5HN0A 2R2RA 2VJVA 3ENAA 4Q0BA 2OIHA 4EO6A 2R7XA 3D0GE 4HI2A 5K9FA 5ADZA 5J2MB 4RW8B 2BDPA 2DR8A 1FKPB 4EFAC 4C0OC 3HT3A 2LP4A 1H2TZ 3CGIA 1HQ2A 1FDDA 4OX9J 2EVZA 2EFGA 4RW6B 2OEJA 5IV3A 3VVTA 3V81A 2MY8A 4HLBA 2KH9A 1MMDA 1KVIA 3N4WA 3JSMB 4JYAF 2WOMA 3CIMA 3DLGB 4QU6A 4IG3B 4XTTA 2Y8YA 5K5MA 2UUAF 3M1VA 5F8MA 4YOEA 3T5LA 4OYWA 3TX0A 3IG1B 5A8RA 2XB2D 1KQSR 2QZ8A 4PAAA 4OJGA 2GHWA 3Q8QB 3KK3B 4MK8A 2YQ0A 3BO2A 3EDRB 5BYSA 3TOQA 1TL4A 1VYAA 3OLAA 3RGIA 2B9YA 4EMDA 3PW7A 2QE5A 2MKCA 3OFHA 1LXJA 3D9BA 3HHDA 2UZAA 1YGYA 3AY0A 4NLGA 2ZVSA 2LA4A 3NS7B 1EKRA 3MFIA 1W7WA 3IP0A 3FBBA 1WHYA 2C3UA 2MKSA 3CCZA 3TAQA 1R8PA 2MLXA 1JJHA 1V3ZA 2MLZA 3H5UA 2X7IA 1DAXA 3JTOA 3MR2A 2AEFA 3CE8A 4NRTA 4KKOB 4TY8A 4YR2A 4DFMA 1B0PA 4X84A 5LOQA 4Y65A 1TU0B 1JLBB 2ZOFA 1ZM9A 2CYYA 4PYAA 2BXJA 2BE9B 2XMAA 5FLXY 1UPPA 3DLEA 2RE1A 2X1FA 4MIWA 2DEIA 4H54A 2BX6A 1AUDA 5AXMA 4LREA 1S10A 3OR2A 1AYEA 2F4FA 2QG9B 5J2PB 4YQWA 2W2MP 4ANEA 3NG8A 1L3TA 2UXCF 2E5LF 2YY3A 1WC5A 4N5SA 1QAYA 5A8KA 2DJWA 2HNZB 2H5JB 4DV1J 2OP5A 2Q43A 3VAGA 3J81U 4OMFG 4HT7A 3T5KA 1I51B 1V9OA 2C2ZB 4MIBA 1F2GA 3AD7C 1FJEB 3FFIA 1BWVA 2CPEA 4NMLA 3PHTA 2WRMA 2AGOA 4KSEB 4C8OA 4B3OB 1FK9A 1WI8A 4WIIA 1RT7B 2XNRA 3MECB 1ZPVA 1XERA 3SSSA 1VR6A 4M5IA 4DFJA 3F56A 5GAHI 5KFOA 2CDRB 3CJSA 4I67A 2SXLA 4JI1J 4ZCMA 1P6TA 4AQYJ 2VQEF 4C8ZA 1IQZA 4DUYJ 4ZVQB 2UXDF 1SJ1A 3BR9A 4O3NA 3ZXWA 3SI8A 3NGTA 1RBAA 1U0SA 4XPCA 4DUZF 3KLEA 4C8NA 2R7QA 2CJBA 3LALA 4P7VA 4NLYA 2IRXA 4OX6A 1KP6A 2D41A 1S1UA 1NH8A 2MZ1A 4F3OA 3VWSA 3M2UA 1SUQA 3DLKA 2BE2A 4IOAQ 1NLKL 1HNVB 3K5OA 3OXGA 1XN9A 3MCMA 4USIA 4PUOB 1U6FA 4E98A 1U47A 4ILLA 1HWJA 3D0HE 1JQGA 4YMEA 3QT7A 3DNCA 2X51A 3CDUA 3SCJE 3M8ZA 1XNRF 1I6JA 5FDLA 1BQXA 1QVGR 5KT2A 1HWKA 3ZC4A 1UVJA 4MJKA 5DRKA 3KNAA 4LRCA 2V67A 1EJ7L 4G6VB 3AJDA 5F9NA 1XR7A 2O66A 2VG5A 2EC0A 4KGMA 4ERDA 2NPFA 3SQGA 4ID8A 2P5VA 3OV7A 1VFJA 3OFGA 4MH8A 4WPAA 1LW0A 2YH0A 1X5TA 2D3ZA 1X9SA 2UVVA 2NR0A 1XK8A 4ZKAA 5L8RC 2Z2YB 3PFOA 3ZTOA 3R6LB 4WTOB 2RKIA 2FJAB 1WG5A 5BJRA 5KT7A 2CZ4A 3POTA 4M5HA 3CJTA 2WZ1A 4ZMMA 2LEBA 3GSIA 1EP4A 3IBWA 3EGZA 1CPZA 4JI4J 1FRKA 4O44B 2R8GA 3GZ7A 3MR3A 2EK1A 4ZVHA 3MMBA 3AODA 1HBNB 2OPRA 3QGHA 2J7UA 3WBZA 2VL1A 2I5JB 4F4AA 3I4PA 2V4JA 4KGZB 2NQPA 4UF4A 3SMZA 4NI2A 4F25A 1S7IA 3GV7B 1UMJA 1KSPA 2VC0A 4OI4A 3CC2S 1ZAVA 2BACA 3PO5A 5DGAA 2ZNZA 3PR5B 2CNOB 5C24A 2Q6BA 4QIVA 3NRBA 4H4OA 5AXNA 1C4CA 1VC0A 5C25A 1GNKA 3QZ8A 4C0HA 4DF4A 2F63A 1HBUA 2CDQA 3UNGC 5L1LA 1NEEA 4B3SJ 1NO8A 2IM1A 2O3DA 3EZOA 4OLPA 3BQ2A 4M5NA 2ZJQQ 1DQAA 2C2NA 3D2WA 2H48B 1C1BA 1HQUB 3MMAB 2CPZA 1FWLA 4JI3F 5RUBA 1N4LA 1R0AB 5K8PA 1T95A 1VQKS 2BJ8A 2HVDA 2BEFA 4BDPA 1KBRA 2VBYA 5G0RA 3U27A 4KH0B 3Q0AA 2ASYA 5HJYA 3BO3A 5FIIA 4M63A 3DRXA 3ZZUA 1J5EJ 4Y2MA 1BQMA 1PAUB 2CPIA 2RF2B 3FVYA 4UOFA 2YNFB 2AF6A 4OJHA 1NJZA 4CLZA 4CYUA 3C14A 4B9MA 2JZ5A 3UDCA 4FXWA 1OY8A 5G4DA 1TL7B 3WQPA 4A4JA 4CT8A 1RA7A 1XR5A 1RWOB 3L7PA 4C97A 4RW4A 1Z4UA 3NGSA 3UD4P 4FZVA 2VQFJ 4R8UA 3M30B 2A6OA 3PW4A 3DDNA 3MOZA 2FHOB 3EXYA 2OPSB 1Q7YT 1BE4A 1L5UA 2HFUA 3OL8A 2D3OR 2QSFA 1A6LA 5HJXA 3OJUA 6AT1B 3J80Y 1VQMS 1X5PA 2YBVA 3TX8A 5L9XA 3TVKA 1UFKA 5J2QB 1VS3A 3TRGA 1R6YA 2J5AA 3OFEA 5IS2A 2HHXA 4NA2A 1CBKA 4U7CA 2DGQA 1RUSA 3JQMA 5GAHU 3QRPA 3G6VA 2MQNA 2VUGA 4Y28C 3BN7A 2IMOA 3BQ1A 4S0MA 3JSYA 3R5CA 1B70B 3GYNA 2VJUA 4KGXB 3M8PB 4LSNA 3UCUP 2CPXA 4EU0A 