3FMFA

Crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
229
Chain Sequence
b'FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
molecule tags Ligase
source organism Mycobacterium tuberculosis
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
total genus 73
structure length 229
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmfA00
1NLFA 5EZ6B 1G7RA 3LA6A 4YXWA 3KTAA 2FDCA 1E94E 2DWPA 4URVR 1TF2A 5G41A 3RSLA 4LJYA 3VX3A 2O8DB 1S1CA 2ATVA 4IFEA 1PLLA 2XTMA 3DM5A 1RRFA 2NOAA 4ZI3A 3GEHA 3OF5A 4A0GA 5FPKA 2ZSBA 1TEXA 2AK3A 2D3WA 3KXLA 4HDCA 1G3MA 4OJQA 3UKDA 2GBLA 3QY0A 3GJ5A 1ZNZA 3NTUA 1NIJA 2IT1A 1HTWA 3IBGA 4A82A 1XB2A 4OHXA 5DGXA 4YXWD 4QBGB 2PMKA 4C0HA 4PAQA 2GDJA 1Z0DA 4NYMQ 1QRAA 2B92A 2GILA 1OH5A 1DADA 2DFLA 3HJNA 5L3RA 4LJ4A 2ZE8A 4YLGA 2ZYUX 5BW8A 4KXFB 4Q9HA 4MYUA 5TXGA 1DVRA 1B0UA 2C03A 1M34E 1G64A 2REBA 4I4LA 2ASEA 1W49A 2VP4A 3K8YA 3AVQA 1A4RA 2QI9C 2HJGA 1E9DA 4JT4A 4R9UC 4CEHB 1XZQA 2DFKB 2G3YA 5H70A 1XEFA 4D80A 2NO0A 3T35A 1GL6A 1OH7A 4M1WA 5F2EA 2QROA 1I4DD 1X8LA 4ASUD 1SVOA 2ZAOA 1IONA 4JLOA 2QSZA 2WJYA 2CK3A 3TSZA 2XB2A 1KK0A 2ZJ2A 4WAUA 4KFUA 3EZ7A 2ZYTX 2IW3A 5KSYA 2JEOA 3LRPA 1FL9A 3B7GA 3KXKA 1OXUA 1FUUA 3ZZUA 1G8HA 2RB4A 1P72A 4DJTA 3ADBA 4C9BA 5K8TA 5DNYB 2IUUA 4X8HA 2IYSA 2MSCB 2ZITA 2WICA 4UNNA 5DIFA 5B30A 1XJCA 4HDOB 4TMZA 1MRSA 4BFVA 3DHWC 4QBHA 1E3MA 4GPTA 1U9IC 1T91A 2QMUA 3U3OA 1EWRA 4TLBA 2VEDA 4PO9A 5FBLB 5KPJA 4BPBA 1OB2A 2Q9AA 2EWVA 2JLWA 2VPPA 3NEJA 1IXSB 3MLEA 3AEZA 3T1TA 2RGAA 4XWKA 1AK2A 1ZD1A 3T12A 2NZJA 2OXRA 1XD8A 2XNSA 5AJZA 3CX6A 521PA 3O8RA 1T4GA 2QE7A 2P5TB 4IHQA 2XTZA 1QHGA 3DZ8A 2WWHA 1F48A 2R6GA 4IVQA 1XEWX 4RKEA 3TW8B 1Y63A 4ESVA 3ZZ0A 4R98A 4B75A 2A78A 1K6MA 4IDHA 4BFTA 2ZJAA 3AP1A 2GBLC 4UJ3A 3AVTA 1VDZA 2ZRKA 4X8LA 1D2MA 3ND8A 5GVSA 1SHKA 1JPNA 3B85A 4GOXA 2OCYC 2H92A 1TQDA 1US8B 3EIEA 1TU3A 1UM8A 1AS3A 1MABB 1OJLA 1E79D 3D7MA 1OKKA 3KJGA 3VU9B 3IKJA 4TMKA 1JI0A 2QTVB 1PJRA 1RZ3A 1KY2A 2FSGA 5DSZA 1S1MA 5CYPA 2BVNA 3P32A 4M21A 4DKXA 1H8HD 1OB5A 3AVPA 1YR9A 1P9RA 4MUBA 4D4LA 1GOTA 4L16A 2WSMA 1UBFA 3CBQA 4W5JA 3U5ZB 4ACAA 4JLNA 3NVAA 4W7SA 1SHZA 1JEDA 4OHVA 2O0JA 5LB2A 3U44A 1DS6A 2AKAB 4F7WA 1OXXK 3BORA 4I1SA 3CW2A 3KTAB 4LK2A 1Z28A 2C77A 2FFHA 3Q85A 1G4AE 3EA5A 1KI4A 1PUJA 1JXMA 3PFIA 4JSYA 4C0QC 1W0JA 3QXXA 1T3HA 3VHXA 1IN6A 1MH1A 4QM7A 4TWZA 4CT4B 4QBIA 3H1TA 3W6OA 5CB8A 4BGDA 2GHIA 2J1LA 4F38A 1K8RA 1G3RA 2RH5A 3TR0A 4B47A 1AZSC 1R4AA 2WWWA 1XF9A 3QE0A 3QOFA 2PEZA 3THWA 1XPOA 3BB3A 2V4ZA 3SR0A 4DXAA 2DR3A 2ZM5A 1DAHA 