3FMFA

Crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
229
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
molecule keywords Dethiobiotin synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
total genus 73
structure length 229
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmfA00
3KQHA 3OF5A 1QVAA 2VEDA 3RSOA 4MRNA 1F3OA 2A3RA 3QSYA 1FQKA 2O52A 4JKYA 5FH9A 2OO7A 3RABA 3VHXA 2JAQA 1ZM4A 1NP6A 3SBEA 4NZYA 3K0AB 2FG5A 4B47A 2XSZD 4Q1FA 4LC0A 3A8TA 1NY6A 4Q7LA 3HP1A 2ZSAA 3U5ZB 5G53C 1FNNA 5EZ5A 4C0JA 1SQ5A 4DCSA 1N0WA 1OIVA 2YVUA 1U8YA 3K53A 1Z0FA 1O3YA 2IYLD 3SN6A 1XMIA 2W6IA 2GF9A 3X1ZA 1II8B 4UNQA 3U7EB 5EE5B 2ATVA 5H70A 1IN4A 5AUNB 2ZEJA 3NC0C 2CLCX 1G16A 5EE1A 3TW8B 3M0EA 4TSFA 4B33A 1CEEA 1OH5A 3K70B 1DARA 2ZI4A 3TSOA 3AGQA 3I4LA 2R62A 3LX5A 2SHKA 3F5FA 5D3MA 5GVRA 4PHTA 4URYR 4EDHA 5CLLA 2PZFA 1T91A 1XXHA 3BORA 1CULC 3MWYW 2P2LA 4OHYA 1OKKD 2N42A 4US2R 2FZ4A 4EJSC 2D4HA 2IYUA 4ERNA 3B60A 4FWTA 1AS3A 2JLSA 3KJEA 1A2BA 2NG1A 1W0JA 1GKIA 2VSXA 2YOHA 1W2HA 3W6OA 1PLJA 4W5JA 1UEJA 4V0LA 3RC3A 2W0MA 3QF7A 4LJYA 4WVFA 4C0HA 4II7A 3GJ5A 1EX7A 3L8YA 4CT5A 4M1SA 1QRAA 2QRNA 3GFOA 2ZU0C 1NBME 3FPAA 2IHBA 1BMFD 4GOJA 4A1FA 3GLGB 2C78A 4H1UA 4B75A 1E98A 3RLFA 1DBSA 2ZYVX 4YDHB 1Q3TA 2REXB 421PA 1F2UB 3GLIE 1N6LA 3GCGA 621PA 3WXMA 1Z22A 2GCOA 5FL3A 4DZZA 1DOAA 4OK6A 3CONA 4A6PA 3QVVA 4B74A 2KWIA 4OI4A 5DO9A 1KAOA 1Q57A 1EESA 1E0KA 2NQ2C 4RZUA 3DDCA 1XDBA 4OBEA 2FA9A 1O87A 1N6PA 4GRAA 1AGRA 4Q02A 1GL6A 2ZRJA 4MGKR 2V6JA 4A8JC 1MO6A 1J90A 4LV6A 3QBVA 5FOWA 2AKYA 2B6HA 1G8HA 1GKYA 2L0XA 1M8PA 4YMUA 4BFYA 2ZR7A 1VG8A 3LVQE 4EQ6B 3B1VA 2YV5A 1N5IA 3MRSA 4PC3A 1Z8FA 3FMIA 3RS4A 1IONA 3DOEA 5DE3A 2WPDD 1S8FA 1OFIA 3MLEA 1VCMA 4CZ2A 4V03A 2HUPA 5FPYA 2FN4A 3KX2A 4LZZA 2C99A 4V02A 4D25A 2O0JA 2DR3A 1Z06A 5JJIA 2GAAA 4JLKA 3TE6A 1L8QA 3HWSA 4G5QA 2N46A 4HAZA 4EPTA 5F98A 1VYTA 4OJQA 4URUR 4LYFA 3TW4A 4JBYA 1NVXQ 2RH5A 4MKIA 2VA8A 3T1OA 3M6AA 1LTQA 2C9OA 2IW3A 3U3JA 3UANA 1W47A 5J4HA 2ZANA 4HB4A 2ERYA 4QXAA 5CYOA 4OI2A 4B34A 4XWOA 4DLZA 1KI7A 2A5YB 1AZSC 1GG2A 4DDTA 4LY6A 4PZLA 4KJZA 2WTUA 4F93B 1WBDA 4RKEA 4QGHA 3LXXA 3CH5A 1EX6A 5B2ZA 1WB9A 1KO8A 3FE2A 4XSHA 3SHFA 3THWB 2H57A 4C30A 4RFSA 4DB4A 1NMXA 4Q9KA 1TF2A 4TQ9A 5K8TA 1RVDA 5FTMA 1QHYA 1ZIOA 3VU9A 5KYKA 4X8HA 3PUVA 2ZETA 4AYXA 2VLIA 3ECCA 4B2PA 5JEEA 2BHRA 1MO4A 1ZCBA 3BFKA 2B7BA 1XPRA 1RPZA 4MH0R 4JVNA 3HU3A 1NLFA 4LYJA 2F3TA 3EPJA 4XD7D 2HXYA 1T0JB 4QL3A 4QGAA 1HQYE 1N0VC 2JLYA 4XWKA 2ZRIA 5BWMA 2WV9A 3FFAA 1XNJA 4DVGA 3W9YA 2D7CA 2XXAB 1IN6A 4V0OA 3GLHA 1UM8A 2QU8A 3OESA 2F9MA 1W5SA 2VRWA 3BFVA 5TARA 2R6CA 3SHWA 4HUTA 1KNXA 4XVQA 4A36A 1IHUA 4JBXA 3W6PA 3HPQA 2WJHA 1U94A 4BLOA 4B43A 4MGZR 2HCJB 3BH6A 3R9WA 2P5SA 4F4IA 1OYYA 5KOYA 4DT1B 2D3WA 3OHMA 5GJVC 1T9HA 2EYUA 2Z4RA 4FWIB 1NJFA 2ZSFA 3SJCA 2QBYB 4W7SA 4K46A 4U02A 1MKYA 3RVBA 1HT1E 4V0MA 1SHZA 4BZXA 4P4SB 2OBMA 3T5GA 3THYA 5H1YA 4M53A 3NBXX 2Q3MA 1UJ2A 2ZRAA 4NBSA 4NP6A 4FW9A 4PSKA 1Z08A 2PZGA 5C4MA 3QXHA 5CM9C 5JSZB 5KNDA 2GEVA 4BZQA 4Y0AA 1NVVR 2VHQA 4LSGA 4WAUA 1ZVQA 3WP1B 2BIFA 4C4PA 3O8BA 4DCNA 2IHYA 4BLRA 4KYUA 5E7MA 1Y63A 4RCYA 1RIFA 4FD2A 2O5VA 2J7PA 1P60A 1OV4A 5TVKA 1S9DA 3K9HA 3K70D 3EIEA 4JLVA 1U90A 3SR0A 1SXJC 3VMFA 1LFDB 6Q21A 3LNCA 4PC7A 1OJLA 4CEJA 1W4AA 2IEZA 1ETUA 1SVOA 1WF3A 2J59A 3CNNA 2QORA 4NE2A 5DI9A 2D62A 1XD8A 2X1VA 2F43B 1Q1QA 3E2IA 1E2KA 2QAJA 4URVR 2QP4A 5SZJA 2J0QA 2J3EA 3KQNA 4ZCLA 2OCYC 5K8UA 1E2HA 1N6HA 4QBIA 1COWD 1RRFA 1T3SA 3GQBA 2RGGA 3PENA 4Q9HA 4DEYA 1T5IA 4QJ3A 3D3QA 1VG9B 2XNSA 4A8JA 2ZJ5A 1TNDA 4CRWB 3KKQA 3TAHA 3IEUA 3AKYA 4N1AA 4NCNA 1VG0B 1YRAA 3MGCA 4JLNA 2V54A 4HI0E 5FPSA 1TQ2A 2OLKA 4RY2A 2P3SA 5CYPA 1F2TB 5C4GB 5C46F 2FFQA 2BVNA 1IY1A 5EXXA 3SE0A 2AX4A 4GOKA 3MCAA 3LFUA 3QNUA 4FCVA 5DGXA 3D7MA 2KBEA 3KXIA 4IFBA 4LI0A 4OQFA 4P0TA 1DEKA 1UKZA 2P6RA 2AFHE 1T8TA 1L4UA 1TF5A 1ZP6A 1C4OA 1XMVA 2CVFA 4POAA 1VPLA 1YU9A 3SQXA 3U44B 2GEUA 3RWOA 1RKBA 4KFTA 1LS1A 4Q9IA 4Q4HB 2RCNA 4HB0A 1GUAA 1JEEA 4KV9A 3QF4A 1JR3A 4I1UA 4R98A 3W6NA 4OHZA 3K8YA 4CYMA 2P0EA 4ILEA 4BPBA 5CJ2A 1PLKA 4NH0A 2FZLA 1R2QA 2QMUA 4B71A 1ZD9A 1QDEA 2AK3A 4DWJA 1KOFA 2FPLA 3IHLA 2FFHA 2NMVA 2H7VA 2PX3A 3OE7A 2ZRCA 1KKLA 4TTPA 4H9GA 4B3FX 5E7JA 1EFRD 5GJWC 4EIWA 1G7CA 4AKIA 2RGAA 3NC1C 3T12A 3OIUA 1W49A 3HR7A 2GDJA 2P67A 4OQMA 5J4VA 2R44A 4US1R 3TUJC 4DLXA 2ZJ8A 1ESMA 4R9UC 4BLPA 2IUTA 4Z54A 4G5GA 4CIDA 4TZ0A 1OB2A 2YOGA 4S35A 2GTPA 1KKMA 3IO5A 3KJIA 3HJNA 3IQWA 4BGDA 4IOMA 1AA9A 1FTSA 3NTUA 4BECA 2DWPA 4M21A 5JFGA 3BGWA 1KY3A 3RS7A 3V4FA 1ZM3A 2GNOA 3VFDA 3VR4A 2IK8A 3R8FA 2O0HA 4DLSA 4V0NA 5JCPA 3TK1A 2AWNA 3GLIB 4C3ZA 1VIYA 3S1AA 5BN5A 4Q4JB 5L8VA 3QKRB 1H65A 3A1UA 4M2LA 1XTJA 721PA 2MSEB 2JEOA 4HB2A 4P3YA 3DMDA 4Q66C 3F8TA 1YHNA 2VQSA 1H8EA 2ZRDA 1KK2A 1OE0A 5TXGA 3DM9B 2H8KA 5FL7D 5FPTA 1W0KD 4B44A 4ZPXA 4YMVA 1G6OA 4Q1EA 4URZR 4DCTA 1E0AA 3GFPA 1CRQA 1NMYA 1XEFA 1ZNYA 4DUGD 2O8CA 2ZU6A 5FOVA 4PX9A 2J5XA 1NN1A 1QHHA 4PC2A 3LBNA 2WICA 3MG9A 3VTKA 1U81A 2G0NA 1Q12A 4DKXA 