5THWA 3CD5A 2WBRA 3GFXA 2MGZA 1ZH5A 4PG4A 5MLCV 2GJFA 1WKLA 4N77A 3V4IB 2XG8A 4QPXA 3RG6A 5K14A 4FN5A 1J5OB 3P96A 2DCUB 3MEEA 3IAS9 4CRJA 1HNXF 3MM9B 1JB0C 4DR1F 3VAMA 1RTJB 2YKQA 1FNXH 1MWQA 4YR0A 2XZTB 2CJYB 3GU0A 4DR6J 1QDUB 4Y2AA 3M2RA 4LMZA 3AOCA 2ZC3A 3MMCA 2VD3A 3TEHB 1NM2A 1MU2B 2V8HA 4UW2A 3DYAA 5T7LA 4ELVA 2XMWA 1Y11A 3KUGA 2WVDA 2V4JB 1DLOB 1EKSA 1UJ6A 2FHJD 3I0SB 4LF1A 4K0KJ 4MT1A 2CVEA 2KU7A 2XZDB 2F7VA 4OX9F 2YX4A 5L39A 4CTAA 3UW1A 1VQ8S 2F1FA 3M05A 5H1SV 1NSAA 5A0YA 2FHKA 5B7WA 1R8CA 2DXFA 1JLAB 1L3SA 4DU7A 2CQ3A 2GMHA 1KQKA 2JLEA 2XMJA 2RDDA 1UPMB 3W2WA 1UEUA 3VHQA 3QBCA 5E2QA 2F8EX 1FRIA 2JVRA 5D77A 1P9YA 3WX4A 4C0BA 8AT1B 2GO9A 2IVMA 2RUGA 1TL3B 2IMWP 4I6WA 1P1LA 5DQIA 4Q7AA 4YB6A 2KFYA 2YVSA 3FK4A 3GV5B 2MEWA 2C2DA 1SCJB 5EX0A 3LPEA 2R42A 2OUGA 4PCQA 3A4TA 1KS2A 3N5FA 1B64A 4KPYA 3E51A 4CLWA 3KKFA 5GAGI 2IAJB 1HW9A 2W7AA 2VDHA 4KRWA 1WC3A 1LWXA 1HPZA 5ETSA 3L09A 1YK9A 4F02A 3IC1A 5CH7B 3V6HA 3AH6A 2PEHA 3HCXA 1ZTTA 1HI0P 4X64F 3C14B 5HROB 3M2VA 1RDRA 2EKNA 1F60B 4ANDA 3HHLA 4IQXA 1U8WA 4HEA9 2FVPA 4CM2A 3JS9A 1AXQA 5JJBA 1TKTB 2OD6A 3ZNUA 1NK5A 2V6AA 3PJWA 4NLRA 3EGVA 1QSSA 1HYSA 2NREA 4USJC 2FLPA 3AQPA 1S5ZA 3TA2A 3W8GA 4CLSA 1JXLA 2G1HA 3HDSA 3OUYA 2LQBA 1S49A 2C2EA 4N56A 4DV1F 2GGPB 3ZZOA 1SV5A 3OVAA 2C2KB 1AW0A 3GCXP 3CIZA 1L3KA 2EBGA 2KXNB 2V94A 4DZDA 4A8KA 2BKPA 1RA6A 3HJVA 4L76A 5A2QU 2DPJA 1LNQA 3D3BJ 1QUPA 2H4WB 4LF4J 4HDGA 3VGUA 4NEZA 4K50A 1TUVA 4AQYF 3MUTP 1N8RT 1URNA 3DCAA 4LQ3A 4ID5B 4HKQA 3PV8A 3HKWA 4DUYF 3CMQA 2JNJA 2YKNA 3DRRA 2YWGA 4DQRA 1TAUA 3E01A 3MXHP 4EGLA 1Q0NA 2F8MA 5F8JA 4DL6A 1GMWD 2R8IA 2KRBA 2XTJP 3IBFB 1QSYA 5LMNJ 2OFGX 5KFFA 3CD0A 1QD1A 4JI2J 3HVTB 3MURP 3H20A 1WSRA 1WI6A 3PFEA 2NSCA 3PKMA 2QC3A 3IWLA 3DOLA 3M4XA 1KVKA 1Q95G 2NCKL 5ETOA 2V8PA 3DOMA 1NK7A 3NCQA 4OHYA 4RWXA 3OTDA 3DU6A 4B3RJ 2HBRB 2YQ1A 1OO0B 3MAAA 2DRAA 1NMEB 4OYZA 1U1MA 1MMLA 3W63A 4BS2A 3DI6B 5B0FA 2QSWA 1HKAA 3RB6A 4IO1A 2WSCC 4O3PA 3GCWP 2MYFA 4RPFA 2BV3A 2DNMA 4ZLPA 1REVB 3VZHA 1S6OA 4F7VA 3CNQP 1U24A 4AYBD 3RR7A 5A0YB 5B0CA 1ZAWA 4F36A 2DNYA 4CO1A 1U6ZA 1X4HA 1RYSA 2UV8A 2I6WA 1JJ4A 3BH6B 3KHGA 4KO0A 1D1UA 2PMZD 3WC0A 4KY3A 3ONQA 3P4UB 4NLXA 5EN1A 1XMQJ 4Z7CA 3HVAA 3BGRB 3OL7A 4YEAA 2GS8A 4EI2A 2IBKA 4P2MA 1UVKA 4XDCA 2MZSA 2WVEA 2MZQA 1NCLA 4FPIA 4F3MA 5IXUA 1WC1A 5IC6B 1AZSB 1VRQC 3RRGA 3S7RA 1UJ4A 1IKWA 3KK2A 5A8WA 3D54A 4JI4F 1MNEA 3TZWA 3DGVA 3I32A 3PM9A 4IOBA 3FBEA 3CTRA 5C42B 4X4OA 1RT5B 2ZH9A 1WACA 4L75A 3T1HJ 1N5YB 4B3MJ 1PJ5A 2ZHOA 1Y3JA 1Q79A 1KRPA 1CEZA 3CCLS 2EXUA 1Q78A 3NLCA 5HK4A 3TAMA 4ZIWA 2HFZA 1M5KC 2W2OP 2XULA 3NAIA 4DL7A 4BBYA 2CIMA 2EK6A 1SIZA 2U1AA 3QZ7A 1BQNA 4KAIA 3MM8B 2G2OA 3KYLA 4N76A 2HMIA 2UXBJ 1H7WA 2MLYA 1E6YA 1SQEA 1U0HB 2V9KA 1QLNA 4NZ7A 4IDKB 2DVIA 1FNMA 4X65J 3CCMS 5DDOC 3HI9A 2CJKA 1FWKA 1FWPA 1LWCA 2PMHA 3E3XA 2B43A 4MTPA 4ECWA 1VRUB 4B3SF 1WC6A 4IFYB 3KDNA 4RW7A 4EBDA 2HNYA 1HR0F 2I1RA 1FDBA 3BS9A 1JJCB 2MKJA 5LXYA 4LFBJ 5KFDA 1H2UX 2DB1A 2NXNA 4ILMA 5KFYA 1C0TB 1R31A 3R9LA 3KLGA 4UUXA 4F2RA 3BSCA 3C6TB 4ETZA 4C8MA 2AMCB 1N5SA 5D0HA 3G82A 4J9MA 1N54B 4OHVA 4J5OA 1WEZA 3AFGA 4K5RA 1VHIA 1J5EF 3M8SA 1QM9A 3NMAA 4HHUA 2B9WA 3FCWA 1PC4A 2VG7A 3T19A 2B0GA 4M5DB 3NGRA 2XNQA 1T03A 1F9EB 1WWHA 2A2DA 1KONA 2VA2A 3UVJA 4WXWA 1F5AA 4B08A 3ZZPA 2VQFF 2WW8A 1SC1B 1EARA 3QGPA 3PYDA 4U9RA 2LEAA 4DCPB 1XTZA 1AT1B 4J9KA 4DR5J 