4DIEA 1NN1A 2CNWD 1IN8A 2QT0A 1KSFX 2W2VA 4JS0A 5D3MA 5FOWA 5FOVA 1GITA 2ORIA 3PEWA 5JWHA 3ZH9B 1QHNA 1Z07A 4WBSA 2BBSA 2VF7A 3WHKA 1YZLA 3ZGXA 3G0HA 4ZDWA 3RS4A 1XEXA 1YJ5A 3SOPA 3I32A 4TLEA 1WRBA 3BXZA 3M0EA 5A5GA 1W0KD 3LFUA 4O2RA 4JKIA 3WNBA 1LF5A 3E5HA 4NCJA 4JBYA 5J4VA 3RHFA 3AM1A 2QAJA 3Q7QA 3VR2A 3MWKA 1O87A 4LUCA 1CBUA 1DG3A 3ZQ6A 2VSXA 3CUEF 2QMOA 1RYFA 2XNDD 5FOUA 3Q9LA 4ZIRB 1JQLB 1KJYA 2J3EA 4LRWA 3QF7A 1S9HA 1JAIA 4AWXA 5K8LA 1TTTA 4CEHA 5FTMA 2W6ID 2QL6A 5DHFA 4P4TA 4QKQA 5L8VA 1GNQA 4U02A 4EDHA 4MDEA 4QGAA 1Z0KA 1E0JA 1ZU4A 2JDIA 1Z47A 4FCVA 4M1OA 1CKEA 1F5NA 2EU8A 2QP4A 1UKZA 1E0SA 5HZHA 3L0OA 2WSSA 5BQ5A 1W46A 4OK3A 4E03A 4DB4A 4JVNA 2B6HA 2FX3A 2WMNB 4LOAA 2XITA 3LWNA 1I2MA 5UKDA 4DLZA 2HXSA 3AVWA 1RRPA 4IKEA 3SI7A 2CE2X 3CRRA 4OQLA 2Q9CA 3QNUA 2WIAA 3QVVA 1VIAA 4BZPA 2X2FA 4O0MA 3I61A 1W2GA 3HU2A 4I99A 3SJCA 3ZIAA 5HR5A 4BEJA 4ZCMA 3K70C 3CF6R 5EP3A 5P21A 2QEQA 1LTQA 3OEHA 5F3WB 2ZSEA 4LZZA 2G9NA 3ZDQA 2B7CA 5FL7A 3UATA 1ZAKA 1Z0FA 1SKQA 5L3QB 1DEKA 4QGGA 1E1QD 4LHXA 4Y0VA 4B2IA 4LV5B 2KBEA 1G5TA 3OIWA 1BYIA 4LYAA 4LY6A 2RGDA 2P2LA 1OIVA 3OIYA 3EWAA 3GCGA 4IOKA 4E5UA 1OFUX 4OI1A 1R8QA 2CL7X 3TAHA 4A1FA 4OI0A 5HCIA 4HB0A 4V0OA 1GKIA 5FBWB 2JJ1D 3IILA 3SJBA 3SBEA 3BBPA 4WZ6A 1G3IA 5E7MA 4F4JA 2AXNA 2B21A 3QXJA 3I8SA 2DY1A 3FHOA 3NG1A 4Q5IA 3REGA 2GJAA 1NNEA 4JBXA 2G77B 4BFYA 5J47A 4DCTA 4BUJA 4F91B 4JT2A 2OT3B 4LV6A 3OFND 4NKRA 2HEIA 3E70C 4MRNA 1NSFA 4JVLA 2XGJA 3H0KA 2VRWA 2G6BA 4GMDA 1IXZA 3R7WB 3QBVA 1XCGB 2WJIA 3FE2A 4IVPA 3VR1A 4Z8YA 3T06B 3QXSA 4BWYA 3SZRA 2Q21A 3EASA 4BZXA 1P4SA 2QENA 1KI7A 1G20E 4D25A 4Q19A 4KBFA 3RYTC 4BZQA 5BN3A 3J81k 2HUPA 1OFIA 1CJVC 2CCGA 4BLSA 1OYYA 4N0DA 1FFHA 1VIYA 1ZYUA 2I1QA 2ERYA 3IIMA 1A1VA 3U7FB 1AS2A 1U8ZA 3W5IA 1KK3A 4II7A 1GDDA 4TYYA 1DE0A 4DLUA 1KJWA 3W6NA 4I81A 2ZR0A 1VG1A 4M1MA 2F6RA 2VTKA 1OT3A 4JLVA 2WJGA 4M9QA 3T15A 1VKJA 1ONBA 1TF7A 4WVFA 1V43A 1EGAA 3OAAD 4HAZA 2G0NA 5E3HA 2VQSA 2ZE5A 2ZI7A 1IY0A 3AP2A 3IQXA 3QPWA 4LHVA 4B6FA 4D2IA 1F3OA 4Q4HA 2AHOA 1KSHA 3BB4A 4TL7A 1E2DA 5FI1B 2BC9A 2ONJA 2RGXA 2JLQA 3U7GA 3P20A 2ZS7A 4N1AA 3Q7PA 4MUAA 2O0HA 2Y8EA 1PVOA 3W6PA 1UBEA 1NBMD 4TN1A 1G8FA 3QPUA 2OBLA 2HF9A 3F3YA 1XTSA 4PC3A 4URXR 3FGNA 4NH0A 5J5CA 3V9PA 1FX0A 2PZFA 4TQUS 3PQCA 4PFSA 3NXSA 2JLUA 3KB1A 3PUYA 3DKVA 2UZ3A 4Q7KA 5E4FA 5B2ZA 2YWGA 4NCKA 1CJTC 1EFRA 1JR6A 5DH9A 4OI4A 4UNRA 2C98A 1KGDA 3THYA 3BIFA 2BBWA 4XIGS 2CL0X 5HKKA 3GLHB 2ZYVX 5CLLA 1HY3A 4WOPA 3KQHA 3C5CA 2J5XA 3TRFA 3TSWA 2MMCA 5DN6D 2A2ZA 1E96A 4DVGA 1KHTA 