4OJKA 4XSGA 5KSYA 3SEAA 3A4NA 5JHHB 5KSOA 3BAFA 4AWXA 3JZAA 4R71A 1NKTA 2YKGA 2BMFA 3BC1A 4EPRA 1G64A 2CDNA 1Z6XA 3A58B 2IXGA 3AVWA 2DB3A 2RB4A 3CPEA 4YMWA 3UK6A 4NONA 1Q22A 1S3SA 3CRQA 1GVNB 3WYGA 1MO5A 2OUKA 2P6NA 1GL9B 4LBVA 3AVOA 3AVTA 4PQYA 3T1QA 1F5NA 2RGXA 3AH8A 3NG1A 4RJLA 4E07A 1LY1A 2PX0A 2HV8A 4M8NE 2ZRHA 5FUVA 1T3LA 1WXQA 1ZC3A 2D2FA 4HLQB 4KI0A 4KODA 1P75A 4F38A 4ZDKA 3WYAA 1W36D 4AKHA 1E32A 2ORIA 4HZIA 4QBHA 3AP3A 3MJRA 2QN6A 4D0LB 2LKCA 4RD2A 1VG1A 5FBVB 3W3AA 2JLWA 1H8HD 1OKKA 4Q01A 2BOVA 1YZGA 1SZPA 4LHXA 1Z0IA 8OHMA 1RJ9A 5CITA 1Z2CA 4TMXA 1E4YA 4IFEA 4FI3C 4B6EA 4ZCMA 2KSQA 3VNUA 1CRPA 3ZS9A 2ZJ2A 2DFLA 2J87A 2A2ZA 2JLRA 1R5BA 3GJ0A 4L9SA 1G20E 2AD1A 2KE5A 3PUXA 2WAXA 1XD2B 3B2EA 4AKEA 3NH6A 3P1JA 4C2UA 3K70C 2WM9B 1EWRA 4RD3A 4UNRA 3AUXA 1Q44A 4GFDA 1YKSA 5EP3A 1BMFA 5HZKA 2IS1A 2J45A 3QKTA 4ARZA 3L0OA 1S9HA 1VIAA 3REFA 2HF8A 5FOXA 3WHKA 2GEDA 5JECA 2YWFA 3WNDA 4DLTA 2IYTA 4ACAA 2IXFA 1A7JA 1G21E 2HF9A 2ORWA 2WKRA 4Q9JA 2CMKA 3RYTC 2PJRA 2JASA 1BH2A 2CHGA 4UNNA 3TUIC 3BK7A 3GJ3A 1P72A 1XZQA 1R0WA 1KMQA 1KO5A 1GRNA 4OKSA 3CLVA 2AXNA 1A82A 1KSFX 2VP4A 1NKSA 3K09C 3MJHA 2O8BB 1NVVQ 3Q3JB 3NBFA 4TN1A 3TVDA 1OXXK 2VL7A 2ZRPA 3BOSA 3FVQA 2C98A 1WMSA 1Z0KA 2QTVB 2GCPA 3GLHE 3KB2A 1E9FA 2G88A 4HLUA 3BFXA 4C0QC 2FF7A 2JATA 2Q0HA 3EZ6A 5K8LA 3U7FB 1R0YA 4CEHA 3B9PA 3IGFA 1TUEA 3H1TA 2VP0A 4M1TA 3ZYCA 1VCNA 4CEIB 2WPDA 4L9WA 3RHFA 3T61A 5HE8A 4JL5A 3WRYC 3DHWC 4QG7A 3L0SA 4JS0A 1OPXA 2P65A 3KQUA 2ZIAA 2VHCA 2CCJA 3LXRA 2G0TA 3TNFA 2O8EA 5TY0A 4O25A 5L3SB 1CJVC 1KI6A 4C7OB 3A1VA 2WWFA 1NVWQ 2BBWA 2RHDA 3C8UA 1HA3A 3OE7D 3EZ9A 2BV3A 3K0CC 3DZDA 3IDQA 4BQSA 3C41J 1MABA 1ZM7A 3RNLA 4G01B 4XOIA 1CS4C 2QTHA 3VX3A 2FSIA 2ZI5A 3C16C 4CT4B 2CHVA 4G1UC 4E03A 1UADA 3EW9A 1NRJB 4GP6A 1RE0A 1Z0JA 1YE8A 3DEFA 3I3SR 3VR2A 4M4SA 4Z1MD 1ZIPA 2FSHA 4Q19A 5FPHA 4MGYR 3RS2A 1OH7A 1E6CA 1KJWA 3CUEF 1R10A 4N3NA 2VYFA 5B58C 3L0PA 3AUYA 1CR4A 3AEZA 4TYNA 2YWHA 2V6IA 4PZZA 4Q00A 3SI7A 4R2HA 3C5CA 3AVPA 2C8VA 4PPGA 4HZUB 4A2WA 1KY2A 3U4QB 2BCGY 1E9BA 1FNMA 3AKDA 4E5UA 3DO6A 4YQFA 4FCTA 1KMHB 4KFUA 4AK9A 4F4JA 3CZQA 4Q18A 4W5HA 1HEIA 5JEDA 4A0GA 3NIBA 3U61B 4TLAA 1DE0A 5UKDA 1E1RA 4QM7A 2AN9A 4XD7A 1CU1A 2CE7A 4IXMA 4YXWA 4UXHA 1AQUA 1YVDA 2YWEA 4C0KA 3ZGXA 5DYIA 1ZUIA 4OI1A 1XCGB 2CK3D 5H8WA 2QI9C 3ZLJA 4US0R 4QBFA 3TR5A 1TQ4A 1RZ3A 3NEJA 3QXSA 4HUQB 4KXFB 2ZAOA 5DI3B 1FP6A 4DB2A 1Z6TA 1FW6A 2VPPA 4TLDA 3QKSA 3WBJA 2IX3A 4I1SA 4LCBA 3KXLA 4EFNA 2J1LA 5J5CA 1HYQA 1XF9A 3GEEA 4Q48A 4MQBA 3D8BA 4IW3B 2TMKA 2XB4A 5J4YA 3PUZA 4TL9A 4D4KA 1IN5A 2FEOA 2FH5B 2GETA 2OCPA 4Z8XA 4RKFA 1W7AA 4HAUA 1TEXA 5FOTA 1W5TA 2FE4A 4TL6A 3BJIC 2QZ4A 2C95A 1KO7A 2VF7A 5FTNA 4D4JA 2DY1A 3SOPA 1II9A 1AZTA 1ZNXA 3A37A 3K0AA 1IJEA 2MMGA 1XJCA 3T35A 4TZ6A 5L3RA 5EP1A 3BH7A 2BKEA 1P2UA 221PA 3R20A 1R5OA 1P9NA 4BASA 2OXRA 5JMTA 3U2QA 1T3HA 2WVJA 1M1YE 4PZYA 1XU4A 3BB4A 1II8A 2WJJA 4RZ3A 1AK2A 4UXJA 1SXJD 1E2DA 1E2GA 2OCBA 2Q21A 2VF8A 3DOFA 1PV4A 1J8MF 3EZ7A 1W4BA 2Q3FA 4LUCA 4RD1A 5CJPA 5IDVA 2NPFA 1U0HC 1JECA 4JYBA 4XWAA 1P62B 4FMCF 1G7SA 4MRPA 3FDIA 4XIGS 1KI8A 5J40A 4CGZA 4E22A 1XX6A 1ZC4A 4I4LA 5HKKD 4ZI2A 5F9FA 3ZZ0A 2GZDA 5G40A 1G7RA 2G9NA 4CF7A 2ANBA 4AY2A 2FV8A 4HDCA 4RD4A 2C9CA 2E9SA 3CRMA 1DAFA 3P4YA 1BS1A 2FPMA 5F2EA 1W36C 4OQLA 1Z07A 4R2IA 4I1OA 4OHVA 3GFTA 3OIWA 4H1VA 1D2EA 5AJZA 4A82A 1K5GA 4JJZA 2FX3A 1VTKA 3X2SA 1IN8A 4JIMA 3I92A 3L2OB 1E3MA 1NG1A 1UDWA 1AN0A 4NTZA 4P32A 5AJXA 4JLBA 1COWA 4QHSA 4OI0A 5SZHB 2CXXA 4JJKA 3NWJA 1FX0A 2GZHA 1C9KA 3KKPA 4JMPA 4DIEA 4QNMA 1RFLA 4FMDB 1X1RA 1GOTA 4OL0A 4LGMA 3KJGA 2QRZA 3C4JA 3WNCA 3KDSE 4CDGA 1K5DA 1ONBA 1UFQA 3GLGA 1OXUA 1E9RA 1G5RA 1JBKA 1CLUA 1XTKA 1JJVA 2C2HA 4LC1A 4PR0A 3H2YA 1HV8A 1KSGA 5B30A 2EQBA 2XNDD 4KBGA 4JL8A 1G8GA 3QJYA 2XTNA 2OG2A 2ODWA 3ZVNA 3IHWA 2B21A 1F2UA 2JCSA 5DN6D 4RSGA 1P2TA 1G3UA 3KKNA 4B3BA 2JLUA 1CKEA 4XTCS 4KVAA 2ONJA 4A2PA 3GLFA 3B1YA 3QEOA 2CL6X 3HR8A 1M7BA 5KTYA 5J4KA 4JZKA 5FTLA 3QIAA 4TTRA 2AFIE 1N6RA 3P27A 2IWRA 2HDNB 1RW4A 1F48A 4RCZA 3V9PA 4JLPA 1EXMA 1PVOA 2JJ8A 3K0CA 2R6FA 2YINC 3ZVRA 2DWQA 4HDQB 3PXGA 4DLVA 4JT2A 3FB4A 2E87A 2J46A 2UZ3A 2ZITA 1FUKA 1ANKA 4QKQA 4UJ3A 4EQ6A 2DWOA 1HUQA 5FOSA 1W4RA 4HYYA 3UKDA 1LNZA 4GOXA 2RAPA 1PUIA 4Q47A 3QPUA 1IXZA 2QENA 2IS6A 1EFRA 4MYTA 4TYPA 4JSTA 1MRNA 2WIAA 3K9LA 2OESA 3MAAC 3ADCA 4M9ZA 2UVQA 3QI2A 1DAHA 5C2JB 1IN7A 2JJ2D 3LVRE 1ESNA 1Z6YA 1KJYA 2QGZA 4LPSA 3AVYA 3CW2A 4Q1AA 1L2TA 1G17A 1L7VC 2K5UA 1LW7A 1Z0AA 3BERA 3SS8A 2ERXA 2GRJA 3X1XA 5KPDA 4O0MA 4RZ2A 1KK1A 4YDSA 4LYHA 3T15A 2BEKA 4EPXA 2HXSA 2ZRFA 4IXNA 4GDFA 5KUTA 1N3BA 3A4LA 3LWNA 1JQLB 1P73A 1QVRA 3NBYC 5CIQA 4DDVA 4MKFA 5BN3A 1MRSA 5TV2A 4UNSA 2ZM5A 1KIMA 4OHWA 1IY2A 4GL2A 2QY9A 2LWIA 3SBDA 2EFGA 3B82A 4IDPA 1OLOA 2PCJA 1U98A 4GZLA 2BKUA 4PANA 4FMBB 3TIFA 1E1RD 4BRUA 4ZDIA 5CB8A 4YXWD 3B1ZA 2WWGA 5IRCD 1IBRA 5JS7A 1E2NA 4MRRA 4B2IA 3EZFA 5FL7A 1W0KA 1AQYA 2ZSBA 1N25A 4DUGA 2WWYA 1TF7A 4DLWA 5CK5A 1GNPA 5JZVA 4DLRA 1E2FA 2DYKA 1KO1A 1M34E 3AKEA 5AJYA 