3NGUA 5JVHQ 2DR9A 4DQSA 4TLQA 1TKDA 3I4HX 3UN2A 1FRLA 8RUCA 3M6WA 1WOSA 4ECSA 2LKZA 3DOKB 2X1BA 3KTQA 3CCJS 3I31A 3CCSS 3NGDA 2MY7A 4NLTA 1YJ9S 4QIWD 2N82B 2H3EB 1I1GA 1DY3A 3FUYA 2QMWA 2ZBIA 1YDLA 2UUTA 3KLHA 2B7BB 2DGSA 4IH6A 3MMJA 3P8BB 3IR5B 4HYKA 5KT6A 2CQIA 2IHR1 2ZITA 2R2SA 3V6DA 1HA1A 1N36J 4FBTA 2HEKA 3W66A 4OHZA 4LIWA 4Q5VA 3EZ5A 5CXTA 2DXEA 3WZ0A 3CULA 3I5AA 2GIQA 2VH7A 2AD9A 5GAEI 5CD4A 2NZ4A 2HLTA 5L46A 3RBEA 2GHPA 1GX6A 3UCGA 2BJ7A 1UTAA 1JX4A 2J9EA 2HQIA 4DR6F 1C1CB 4JV1A 3OHAA 2K8GA 4C8YA 1QE1A 5HVFA 2YPZA 1VJWA 4Z7YA 1RAFB 1FE4A 4LRAA 4LIRA 1U1QA 4RUBA 3DRPB 3W62A 1WHXA 3FCVA 1RT2B 3JQKA 3CCES 4X4VA 2KT2A 3GILA 5CAAA 4CQ1A 1JXEA 3R6GB 4DQQA 4CDIA 2ZVIA 1U1LA 1HI8A 3M32B 3JYTB 1S48A 4DV3J 3THVA 4QZVB 5ETPA 2GVDA 4DU8A 3KXDA 3Q2TC 3Q8SB 2QLXA 4RNOA 3LP1A 3LGHA 2HGNA 1DQ9A 2HWTA 4OI0A 1NHKL 2VG6B 1TUWA 5KFEA 5IOLA 5D15A 4GKJF 5IT9U 4DV2F 5AT1B 4YHHJ 2G0CA 4LF2A 2H5IB 3LO3A 4ZCLA 1Q4RA 5F8HA 4TVAB 5A6PA 1QTMA 2QJ3A 4CT9A 4NZ6A 2DNNA 3C16B 3TEGA 1S6QA 4ECRA 2DISA 1EETB 2VICA 2X3DA 4HDHA 3JXOA 5A76A 1VBKA 2FUG9 4P9SA 1FXLA 5H9FJ 3PX0A 2HAFA 3QT6A 3VALA 2P8IA 2OJ3A 2EBEA 3W9HA 2GX8A 1S9EA 5IZHA 3VAHA 4TU8A 2L48A 4U8YA 2LVWA 4DSJA 3MPUB 4H4MB 1DTTB 1U09A 2ZD1A 1NJXA 5H9FK 9ATCB 4ETXA 4KGKA 4DS5A 2AJ0A 5KFZA 4C2MA 1FFWB 2DPIA 4V19X 3PJXA 1RKIA 5KFNA 3EM1A 4LBIA 4IOCQ 3N0VA 4P7TA 1JNRB 2BJ1A 5KFVA 1LV5A 4U96A 3D1OA 1IKVA 2XHCA 2VKRA 4QQBA 3D1QA 4USUA 2ZUGA 3F73A 1SIWB 5DLFA 2M70A 3U7JA 1PYOB 2KM8C 3VZIA 2ZNYA 4QWBA 1NB7A 4URSA 3LOUA 4JBCA 4MIAA 4FVCA 3SYZA 2W4DA 3TZXA 4DN9A 1T9UA 2FVQA 4ED7A 4DLGA 1JKHA 1RWWB 1OIAA 4J9UE 5IM0B 1WORA 3HK2A 3SDEB 3VAKA 3ICLA 4PQAA 1YRTA 5LSRA 3U1LA 1K73T 4ZJOA 2BANA 4V1Ak 2XSJB 1CJUA 3TUJC 1I5OB 2HRTA 1S1TB 2WVFA 5HLFA 1C0UA 3KLIA 2V9WA 3Q8YA 4LF4F 3W60A 1W2IA 3DHXA 2XMKA 2DNZA 4I6AA 3W8PA 1N48A 4DV4J 4FKXA 4X4NA 4Q8FA 2HG4A 3CO0P 3LWMA 4DV5J 1NUEA 3GG0A 2VIHA 4PZVA 3B54A 4DV6J 3C3LA 3PZPA 4ZS6A 2RJZA 4C4WA 5LMNF 3OR1B 3T9NA 3H7HB 2XQCA 4C3MA 4YP3A 5CA5A 2HFVA 3DGPB 1S0NA 1NZ8A 3QAEA 4U7UD 4LJMA 3P49B 1DTQA 4Q2LA 4LRDA 4WXOA 1C4AA 4ZP6A 3PW2A 3BO4A 1GTEA 2LECA 4B3RF 3THTA 2PC6A 4RBVA 4W92B 4AT1B 1N88A 2W4PA 3IGVA 2XMVA 4K2JA 1NSKL 3P45B 1AUSL 1T9TA 3H2LA 3BGLA 3NOCA 4EWTA 1NKCA 2V4QA 1CLFA 4Q8EA 2CFXA 3IN5A 4DQIA 3TNVA 4NA3A 1UVIA 1DQ8A 3I9ZA 4URGA 5DO2A 2V4RA 4ZPTR 3QFWA 4OYBA 2LQ9A 4OYIA 1HMVA 4GVBA 2KTQA 2ZBCA 1H3DA 1RWVB 1IBCB 3A8KA 3KUHA 4JB8B 1U4BA 2OSQA 4WP3A 5GAEU 2D69A 3LAKA 2FJBB 2ZZNA 1H98A 3VGSA 3AOAA 5J1EB 3OVBA 1WTFA 2YX7A 3IMQJ 3NMRA 1D0EA 3ADAC 3M8QA 1HNZJ 2M2BA 4DV0F 4ECQA 2XWYA 5KG2A 3H8YA 1CQMA 2QA2A 3QGIA 4DR3J 1E6VB 1IXKA 4DG1B 1B7YB 1YSJA 3T1HF 1NJIT 5I4MA 1I94F 1HL6A 4A8XA 2LA6A 4MFBA 2ZDOA 3S1TA 2J6UA 2PMWA 4EYIB 3IXQA 5L1KA 3ET6B 2VFTA 2YKMB 3C15B 4I69A 2IA0A 5F8NA 3G96A 4X65F 2AEJA 1VDHA 2BZ2A 2IRUA 3QRRA 4DSEA 3P6YC 4ZP9A 4PG5A 4UT4A 1HFEL 4WIQA 2B3TB 2V2KA 4FF4A 5CABA 3BDEA 5JUMA 3BYRA 4KBIA 1XNQF 3PEHA 1IKYB 2XYPB 3WX8A 1VK8A 1SJQA 2EC2A 4NEYA 5L9NA 4ED5A 1KEKA 3HF5A 3G8QA 4DUTA 2EI5A 3CJ3A 2ERRA 2QA4S 4Q2MA 1RT1B 1VGYA 1WF2A 4OV6A 4O3QA 3OQ2A 1RADB 1A9NB 3UO0A 4G1QA 3B6BA 3M8RA 3D66A 1X9WA 4X4QA 1FCAA 1S12A 4C11A 2F4VF 1IKXB 2E5JA 4I2QA 1X0FA 1OPIA 2FVCA 3LANA 3RAXA 2NSBA 4WP9A 2ZWPA 3AXKA 3GP9A 1IBLJ 2DY1A 1QAXA 3LP2A 1JLGB 4JI0J 1XMOJ 2FHJA 3AB2B 3TQEA 4J90A 4B9LA 2C42A 4KTQA 2E1CA 3UQSA 4O4GB 