2ONKA 4S35A 4UNQA 2C9CA 2XEXA 3IPYA 1IJEA 4Q48A 2FSHA 2FPKA 4ZCIA 2OCAA 2SHKA 3QQ5A 5EUQB 5LPNA 2A5FA 1OKKD 2QN6A 4EFLA 4U5XA 1SVWA 3LLMA 3DMDA 2CLCX 4RD3A 5JCPA 4ACBA 3QKSA 1TEVA 3OIVA 2QUZA 2GRJA 1QBKC 2XSZA 3KQUA 1IY2A 4KODA 3B82A 1ZD9A 4GI7A 4HAUA 4HUQA 1EFHA 3WNDA 3M1IA 1JR3D 1DAKA 1G16A 1XU4A 3AP3A 5DE3A 4A2WA 4AURA 4B3XA 2D74A 2J59A 3PEUA 1VCNA 3LY5A 2W6JA 2O8EA 4WXRA 2YWHA 5AR1A 2GA8A 3IBYA 5FL3A 4O2LA 5AJYA 2GK6A 4OHZA 1OFTA 3W9YA 5J4HA 1JEEA 3QSYA 1A7JA 3EA0A 1R10A 1OIXA 1D2NA 1KK2A 1U0JA 2OV2A 3MFYA 4C7OA 4NU0A 4XWAA 1MKYA 1RYHA 1YZQA 4POAA 1WF3A 2QORA 4DT1B 2J87A 1UPTA 3H86A 2GK7A 1CEEA 1AN0A 4HB4A 3EPLA 2QPAA 4OK6A 1WBDA 3B1YA 4I1OA 1AS0A 4M1SA 4EJSC 1Q57A 1R0WA 1A5TA 1GWNA 3RC3A 1WDTA 2ZEJA 2N46A 3I8XA 221PA 3K0EA 5DI9A 3X1DA 2BBTA 3SDZA 3K0CC 2CHVA 1N6NA 4CEJA 2DPXA 1ZCBA 4KITB 2FPMA 3CPJB 2EYUA 4B3FX 1R6BX 1E1RA 2GXSA 4Q1FA 2UZIR 3EPJA 4RFSA 2PX0A 1T3SA 1JR3E 3MWJA 4B3BA 4DDUA 4BRUA 1EX7A 3Q72A 4B44A 5IRCD 4DLSA 3N2IA 3X1WA 3TVDA 4AG6A 1NMXA 1OPXA 3LV8A 3BH7A 2O8BA 2C8VA 4YC7A 3TH5A 2F1HA 3QENA 4FI3C 3CF0A 2H17A 3K0AB 1P2TA 3UWOA 2H57A 3A4LA 1P62B 3LXRA 3Q5EA 2GF0A 4P3YA 1W7AA 1L4UA 2A5DA 1E4YA 4P33A 1XPRA 4DLWA 4HYYA 1HA3A 3TVTA 1ZNWA 3BFVA 1Z22A 1M7HA 3E1SA 1ELOA 2F3RA 2Z83A 3EAQA 1NP6A 3S1AB 3PENA 2QG6A 2H5EA 5FOTA 1JJ7A 5C2JB 3MAAC 4CVNA 2NO7A 1VHTA 4UNSA 1W4RA 4ZIRA 3LAWA 1N0WA 2QU8A 5CITA 2JLXA 4PHTA 1VMAA 2OILA 3DZDA 4EUNA 2IBMA 1JECA 3V4RA 5K8UA 2GXQA 1GP2A 2IYLD 3CX8A 3C16C 5JHHB 1TADA 1JXOA 1FMJA 1DO2A 1G9XA 2IYXA 3GLIA 2IWHA 4LBVA 4OYHA 1IM2A 1NLYA 1VG0B 3SQXA 3PUZA 1E2GA 2EVWX 3VAAA 1AKYA 2WV9A 2ZVPX 4QGFA 2CEAA 3K9LA 2RGGA 4URZR 2VIIA 4JJZA 3U3MA 3KJEA 4H1VA 1VTKA 1Z83A 3FPAA 2ZVQX 1GTVA 3VHLB 3ZQJA 1OXVA 1IY1A 1KI9A 2FSIA 2RHDA 1H65A 5FPSA 4YMVA 4CT5A 3THWB 4RZXA 2CHQA 3CF2A 3VTKA 5JWRA 2EYQA 3M6AA 2YOFA 1KO1A 4XTRA 3U4QB 3BJIC 2W83A 1U99A 2ZR7A 2C9OA 5C1BA 3MWLA 3IDQA 4QNRA 3GLFE 2VLIA 4MRPA 3NBYC 4ERNA 2YOHA 2ZI3A 2A9KA 4V0KA 3I5YA 1X6VA 1G5PA 4CZ2A 4AIIA 1IN5A 5CYOA 4AKHA 2HYIC 2PMDA 1FP7A 1T0JB 3EZ2A 4Q1EA 4JMPA 3KJHA 4Z51A 2OBNA 4NHOA 3B1ZA 1G19A 1YZUA 2C04A 1NN3A 3L8YA 3VX4A 4BEBA 2ZUDA 2W6JD 3R9XA 1TQ4A 5KPDA 4XVRA 1VCMA 1U94A 2FN4A 1MOZA 4MYCA 3TBKA 2IHYA 3ZJYA 2ZU0C 3UG7A 2RHMA 3AF0A 2IA5A 3F8TA 4B73A 1NMZA 3KQNA 3GJ0A 3OIUA 1DAEA 1XMJA 3BH6A 5GVRA 3AVXA 1A2BA 3OFNA 2MMGA 1GKUB 1FZQA 1X8JA 4ON9A 2QGZA 1KY3A 1OF1A 2QE7D 2WM9B 1NVUQ 3ADCA 2A30A 1G41A 3O8BA 4MGIR 5FI0B 3KKPA 5TARA 3W90A 2HXYA 4AKIA 1CR4A 1ZUHA 2ZE7A 1KO5A 3K9NA 3UWKA 4QHYA 2H18A 4HAWA 2O8BB 