1R7RA 3N2EA 2OHFA 2QT1A 5FOUA 1GL7A 3GLHB 4M0LA 2VO1A 2XXAA 1UEIA 5FBQB 3OEED 4YMTA 2ZUCA 5G3YA 4BFSA 1MV5A 4TT3A 5JI2E 2ZS8A 3LV8A 4FIDA 5GJBA 1XCPA 2JJ1D 1JAIA 4NYMR 1Z47A 4AYWA 1XJQA 5KPJA 4FXPA 2R6DA 3SC3A 1EFHA 5IF9A 2XTMA 1XD9A 4LV8B 1D5CA 1M6NA 4TMTA 2ORVA 3TH5A 2ZJYA 4DT1A 2QAGB 2QROA 3O8CA 2H18A 1KDOA 4MKGA 5BXQC 1DG1G 3KQKA 3UATA 2QSZA 1FZQA 3ZZUA 2QBYA 4EJSA 4CW7A 1VECA 2NZJA 1XPUA 1NL3A 3THYB 1E96A 3UMRA 4P4SA 2BM0A 3AF0A 4KO8A 2ZJBA 4NL4H 4N0DA 2ZI9A 2IUUA 2MMCA 1ZMXA 5SZIA 1RRPA 5BN4A 5JSZA 2IEYA 3PCRB 1Y3AA 1NN0A 3B6EA 3NHAA 5A5GA 3ADDA 2A78A 3UIEA 3TRFA 1H8HA 2QUZA 2PL3A 3K9NA 5CDFA 4Q1BA 1F60A 3PR1A 4Q03A 5EE9A 1DS6A 1YR8A 4DHEA 3ZVMA 3L0IB 2GJSA 5E95A 3MWLA 2GJAA 1E2IA 1A2KC 1GRQA 2ASEA 2Q9BA 3FOZA 3LX8A 2FJUA 5HR5A 1T5LA 1ZD8A 1OXTA 3Q85A 1P2SA 1OFHA 3PVSA 4XJXA 1I2MA 3UWKA 1DO2A 3AVQA 1KZGB 4PSVA 4D2IA 1U9IC 2R2AA 5JJLA 1Z3IX 1T4GA 2F43A 4NYIR 2ZJAA 5FBRB 4JYCA 3K0SA 4ESVA 2ZJZA 3QXJA 4WBSA 1KDPA 3M4YA 4IOJA 1PJRA 2ZI3A 3ONWA 2IWHA 2O8FA 3G5UA 2QGNA 5FTJA 3E1SA 4KU4A 3QKUA 3THXB 1R6BX 2A30A 5ELXA 2WBLC 1CF4A 2VHTA 4ZI3A 1VHTA 5L3QA 1G3QA 3NVAA 3TSWA 3E5HA 2A5FA 1KDRA 2A5JA 1L4YA 4KCGA 2VHJA 1Q3HA 521PA 3HU2A 2JIZD 4FN5A 3CM0A 4EKDA 5HPYB 5AUOB 2GKSA 1S96A 1T0HB 1F2TA 1KGDA 1G3MA 2ZUDA 821PA 3KTAB 5DHAA 4XVRA 4IRUB 2ATXA 1P3JA 3FYHA 2QEQA 4L16A 2FFBA 1S2MA 3L82B 4PPQA 4XH9B 2F1RA 4RFVA 4FCWA 2BMEA 4GPTA 1P61B 4OYHA 5DYGA 2REBA 4MGIR 3U44A 4DEXA 3FKQA 3N5CA 3QEJA 2V3CC 4ACBA 3I8XA 1E99A 4RVCA 2BWJA 2CJWB 3ADBA 2Z83A 1W48A 3AB3A 1HT2E 2YYZA 2JLVA 3EARA 1Z29A 4URXR 4HAWA 1AGPA 1AS2A 1WP9A 2J0UB 2BEJA 2FGJA 3EZ2A 4LOAA 1FPMA 2V1XA 5GJCA 3SFZA 3B8HA 3A6PC 4BLQA 1SVKA 3GJ6A 1IY0A 3JVVA 3OIYA 1LF0A 3UMSA 4Z1MA 2OV2A 1NN5A 2QE7D 4AYTA 3Q8XB 3B1WA 3DM5A 3RANA 1SVMA 1E9CA 1G8PA 4UQOA 2GXSA 4M9QA 2GJ8A 3AF4A 3EPLA 3RAPR 4M1KA 3SZRA 3THOA 3U60B 2A5GA 3GMTA 1HE1C 3ZZTA 1J99A 2OBLA 1XXHE 3SYNA 4B32A 3RWMB 1X6VA 4HLCA 3HPRA 4NKRA 2QA5A 1NG9A 1GIAA 3PIRA 4QHYA 5EP4A 1HY3A 2GCNA 1FL9A 2EFEB 1P9WA 4NDZA 3I62A 3RDPA 5JCZA 3AKCA 1G4UR 2AKAB 1NBMA 1YRBA 3LLUA 3B9QA 2XITA 1IJFA 4ZCIA 4BEJA 3NHBA 3X1DA 3CIOA 4Q4AB 2CK3A 1X8JA 5DH9A 1D9ZA 1ZD1A 3L43A 2V4ZA 2IYWA 1LVGA 3Q72A 2DFNA 4PFSA 1RRGA 2EFDB 3QKRA 4ZDWA 3GEIA 3FKSD 2H92A 1J7KA 2VIIA 3QXXA 3IO3A 2MSCB 4IVPA 4ZKEA 2PH1A 1OXSC 4AD8A 2CL7X 4WXRA 2A9KA 2X2FA 3EA5A 5H68A 2HLDD 1TTTA 4JVLA 5FR1A 5AWFC 3MUFA 2WJVA 1DAKA 1CP2A 4B3XA 2NO1A 2X77A 5LB4A 2PBRA 2ZR9A 3SJZA 3O8RA 4Q1DA 2VP2A 3IIKA 2GK7A 4TT3D 1OH8A 4P33A 3QE0A 5CK4A 2WOOA 5D3QA 1XEXA 1G41A 4D4MA 1DAGA 3LQQA 1E9EA 4GMDA 1Q1BA 1EK0A 1JNYA 2XOKD 3SDZA 1NSFA 3N70A 4B3GA 3KZ1E 2ZRMA 4GI7A 2G83A 4XVUA 4NMMA 5M04A 2X19A 3ND8A 4EFMA 2C03A 4K81B 1XRJA 2OE2A 4LJ8A 5HCIA 1MT0A 4N0EA 1SXJA 3AM1A 1ZNWA 1TUIA 2OILA 4LJ7A 1SKYE 1WQ1R 4MKHA 4DDWA 1WCV1 1JPNA 3U3RA 1OH6A 4D0GA 1XTSA 3SJAA 5HKKA 5EXPA 4Q4LA 2ZE7A 3IPYA 4BFWA 1ZJ6A 1U9IA 2W83A 3H84A 4KAXA 5KDOA 2HYDA 4U00A 4G0NA 1SVSA 2Q3HA 2VSOA 1EG7A 1E9SA 2BBTA 3VHLB 3W90A 3U3KA 3QUSA 4FMDF 3BS4A 3K0FA 2FNAA 5KNBA 3AVUA 2IYYA 3W5JA 1JQJC 2DBYA 2GA8A 2EYQA 2YC4C 1QBKC 2IS2A 3K0EA 4Z51A 2ZQ5A 2QL6A 2FSFA 1OHHA 4NYJR 2BM1A 4NCJA 3R9XA 1OF1A 4XTRA 1HTWA 1VCIA 5IT5A 2XEXA 2C04A 3Q5EA 1LV7A 2RKOA 4PPNA 3NDPA 2GXQA 3PV0A 2P6UA 4A2QA 3NH9A 3KKMA 4NCHA 2GJ9A 3BXZA 1LF5A 1G291 3H0KA 3MD0A 4NYMQ 1J2JA 1P5ZB 2RGCA 3BH0A 4D0NA 1ZNZA 4X8MA 4DC9A 4A0HA 3P32A 1P6XA 3PITA 1CJKC 4WZ6A 3SYKA 3A1WA 1R5NA 3CRVA 4DSNA 1C1YA 1Q1EA 1YR6A 1Z28A 3VKWA 1GSIA 1XB2A 5E7IA 5LD2B 4W5WA 4TYWA 2XNDA 2N1BA 1AJEA 3CH4B 2AHOA 5DN6A 1E1QA 4Q9LA 3TSZA 4BE7B 2VSFA 2JDIA 4V0KA 4ASUD 4LX0A 5GADl 1E9DA 1NMZA 4ZIRA 3T06B 3MWKA 5BQ5A 2F3RA 2ZROA 5JHGB 2CL0X 3FMPB 5CB6A 3RS3A 3I73A 4P31A 3IQXA 4TL8A 2NO9A 4ZDJA 2O8BA 1IQPA 4TQAA 4TMKA 4BUJA 2GZAA 2QMHA 4Q7JB 1XCMA 3V4RA 1G18A 2O8DB 2GVZC 1E2LA 3CNLA 3AVVA 4AC9A 3ICEA 4EAQA 4WOPA 4CEHB 4EPVA 5JS8A 2D74A 1KI1A 2GILA 2WSMA 4BFXA 4KFRA 2I3BA 2YJTD 4CEIA 1U0LA 2F7SA 3O47A 4LPKA 4TYYA 1CR1A 3F0TA 4V0ME 3CX8A 5JJKA 2O8EB 4KBFA 1R4AA 4A92A 4NYIQ 2ZRNA 3EASA 4LWZA 5L3SA 4C7OA 2JJ2A 3VR5A 4LRWA 4P4TA 3KFVA 3D6TB 1KAGA 3EIQA 1G7TA 4L8GA 5BW8A 3NXSA 1VCOA 2NOAA 3B1XA 3OFNA 4JL6A 3O8DA 3T1TA 3UG6A 1US8A 3A4MA 3WNBA 2RMKA 3VKGA 3A36A 3DVLA 3QXCA 3EPKA 1GZSA 3KJHA 4ABYA 1IXSB 1PLLA 1W44A 2ZRBA 4WIAA 3FHTA 2Q6TA 2JGNA 1WRBA 2J0VA 1DG3A 2BDTA 5EUQB 2LCFA 3B85A 3U3MA 1E79A 3H86A 1RC8A 3UXMA 5C1BA 4BWYA 4KLNA 3CO5A 5FFMA 5EUMA 1QHGA 1GTVA 2QM8A 4DCUA 3K9GA 3OEHD 4MYUA 3GP8A 1NBMD 1OFUX 4WA7A 3VR6A 3E70C 4HZUA 3ZH9B 1P4SA 5DLQC 3RRZA 3U4QA 1Z6AA 4L5BA 4AURA 2EWVA 1VKJA 1GP2A 3NKVA 4OQXA 2G1JA 1U0JA 4TQUS 1IAQA 3B5JA 4OHXA 3PEYA 3TKLA 1CR2A 4MRSA 3R7WA 4F92B 2D06A 3IIMA 2PCLA 4K8OA 4QOSA 4UXIA 5JWRA 4AI6A 2ZS7A 2YHSA 2WSSD 2NPIA 1P7CA 3H4MA 3OEEA 4A9AA 4EPYA 1G8FA 2VP9A 3EWAA 2GVDC 4HUQA 4PTLA 3EC1A 3P4XA 5DI3A 2JJ1A 5JWHA 1W46A 4JLAA 3OAAD 2GAOA 2RGBA 3UMFA 4ZKDA 5AUPB 5G41A 1NSTA 3AF1A 2XAUA 1JB1A 1G5TA 1B0UA 1ZRHA 3AQ4A 4B35A 2PLRA 3EXAA 5E4FA 3MFYA 4EFLA 4L15A 5F9HA 