3G8TA 4NYOA 1K1SA 5F0WA 2XGQA 1PO6A 4WKRA 2CQDA 3RB3A 1RTZA 2W25A 3A3NB 3W9JA 1S72S 5IQQA 2JWNA 1Y5LB 5C5JA 1N34J 3ZTSA 3K5PA 3MM5A 3NL0A 2HURA 4CIOA 3AQOA 3MGJA 1SVDA 3FEYB 1L3VA 3UR3C 4ZCIA 3MHYA 4DS4A 3J7YI 4IR9A 3MM7A 1NZAA 2Y1LB 3BSOA 4TU7A 1WJ9A 5T41A 3IRXA 1CS4B 4KV8B 1N5TA 3OBIA 1PSDA 1FVSA 1OSDA 2WONB 5B0BA 2PFFB 2FPHX 2RILA 1RT3B 1GK8A 4TLRA 2Q1LA 1U45A 2XS2A 2E66A 3K8VA 2OPPB 5ETQA 4BWMA 3W2VB 5KFLA 1WKKA 2VB6A 4K2XA 3QRQA 4OX8A 3BDPA 5DG7A 1RAOA 2BVZA 1S76D 3KOAA 2CAJA 1LWEB 1OY9A 2HHQA 1LK7A 4CO4A 1N0VC 2KI2A 1PJ6A 1RTDA 4C6AA 1GT8A 4IUFA 1M5HA 3LGNA 3BPDA 4QR0A 2F5GA 3PACA 3OTOJ 2OGUA 3R1LA 3M9NB 4ZVUB 2BBEA 5AXKA 1BXNA 4Y2CA 2YWKA 2DGWA 1LWFB 1NJWA 2MQQA 4O23A 4PQUB 2CQ4A 1HD0A 2B5JB 3G8SA 2B4PA 4HH0A 2ROPA 3LQVA 2HS0A 5KFBA 4WE1A 4ED1A 4DV3F 2ACYA 4KFBB 2ZE2A 3D1HA 1UEVA 1H0HB 2Z2LA 3DFEA 2R7RA 1RT6B 2YX1A 3HHLD 2XM3A 2NXCA 2CG4A 2FHMA 2IYGA 4WZMA 1XBWA 2WW4A 3KLVA 2OEKA 2V8GA 3QO9B 2W2NP 4NCBA 3LP0B 3M7VA 3ITHA 4X4TA 4YHHF 1T05A 5HP1A 3HVWA 4LF9J 2ZKUA 5D4LA 4O3OA 2O5DA 1JLFA 4I64A 4P72A 2K1RA 3DDKA 4WK3A 3QATA 1UZDA 2KYXA 2NPIA 3NWGA 5DG8A 4MK9A 1T9VA 3FKBA 3ENVA 2AU0A 2HK3A 4HVZA 2L9NA 3PG9A 2AYGA 4IFVA 3EGWB 3H2VE 5KFHA 3WDOA 1W26A 2FIUA 3SXLA 2IFXA 2Z57B 1KOHA 1IR1A 1RHJB 1CJVB 2N3LA 1V5VA 2E7XA 2KVIA 1V3RA 2ZZMA 2BM0A 2IBOA 2W9CB 1TL1A 3MR6A 2MZJA 5HSPA 2DHSA 3I5CA 5E3PA 1S1VB 1YJTA 2OPQB 3MPDA 3WIVA 2V34A 2C2MB 4IH5A 1YJVA 3JQJA 2MQLA 1CVJA 5ETTA 5CZVA 4QWCA 1OQ6A 2YNHB 3EE3A 2DGOA 2DR5A 3GJTB 4FYWB 4R5PA 3NY0A 3SSQA 1S97A 3Q89A 4LFCJ 2FQQB 2HHPA 1BHNA 4ED4A 1TKZA 3GJSB 1N6QB 4M5JA 1G3OA 4UOGA 3PIPQ 3O5TB 3CJQA 1CG2A 5U47A 2H9ZA 3HSGA 2G2ZA 4CLTA 1D8YA 4JI5J 1H72C 4K5SA 1SL1A 2PD1A 3KJVB 5CYMB 1D9DA 2AX0A 4P6QA 5HQLA 2C3YA 2F3JA 2DR6A 3BGOP 1U25A 1SC6A 1P1TA 5KFMA 4A48A 5HAOA 3MEGA 1FDAA 1K0VA 4QYRA 1TTHB 4I56A 1XR6A 2M8DB 3NNHA 4DV6F 4A8WA 1YI2S 4OX7A 4DSIA 3PIOQ 3Q24A 1RTDB 3LA0A 4DR4J 1VLYA 3H90A 4ZVSB 2Y1JA 4FYVB 3DMJB 2B4OA 2VOOA 3H40A 2XS7A 2QT7A 2XLJA 3OPKA 1Q82T 3O2IA 3QYYA 1HNIA 5AJ3J 1TKXA 1RB0A 2Y8WA 3F41A 1LW2A 2MZRA 1RU1A 1XJWB 1HWIA 2OTJS 1U2CA 4N41A 3RBXA 1KR4A 2HBQB 5J1PA 2LDIA 4RLEA 4LVNP 2ZE2B 2VFUA 1K1QA 5F0UA 1U8SA 4PWDA 1CULB 3HJFA 4CH0S 2J6TA 3DRSB 3PYEA 2MHEA 5HVHA 2V68A 2JEGA 3A8IA 4GC6A 4DQPA 2L3MA 2NZCA 3X1LB 2PDAA 4KYZA 4ECXA 4ZVTB 4CZCA 3I56S 4M94A 1CC7A 5I3UA 4F4XA 2YWWA 1ROFA 2YNGB 3VGVA 2ASLA 4GO7X 3HX9A 2VV5A 1RBLA 2AKWB 2VASA 3TQ1A 2IY5B 5SZTA 4I2PB 5KFUA 1UJ5A 5E3QA 1HNZF 4FNIA 2ZZTA 1S9GB 1KVJA 2R9LA 1Y9OA 1SL2A 1UZHA 3ISND 3TR5A 4C7QA 2N3OA 3GFZA 4IG0B 5JMNA 4N47A 4DR3F 1PBUA 5IC4B 2D1CA 2B56A 2B6AB 5HMWA 4F0MA 1JLEB 2ABYA 2JH3A 4MKYA 1TV6B 4B9UA 4I7FB 2EFPA 2HVZA 4OYMA 3QAUA 1X60A 4ALZA 2JVOA 4X62J 1TFYA 1Z2ZA 2XWXA 1FKOA 3D0IE 3Q86A 1F5CA 2XY7A 2CWXA 3FZ2A 2MKYA 5KOWA 3GYXB 4QU7A 2JLFA 2FB0A 1CJTA 5A6WA 1GFWB 4I0WA 2IC3A 2DR7A 3GV8B 1ZZNA 3K17A 3MZIA 4CNYA 1IM4A 1R89A 4B3TJ 3SSRA 2AHOB 1AFIA 5M2PA 4Y2KA 5J2NA 4PEOA 3UN3A 1NAQA 5MAOA 3PX4A 4RNFA 3QWUA 3GFHA 4ITSA 4W98A 3S6EA 3EVMA 2QN6B 2Y9HA 5EWFA 1VLOA 2ZKTA 2FTRA 1V5IB 4A46A 2M0GB 2RRBA 1U1RA 3V2UC 2HBYB 3BBFA 3M6VA 4J9PA 2YNIB 3HM9A 1IBLF 4PWWA 2VPWB 1WHVA 3HD1A 4RW9B 1ZYQA 4JI0F 4DL4A 2V50A 1VISA 3IWXA 1WELA 1SPBP 2HIQA 3CO9A 3MOJB 1IBMJ 5H9EJ 3BZQA 1R8BA 4QIGA 1JLCB 4QJVA 1KLMA 1H38A 3FBCA 3I0RB 2XEXA 4HHJA 5KT4A 5DLGA 1P8GA 1V6HA 1OPZA 4MKVA 4WYLA 