2X19A 2ZE6A 4IEIA 4U00A 2AXPA 5KYKA 4LJ5A 4TSFA 1OLOA 2C2HA 3QF4B 5DYIA 3RRZA 3U6BA 1KNXA 1TL7C 3CNLA 2P6NA 1A82A 3WP0A 4Q9KA 3FDIA 2BV3A 3VQTA 2KI5A 4GZLA 4EPWA 3SYKA 1ESNA 4W9MC 1GZSA 3C8UA 3KUCA 4BLOA 2UVQA 5F9HA 3U44B 2V8OA 1KAOA 3CPHA 5IDVA 4Q01A 1D8TA 1JR3A 1J70A 3IUYA 1UBGA 3ZVLA 2BMDA 5KUTA 2RAPA 4MGKR 3MGCA 5FBQB 1KJZA 4HUTA 5CM8B 1L7VC 5H1YA 3A1SA 2R9VA 3GJ6A 1NSTA 2ZRDA 4D81A 1E2MA 6Q21A 2IYQA 4LJ9A 2FA9A 4MGYR 1FTNA 2FGJA 1NY5A 5LD2C 5F9FA 4M9XA 2OG2A 1Z0JA 1KMHB 1Q1BA 4UXIA 1E69A 4CRWB 5CDFA 1AJEA 3OEEA 4BE7B 3D3QA 4IEEA 5CDFE 1VYTA 4BFXA 2JIZD 3AKEA 1KMQA 2Q3HA 4OQFA 4M2LA 2WPDD 2V6JA 1N5IA 2OZEA 4G01B 5EXPA 4FCWA 1U0HC 2GEUA 1FNMA 3GLGB 2J0QA 4EQ6B 1DG1G 1QVRA 1CTQA 5CK5A 2F55A 2QZ4A 3DKPA 4TL8A 3ICQB 2NMVA 1BMFD 1ZUIA 3OHMA 1XTRA 2F7SA 4PPNA 1XEWY 3NIBA 5KU1A 4JBWA 3PITA 1TUEA 1CJKC 2I1VB 5JHGB 3OEED 1E2IA 2N1BA 3QBTA 5GJCA 2QM7A 4D0NA 1E1RD 4JLJA 4XH9B 1U2RA 1COWD 4AD8A 2KBFA 3MMPA 2V7QD 1I4LD 2YKGA 2GJKA 2REOA 4YMSA 3CWZA 1CU1A 2P3SA 1ZBDA 4DCNA 5HE9A 4TYWA 1BS1A 5G53C 2YWEA 1EK0A 3U7HB 2ZQ5A 3HWSA 5DHAA 4X8OA 1HUQA 4LCBA 5HE8A 1Q22A 1HH4A 2KE5A 3I5XA 1X1SA 3B6EA 3RVBA 1NJGA 2R62A 3FMIA 2LWIA 4DBLC 4Q03A 3FOZA 3LH5A 3C41J 3C4JA 1TX4B 2FFQA 2GEVA 4NL4H 5FTNA 5FOXA 5G3YA 3U7EB 5LDDC 1TUIA 2QRNA 3MUFA 4WW0A 1G6OA 2BOVA 2P6UA 4NE2A 4NDZA 3GEEA 1HQCA 2R6DA 4TMXA 3RSOA 5JZVA 4L9SA 4NCHA 5JFGA 2AWNA 1R8SA 2N42A 2QTHA 1E4VA 4KAXA 1J8YF 4RZ3A 2X1VA 4XD7D 4MDFA 2NPFA 1HE8B 5FPTA 3IIJA 4Q9IA 3FMOB 2V3CC 2ODEA 1AZTA 2XNDA 1SULA 3RS5A 1XEXB 1Q1ZA 1RW4A 2ZU6A 3TGPA 2J0UB 2Q3MA 4BLQA 2HLDD 3T1VA 2R44A 3VMFA 1OFHA 3GJ3A 5AJVB 2G83A 3CWQA 2YC4C 2GNOA 2GZAA 4XVQA 1UAAA 2OO7A 4C0AC 3LBNA 1CR0A 2JDID 1VG8A 2AD5A 2RGBA 4QM6A 4PZZA 1DAFA 1LS6A 1G7CA 4Q9JA 2PLFA 4UJ5A 1QF9A 1SXJD 2GCNA 4LDJA 3LW8A 3W8NA 5EE0A 4G5RA 4RD0A 4UQOA 3VR3A 2GWHA 1R5OA 3DM9B 4Q00A 1GSIA 4C2UA 3TK1A 3SC3A 4PO8A 1F60A 3VR6A 1DAGA 3GPLA 2QPTA 3NHBA 1DARA 2PZGA 3L0SA 2XZLA 4A0FA 3HU1A 1VCOA 1HE1C 4TYQA 4OBEA 4R2HA 1RPZA 3RDPA 4DDVA 2WWGA 2JIZA 3BFXA 2W0MA 4GT1A 1TNDA 4OQMA 1IOZA 4B34A 4XWOA 4M53A 5AWFC 4MKHA 4CGZA 4IDQA 1UBCA 2CJWB 2ZJ5A 1NN0A 1WXQA 5JCZA 2D06A 2ZUCA 4ZO4A 2JLZA 4NYIQ 5JS7A 3SHWA 2GKSA 2YC2C 2WJHA 1T8TA 5SZIA 3AF4A 1N6RA 2EFGA 2QSYA 5D3QA 3EW9A 1NBMA 2ZR9A 2PX3A 1WMSA 4B76A 5ANRB 1E0KA 1PV4A 2KWIA 1SXJC 1ZC3A 2I3BA 3BK7A 4V02A 4UXHA 2XZOA 3EZ6A 2ZI9A 2O8FB 3OEHD 4PHHA 5JS8A 3MG9A 3T1QA 3F0TA 1MT0A 2AN9A 4O25A 2WOJA 1E79A 2HV8A 2WZQA 3E2IA 3H2YA 2E1RA 1S96A 3P27A 4WA7A 4MRRA 2WTUA 3TLXA 1CF4A 1KO4A 2V54A 