3EAQA 3I5XA 2H1LA 4AKGA 1CJMA 3IILA 3HDTA 3TUZC 2E1RA 5P21A 1SVIA 1VYUA 1X1SA 3CZPA 1U2RA 3NDBB 1WDTA 2FFAA 2GWHA 2RGDA 4ZO4A 1JR3E 2AR7A 2QMEA 3KB1A 2R6AA 3QVUA 2X8AA 4M9SA 3TJZA 5DISB 3A1TA 1XTQA 5SZKB 1AKEA 4IKEA 4HAYA 3IBGA 1FP7A 1KI3A 1BYIA 2FPKA 3CB4A 4A6XA 4ZV4A 4F91B 3RS5A 2HCBA 4LHWA 3QENA 1GRRA 1ZU4A 4LHVA 3WMFA 5FPKA 1K8RA 5IK2D 5D3MB 1A4RA 1Z5ZA 2GF0A 1J8YF 5KSZA 3W8NA 3QPWA 2QAGC 1XXHB 1MOZA 1CJTC 2CNWD 1NY5A 4PO8A 3TVTA 4DSUA 2UZIR 4JBWA 2ZR0A 2XGJA 2PEYA 1OHHD 3Q9LA 2WKQA 2RGNC 2A7QA 2DHRA 3KQLA 2W2VA 1UBCA 3M1IA 1JJ7A 2R9VA 4MA4A 4URWR 1I4DD 5JRZA 1R0ZA 1IXRC 2QG6A 1EGAA 3K09A 1KI9A 2V7QA 4F7WA 3LH5A 4LJ4A 1GM5A 2J7KA 2QMOA 2EFCB 1I4LD 1KI2A 3TMKA 4BFTA 2WWWA 4HAVA 5DNYB 3UPUA 1FX0B 1UKEA 4A15A 1S1CA 2BMJA 2WJIA 4LJAA 4Q1CA 2OXCA 1OIWA 3WP0A 4DSTA 3CX7A 3PEWA 1NF3A 4MDFA 1U8ZA 2Z5FA 1JR6A 4QNRA 2Z6VA 3QBTA 2GCOB 2YZ2A 4GP7A 3FFBA 3PQCA 1E1QD 1FOEB 2AWOA 2WJGA 2GXUA 3ZIAD 2C9YA 1E2JA 2JDID 1YZQA 3Q7QA 4LV5B 4M22A 2JIZA 2YNMA 1NVUQ 1ZUHA 1TU4A 1GKUB 4A4DA 3SYLA 1YR7A 1XMJA 2Z43A 3SQWA 4PAQA 4B3DA 2O0KA 3LAWA 3GLFB 1S1MA 4M1WA 1QZXA 3ADKA 1N0UA 2KBFA 2WMOB 1OSNA 4IDOA 5HE9A 4F4CA 4JLOA 4NPHA 3TAUA 3I61A 2FWRA 1HURA 1UBEA 3PUWA 5AJWA 2XJ4A 2LKDA 3LRPA 5IHPA 3AP2A 3QY0A 4O2RA 5EZ6B 1S3GA 3K1JA 2XB2A 1SKYB 4JKIA 3AF2A 1JI0A 4QBGB 1CTQA 4NYJQ 2PLFA 3T34A 2RGEA 1AKYA 2V1UA 4IHQA 4ON9A 1Q1ZA 1ZBDA 2W00A 2YWGA 4DCVA 3IKJA 1SVWA 3CWZA 3LQRA 1Q21A 4HB3A 4BFZA 5FI0B 3GPLA 4IVRA 2IT1A 1SXJE 2QE7A 3Q5DA 1E4VA 1JXMA 2C96A 3OFND 3CBQA 2VP5A 5KO2A 4KHZA 3KUDA 1DO0A 1PUJA 5AJVB 2FDCA 3IUYA 1TQDA 2ZAMA 3D31A 3PFIA 3TGPA 5EJEA 1KNQA 4PPFA 5HCNA 2G6BA 3B13B 1IM2A 5GVSA 5AK0A 4DSOA 1E79D 1CXZA 3BIFA 4PAMA 4D4LA 5DIFA 3DKVA 2IYRA 1XJ0A 4RD0A 1V43A 1AS0A 4EPWA 2R65A 2P5TB 2NO7A 1K6MA 2IUSA 4G3XA 2QP3A 4PC1A 3LY5A 4RFSB 3SNHA 5E3HA 3THWA 2DFTA 1KTVA 2CLSA 3CR8A 4DXAA 2VP6A 3VU9B 2NGRA 1EFCA 2C5LA 5CM8B 4A0RA 3KXKA 2IA5A 4M1MA 3BBPA 5KDLA 3RRYA 5DSZA 4PHHA 2ANCA 1ZUNB 2W6JD 5JWOA 4TYQA 2GJKA 3FKSA 1TL7C 4G5OA 4DDUA 2H16A 2IYQA 2GBLC 2PMKA 4KSCA 4TLEA 2CBZA 3EC2A 5FUYA 4KSBA 2HLDA 4TMZA 4YLGA 2W0SA 1MH1A 1N5KA 2NTYC 4J0QA 2AL7A 2HJGA 2G1KA 3U6KA 2IS4A 2BC9A 3BD9A 1XEWX 1DAEA 2IBMA 2ZYTX 4QRHA 5FI1B 3EG5A 1W2GA 4DLYA 4OK3A 2HT6A 1XWIA 2WKPA 4CVNA 1N6KA 1UPTA 3DZ8A 1B23P 1N6OA 2X2EA 3V00A 1JXOA 1M2OB 1MR3F 2OT3B 2V8OA 4OQNA 3DPUA 5FUWA 1FMJA 2XOKA 1DTSA 1YZLA 5EQTA 4EUNA 1OYWA 3CPJB 2F9LA 1A5TA 3W3ZB 1UBGA 4A0FA 5HTKA 2XZOA 4IDQA 4UJ5A 1TAGA 2GHIA 4NHOA 1OIXA 2QAGA 2CEAA 1NLYA 1R8SA 2G3YA 2ZVPX 3EWSA 4JLDA 1TU3A 2KB0A 1KK3A 2WWIA 3WMGA 1KDTA 3I32A 4RZXA 4EJSB 3LW8A 4G5RA 2JA1A 2W6ID 1XEWY 1Z63A 1W36B 2IF0A 121PA 1T8UA 3LD9A 3I5YA 4TLCA 2RGNA 4TL7A 4E09A 3RC8A 4IJMA 3U6BA 2B7CA 3RRNA 4BLTA 4PHGA 4TSFD 3REGA 1R8QA 1G3RA 4HEJA 1X3SA 1S0UA 1G3IA 4QJ5A 3FGNA 3CWQA 1ZM9A 2PMDA 3VR1A 3FHCB 4UKDA 5BYKA 1FQJA 3LLMA 4DRZA 2IYVA 4M1YA 3MWJA 5EP2A 4CEJB 1YJ5A 4D6PA 1W4CA 1RRCA 5LPNA 1II0A 2FMXA 4AG5A 2ZJOA 5KU1A 3MMPA 4LBWA 2ZTSA 3CR7A 1DPFA 1G5PA 4W9MC 2EW1A 1F6BA 1LS6A 4TLBA 5KSPA 4JSYA 4Q5IA 1G4AE 2FOLA 3W34A 2V7QD 4PSAA 1KSHA 1QHSA 3HU1A 1SKQA 1W0JD 4C2TA 3QG5A 3CNOA 4FMCB 5L3VA 1UDXA 2XZLA 5EE0A 1PZNA 1KZ7B 1ZW6A 3Q7PA 2FGKA 2H5EA 3DL0A 4LBZA 2QQ0A 5FUXA 1KI4A 4A8JB 1ZAKA 5ANRB 1G8YA 3ASZA 1ZCAA 2B8TA 3I72A 2O8FB 3C5HA 1EWQA 1GFIA 2D2EA 4DLUA 4TMVA 3U3OA 3NEYA 4ASUA 3CRRA 4YC7A 3ZD7A 3BWDD 3THXA 4P4UA 3RRMA 4TWZA 2ZYUX 1GILA 2R8RA 1D8TA 3DMNA 3OZXA 2BJWA 1P9RA 2CVHA 2CHQA 5L3QB 2OFWA 2CCKA 1XZPA 2OSBA 1XTIA 3AF3A 3SU8A 1VDZA 1OW3B 2ZS9A 1R0XA 5A0FA 4NCIA 5AUQA 1D6JA 2JLXA 2OBNA 3UWOA 3KTAA 1DAIA 1Q0UA 5JI3E 3JZMA 1BKDR 5LD2C 1YQTA 3P20A 4QGGA 4LBYA 4IEEA 2QPAA 3QF4B 4R7ZA 4Q4HA 1QG2A 2WIBA 3ASYA 4ITRC 1D2MA 2ZSDA 4HLDA 2PT7A 4C9BA 1T6NA 5JRJA 4PHFA 2A5DA 1KYIA 2B92A 2ODEA 1ELOA 2ZE5A 4MYHA 1ZU5A 4GSYA 2PJZA 1BO6A 1G6HA 2CCGA 3ZQJA 5KDDA 5KNCA 3CF6R 1EFTA 2IYXA 4MDEA 2CJWA 2DCUA 3R8CA 4C0AC 2OFOA 3WMEA 3AV0B 3U7GA 4BEBA 4HLUC 1FMLA 2J0UA 2F6RA 3ZQ6A 1XPOA 1JEDA 3TQFA 3ICQB 1KHTA 5DHFA 2ZUBA 1CIPA 3AP1A 4U5XA 2JLZA 3CPHA 3BRWD 4LDJA 1OT3A 2WAYA 2ZVQX 1E0JA 1E2EA 5FTKA 2F1JA 5FBWB 1NIPA 3PEVA 1E9AA 4HSEA 2CLDX 1NI3A 2GBLA 3VR3A 2PZEA 4Q7MB 2BBOA 4AG6A 4LJ9A 3EX7C 2OAQ1 2WOJA 4B76A 3OEHA 1NN3A 1TPZA 2OM2A 4KVGA 1QF9A 1X8KA 1TEVA 4B2LA 4B73A 5J4LA 3QQ5A 1AM4D 4U7DA 4QHTA 3GJ4A 3S1AB 3R9IA 2ECKA 1YZKA 4NCKA 3GLIA 2PT5A 2AXPA 4JVMA 4M9XA 3CX6A 4UNPA 1LB1B 1UKYA 4Q4JA 1NIJA 2YOFA 2Z0MA 4IOLA 3BB1A 2ZRLA 3IIJA 3G82C 2V9PA 1BIFA 3PUYA 1JALA 3LBIA 4Q4AA 5A4JA 2WSSA 2QQEA 3VKHA 2O8CB 1OXVA 4B3CA 3W5IA 3W8RA 3ZDQA 3QG1A 1V5WA 4DJTA 3J81k 3GLGE 1DADA 1QHHB 4D80A 3GEHA 2EFHB 2W58A 2QNRA 2J41A 2W2TA 3QOFA 3OAAA 5TB5A 1TMKA 1I2DA 1MO3A 2ZSEA 1A1VA 2ZPTX 4MUBA 2W2XA 4L4UA 2IL1A 3WBKA 5CIWA 2C77A 1QHNA 1HE8B 2OZEA 1BYUA 1D9XA 1NJGA 1GNRA 3GLFE 2F55A 5B64A 2J0SA 1GITA 2QPTA 1XEXB 3L8ZA 1OB5A 4Y0VA 1N6NA 2GXAA 2XSZA 4GMXA 5TDHA 1X86B 1E94E 2AD5A 5KHOC 1CJUC 2NO0A 3C14C 2GESA 2DPXA 2ONKA 1OFTA 2YC2C 2HT1A 4O3MA 4GBMA 5B57C 3GJXC 1N6IA 2DFKB 