1RXOB 3IR6B 4NCGB 1PJ7A 1RTIA 2FZCB 1HBMA 5H9EK 3R3TA 2APOA 5KFRA 2VFSA 2AJQA 2E1PA 1S4FA 4DEZA 4UQGA 4WFYA 5E3AA 1UEKA 3GIIA 3RB4A 2HFSA 4OI2A 4A8YA 2AZ3A 1GX5A 5E3RA 1U1PA 1UWBA 2RS8A 3CCWA 4ZP7A 2KN4A 3QLHA 3QIPB 5KTQA 2Y0SD 2NLWA 5IWAJ 4NE9C 1X4GA 3L95X 1S6PB 2OSRA 4HACB 4ZPCA 2ILYA 3ILLA 1VJQA 2ZJPQ 3ILJA 3PXGa 4JV5J 2EFVA 2JOQA 4N8NA 1U6BA 3CT9A 3N9UC 3FDSA 2R2TA 1M1HA 5BR8J 1LEOA 3M6UA 3BSAA 2RVJA 2HLUA 3GJQB 3TW0A 5CCLA 3ILIA 2KVQE 2IRYA 4EBCA 3A12A 2DIVA 3CJ2A 3MM6B 5B0EA 4RL1A 1FD8A 3IS9B 2DGVA 2GIRA 3CJKB 2R7WA 1Y7PA 3MAHA 2C28A 2J76E 3OTOF 4LQ9A 5I42A 1PBAA 3KFWX 4ZJLA 4LBHA 1HQEA 2ZOGA 4PG8A 3G9CA 4DSKA 4JV0A 1UL3A 5F3TA 1KD1T 1H73A 1TK8A 1D9FA 2RMLA 2CJXB 2UVWA 2MSSA 2J0SD 2QX0A 4DPYA 1WF0A 1YRXA 4FDFA 4DL5A 3A13A 3EVWA 2AYMA 4ZHRA 3KK1A 4OZJA 4K7QA 4Q0BB 1Y10A 4EO8A 2LXUA 3RRHA 4CP5A 2B9XA 1H2VZ 2PA8D 1IUJA 4ILRA 3BM7A 4PPDA 4WFZA 1ITPA 3CJRA 2IC3B 4P10A 2D9PA 2B9EA 3DXBA 3PHEA 1B99A 3V81B 4RO0A 4C98A 4LF9F 4J9LA 2Z0GA 2WOMB 5J2NB 4F4KA 1UKUA 4FXVA 3PTWA 3FQLA 3CJ8A 2E9TA 4ZPWR 5K8OA 3M1VB 3KG1A 4QW9A 1Q8BA 3HZGA 3A3OB 2DKOB 4NPOA 3W1YC 2UUAJ 1RAGB 3UDEA 2WHOA 5A8RB 4C9DA 3BEGB 5EDWA 1TVRA 4C3KA 4F0KA 1NDLA 4RNMA 1NDCA 4ENOA 2ZFHA 3SBMA 1FJCA 2JHEA 5M2RA 2RNEA 4Q45A 2GAHC 4A8MP 3MTJA 4DPWA 4ZLJA 3TVZA 1VIXA 2B4UA 5KFIA 5B08A 3ISZA 5DZ7A 3GR0A 2G2YA 3T3FA 4DX6A 3RBZA 1MSWD 4DCJB 2UV8G 2VFVA 2M3DA 2YKAA 1RT4A 4PXCA 1X0PA 3C66A 1M0SA 2QLWA 5HBMA 5D0GA 2DO0A 4OZNA 4NLSA 4OZ0A 3J81Y 1YG0A 2V2VA 2MJUA 3EZUA 1FHTA 2M4MA 3FSYA 5KFQA 4TY8B 1RTHA 1S9FA 4AFFA 1EQMA 2DITA 2Q79A 3HHKA 4NA1A 4LFCF 3DLEB 2XCPA 2O67A 2QYCA 4MK7A 3Q8RB 1FA0A 1OJ4A 1R3NA 3KJNB 3OR2B 1MROA 5DDQC 4FF2A 1RHMB 3K59A 4JI5F 3VAJA 2W9BA 2V63A 1GMVA 3RJMB 4P2SA 3BPSP 2XGPA 2QFJA 9RUBA 2HRUA 5A8KB 4B02A 4HHHA 4CLUA 1HLWA 3Q2SC 1SJFA 3D4JA 4C3LA 3JAMU 2DNPA 4Y0FA 3AB4B 2HVEA 3L9ZA 3FFIB 5EHHA 1O51A 2RS2A 2LXFA 2JJ4D 2RU3A 1APSA 1FK9B 4U95A 1F9FA 7FDRA 1ZM2A 1T3OA 4NASA 2JRSA 4OZLA 2E5GA 2BOPA 3KNGA 1Q16B 1VQOS 4DR4F 1NBEB 5KAKA 4GKKJ 2GIFA 1R27B 4OHWA 5L38A 3MUMP 2VQEJ 4ICLA 1PILA 1WHWA 1NK4A 3SZ2A 3C6UA 1VQ5S 1YX2A 3OTCA 4M5LA 4EK2A 4XPEA 3KLEB 1U2FA 2KO1A 3ZO7A 1C2PA 3OSPA 3G87A 4G1PA 4DUZJ 3O44A 1S1UB 3KLFA 3CC7S 4NLOA 3NCPA 5AJ3F 1KC8T 1RHQB 1RCOB 2I2YA 2IJNA 4ZPVR 3M2UB 3P3DA 4Y2IA 1SUQB 4OI1A 3DLKB 2BE2B 2R8HA 3NNCA 3H5YA 4USWA 4QWDA 3SCIE 1BGXT 1F2HA 2X1GA 3GB0A 2HZCA 1M90T 1S1XA 2CRLA 1CJKA 3SFGA 3MEDA 4HT5A 4WFNQ 2FGCA 1KWMA 4DJBA 5FDLB 1F1BB 4JI6J 4GRSA 2JL9A 4QOTA 3EYZA 4DR7J 2OHDA 2XO6A 1YZ7A 3ZZZA 3MUVP 2EEYA 2XY6A 2ZHBA 5KFCA 1GTHA 1KQFB 3NBPA 1T02A 4EUVA 1EHWA 2VG5B 1M5SA 2R7UA 2V69A 3SQGB 4J91A 1S99A 1V3SA 3OXFA 1LW0B 1PCAA 5DQGA 4ED0A 3MI7X 1VRTA 2YTCA 4K4SA 5IQ6A 2RKIB 3H42A 4TYBA 3HT0A 1O6XA 1P9QC 1VBXA 2AT1B 4ECZA 4J9OA 3POTB 3HVRA 4KC5A 2KHDA 4GC7A 2DNQA 3VCDA 1HHTP 1EP4B 3NCRA 4FPRA 2H5EA 1FRHA 1NB2A 4KJIA 4DR2F 3DKDA 3MMBB 2V2QA 3DXSX 2A2CA 4X62F 3GLJA 4LF5J 1SJ4P 2OPRB 2POKA 4F50A 2QV6A 2HK2A 1KN6A 2GVZA 1X4DA 2GQCA 2JX2A 4DF8A 1SI9A 2KB2A 1TUGB 1X4BA 4EZ9A 1MWZA 2WB1D 4NI2B 5FD1A 1GXUA 4MKAA 3V6KA 4F4ZA 4J9SA 5J2MA 4RW8A 2BJ3A 3QJPA 5KG1A 3AT1B 1FKPA 1O8BA 4L3NA 1EIYB 2ROEA 8ATCB 1NPKA 6FDRA 3IFEA 3R2DJ 4M8LA 1VQ4S 4B3TF 4X2BA 3HSDA 4TQSA 5C24B 3TUPA 2C2RA 4RW6A 4H4OB 1FJGJ 5C25B 1NK6A 4ELUA 2E5IA 3JSMA 1HBUB 2V0NA 1IN0A 1YJUA 3KJQB 1Q86T 1NPPA 3DLGA 4UZBA 5AE1A 1SKRA 4IG3A 