5EP2A 3FB4A 1NVWQ 4A6XA 4O3MA 1X8KA 2OAP1 4ARZB 2IS6A 3NH6A 4Q1BA 2FFBA 5E7IA 3TJZA 4PZLA 1ZM7A 2OSBA 1Z6TA 3BERA 4JL8A 5KHOC 3K9GA 3JVUA 2AD1A 3AV0B 4DCSA 2VP5A 3AKCA 3GLFA 5L3SB 4RVCA 4LV8B 4YDHB 3ADKA 1KKLA 1SKYE 1E2FA 4Q18A 2OCBA 4HB3A 1Q3HA 4RY2A 2WWYA 1W47A 1M8PA 2FE4A 4K46A 1IQPA 1SZPA 2PL3A 2A5GA 4M4SA 5DO9A 1OE0A 3QJYA 1GUAA 4FD2A 4XSGA 3QPVA 1SXJE 5JI3E 2ZS9A 4K8OA 3GP8A 1RJ9A 3EX7C 3VKGA 1CP2A 1II0A 1Z29A 5TY0A 1AA9A 2XAUA 4Q1AA 2BIFA 2QQEA 2GCOB 4P4SA 1EXMA 1Q44A 4PHFA 1NI3A 4PPGA 2RGCA 4C0LA 4AC9A 1FQKA 5EP1A 4B2PA 821PA 2GXAA 1C4OA 1XCPA 3AH8A 4ZCLA 2NG1A 3IO3A 3SHFA 2DB3A 3EWSA 3ZVMA 4DEYA 5TB5A 4X8MA 1CRQA 1FPMA 4BRWA 1DTSA 2V1XA 2E87A 4G3XA 3PIRA 2GVZC 5EZ5A 4FMCB 3DPUA 5DYGA 3GMTA 2D62A 5HZKA 4ILEA 4QGHA 3KDSE 1F2UA 1M7GA 3BGWA 1G7TA 4LI0A 4YQFA 3KFXA 4EQ6A 4M9SA 1Z0AA 1XTJA 4Q1CA 5GJWC 1E2PA 2ZYWX 3T1OA 3AKYA 1KZ7B 4R7ZA 1QHHA 3THXB 1GVNB 2IXFA 1XTQA 1VHLA 2VBCA 2X8AA 2ZRIA 4HUQB 3OESA 2GJSA 2JCSA 3NBXX 1LNZA 1ZUNB 1JQJC 1KI6B 1E32A 4IOJA 1W4CA 4P4UA 1OH8A 2WKQA 2D2EA 3I1FA 1N5JA 3QKSB 4Q7MB 3VKWA 3GFTA 4TLCA 2VHJA 4ZDIA 4P32A 4OQXA 3EXAA 2QA5A 2EFDB 4KYUA 4OL0A 1ZM2A 2O8FA 1S3GA 2JJ2A 2BJWA 4B3DA 4KV9A 1EX6A 3JVVA 4RCZA 4JL6A 3AQ4A 3UXMA 4GL2A 2EFHB 1ZIPA 2VSFA 5FTKA 1COWA 4ZDJA 4LYFA 4E09A 1BH2A 2OXCA 3K0SA 1Z06A 3AGQA 1AQYA 1G21E 3AGPA 4CDGA 5L3QA 3ZD7A 4M0LA 3I4LA 1Z6YA 4OI2A 1P2VA 1T9HA 1YR7A 3QKTA 3RAPR 1KDRA 2J0VA 2MSEB 2QY9A 3VR4A 4M22A 1J90A 2VHQA 2WAXA 4JLMA 4CIDA 1RRGA 3Q3JB 4BLTA 1YVDA 1NLZA 1ZIOA 1XXHB 4XJXA 3CM0A 2W2XA 1FX0B 2WJJA 4FXPA 1KOFA 2G0TA 1Q1QA 3N70A 1ZRHA 2PBRA 3FHCB 2Z5FA 5EE5B 1HYQA 1NG1A 5CIQA 4PC7A 1W36B 4TTRA 3LVQE 1XMVA 4ITRC 2IXEA 5B58C 1E98A 2FPLA 1P7CA 2P65A 4LSGA 3C5HA 2ZRAA 4PC1A 1EFRD 1J8MF 4D0LB 1E9CA 1OXTA 3GJ4A 2CLDX 4KO8A 4L15A 4ESHA 1U9IA 2LKCA 4QJ3A 1GNRA 4LBWA 3SNHA 3AVOA 4R71A 2QBYA 2GETA 1XJQA 4MKFA 2X77A 4MA4A 5EXSA 5C46F 2ZREA 3DO6A 3SBDA 5HPYB 3X1XA 5GJVC 1H8EA 2R65A 4LX0A 2HJVA 2IC5A 4QHTA 4TYPA 1F6BA 3KFVA 5BN4A 1W48A 2NZ8A 1R5NA 1UDWA 4N0EA 3FFAA 1W0JD 5FTJA 3GJ7A 2CMKA 1J7KA 1JNYA 2ZS8A 4Q1DA 5FFMA 3MD0A 3NH9A 4EIWA 4TMTA 3IHLA 5JJKA 1ZJ6A 1Z63A 3GD7A 3A36A 4NYJR 3QKRA 3SU8A 4CEIB 5JLJA 1RIFA 2ODWA 2WMOB 2HCJB 3RRMA 2ZRFA 3FKSA 5CM9C 1J99A 4A15A 3GLFB 5JMTA 2DCUA 2GZDA 2IYUA 421PA 3BD9A 2PCLA 3QG5A 1GRNA 2YJTD 1WP9A 5E95A 3TR5A 5KSOA 4P0TA 2JLSA 1SVMA 4AG5A 4RD2A 3ADDA 4HAVA 1XRJA 4ABYA 5JRJA 5C4GB 4CW7A 5KNBA 3CH5A 4JYBA 2H1LA 4G5GA 5JBQA 1N6HA 2DFTA 1Z6GA 2B8WA 2OBMA 3I73A 2XXAB 2K5UA 2ODNA 2ZJZA 3AUXA 3VKHA 5AK0A 2ZJYA 