3HYRA 3KUCA 1AIPA 4BLSA 1SXJB 3IBYA 2RHMA 2Z4SA 4LYAA 2I1VB 1TX4B 1P2VA 1VHLA 3MSXA 4TMWA 3VQTA 4M1OA 4MYCA 3WYFA 2HJVA 2H17A 1XMSA 3EA0A 4LHZA 2UKDA 4QM6A 3CKLA 4I81A 5IK2A 5TMPA 3RS0A 1TQ6A 2GK6A 1SULA 5JBQA 4QJ4A 1Z2AA 1GAJA 2J9RA 3ETLA 2F1IA 2CNWA 2VBCA 1U8AA 2IF2A 3N2IA 3SJBA 2ZRGA 3WY9A 3X1WA 3FHOA 4YMSA 2D7DA 1RJ9B 5G3ZA 4QGFA 2Q9AA 2WJYA 1UAAA 1EFUA 1BOFA 5BYJA 2HEIA 2KJQA 2J7PD 4C0SA 3K0FB 4YONB 3ZD6A 1N5JA 5EXSA 1ZINA 1CR0A 2WMNB 3RSLA 1J70A 1VMAA 2JLQA 1GWNA 2ZI7A 2OEPA 2VH5R 1G19A 3IEVA 3LDAA 1XD2A 4PXAA 2F1HA 4GZMA 3ZJYA 1M74A 3T5DA 2XJ9A 4ARZB 3DKPA 1UBFA 4C0LA 3JVUA 4MITA 1WE2A 3PG5A 4BFUA 2CE2X 4JVSB 3T1VA 4JT4A 4QFMA 1IOZA 3EPHA 1ODFA 1RYFA 3I1FA 2EVWX 2QT0A 4PC6A 3TQCA 4IVQA 4MUAA 3TBKA 2G77B 3ZIAA 4D81A 1I4TD 1KSJA 3PJRA 1M7HA 4HAXA 4I99A 1QHIA 1QHXA 4GNKA 1Z0DA 2BBSA 1DAMA 1FFHA 2XZPA 2BMDA 4S2EA 1E2MA 2VHUA 5CLQA 4ZIRB 3GD7A 5C18A 4LJ6A 4GT1A 3WRXC 2NO6A 1JPJA 4BFVA 4G5SA 1X8LA 3LW7A 3FTQA 4KYIB 4I1VA 3KFXA 2Q9CA 4JLMA 4X8OA 1N5LA 2EWWA 3F3YA 4WZAE 1SVLA 2I1QA 4PQFA 4X8LA 1FTNA 3EIHA 2IYSA 3NBZC 1Z6GA 1UKVY 4WZBE 4Z8YA 4LK2A 2WWXA 1FUUA 5FBLB 5HZHA 4MRVA 4NU0A 5AR1A 5EE3A 5LDDC 4PAOA 1W1WA 2IYZA 2WWHA 2ZRKA 4PO9A 3C15C 1GDDA 2O8DA 4O2LA 2NZ8A 3WHLA 2ODNA 2AK2A 2WHXA 3VX4A 1G9XA 2QM7A 2OCAA 2ZE6A 3P26A 4HATA 1DELA 4KFSA 1KI6B 2FU5C 3B78A 2VTKA 4IOKA 1JR3D 4DIDA 1JAHA 3FMOB 4HDOB 3KL4A 1QG4A 4AIIA 4IEIA 4ESHA 1YZTA 4D82A 3AVXA 1MABB 2OFXA 2FSGA 1E2PA 1KO4A 1U99A 1UF9A 2Y8EA 1D2NA 2R6GA 3VNVA 3CF2A 4B6FA 1KK0A 3G0HA 2KI5A 3ZVLA 1NNEA 1XP8A 1XBTA 2HYIC 3TLXA 2XX3A 1KJZA 1YZUA 4D26A 1US8B 3C7KA 4B48A 5LB2A 2QPOA 2ZYWX 2QTFA 3BB3A 1SHKA 2PEZA 1WA5A 3A1SA 1SGWA 4C0BA 1DVRA 5CDFE 1ZM2A 2ZREA 2WZQA 1S4QA 1HQCA 1N2CE 1XTRA 3UG7A 1VYVA 4JLJA 3FMFA 2OLJA 5JLJA 1Z83A 2QSYA 2FEMA 3FWYA 1RYHA 3GJ8A 4BZPA 4KITB 2BJVA 4IDHA 1YR9A 3X1YA 4Q21A 2BCJQ 3SFVA 4KLZA 2ZE8A 2REOA 5LBIA 1KMHA 4DBLC 2W6JA 1WBBA 3BE4A 3TR0A 4WXPA 1YZNA 2ZXUA 2NIPA 5K8IA 4LHYA 2ODBA 1Q20A 4IDNA 3CF0A 4TTQA 4WW0A 4LJ5A 2ZI6A 4FINA 3ZS8A 1HH4A 3I8SA 3KKOA 3ND9A 3GJ7A 3PEUA 1E2QA 3AGPA 2EU8A 2IXEA 4BRWA 2XTZA 1NLZA 2V55B 3OIVA 4OK5A 4PO1A 3R7WB 2OAP1 3QKSB 1E0SA 3B7GA 1CBUA 2I4IA 2QP9X 3HYTA 5J47A 5F3WB 3LBHA 1ZYUA 1H8ED 3LO5A 4Q7KA 4QC2A 1M7GA 1GNQA 4PQRA 3U7HB 3QPVA 3VAAA 2B8WA 5EXTA 2MSDB 1TADA 5FR2A 4RD6A 1G1MA 2IC5A 1E69A 3LA6A 1XFAA 3IPXA 3CRW1
chains in the Genus database with same CATH superfamily
1BQ3A 2YRXA 3I4FA 1QVAA 2Y1LA 2J8ZA 1PR1A 3UHJA 1U3UA 4Z5XA 3C8HA 1FQKA 2O52A 3QSYA 5FHQA 5DB4A 1ZM4A 1XNGA 3TW0A 1I94B 3QJGA 2IZ6A 3K0AB 1K4MA 2AW3A 4NZYA 1DMRA 1CHNA 2XSZD 4U7FA 4Q1FA 4AJOA 4B47A 5J2TA 3ZDEA 1FNBA 1SO8A 4KMOA 5LJIA 1T2NA 5JYEA 4CMCA 3BKWA 3CUKA 2QD1A 3OCXA 5G53C 4EMSA 1FNNA 1SVNA 2JAUA 4IINA 2J48A 4DCSA 5GIPE 2WIDA 1Z8HA 2W6IA 1QFXA 2IY9A 2BAGA 2IZ0A 5J3JA 3OP4A 4AUKA 4DA7A 3NFRA 3EF0A 3TD6A 1JKXA 4Z0HO 3M0EA 1NJ5A 3G2MA 4B33A 2GYYA 1AK9A 4GPEA 4NVRA 3CINA 1Z26A 3KAQA 2ZI4A 1N5OX 1QO7A 4R1OA 4N65A 5IZ4A 2R62A 2XWBF 1OASA 5AIBA 4ZVUA 4L6CA 3O8OA 1Y7LA 4XDGA 3SHVA 3FOFC 2OCXA 1V9SA 2SHKA 3ECSA 4W6ZA 4PHTA 2FVXA 2OD9A 4URYR 1KOGA 2PZFA 1AK1A 1LD3A 3DFKA 3LOQA 3RVRA 2I7VA 2CC2A 2ID9A 1A8QA 2VNJA 5KVSA 2O2EA 4HGYA 4W5RA 4HO1X 2Z9BA 5T8KC 3TIGA 3TLZA 1B0AA 2BFWA 2YJGA 5DFAA 1JSZA 4J9VA 4US2R 3TQTA 2D4HA 5LA6B 4ERNA 4XX0A 4FWTA 1AS3A 1BDBA 1LK7A 5BV1A 4CTMA 5LFAA 3TN7A 4JR0A 2GEKA 5L40A 1SXQA 1A2BA 4HWOA 2CHEA 1S8AA 3H9JA 3SQDA 4KDRA 1RQXA 5ARDA 1XU9A 3OTWA 1W2HA 1PQ4A 3W6OA 2B37A 1I1OA 1J0EA 1UEJA 1M1ZA 2W0MA 2UDPA 3QF7A 3GPCA 3H18A 4II7A 1EDEA 3NETA 4FCCA 3ZN2A 3KPYA 2YHIB 3DLCA 1HX7A 5GP1A 2H65A 4YIKA 3WO0A 5K0GA 1LJ8A 2ZU0C 4IGIA 1JG2A 3HL4A 4RA9A 2J9YB 4BL5A 4QUBA 5DCYA 3ET5A 4H1UA 3R3WA 1F0NA 1V4NA 2VC2B 1Z36A 4EH1A 2XMQA 4OPMA 4Z2YA 5CFQA 5EEGA 1IZZA 5E9JA 2IZ1A 4FT2A 3PNYA 5JXWA 1ZMOA 1DOAA 2YL2A 3RBXA 4A6PA 4CU2A 1N3LA 1SC6A 2KWIA 2C4WA 4OI4A 3KALA 4QUIA 2C9BA 1XQWA 2IVZA 1E0KA 3MRXA 4NJMB 4XDYA 2R79A 3DMPA 3IFSA 5AM5A 1P45A 1SUEA 1XDBA 2FMKA 4OBEA 5BPHA 2LBPA 1P7ZA 3G2LA 2BRUC 3T5BA 3E05A 3R44A 3TKYA 3VH4A 1BHQ1 1JSRA 1CY0A 2C88A 5E9QA 5IT9A 4HQ6A 1MO6A 1J90A 1ZVMA 4LV6A 1JEOA 3D3NA 1ZHFA 5FOWA 3SZ3A 2AKYA 5DU2A 4ZVLA 5CFOA 2B6HA 5KQGA 1XXLA 4PYKA 1DV2A 2WYIA 4LSWA 5JO9A 2CMFA 2V7PA 3OTIA 4YAGA 5T64A 3QTBA 3R7LA 3N2YA 5JNWA 3UGJA 4BN0A 3MRSA 1Z8FA 1NAHA 1IONA 3OQBA 1Y6ZA 3S70A 1PT9A 2PMFA 1M9NA 2WPDD 4E33A 5IVHA 1NHGA 3MLEA 1OFIA 4JWKA 1VCMA 4RMHA 2HUPA 2Q2QA 2I33A 5HRCA 3D6HA 4LZZA 3BMQB 1BEUB 4FZ5A 4P4NA 2X0FA 4BC1A 2O0JA 1Y8QA 2PGAA 2VQDA 4D56A 1ABFA 4P7KA 3GY0A 2GAAA 3TL2A 4S2UA 1TW2A 1ECGA 5AW5A 5D2CA 2N46A 3AHCA 2RI6A 4RMGA 1VYTA 4V3BA 1T2UA 3PGLA 3OE1A 5DVZA 4IH4A 4LYFA 5JC1A 4KQFA 1JR2A 1VPEA 3DBIA 4B79A 1YNSA 3WE7A 4MKIA 3DTVB 3U7IA 4DMFA 4EW6A 3D6MA 3AUJB 4DV5B 2C9OA 2QR3A 3TPFA 3UJPA 2WC1A 1RLOA 3ZHQA 4DYHA 4DUYB 4KWIA 3BT7A 4OLHA 4ZT6A 3C6ZA 1HDYA 4BCDA 5KQRA 5C8YF 3NEPX 1A2OA 2BR4A 2O3UA 4GLBA 3U19A 1TA9A 3F2VA 3FSEA 3S1LA 5CRIA 4R1NA 1BTOA 3VR2D 4Z7OB 4P5EA 1B42A 1JH8A 3GAZA 2YYSA 1XSEA 