3DDIA 1YRUA 2HS4A 1OYEA 1N5QA 4C8KA 3RU0A 4B9VA 4YDDB 1T3NA 3HP6A 1C1BB 2IDLA 2UVUA 2J7WA 4FVMA 2DGTA 4U6PA 3KK3A 3R1HA 1UAWA 2VU5A 4UY8T 4FYDA 4ZP8A 3R5BA 4CH1A 4U67Q 5I3PA 3FRZA 5G0RB 1N5VA 4H4KA 2RAQA 2KXHA 4OJ3A 2ZC4A 4LF6J 1Z2LA 2WCXA 1PGZA 4E0DA 1BQMB 5L1IA 2GAGC 1IBMF 3G6ES 2QIFA 2BJDA 2F40A 4RU2A 2HSEB 1VC6A 3A8JA 3UE2A 2FC8A 2DGXA 4CYUB 4ZA1A 1VBYA 5ETNA 2J8AA 4RUAA 4HL9A 3BF4A 5EWGA 4IR1A 1VHFA 2YWFA 2AJFE 4RW4B 1FEEA 4KKOA 4R8UB 2N4DA 2BR0A 1JLBA 4TYAA 1SH0A 4FYXB 1WOOA 1VQ9S 1UCNA 3AJ2A 3L7UA 1Q1KA 2NXJA 2CJAA 1X4AA 3JTNA 2BKOA 2IPOB 4AE5A 2BE7D 2MKHA 4ES3A 2F8HA 5IWAF 5J2PA 3R7NB 3QJLA 1NHVA 2CQBA 1NU4A 2VKZG 4KE5A 2CA9A 3IAM9 2HNZA 3FSXA 4JV5F 1BLUA 1B7FA 2X1AA 3LWLA 2ADBA 4CM0A 2A6MA 2RD5C 3MEKA 5BR8F 2QGFB 4U8VA 4Y6IA 1SBRA 1SC3B 4LSNB 1X7VA 2MPUA 3SCKE 4B3OA 4C8LA 2MGZB 4YUDA 1KNZA 3HSJA 1RT7A 4JI1F 3MECA 2J9DE 3D3CJ 5DETA 4DN0A 2WSEC 4CLKA 4WU2A 5FLXU 2XS5A 2Z58B 1CSJA 5K14B 3MEEB 2NXUA 3K2YA 1TMMA 3B78A 3TJ9A 2N4CA 4DL3A 1SQFA 1SJRA 3T6BA 3M2RB 5LSLA 4ED2A 3D6MB 3D7SB 1FI4A 2QA4G 2MMYA 1FNOA 4L72B 3MMCB 2F9DA 4USKA 2RT3A 3EVOA 3DYAB 2VOPA 2ZH4A 5T7LB 2UUCJ 1HNVA 5F41A 4EEYA 5DM6Q 4QWAA 1LXNA 4PUOA 5KFGA 4EYHB 4QCLA 3K5LA 2CWKA 1YVFA 2A0FB 2KFZA 3THPA 3B4DA 3VR1A 2MQPA 3Q8PB 3MF5A 4NCAA 3MPYA 4CTAB 5K8MA 2EPIA 3GONA 4WF9Q 2UP1A 1ULRA 2MQMA 4DV7J 3W2WB 4PXEA 3TP2A 3G4SS 2OFHX 2OKQA 2M7SA 3CJ4A 4PABA 1T11A 3PDNA 1QVFR 5KFTA 4FP9A 2JFDA 2B4VA 2KDOA 3NWRA 2RUSA 4IQMA 1KOOA 5DJBA 2B51A 2L08A 1Z1ZA 3NAHA 4PWUA 2HIYA 2ALYB 5F3ZA 5D4OA 4MYUA 4OJ1A 1EZZB 4O0IA 3NOGA 3R97A 1CQNA 3MCSA 3BBBA 2CQ1A 5HMZA 3CUNA 4DSFA 3QJJA 1UW4A 1IJFB 4OIXA 5M2UA 4O44A 1T94A 3TZZA 3DHWC 4MYTA 1S0OA 2WVCA 1HBNA 1HPZB 2IM0A 2HZVA 2ZHAA 1JNZB 2C1EB 2I5JA 1HARA 3RZAA 3HFZB 2RDIA 1SKWA 3M2VB 3IO1A 1R8HA 1AROP 2GHVC 3HHLB 4X64J 1JMTA 5A2QY 3CC4S 3CJ0A 3QMQA 2RQCA 4OYAA 3V4MA 2QRRA 4U7UK 3U02A 3FMWA 4M5MA 2LU1A 1VIOA 5D4NA 2AJ4A 1HYSB 3A1YG 5ETLA 4DX7A 1BMQB 4NXMJ 3FGVA 1ACMB 1TMJA 1NRKA 5LMUJ 1PKUA 3SV3A 1MLAA 4TU9A 1OYDA 3F44A 4HR2A 2BRKA 2W01A 3OUYB 1RQ0A 4PG7A 3R5DA 3UDLA 2GV1A 1SV5B 2CPDA 1YBAA 4F04B 3K0JA 1TL5A 1HQUA 3MMAA 3MD1A 1HNWJ 3NXZA 2DD8S 5K8NA 2J0XA 1R0AA 2BUNA 4DXLA 4O3SA 3ENQA 4E2FB 3K5MA 3FRYA 3OXLA 3G2XA 4NOHA 2HAIA 2PSZA 4L3KA 1RWKB 5DQHA 3EICA 1OS5A 4GKKF 5D8HB 4OHXA 3D28A 2ZH8A 3GIMA 3EGNA 1QJHA 2YKNB 3DRRB 2RF2A 4XK8C 1RAHB 4D3GA 2LQ5A 3E01B 2YNFA 3H5SA 2Z56B 4YFUA 2K7JA 4YY3J 2P6TA 5LL6d 1TL7A 1WD6A 3DOLB 3CDEA 3FCHA 5KG4A 3CDWA 1PC5A 3M30A 2UUWA 2K2PA 2V5HG 2OPSA 3DOMB 4J9NA 2CNNB 2E1RA 4G3IA 3MAAB 1LFPA 2RIJA 1QAIA 5CYQA 4JI6F 5IT4A 2JDJA 3PO4A 4DR7F 4DX5A 4QPTA 3BKUA 5J2QA 3EJMA 3N28A 2XO7A 2J9DA 1KTQA 5EGYA 2JC1A 2LQJA 3UWTA 4FF3A 1N32J 3D68A 3VV2B 2DO4A 4JV2A 2HHSA 1RACB 2IM2A 4KO0B 2VF3A 1FXDA 2DNGA 5AXLA 4X66J 1UFWA 3G6YA 3M8PA 3MDFA 2A18A 1S0MA 3CVKA 3K7RA 1JJ2R 5C2GA 2P9CA 2I9SA 2ZEJA 3RB0A 2J0QD 1WUUA 3V4IA 2PEBA 2CPFA 4YR3A 4CH7A 1R0CB 2MJNA 1IKWB 1J5OA 3KK2B 5A8WB 3KG4A 2DXDA 3J80U 3K8WA 3MM9A 5KFKA 1HHQA 5KG7A 1RTJA 3MD3A 3OL9A 2HNDA 3FC9A 4LF5F 4NZ0A 2B8QA 3Q22A 3AA8A
chains in the Genus database with same CATH topology