4GP6A 1N6LA 2OEPA 4D4KA 2J46A 3B5JA 4L9WA 3WBJA 1NVVR 4QJ5A 2FGKA 2ECKA 4KVGA 2XTNA 2F3TA 3I3SR 2YVUA 1GNPA 1S3SA 4PSAA 4EPVA 3R9IA 1N6PA 5HTKA 2EFEB 4JYCA 2VA8A 4Q66C 3V00A 1SGWA 1E2LA 2A5JA 2XJ9A 4HZUA 4KLNA 2ZRNA 3O47A 4QJ4A 5DISB 3TQCA 4Z8XA 4BFUA 4MQBA 2RKOA 2QAGB 1I2DA 3M4YA 3ZZTA 5EP4A 3W5JA 2ZANA 4NTZA 1VYVA 3P1JA 4KCGA 3NKVA 1E0AA 2BBOA 2A7QA 2OHFA 3U3RA 2D7CA 5BXQC 3DEFA 1N5KA 2ZRLA 1N0VC 1DOAA 1NVVQ 1SVIA 2IWRA 4KLZA 1OV4A 2F9MA 1G8YA 2XX3A 3WMFA 4YMUA 3K70B 2FSFA 3VNUA 1Z2AA 1AGRA 2C5LA 1OIWA 5KDOA 1LS1A 4QC2A 2VH5R 1S8FA 1BMFA 1NY6A 1PLJA 3T5GA 3W3ZB 3T61A 4FWIB 2NGRA 3VU9A 4Q4LA 3PVSA 3HYRA 3N5CA 5FUVA 4OQNA 3TIFA 3IEVA 2R6CA 4JKYA 2FMXA 5AJWA 5CB6A 1BO6A 2ZRCA 5JRZA 2IL1A 3V4FA 1GRRA 1LF0A 1M2OB 2XXAA 2DFNA 2ANCA 4V0ME 4B33A 4J0QA 2PT5A 1TU4A 1TAGA 4TMVA 4HAXA 2DYKA 1R2QA 4LYHA 3O8CA 2IS2A 2IS1A 4B35A 1CR1A 4QRHA 5FPHA 4KFRA 5JECA 2QNRA 2ZAMA 3NWJA 2ANBA 3SFZA 3BAFA 1W0KA 4DB2A 3K70D 3ZS8A 5F98A 1OXSC 2WIBA 4DUGA 2V6IA 4GSYA 2WPDA 4B43A 2WWXA 4EFNA 1FMLA 3AF1A 1CULC 1E6CA 5CJ2A 1P2SA 1XPUA 3PCRB 3EZ9A 3B60A 3EIHA 4QNMA 2IYVA 3K9HA 1W44A 5KDDA 4FCTA 4TT3D 4DSNA 2R8RA 3BRWD 4FMBB 3BFKA 4LPSA 2NTYC 1JALA 1LFDB 3QF4A 4QFMA 3ECCA 2ZI5A 2O8CB 2QAGA 2Z0MA 3VR5A 2IYYA 3WP1B 2OESA 1EG7A 1H8ED 4RZUA 3LX8A 4B3CA 4LGMA 1U0LA 1FQJA 1W4AA 3SJAA 1S2MA 3NHAA 4Z1MA 1KAGA 3TNFA 1R7RA 2YOGA 1Z3IX 2L0XA 1XDBA 4FIDA 2ZRBA 5AUOB 3KZ1E 1KYIA 3CLVA 1W2HA 2ERXA 4KFTA 1HQYE 2NO1A 3EC1A 1RC8A 4XVUA 1BKDR 3JZAA 2VF8A 1EWQA 1S0UA 4LHYA 1P9NA 2OLKA 2WWFA 3OE7A 5TV2A 4B2LA 4XSHA 1UKEA 4C7OB 5KSZA 2V7QA 2GXUA 5BYJA 4RCYA 3F5FA 1E9RA 4Z1MD 2TMKA 4US0R 4TTPA 1R0XA 3KKQA 5EQTA 4FINA 2ZJ8A 4IDNA 3UIEA 4IOMA 2ZETA 3RC8A 3UMRA 4F92B 5D3MB 5FUYA 2YV5A 1ZINA 2BKEA 4Q7JB 4IRUB 3WRXC 4AKEA 2NPIA 1E9SA 1EESA 1KK1A 1RRCA 3X2SA 1AKEA 4DEXA 3K53A 3LD9A 4LPKA 3SE0A 1E9FA 4Q47A 4KSCA 721PA 3PUWA 2HT6A 3LXXA 1MO3A 3MWYW 2E9SA 2VP2A 1U90A 1G1MA 3ASZA 1S9DA 1VYUA 3U3KA 1IHUA 2GCOA 3UANA 5E7JA 3EC2A 3L8ZA 4GRAA 2AWOA 3FTQA 1ZMXA 2WWIA 4A2QA 1NKSA 2IYZA 2AFHE 1RJ9B 4BQSA 1NJFA 4TZ6A 1QHXA 1Q1EA 4V0MA 1KO8A 1RVDA 1XD2B 1GILA 2JGNA 2QQ0A 4W5HA 3WYGA 4RFSB 1AGPA 1YR6A 3GFPA 2OFWA 3KKNA 2MSDB 1J2JA 2P0EA 5FR1A 3HP1A 4B71A 1GRQA 1NBME 2PJZA 3FKSD 1R0ZA 2JASA 4GBMA 3CX7A 1M1YE 5FUXA 3K1JA 1LVGA 1MO4A 5L3VA 2PEYA 2ZROA 1MABA 2IEZA 3PEVA 4C30A 2BKUA 3W8RA 1UADA 2RCNA 3SYLA 1C1YA 3I62A 4DT1A 3FKQA 1KIMA 4F93B 4TQAA 2VSOA 1UKYA 4B6EA 2CXXA 1AM4D 3A37A 5EJEA 1PLKA 1ZNYA 2IYRA 3DVLA 1HV8A 4KVAA 3AB3A 4QXAA 2FOLA 1NMYA 1G3UA 5CK4A 4ASUA 4V03A 