3E82A 5ENZA 3LXXA 4F8YA 3CH5A 5BSMA 4OHRA 2WSIA 4DDHA 3OHPA 3F8SA 4PQEA 1U0TA 1UMCB 3FE2A 3GG9A 3SR4A 4LFCB 1HE2A 1T34A 2VPWA 3R1IA 4OP1A 5JE8A 2H57A 4C30A 3SHFA 2QTNA 3BTUA 4CNQA 2FG7C 2VDQB 4KWEA 1AKQA 2PUTA 2BFAA 4X8HA 1YR3A 5FQNA 4UVDA 3OH8A 2XD9A 4B2PA 2ECPA 3NHWA 2ON6A 1L5GB 4YYZA 3N6XA 2XZTA 5C2JB 2ZUFA 4MH0R 1KIFA 1SUPA 3USCS 3PGA1 2UU9B 2DVMA 5CDYA 5BUSA 2V9ZA 4C1NA 3EPJA 1UZMA 2PBFA 3I6MA 3CLSC 3L6RA 4QGAA 4CCAA 3K9FC 2ZWOA 1WD7A 4EZBA 1XNJA 1IHYA 4W5OA 3S4YA 4LJSA 3BPSA 4EYSA 4HQFA 1UPXA 3GLHA 3DNPA 4HPXB 2H63A 4MV5A 3ZXIA 5C52B 4LX8A 3K1TA 2VRWA 3WAGA 5BUQA 1D1TA 4YRGA 2HKIA 1JV2B 1QO9A 1IHUA 1RWBA 2WPNA 2Z09A 4X1IB 4TKVA 3TL6A 1U94A 4BLOA 4B43A 3O7WA 1B8UA 3OKAA 4HFMA 1M2GA 4EB6B 4CM7A 3RS9A 2A1UB 5EYPB 2P9GA 2AG5A 3LECA 3ZHCA 1GLGA 1U8XX 3FTEA 1M2OA 4JUDX 2WQ6A 4DV2B 3VISA 3IQHX 3OY2A 4DT1B 2QLJA 2HA4A 3A70A 4CTNA 3D4BA 2Z4RA 3SICE 3L46A 4R1UA 4P98A 4N6GA 5B7GA 2GN4A 2AC4A 5AVWA 4K46A 1J42A 4NRDA 2OG1A 4ND7A 2FW6A 1SHZA 1B26A 5JG7A 4U2KA 1THGA 4LDAA 1O97C 1Y3DE 1JDTA 1ZESA 5AXAA 4YASA 2B4YA 3FNGA 2Q3MA 3ISVA 2PV0A 4PSKA 3B12A 3MTIA 2HWKA 1XDSA 3WLQA 4N54A 2B20A 4XCQA 5CM9C 2PIDA 1J97A 4GPAA 4J3JA 5CAEA 4HXYA 3A2KA 5FWYA 4HFNA 1YOVB 5IMBA 3AWIA 2BIFA 3RVNA 1UPFA 4YMIA 1OWMA 1OZAA 3MK31 3TDNA 4KYUA 4J4BA 1Y63A 1N4DA 1RIFA 3HB7A 1QTIA 3UQZA 4K0KB 1DGQA 2O5VA 1CZKA 4TWRA 2CXQA 1S9DA 3B70A 1TCVA 3K70D 4JLVA 2X86A 1U90A 3O21A 3G88A 3DW3X 1NNI1 3E3NA 2HHHB 2JD2A 3B1KA 3STXA 3WV4A 2Y2UA 3BJZA 1I2BA 3GFQA 2QORA 3OETA 2AZDA 2X1VA 2ATCA 3L1IA 4QRDA 1W85A 1K7SN 2P2YA 1MC4A 1PZHA 2A5LA 2YJ3A 3DL4A 4GLFA 4IG4A 2QAJA 4M83A 4DG9A 1GGMA 5KREA 2J0QA 4JI1B 1TZCA 2J3EA 1NVEA 3ZW9A 5GGXA 4BAGA 4HHEA 4BCBA 5K8UA 1Y7IA 1Y9ZA 1E2HA 3ZDYB 1WNFA 2QRGA 4J1QA 1L4LA 4J03A 1T3SA 1C3LA 3HDVA 2CUTA 5TV2A 2PFSA 2B2CA 4BJHB 4DLKA 1CT9A 3Q0EA 5HF6A 5MN6A 4NS4A 3CEPB 1B4DA 1Z7GA 3D3QA 3ELWA 2H2GA 3DF7A 4CQJA 1Q17A 2E21A 3HL0A 3I2GA 5EWMA 4Q9NA 2HK6A 1Y8AA 1MIOA 4PTYA 3G2KA 4D02A 4KLRA 3AKYA 1TMOA 3K6KA 4N1AA 4DLPA 2CT8A 1N78A 4QVGA 1FCJA 2CVOA 3DYIA 3FOAA 1EXWA 5CYPA 3L02A 3WFJA 4D8VA 4HVCA 1BFDA 1T24A 3INRA 2XVZA 1SU8A 5FPQA 2K2WA 3M82A 3BJMA 3LFUA 3MCAA 3QNUA 3EPPA 4GOKA 1JDSA 3D7MA 4RXMA 5DGXA 3ER8A 3KXIA 4LI0A 1R4NA 4G81A 1UKZA 4P0TA 5DMXA 4B3SB 2MSNA 2B94A 3OQOA 1DEAA 1F3LA 1HYGA 3DP7A 1SZCA 5FADA 3ZWDA 3QEKA 3L7DA 1TF5A 1ZR4A 1XMVA 1TM3E 1VPLA 1YU9A 3SQXA 2HZBA 1Q3KA 1RKBA 4GYKA 4KFTA 1PZXA 4JNKA 4RPHA 4TUYF 2AYYA 5DW0A 5HIMA 2RCNA 1JHOA 4IYJA 4KV9A 1ZIDA 5KJEA 1FP4B 4UDOA 5B4VA 4I1UA 4INZA 4KDCA 5CUQA 3SR3A 2FG6C 3R6TA 3I9JA 5ALEA 1EWVA 2JK1A 4P54A 1I7DA 2W4MA 4CM6A 4BPBA 4NH0A 4B71A 2H1RA 2AK3A 2H4ZA 5EUBA 2HRRA 4QU5A 2FPLA 4WCDA 4GYYA 3DS8A 2FFHA 3G2IA 1GYQA 1OC4A 3PZRA 4IHAA 1KS2A 2CLMB 4FHZA 3HADA 4PGGA 3C97A 1KKLA 2I99A 3IDFA 4KXQA 4TTPA 2ZDGA 2H85A 4JB2A 2P68A 2JZCA 4Z4EA 3MWEB 3PXDA 4AKIA 4ZOLA 2Q5EA 3A6HA 3IT1A 3UMCA 1RHQA 3NC1C 4ENQA 2MSWA 3OIUA 4ZOEA 3HDQA 2QX6A 2BP7A 3GA7A 3HGTA 4FDLA 4JOCA 5KCMA 3QPDA 5J4VA 2X40A 2R44A 4US1R 4LF7B 2XGMA 4QU8A 4IIUA 2UV8A 2ZJ8A 5AJTA 3MJCA 1XUOA 4R9UC 2IUTA 4LIPD 3E7WA 2C4TA 1GZDA 1ZXBA 3ETCA 4G5GA 3W5AA 2QRQA 1TT5B 3IR7A 4GM1A 4CIDA 4D42A 1KEVA 4AXXA 4EGFA 2GTPA 1MBZA 2HLNA 5KX5A 1MO2A 1VHDA 2EJWA 2LIVA 2I22A 4GAEA 3QE9Y 4MSUA 3S2GA 1XZLA 1DB3A 5LDHA 3SLRA 2JCYA 4BECA 1ISFA 1KY3A 4F46A 4D97A 3W2TA 4W5NA 3VR5H 3KTFA 2O0HA 4ZOQI 4EZEA 5JCPA 3HXQA 4YK7A 2FHPA 4R7TA 1SUWA 3C7DB 2IIPA 4WLEA 2NU9B 1VL1A 4I08A 4JCCA 5BN5A 3GLIB 3QKRB 1QGUB 2FX5A 3A1UA 3MUOA 5AM3A 1C7ZA 4WFKA 4O4IB 1UBLS 4P3YA 1ZVKA 4X5OA 2WJPA 1TIBA 1KK2A 2R97A 1OE0A 2W43A 2ZRDA 4WEOA 4WK2B 3DM9B 2H8KA 3IA7A 5AKGA 5FPTA 2GOYA 2FQWA 3SJUA 1G6OA 3ZLBA 4DCTA 1YS2X 2Y99A 2JFXA 4DUGD 1K92A 4B6SA 4HJXA 2ZU6A 2J6IA 1QONA 4NNJA 2J5XA 3G5MA 1FXUA 3QRWA 4ID3A 4PX9A 4PC2A 4CLEA 3LBNA 3GT0A 2G0NA 4BE9A 1Q12A 2XWSA 4KWCA 1NBAA 2R60A 3H8SA 1L7MA 2IV3A 2YKGA 4R71A 1VSBA 3OM0A 1JX6A 3MHTA 3BC1A 5CT6A 2NZWA 1GG9A 1JDZA 1WWKA 1JT2A 3EQ2A 1DXQA 3C1TA 3P2EA 4ME6A 3R3ZA 6LDHA 4W82A 4YMWA 3I9NA 1Q22A 3GV0A 1ZCJA 3JX9A 1DEXA 2DR0A 1MO5A 3HVJA 3LUBA 4X6XA 1GL9B 1NQUA 2WF7A 3KQVA 2QVGA 5E3JA 2NQ8A 5DHUA 5DYTA 1KPGA 1F5NA 4GM4A 1TLFA 3NG1A 1HLDA 3QOYA 3TD2A 5DTQA 3T1YB 2PKRA 3BD8A 2HJ9A 4TRNA 2HV8A 4M8NE 2C5FA 3RO7A 1HG1A 2GD0A 1ZC3A 2D2FA 4HLQB 3FWKA 1YB4A 1P75A 1WXHA 4E4RA 5F33A 3WYAA 3NNDA 5DNCA 4AKHA 2JNWA 3Q2KA 5B3JC 2ORIA 5JSUA 3G0CA 4RHEA 4W7HA 2WZDA 3L1JA 1J56A 3DEHA 2YR0A 3PEYA 4IILA 3NHSA 2OAGA 4H0NA 4MB6A 3VU8A 3Q10A 4MRAA 2E82A 2QZJA 2X4LA 3PE6A 2A9RA 5TGTA 2FAXA 1F38A 2IYAA 3E9CA 3JQAD 2JLWA 8MHTA 1PJ8A 4HGQA 1Q1AA 1YZGA 8OHMA 1RJ9A 3C3DA 5AKZA 3OKPA 4L3OA 3GJTA 4G0OA 2X8WA 4FI3C 4D0SA 5A4IS 1CV2A 3VNUA 2OGUA 2I7TA 3KEQA 3V8RA 1M1NB 7REQA 1CRPA 3VZRA 2YFKA 3GJ0A 1OZGA 2JLRA 1BMDA 2X8LA 5BV2P 2PUEA 2KE5A 4FSDA 3B2EA 1H0KA 1CX9B 1QE0A 4JNCA 4NK5A 2C4HA 4OBBA 5J1TB 4D9KA 3M3DA 3L0CA 3K70C 2WM9B 2VT3A 4ZQFA 3TEJA 3AUXA 3HXTA 3ZDXB 2V4MA 3AM3A 3Q7SA 3HVKA 3UAYA 3OWXA 4BWFB 2IS1A 3DV0A 3O83A 3EHEA 4EGAA 3EFOB 1P7WA 5BRAA 1VIAA 