1URRA 1HWUA 4WJBA 1K1QA 1L3KA 2EBGA 1U8SA 2Y1RI 5F0UA 3TAMB 2Z2MA 2KXNB 1MU2A 2JEJA 2V94A 4PWDA 3HJFA 3ZZTA 4CH0S 2J6TA 4X4VA 3DRSB 4A8KA 2E7WA 1RA6A 2MHEA 2E1MC 3G86A 3HFKA 1FVQA 3UPFA 3KWMA 2KHCA 4K0KF 1R7IA 2JEGA 1DLOA 2DPJA 4GC6A 2W9CA 4DQPA 1QUPA 1BQNB 3M6XA 2L3MA 2M88A 4GMKA 3I0SA 4UQTA 4HDGA 2HMIB 3X1LB 2W8LA 2PDAA 4URQU 1GH8A 1X4EA 4K50A 1E6YB 3JSRA 5I3QA 4ECXA 1KLMB 4B17A 5E41A 4CZCA 3T6JA 1S1VA 3GR1A 3I56S 1TUVA 2XLIA 4M94A 1IR0A 4AQYF 3QGGA 3MUTP 1CC7A 5I3UA 1N8RT 1URNA 6FD1A 1SJ3P 4F4XA 2OPQA 3DCAA 1ROFA 2YNGB 2ASLA 4LQ3A 4ID5B 4HKQA 3PV8A 4KB7A 1LWCB 2CQ2A 4GO7X 3HKWA 3LPYA 3HX9A 4DUYF 1FJGF 2VV5A 2VASA 3VQSA 1RTIB 2F9JA 5CD4H 1QSLA 1HBMB 2YKNA 1Y3KA 2XMMA 3DRRA 3TQ1A 4KHPF 5SZTA 4I2PB 1JLAA 5KFUA 2YWGA 1UJ5A 2OLWA 5E3QA 4LF8F 4PPZA 4DQRA 2YWHA 3E01A 3MXHP 1TAUA 1HNZF 4EGLA 4FNIA 3EPIA 1S9GB 2F8MA 3V5RA 4DL6A 2AP6A 2KRBA 2R8IA 3MTKA 2YNHA 4RW7B 2R9LA 2EFNA 1Y9OA 2HNYB 1QSYA 1SL2A 4NLDA 2OFGX 4OQJA 5KFFA 3ISND 3TR5A 4QR1A 2RQ4A 3CD0A 1OWXA 4C7QA 2N3OA 3GFZA 4IG0B 1U1KA 3FZBA 3H98A 3IRWP 2GQ2A 3HVTB 4HH1A 3OSNA 1U48A 1RP5A 3MURP 3H20A 3KG0A 4DR3F 4N47A 2RQKA 3H5XA 3QPIA 1WI6A 3PFEA 4V19J 2NSCA 3PKMA 5BYRA 1UWBB 3IWLA 2D1CA 3DOLA 2R7VA 2B56A 3M4XA 1N6QA 1TL3A 2MZTA 2B6AB 1BWEA 5HMWA 3KLGB 1X5SA 3QLHB 1JLEB 3FQKA 2ABYA 3DOMA 4ECTA 1FT8A 1NK7A 5E5NA 3NCQA 1QAJA 2JSXA 4OHYA 4RWXA 3GG1A 2JH3A 4MKYA 2DHXA 1TV6B 2GJ2A 4B9UA 4I7FB 3OTDA 2MB0B 3DU6A 2DRAA 1J2VA 1OO0B 4WU3A 3W3SA 2EFPA 2HVZA 2KYZA 3QAUA 4RU9A 4FS2A 4TXSA 1U1MA 2IYIA 1TK5A 3I96A 3I87A 4ALZA 2JVOA 3MFHA 4LF6F 1MMLA 4BS2A 3DI6B 5B0FA 3KJVA 5CYMA 2QSWA 1TFYA 3RB6A 3OTEA 1Z2ZA 4IO1A 2GO8A 2WSCC 2XWXA 4O3PA 2M52A 2MYFA 1FKOA 2BV3A 5HMYA 2IAJA 2DNMA 4ZLPA 1REVB 3D0IE 4EBEA 1RI7A 3VZHA 1S6OA 1F5CA 3I9V9 1X9MA 3E2EA 1U24A 4AYBD 2XY7A 3RR7A 5A0YB 5B0CA 2VG7B 3PVXA 1ZAWA 3FZ2A 3PEJA 2DNYA 5KOWA 5EWEA 2I8EA 3GYXB 4QU7A 3TARA 4CO1A 2IJFA 2AWZA 2JLFA 1U6ZA 2FB0A 5AE3A 5A6WA 5L1JA 1X4HA 3JB9k 3RBDA 1T03B 4I0WA 1RYSA 2UV8A 1BC6A 2IC3A 1JJ4A 2DR7A 3H59A 5HROA 3KHGA 3GV8B 1ZZNA 4KO0A 5SUHA 3I6PA 1D1UA 3OFFA 2PMZD 3WC0A 4H4KC 5F8GA 5LJ5Y 4QYZJ 3ONQA 3MZIA 3AHPA 4CNYA 1IM4A 2DRBA 2B7CB 1WG4A 1R89A 4NLXA 3SEOA 4B9SA 5EN1A 3R27A 3J7ZT 2GQQA 3HVAA 3BGRB 3OL7A 3SSRA 1AFIA 2E1AA 4YEAA 4HTJA 5M2PA 1JWWA 3MPWA 4Y2KA 2IBKA 4W90B 1UVKA 5I42B 5J2NA 4XDCA 3GSDA 2MZSA 3RW7A 1TKTA 3N5BA 1HQEB 4CCHA 1NAQA 2MZQA 4LFAF 2DTJA 3DMJA 4F3MA 1ZETA 5EUHA 5IXUA 3RW6A 5MAOA 1WTBA 2CQHA 3PX4A 4RNFA 3RRGA 3S7RA 2LLZA 3QWUA 1UJ4A 1IKWA 4RNNA 1N0UA 3GFHA 2N7CA 4ITSA 5DDPC 2KZMA 3KK2A 5A8WA 4BCAA 4FF1A 3D54A 5KG0A 4JI4F 1MNEA 3HHLC 4ZPBA 3S6EA 4DOZA 3GWCA 5CYQB 2HHUA 3I32A 1ZPWX 5EWFA 4O3RA 3PM9A 4Z37A 4IOBA 3G6XA 4CI0B 2G13A 3CCUS 2ZKTA 4ZHRB 1HW8A 2FTRA 3CTRA 5C42B 3PRBA 5F9LA 1RT5B 4X4OA 3KK1B 2ZH9A 1WACA 4OZ5A 1N5YB 4CO5A 4A46A 2KJWA 2GGPA 2M0GB 2RRBA 5CZXA 2ZHOA 5LJ3Y 1FESA 2PT0A 1Y3JA 3M9MB 1U1RA 4KHMA 1RYRA 1Q79A 1KRPA 1CEZA 3CCLS 3V2UC 1Q78A 1VQPS 3NLCA 2KM8B 2E5HA 3M6VA 3TAMA 3KLHB 5BYQA 2L41A 1SL0A 4J9PA 1FKAF 4WZQA 3DRSA 2YNIB 4Y00A 2CQPA 2HFZA 4F4WA 3ENWA 3HM9A 1IBLF 2WSFC 2OD4A 2MSTA 1U26A 2VPWB 1M5KC 1WHVA 3O8WA 1FERA 4RW9B 1ZYQA 1G2EA 4JI0F 4DL4A 1S1WA 2XULA 1Q53A 3NAIA 4BBYA 4DL7A 2CIMA 2EK6A 3PRDA 1SIZA 2U1AA 3IWXA 4OI6A 1WELA 3V6DB 2RRNA 3DLJA 3QZ7A 1BQNA 2HIQA 4XDDA 3CO9A 4O4RA 3KHLA 4A8SA 4KAIA 3MM8B 3KYLA 2DNKA 3H4BA 2HMIA 4N76A 1UVNA 3MOJB 5H9EJ 3BZQA 1R8BA 1X8DA 4QIGA 1H7WA 1E6YA 1SQEA 1Y0HA 1JLCB 4QJVA 2V9KA 1FEHA 1KLMA 1T8EA 1H38A 1QLNA 3UCZP 4NZ7A 4IDKB 2DVIA 1VQ6S 1FNMA 3I0RB 3CCMS 5IT0A 5DDOC 4JI8F 2XEXA 3HI9A 4QW8A 2CJKA 4HHJA 2YNGA 5KT4A 