2QMHA 5SZJA 1UKVY 1Z6AA 3ZVRA 4XD7A 1SQ5A 3DOEA 4OHWA 5BWMA 2F1JA 1G4UR 2ZSDA 5CIWA 4EKDA 1Q12A 3ZLJA 2NO9A 5LBIA 3S1AA 1KTVA 1QHHB 3NBFA 5KNCA 1CJUC 5J4YA 5J4LA 1XBTA 2ZRJA 4HATA 1TMKA 2BMFA 1F2TA 5FL7D 5JI2E 1RFLA 2VP6A 4JLBA 3GLHE 1H8HA 2IXGA 3K0AA 1XTIA 1AQUA 2FU5C 3QI2A 2W6IA 3GJ8A 4RD1A 4URYR 4V0NA 2NQ2C 2WOOA 4EJSB 4US1R 2F1RA 1W5TA 3QUSA 4DSOA 1PUIA 3B1VA 3TUZC 3TQFA 1VPLA 1DAMA 4JVMA 3SYNA 4URWR 3A4MA 1ANKA 1KDPA 2F43A 2YNMA 4GZMA 4M1KA 5SZHB 4QBFA 2FZLA 5GJBA 4PQYA 4WIAA 4E22A 2BMEA 1P75A 2CNWA 3CR7A 4A8JA 2YYZA 4L4UA 2BJVA 4C0KA 4GMXA 4DLRA 4HI0E 3KQLA 3CRQA 1CJMA 4NMMA 1JJVA 1IBRA 3NC0C 4KU4A 1OSNA 4QOSA 3RS7A 2VL7A 2IK8A 3G82C 1WB9A 1SVKA 1KNQA 1TF5A 2GCPA 3A4NA 3GLGE 2OM2A 4PC2A 4UKDA 2V55B 1MO6A 4HSEA 4PPFA 2GESA 4GNKA 4MYHA 3ASYA 2C9YA 3GEIA 4LHZA 4K81B 4NYMR 2GJ9A 3ETLA 1XMSA 3PXGA 4NBSA 2J7PD 1HEIA 3THOA 3NEYA 4PAMA 4LBYA 5TDHA 2KB0A 1YQTA 2O5VA 2QP9X 3QKUA 1R0YA 2O8EB 2OE2A 4S2EA 4EFMA 5KOYA 5EE1A 3X1ZA 1NN5A 4DRZA 2Z4RA 3CRMA 3LBHA 3A1VA 1KSJA 1D6JA 3BE4A 4BLRA 3SFVA 4PANA 1QVAA 3U3JA 5CJPA 3CZPA 2EQBA 3QEJA 2JLRA 4HAYA 4JLPA 4KFSA 2Q6TA 4U7DA 3CRW1 1OYWA 1UJ2A 1P61B 2DHRA 2YZ2A 2QMEA 3A6PC 3W3AA 1L4YA 1ZM9A 2ATXA 4CYMA 1LY1A 3LQQA 5B57C 3TAUA 2GEDA 3ZYCA 2R6FA 1WE2A 2XSZD 4KBGA 3LX5A 4C3ZA 1GL7A 4N3NA 4Z54A 3D31A 1QHYA 1ZM3A 1Q21A 4ZV4A 2QT1A 2J7PA 5EXXA 3EPHA 1G17A 1UFQA 4RZ2A 1CS4C 1K5GA 3G5UA 3P4XA 5TMPA 2ZTSA 3C7KA 1II8A 2X2EA 2ZRHA 4PO1A 1G291 2PLRA 2XOKA 4NYJQ 1EFTA 1MRNA 4YONB 3RNLA 4JZKA 3NDBB 8OHMA 3KL4A 1RKBA 2XB4A 4NYIR 2GAOA 3WYAA 3SQWA 4CEJB 3DDCA 2LKDA 4B74A 2OFOA 4BECA 1YRBA 4CF7A 3X1YA 3RABA 3C15C 2C99A 1N5LA 4Q4JB 3P26A 3FMPB 1KO7A 3GLHA 1UEJA 2P67A 4G5SA 1XP8A 2LCFA 4JJKA 4EJSA 4EPTA 3CNOA 1N0UA 1X3SA 5DI3A 4A8JC 2IUTA 3AF2A 1EFUA 3TSOA 3R8FA 4C0JA 1T0HB 2WJVA 4PQRA 4WZAE 3AVVA 1E2EA 2HLDA 1CR2A 1XXHE 1E2HA 2FEMA 1XD9A 4D4JA 1ZP6A 4A92A 5BN5A 2NIPA 4YMTA 5TVKA 1VG9B 2Q3FA 2OLJA 2Z4SA 4QG7A 3QG1A 4NZYA 2CCKA 4QHSA 2IEYA 4IW3B 1F2UB 2VO1A 2ZRPA 5LB4A 3WHLA 3B1XA 1NKTA 1MV5A 3KX2A 3MRSA 4A2PA 3SN6A 3GLGA 3PUXA 3GLIE 3SS8A 1V5WA 3RWOA 1X1RA 4IXNA 4EPRA 5DLQC 2JJ1A 3BWDD 2HF8A 1NRJB 4RSGA 4TSFD 3ND9A 1IAQA 4HZIA 4LJ6A 3IHWA 2RMKA 1W5SA 4AY2A 4PZYA 2W00A 4EAQA 1CRPA 3ZVNA 4BASA 2IS4A 3L82B 2J0SA 4XOIA 2CDNA 1U8AA 3DL0A 4Q4AA 1U8YA 2FF7A 1YZNA 2YINC 1WA5A 4DLYA 2WKRA 1XD2A 1EFCA 1GL9B 2HT1A 4TMWA 2G1KA 4HLCA 4XTCS 1II9A 2PCJA 2FV8A 3CIOA 3R7WA 2B7BA 3RRYA 3N2EA 1T5IA 2EWWA 4H1UA 4E07A 2IHBA 3HPQA 4D6PA 2FH5B 2OFXA 3IEUA 2B8TA 2DBYA 1XX6A 4FMDB 4OKSA 1TQ6A 