4FEAA 2VTBB 4QSMA 2XWQA 3CCFA 5IAJA 3AL2A 1CUGA 3REFA 1VLZA 2HF8A 3RGGA 4P7FA 1FYWA 4FLMA 3M2TA 4PCLA 4N39A 2EGGA 2M32A 3WNDA 2E4AA 2LIPA 2IYTA 3E5NA 2CFSA 5HGJA 4D9IA 5HILA 1M0SA 1A7JA 1U7TA 2QQGA 4RLQA 1G21E 4JI7B 4Q9JA 2D13A 2HB6A 3EMVA 4XGRA 2ZZMA 1TJ4A 1BVHA 1IOWA 1T9CA 3A25A 5BT8A 3H7AA 3RU7A 4LYEA 1YFJA 1D8AA 1HKUA 3E3AA 2CHGA 5HFNA 2WA1A 3GJ3A 3TUIC 3NNNA 4BO5A 2NYVA 3N5KA 1UKAA 2CUKA 1XJ5A 2O3SA 2QVYX 3WK8A 4EFKA 4MVJD 1A82A 1FB5A 1L8LA 3EIWA 1ZH2A 5BT9A 1E7RA 3Q3JB 3INNA 5FFNA 4D8WA 1CF2O 1CUSA 1ZKDA 2DXIA 3ZZNA 2PGIA 3V8BA 2Z5VA 2N75A 2C98A 3IVCA 5IBPA 4DRYA 5K2OA 5ITSA 1T8WA 4FUTA 4XA8A 3ISJA 3U7RA 5CCEA 5HX7A 2PUCA 1J0BA 1LDBA 2JATA 2Q0HA 5K1ZA 1R0YA 1ULAA 3IGFA 1UFKA 2HNKA 1LBIA 2I1LA 1MJHA 3QMVA 2D1RA 3RUCA 3VV2A 2VP0A 2QW1A 4B3XA 1OI2A 2VYNA 4LEIA 4CEIB 3AJ8A 1MV8A 2WPDA 3DLTA 3JQ8B 4M7OA 4PYOA 3HA7A 3EDMA 4JL5A 3L18A 3SSAA 3WRYC 1RWXA 1WZNA 1Z75A 2RJ3A 1ODKA 2OV3A 4X0EA 5IJZA 4NAVA 1E1LA 4JS0A 4JWTA 1YC2A 2I76A 4UVHA 3DOUA 2ZIAA 2JI6A 5ALJA 2P2DA 1PN3A 2O8EA 1U6JA 5L3SB 1CJVC 3HUFA 3BIWA 3ZC3A 1EGHA 4KVZA 3K7EA 1E3WB 1NVWQ 1PUXA 3C8UA 1HA3A 3C39A 2VXOA 4BRZA 3DZDA 2QN9A 3K92A 4M0KA 1FDIA 1MABA 1W75A 2HA5A 2QDXA 5I8ZA 5K05A 4GP9A 4IQ8A 2G4CA 1AKRA 1P81A 1DI0A 2VG8A 1YBMA 3B36A 1DJLA 3PJFA 1EEXB 2PSFA 1H1DA 4I1IA 4E03A 4BNFA 1D1QA 1RWNA 3EW9A 3SJ7A 2CXNA 3W7VA 1YTUA 1WMDA 3I3SR 3VR2A 2HSEA 3CBGA 2G82A 3EQ7A 1X7XA 5H4HA 1RYZA 1OH7A 1Z37A 3IUBA 3RBAA 1EGVB 1M6WA 3D7KA 5EKUA 1TMYA 5IAKA 5B58C 3L0PA 3AUYA 3OOJA 3VVCA 2MHCA 4Q00A 4YJ2B 4R2HA 5ESXA 3EVDA 3HJFA 1J8QA 4B31A 2CXPA 2GBCA 1IHPA 4U2DA 4EEKA 1E9BA 2ODPA 2POQX 2PSEA 1Y4ZA 3NHYA 2DSTA 4MVWA 1E5LA 4FCTA 3OM9A 1KMHB 4NG4A 3HY4A 4AK9A 4YCSA 1VJ5A 1HEIA 3OFVA 3QYJA 4KH1A 2FP4A 2HMVA 4UOQA 3VTAA 4GWKA 1J33A 3U61B 4S04A 3CYFA 1DE0A 5UKDA 3RSZA 4IXMA 4RTRA 1MNQA 1VJ0A 4NBVA 1AQUA 1YVDA 3RJ9A 1ZUIA 2FPOA 4TM8A 5M3BA 4HNSA 1Z38A 2O7RA 1Z62A 5H8WA 4QBFA 3TR5A 1TQ4A 3EE6A 4HUQB 4UW9A 2ZAOA 1R6TA 1FP6A 3KG2A 1Z6TA 4LZOA 2B8JA 2CZGA 4OQDA 4C07A 4RPGA 3ERCA 2XVMA 4ZI5A 1RADA 4UBIA 4WXHA 3GEEA 4Q48A 5TS2A 1UT5A 5IXJA 3O8OB 1NXSA 2TMKA 4YWJA 4BV2A 2FX2A 5J4YA 1RRMA 4JBNA 4ZA2A 1Y8RA 2DERA 2FEOA 4F12A 3GFBA 4H7JA 2XUZA 1BC5A 3GPBA 3T7DA 3ZHZA 1XOIA 1O6GA 2C2ZA 4LS3A 5HW0A 4GXRA 4EB8A 2C95A 1KO7A 5HF8A 5B3JA 5KYVA 3RUHA 4YRLA 3P9SA 4UUAA 4D4JA 5CB4B 3T7RA 1IJEA 2MMGA 4EITA 3D6UA 3FGOA 3KYJB 4TZ6A 2AMJA 5EP1A 5DHRA 2BKEA 1P2UA 4P86A 4X7MA 1TPYA 3HJAA 4LTNA 4UVIA 5CVVA 2ZUTA 3DKIA 1EZ1A 3R3UA 1IVSA 1N0HA 4IHJB 3ON5A 1GTRA 2Y05A 3KZCA 1VHQA 4IP0A 4NG5A 3T4UA 4CKEA 4PG7A 4F84A 2AN5A 2I6SA 2X13A 3BYZA 3EVCA 4UXJA 4NH4A 4M7RA 3TQRA 1YK1A 3LGAA 2Q3FA 4GDMA 1RTTA 5IVPA 5L7WA 1KAHA 1GR0A 1U0HC 3QE3A 2RGYA 1I4WA 3R09A 4XWAA 3UA3A 3TW8A 3KHSA 5J40A 2II6A 5ALDA 4OHFA 2PWZA 4ZP1A 1ZC4A 4E22A 3NOXA 3OLWA 4O2AA 5F9FA 1K27A 2GZDA 4BLUA 1YBVA 4RPIA 1TKBA 4MHTA 3CCCA 4CF7A 4IDFA 1YUMA 2XXJA 4AY2A 2PGLA 3CUSA 1A96A 2WB4A 5JSFA 5F2EA 1DAFA 4F97A 1BS1A 2FCRA 2BD0A 2PQMA 2R48A 1YR1A 3WVNA 4CLRA 1CS0A 4OHVA 3U13A 3DDUA 1ETHA 1QIKA 3D5TA 4A82A 4F6RA 1K5GA 3K9CA 3DZJA 2F8LA 2AZTA 1EVQA 1KZ4A 1RWOA 2CY0A 2IPAB 3L7YA 2XKAA 3KYDB 4HFJA 4EHIA 4JIMA 4XJTA 3L2OB 3USES 2DECA 5M29A 1E3MA 4S1PA 1UDWA 2BSXA 2FEKA 2H54A 2HF7A 3FAKA 4P32A 3DLPX 4JI3B 4AUMA 3BXEA 4DANA 3ILHA 3HWX1 3E3LA 3D6AA 3UJHA 2Q2VA 4ER7A 1PJLA 3CLUD 5EJ2A 4PSCA 4ALMA 5E6UA 2J9ZB 4KDEA 3KKPA 1T5BA 1O5TA 1C7EA 1E2UA 3G1WA 4UNIA 2YUTA 4CQNA 1RHUA 1GOTA 3FTFA 4C22A 1ZD5A 2BI7A 3GT4A 4EFDA 3A9SA 4S1VA 1JHRA 3DBOB 2X0JA 2FF5A 1OXUA 1I8TA 1L9KA 2V9CA 1E9RA 1G5RA 3LQFA 5DX1A 1JJVA 1JYEA 4X66B 1DG9A 4MIKA 4LC9A 1XRLA 5HSGA 1R1DA 2JCSA 5LMCA 3LTNC 1XZNA 2FXVA 2JHPA 4UBNA 3GG2A 3WRYA 5AVZA 2CMGA 2PJUA 3FUCA 2POCA 5BSTA 3EOZA 3QEOA 1HI9A 3FMGA 4IX1A 3FZQA 3O92A 3HR8A 2OHJA 2C5BA 3TTUA 5KTYA 4AF6A 4MWDA 3GH3A 4TTRA 1CB7A 4FKMA 1ZPDA 3B6ZA 3UHPA 1RYDA 2ZFUA 3P27A 2EJUA 2IWRA 4ZVOA 1F48A 4RCZA 5IP5A 1L5FA 4JLPA 3SDSA 3OLXA 5KZMB 3FTNA 3JQ7A 3AY6A 1NUPA 1JHQA 2IYEA 1LSJA 4NBWA 1USUA 5E4JA 2ISCA 2G28A 3WGZA 2E87A 3TLAA 2J46A 4HV4A 1UT8A 5KNLA 4RTLA 7ADHA 1FUKA 2CXTA 3FMVA 2DWOA 5K3FB 2JGAA 2WE7A 6ADHA 4MUKA 3SHOA 4HYYA 3DE4X 4KUHA 1LNZA 3SZUA 3UKDA 4GI3A 4GOXA 2OCDA 3ND7A 1BDHA 4MV1A 3B6JA 1I5EA 2M6SA 4HBZA 3E3MA 1Z33A 4D74A 3O9VA 3K3PA 3K9LA 4W5QA 4YMHA 2NLOA 1GO2A 1KZ9A 1JUDA 2OESA 3MAAC 5HUJA 1D2HA 5LIRA 1TK3A 4HEA1 1FFEA 2JL1A 1JG6A 1IN7A 1EFDN 2GZMA 1ESNA 3T7CA 4G1MB 5IJ0B 4B3RB 1L6RA 3AW8A 1L7VC 2RC6A 1DUSA 2OECA 2ST1A 3BERA 3BMXA 4PRZA 3L8FA 5KPDA 2H4WA 5MN4A 3T15A 1PG2A 3AERA 1TZMA 4EL0A 1G20B 4KRGA 5BWBA 3KQYA 1N7GA 4G0UA 1O9GA 3BM5A 4HMOA 2WTAA 4MPJA 3LWNA 1JQLB 3ZGNA 1P73A 3NBYC 1GFWA 2QRMA 1F8GA 2GWRA 1R0RE 2VI5A 5EPOA 3SOZA 2FR0A 2IXBA 1V6SA 5BMVF 2ZM5A 1UKCA 2AHRA 1GPDG 2HFJA 3ONFA 4B85A 4ALLA 1NOKA 3G2QA 1Z0ZA 4EHFA 2XYGA 3SBDA 2EFGA 3LI2A 3QW2A 5T5QA 4BEWA 2BYTA 4XDHA 4MVJP 1YVPA 2AN1A 1K9SA 1OLSA 1YQQA 4H15A 4FXOA 3VVBA 1C1HA 4C4RA 4IJUA 4YLYA 2JGDA 2W6OA 1E1RD 5CB8A 5JOQA 1P5RA 4IUCS 5EWJA 5IRCD 2I4MA 3M5WA 