5DLGA 4ID5A 2HW3A 3VTIA 2PE8A 1P8GA 2DHAA 1LWCA 1V6HA 1Y00A 1OPZA 2PMHA 4ZPAA 3JTPA 2D74B 4K59A 4WYLA 2R7OA 3E3XA 4R0EA 2B43A 3IR6B 4KQZA 4NCGB 4FS1A 1RTIA 3HMJG 4MTPA 2WTFA 4ECWA 1HBMA 4JOUA 4I2PA 3US5A 4WKYA 1M5OC 4ELTA 3R3TA 1VRUB 4B3SF 2APOA 5KFRA 2VFSA 3PR4A 4DWIA 1S4FA 1TVRB 2VODA 4IFYB 2AJQA 4IYQA 4DEZA 1S9GA 4UQGA 4WFYA 2DBBA 4RW7A 5E3AA 4JI2F 5IT9Y 4EBDA 2HNYA 2HNDB 5D3GA 2OH2A 4PR6A 1HR0F 3FEZA 3GIIA 2I1RA 1FDBA 3BS9A 3RB4A 2V8VA 2WBMA 4IG0A 2MKJA 4OI2A 5LXYA 3HVTA 4A8YA 2LXIA 5KFDA 1H2UX 1GX5A 3TUZC 1QE1B 3MR5A 2DB1A 5E3RA 3J7Z5 2HFNA 4TY9A 1G6BA 1U1PA 4ILMA 4BHQA 1UWBA 2V8DA 5LT5A 1BY9A 1LOUA 2RS8A 4I6YA 3V6JA 3N6NA 3CCWA 2UUCF 3KHHA 2B6AA 1C0TB 4ZP7A 5KFYA 1NJYA 3LAMA 3IWNC 2PI4A 1R31A 2KN4A 3KLGA 3E8OA 3QLHA 3O6QA 4UUXA 1JLEA 3SCLE 3QIPB 3CD6S 4F2RA 3BSCA 3CPWR 3C6TB 4PG6A 2Y0SD 2NLWA 5KTQA 4ETZA 1FRXA 4C8MA 1TV6A 2GMLA 4I7FA 1RT4B 1ZAXA 2MKKA 1X4GA 3L95X 1S6PB 2OSRA 4CO3A 2BA9A 4ZPCA 1N5SA 2ILYA 2K7KA 5HBMB 1N33F 2J7KA 4WTYA 4J9MA 2VPYB 1NK0A 2ZJPQ 1SKSA 1N54B 3PXGa 4OHVA 1KFSA 3DI6A 4J5OA 5KFXA 1WEZA 2YKOA 2EFVA 2JOQA 4K5RA 4N8NA 1U6BA 1J5EF 3M8SA 1QM9A 2COLA 4JUZA 3N79A 3U1MA 4Q44A 3CT9A 3JAMY 3N9UC 3FDSA 3LP1B 1S79A 3NMAA 4ZDNA 2R2TA 2ZOMA 1U7LA 1REVA 1VQ7S 2B9WA 1VC5A 3OW2R 3M6UA 1PC4A 3I82A 3BSAA 2HVIA 2VG7A 2RVJA 5DM7Q 4DV7F 2HLUA 1RTHB 2B0GA 4M5DB 3T19A 3TW0A 4LUBA 2HWHA 1FTRA 2XBPA 2Q66A 4RBUA 4B9NA 3ULHA 5CCLA 3OL6A 2ZH5A 1BD6A 2XNQA 2IRYA 4EBCA 1T03A 3EPGA 2DIVA 1TP7A 1XMBA 1XMQF 2UU9F 1WWHA 1S7HA 2A2DA 3CJ2A 3MM6B 1KONA 2R8JA 4DFPA 3H2UB 5B0EA 4DPOA 1FD8A 2VA2A 4FBUA 2E9RX 3IS9B 4WXWA 4NL5A 1LQ9A 5F8IA 1F5AA 4B08A 3ZZPA 2DGVA 2VQFF 2WW8A 1JK9B 2GIRA 2AGQA 3LUYA 2E9ZA 3CJKB 2CPYA 3BGRA 2R7WA 1Y7PA 5CQGA 3MAHA 2C28A 2J76E 3QGPA 2FVSA 4U9RA 1MROB 1FF2A 2YKPA 4KT0C 4LQ9A 1S6QB 3OTOF 3TO8A 2LEAA 5I42A 2UVRA 1UETA 1XTZA 4J9KA 2JEFA 3KFWX 2XMUA 1HQEA 2LCWA 2ZOGA 5B0DA 5JVHQ 2DR9A 2ILZA 2W9BB 1ZTWA 4PG8A 2ZM6F 4DQSA 3DLHA 3G9CA 4TLQA 1HBOA 3HKZD 1TKDA 4DSKA 5HO4A 4JV0A 2FDNA 1UL3A 5F3TA 1KD1T 3I4HX 1TK8A 1D9FA 2RMLA 4TNOA 1FRLA 1RGVA 3H25A 2UVWA 2MSSA 2OAUA 3M6WA 3IG1A 1S9EB 3IGNA 1RKJA 3J7A1 2J0SD 5E7OB 4ECSA 2A3JA 1MWYA 1WF0A 2O01C 2LKZA 3DOKB 2X1BA 3KTQA 1M5PC 3CCJS 3I31A 3CCSS 3NGDA 4B3MF 1YRXA 3AA9A 2MY7A 4NLTA 3OVSA 4DL5A 1YJ9S 1U2RA 2AYMA 4ZHRA 2EFQA 5C42A 1RT5A 3KK1A 2ZD1B 4OZJA 4PRFA 4Q0BB 4EO8A 2LXUA 2R2UA 1N5YA 3U1NA 4NLWA 3RRHA 3S01A 4QIWD 3NKYA 2N82B 5DGBA 1I1GA 2B9XA 4DLEA 1H2VZ 2QMWA 2PA8D 1IUJA 4ILRA 3BM7A 2ADCA 2ZBIA 4TQRA 4PPDA 2GCFA 3K57A 2W7OA 4WFZA 2UUTA 3KLHA 1WNEA 4ECVA 2B7BB 2DGSA 3DM2A 4IH6A 3MMJA 2BABA 2YNIA 2PIIA 4PXBA 4HYKA 3IR5B 2FJWA 5KT6A 3ZFVA 5IFMA 2IC3B 2CQIA 1D9AA 2IHR1 4IKAA 4RW9A 1VK3A 1VOMA 1LKZA 1KFDA 2UXBF 2ZITA 2D9PA 4RZRA 2R2SA 3V6DA 1VQSA 3DXBA 3PHEA 4RUHA 3V81B 4NXNF 2AJ1A 2XI3A 3C8YA 2EWHA 3MM8A 4OV1A 1IKVB 1HA1A 4ICLB 4C98A 4LF9F 2OMLA 4FBTA 2QO3A 3VAFA 1JLCA 4KHRA 4ZVEA 4J9LA 2BW2A 2Z0GA 4IDKA 1TK0A 2WOMB 3C6UB 5J2NB 2CQGA 4OHZA 4F4KA 1UKUA 3I0RA 1XEZA 2HGMA 4LIWA 4WK1A 2FLOA 4Q5VA 4FXVA 3EZ5A 2XY5A 5CXTA 3WZ0A 3FEXB 3FQLA 2JC0A 2E9TA 3NNAA 1FO1A 4ZPWR 5K8OA 3CULA 4IRDA 2VPZB 3BGFA 2XC9A 3I5AA 3KG1A 3M1VB 2D7SA 3CD7A 4QW9A 2GIQA 1Q8BA 2VH7A 2AD9A 3HZGA 4I4BA 4NCGA 3J7YU 4NXMF 4CO0A 3KLFB 5GAEI 2NZ4A 2HLTA 5LMUF 4NPOA 4NLQA 5F8LA 2J6SA 2WHOA 3RBEA 2NS1B 2GHPA 1VRUA 5A8RB 1GX6A 3UCGA 4C9DA 3BEGB 5EDWA 1TVRA