3OZGA 2R1VB 3I4CA 4ZCQA 2HH9A 1RZUA 3REQB 4BFCA 2JH3A 5KYUB 2Q7DA 4YUAA 3KU1A 3D4NA 4DUGA 1W5AA 3HDJA 2WWYA 4OP2A 1C50A 2GHTA 4AMUA 5CK5A 2OSVA 5LQJA 2ORED 1D07A 1M34E 2ACEA 2RJNA 2Z8YM 1UWKA 2MOKA 4KN8A 1XYVA 1GL7A 1KVRA 3GLHB 4TWJA 3WGUA 2AW5A 4CIXA 2O59A 3OEED 3KVOA 1C1XA 2VNHA 1RP1A 3DXYA 5C3UA 4LF4B 5G3YA 4BGIA 3N8IA 3FZGA 1ZNQO 1FFYA 1PGNA 4I6GA 5GJBA 1Q0ZA 2JJ1D 5DPMA 3N75A 2P4EA 1HMPA 3EY4A 1XJQA 4NYMR 3COJA 2R6DA 5TQ2B 2JFOA 1OBHA 4XCVA 3DVRX 4Z3KA 4FP9A 2O3JA 4DV3B 4GS5A 1DBQA 4PZCA 2WY2D 1TZBA 5EZYB 3K73O 1B8VA 3RUPA 2O07A 1AKUA 1L8OA 3IDZA 1NVDA 5LU9A 5LP6C 4RW0A 16PKA 1R64A 2QPLA 3FY4A 3STHA 3F7NA 3UATA 3PBKA 5BNFA 4ZHQA 1NP3A 1ZUWA 5KQMA 1QXSA 4RK0A 5DM1A 5TGZA 3QH4A 2NZJA 3DBRA 4J2HA 4ALKA 3UMRA 4A16A 1A9XA 1KY4A 3HVUA 3C87A 5C81A 4DG5A 4XGIA 4NBKA 4NL4H 4YEDA 3L7NA 1XKXA 4N0DA 5SZIA 1AE1A 1T9GR 4CE6A 1RRPA 2M6RA 2GM3A 3KD3A 1WPXA 5JSZA 4UM5A 2RG7A 1S01A 3ADDA 3G17A 2XNHA 1BDJA 2A78A 5IS2A 1L4HA 2C3MA 1K3UB 2FPGB 4QEDA 3PNPA 2C31A 1EPUA 3E9EA 3I1JA 4H3SA 2CL5A 3ZDBA 2YV2A 3ASVA 3M6FA 4HVAA 4MROA 4DHEA 5BR4A 1CWUA 4Q9DA 3IJ5A 4M86A 2C07A 3W9UA 4EHBA 1MFZA 1U2PA 2PD4A 2WJ4A 1KOJA 2I2AA 1GRQA 1NATA 2Q9BA 2YXEA 3BGDA 3KT6A 5DOVA 3DUFB 5JT1A 2OV8A 4QXRA 1CUHA 5HR5A 1T5LA 1UOEA 4RAOA 4D4IA 3D4IA 3A3YA 1O95D 2NUPA 1UJMA 4LQCA 4OA8A 4NDAA 4W8HA 3I2YX 3QELA 3NO4A 2AZMA 4RGQA 4JR1A 5AVOA 5ALLA 1VE6A 2ZJAA 4IM7A 1JEYB 3K0SA 1U2GC 4ESVA 4COOA 3FRHA 4YAUA 2X8JA 4EJ0A 3Q7TA 4J9UE 2IU3A 1F1JA 1M10A 2VYQA 1JQ3A 3K2IA 4CCWA 5AW6A 5AXCA 1VBNA 1GTL1 5LQNA 1JE0A 3I9KA 4TRMA 3AUSA 4RABA 3TLMA 3W4IA 3ZHUA 1R6BX 3ILSA 1D2GA 1E0DA 4EKYA 5C7IO 2A30A 1QRSA 3AU9A 1M2HA 2WBLC 1RZRD 1V3QE 3OU7A 3S3TA 3CLUC 2GN0A 1VHTA 4RNDB 2Q4EA 3Q7RA 2I03A 3TSWA 2YS7A 3E5HA 1D2CA 1LQTA 3Q9SA 4KCGA 3TO5A 3ZJ5A 4D98A 2VHJA 4TV8A 1P1KA 3K9QO 4QBTA 1A7AA 4FN5A 4EKDA 4BZWA 1HR0B 2XYPA 5HYVA 1S96A 1QRRA 1T0HB 2BTQA 3TOZA 3RVPA 3T3OA 4B4UA 1WLSA 2GLUA 3KTAB 3NAGA 4XVRA 5DHAA 5AI6A 4NXNB 1P3JA 1GGVA 1R4NB 2QEQA 2IIVA 1GPNA 1YFKA 3KE9A 1GZ4A 1I6WA 3OI7A 4GPD1 1YZFA 1S2MA 3GIWA 4HGOA 1E58A 2I8CA 5BQ3A 1ZK0A 2BMEA 4I5GA 3RROA 2WTEA 3KR2A 1ST2A 3L6DA 5DYGA 4D9EA 1HRDA 1DFGA 3EXG1 1NPYA 2NZ2A 2VTVA 2ZJFA 3IKMB 4WKOA 2WUFA 2PWBA 2ZJ3A 3HBMA 2V3CC 3AETB 1PV2A 1V7CA 2R4TA 3IPCA 3N2GA 2BWJA 3ZWBA 4EA9A 1J2TA 2VRNA 2H7CA 5K0TA 3DBHB 1IEWA 3H3XA 4CQMB 2YYZA 4Z4IA 4LMPA 3KSDO 2JS7A 4R01A 1XELA 1N2IA 2WFMA 1JN0A 1R27A 1TCUA 3PUKA 3JATA 3EFEA 3SP1A 4Y67A 2GEJA 4LOAA 3AY3A 1JPUA 3B7WA 1U8FO 3B8HA 2JEYA 3GJ6A 2WTXA 1YH3A 2NUBA 3I37X 3NXKA 4RVGA 1T5SA 3KDPA 5DBIA 5KC8A 1BS9A 1Z5PA 3B1WA 1T15A 3INGA 1IUNA 1DV1A 1SVMA 1O4WA 2I3DA 4RVOA 4ZARA 3RANA 1YQWA 3AF4A 3E23A 1TRHA 4M1KA 3SZLA 1NP7A 3C4VA 5DHSA 2BW0A 3U60B 3G2OA 5F2OA 1HE1C 3ZZTA 1J99A 2OBLA 2PL1A 5HRAA 2XA1A 1BA2A 4HLCA 3R6LA 5E7QA 4NKRA 1QYCA 3EG9B 2B1RA 1Z7YA 2YQ4A 3CJTA 3BRCA 3D43A 5EKSA 3O8RA 5IFLA 5U1PA 5JS6A 3OQNA 3RD5A 2Z8XA 3HB1A 5F1PA 4DQLA 1XA3A 3IHTA 3OLVA 3WKBA 3GI1A 3R0ZA 3DNMA 1HFJA 2H1VA 2IE8A 1PZEA 1U0NA 1CUYA 2FSVC 2BFCA 2ZB4A 3A3KA 4CMAA 4CLDA 3RIYA 1NW6A 2ZSJA 3X1DA 2YICA 1X8JA 1T9DA 4QOEA 3L43A 3AFOA 4D9MA 1XA4A 2RD2A 2IYWA 2Z2JA 2DFNA 1DRVA 2P62A 2EFDB 2P9TA 3DWEX 4PFSA 5CD9A 4B7ZA 4BPRA 2MSCB 4IVPA 4MW7A 5IUKC 3CZMA 3UYLA 1OXSC 3V2IA 2HU8A 4WXRA 1WY7A 4CIYA 1U3GA 4HXGA 2TRSB 4QEKA 4HXFB 4JVLA 1JRLA 1XC7A 4XAQA 4QG3A 2GN8A 1H5NA 1X14A 3VM6A 1DAKA 1CP2A 4IHJF 1CK4A 1XMXA 3AHDA 1Y1KE 2X77A 4ZT4A 5IAEA 2PBRA 2ZR9A 3NRCA 5LB4A 5LYJA 1OVGA 4WV3A 3ZEAA 2ENUA 2R66A 1H0RA 3IIKA 1Y3CE 2H5JA 4P33A 4ZGWA 1RRVA 2I2XB 5CK4A 2RG1A 2B3TA 1OZ0A 2WOOA 4WK4B 5D3QA 5FIUA 3VYSB 1G41A 5CU7A 1F2DA 3FDFA 1DAGA 1O6ZA 1HK7A 1AV7A 3ANTA 3K2BA 2FWBA 1MA3A 5DRYA 2O3QA 3LGXA 4EVSA 5BSKA 5JQGA 1WDWB 3PPIA 2XOKD 1Z8DA 4H1HA 4A6EA 4Y0NA 3N70A 1T8SA 2AQIA 2OP0A 3DV9A 3KZ1E 3LMKA 3ODPA 3U0BA 4C7JA 5HOQA 4B3GA 5ALUA 3LYAA 4NMMA 3W8EA 3ETDA 2X19A 2PNJA 4OREX 2ZBFA 1TCCA 1YL5A 5IDYA 4EFMA 4LJ8A 1ZH8A 2OE2A 5K3EA 3AM1A 4N0EA 4JH0A 3X1MA 1H85A 2C4NA 4W1RA 1CUAA 2J3LA 3D8RA 4DCMA 4K88A 4GVXA 2VT6A 1QHEA 3PRJA 4LYYA 1S3FA 3F7OA 3SJAA 1ZKMA 5JFOA 1QLHA 3NGMA 1OLUB 2ZE7A 4WX2B 1M0EA 2F2TA 2FVYA 1EVZA 1TFUA 1ZJ6A 3WLHA 1JILA 2XUIA 3CZRA 2W83A 4PIMA 4B80A 1PCXA 4K9KA 2PAAA 2JKYA 2HYDA 3LPLA 4UCWA 1SVSA 1AQJA 1XRMA 1E9SA 5ECDA 5KVAA 2JIDA 4I66A 1JFRA 1U2GA 4FYVA 4CR8A 4ARCA 4IZHA 5E4YA 3U3KA 3QUSA 4G24A 4J7UA 1UBHS 4OXXA 5IAAA 3U9SA 3K0FA 1BCSA 2INGX 4C7BA 2IYYA 5F4BA 5JXIA 2BF7A 3EEBA 5LR6A 1E3LA 3NAQA 5K01A 3E9QA 1I3KA 4Z51A 2HIGA 1CY2A 1K68A 2BM1A 1FJGB 2W2LD 4XTRA 2J9GA 4C4OA 1HTWA 2GCIA 5A9SB 7REQB 5IT5A 2GXQA 5CGZA 2P6UA 3I6YA 4O02B 2XKKA 2WJ6A 3VC7A 3A1CA 3PVCA 2Y77A 3GDHA 2TMDA 1PHPA 1P5ZB 2D3TA 3BH0A 3VO2A 4X8MA 4D0NA 2FPWA 1EVJA 3AEKB 4JYPA 3DV0B 3K1AA 2X1HA 5FV4A 4A23A 1O95C 4MQEA 3UUWA 4LE0A 3AYXB 3EGDA 3VKWA 1JWAB 1X39A 3TJRA 5JADA 4BTLA 5LD2B 5EKXA 1FK8A 1OWNA 3G9UA 4ZAXA 2V7TA 2DY0A 1ZAYA 4N47A 3UK0A 1KYTA 3O82A 2FN8A 5KVQA 4CU5A 3WOHA 3TSZA 4BE7B 3OY7A 2VSFA 1SCUB 2JDIA 1BA3A 3DPSA 4ASUD 5I4KA 1WKVA 2EKLA