2BCGY 5L3SA 2RGEA 3WYFA 4RFVA 5KDLA 4YDSA 4JIMA 3I72A 4PAOA 3RS0A 1KI2A 4LBZA 3QEOA 1OH6A 1F2TB 2BMJA 5IT5A 2ZJBA 3TUIC 2ZI6A 1YZKA 3WY9A 5BYKA 3RRNA 3BC1A 3TKLA 5JWOA 4ARZA 1XWIA 3B2EA 4HLUC 5GADl 1QDEA 4R2IA 4GFDA 4I1UA 4LJ7A 1SKYB 4RKFA 1N2CE 4B32A 1T5LA 2C78A 3QIAA 2RGNA 2V1UA 4TLAA 1YE8A 1RE0A 5LD2B 1YHNA 4C4PA 2QM8A 2BDTA 1HT2E 2W0SA 2XOKD 3B8HA 3TE6A 1SXJB 5HKKD 3AF3A 2AX4A 2OAQ1 2XJ4A 5KO2A 3K0CA 4GOJA 4DDTA 4FWTA 1G8PA 3FMFA 3VFDA 5FUWA 2CVFA 3IQWA 2GF9A 2GVDC 4Q4HB 1G18A 4IOLA 4IFBA 5AUQA 1E2KA 1HURA 3B9PA 3EARA 4GDFA 1OHHA 2ZXUA 4DZZA 2KSQA 3KJIA 2D2FA 3RS2A 3NBZC 4PC6A 3H84A 3LDAA 5G40A 1W36C 2G88A 3MJHA 4F4CA 3K0FB 3U60B 2D7DA 1QHIA 2A3RA 4URUR 4BFWA 1Z6XA 3OZXA 3LO5A 4A6PA 4DC9A 2JJ2D 5B64A 5FBVB 4JLDA 4MKGA 4P31A 5EE3A 1JBKA 5AUNB 2R6AA 3CO5A 2O0KA 4HLQB 4AYXA 1G6HA 1P2UA 1CIPA 1IJFA 2BEKA 1N6IA 2CL6X 3HDTA 3LW7A 1NIPA 3QVUA 2J45A 4KI0A 1TQ2A 4OHYA 2VP9A 1ZC4A 4HEJA 2Q0HA 3FYHA 1E99A 3BB1A 4ZKDA 3RWMB 5J4KA 5ELXA 1C9KA 1E2QA 1ODFA 2FNAA 1Q3TA 4GOKA 3LQRA 4A0RA 3LBIA 5FTLA 4D82A 5JEEA 4DIDA 4FW9A 1Q0UA 4PX9A 4ZI2A 2WAYA 3TMKA 2AK2A 3BH0A 5JJIA 1KDTA 4NCIA 3SJZA 3HR8A 1YZTA 4HLUA 4Q21A 5EUMA 3NDPA 1ZNXA 1DAIA 4LJAA 3RANA 3PUVA 2CE7A 4I1VA 1BYUA 3CONA 3KKOA 3D8BA 1P3JA 5A0FA 1DO0A 4DUGD 4ZPXA 3MSXA 3EPKA 2WKPA 2FEOA 2YHSA 4DDWA 4HDQB 2ORWA 1FOEB 1YU9A 1N6KA 1ZD8A 2ZPTX 1GFIA 1NF3A 2WSSD 2WBLC 2ZIAA 4Q02A 4Q7LA 4EPYA 4G0NA 5KSPA 3THXA 3ZD6A 1Z8FA 2QRZA 5EE9A 4LC0A 3WXMA 1SXJA 3K09A 1P73A 2F1IA 1NVXQ 4MYTA 3O8DA 3TUJC 5JEDA 3AUYA 1IN4A 3AVUA 1D9XA 2PT7A 3EIQA 5FR2A 1QHSA 5SZKB 4WZBE 5C4MA 5KNDA 2RGNC 5JJLA 3RS3A 1BOFA 5DI3B 3WRYC 4DCVA 1UDXA 3PR1A 1N3BA 5IK2D 4DWJA 1KSGA 2WVJA 3KB2A 3FWYA 3UPUA 3R8CA 5J40A 2BM0A 1P9WA 1XZPA 3P4YA 4MH0R 4BFZA 4GP7A 1N25A 4PHGA 4G1UC 3B13B 2PH1A 1B23P 1FW6A 1LW7A 1P60A 4TL6A 4DSUA 1JPJA 1ETUA 4CEIA 4DCUA 2BHRA 3QKRB 5K8IA 1E9AA 4AKGA 2ZI4A 4DLTA 4A36A 3L2OB 1YZGA 2BWJA 2FG5A 121PA 1FUKA 4LYJA 2F9LA 2FFAA 2HYDA 3CH4B 2ZUBA 4TT3A 1WCV1 1E1QA 4EPXA 1AIPA 3JZMA 2CCJA 3L0IB 3GLIB 1D5CA 1WBBA 1XCMA 2IF2A 3KQKA 2Z6VA 3K0FA 1MR3F 1G3QA 4JLAA 1KI1A 5H68A 4AYTA 1KI3A 3B1WA 4TLDA 3W34A 2CK3D 3U61B 3RLFA 1D2EA 2G1JA 3MJRA 3OAAA 1UEIA 1US8A 4TZ0A 2BCJQ 3WNCA 4B48A 1P6XA 2FZ4A 1W4BA 1NL3A 2D4HA 4IDOA 1L8QA 3L0PA 4KHZA 2QPOA 3ZS9A 1E9EA 4JSTA 4PTLA 1DELA 1Q20A 3HYTA 3AKDA 5EXTA 3CNNA 4QL3A 4ZKEA 4ZDKA 3BS4A 3K09C 3SEAA 4D26A 1K5DA 1A2KC 3HPRA 4MRVA 3KKMA 1ZVQA 4M1TA 1Z2CA 4JLKA 4M9ZA 5KTYA 2QGNA 3R20A 1U98A 1R5BA 5C18A 2VHCA 4M1YA 4MKIA 4TL9A 4NPHA 4YMWA 1X86B 3B78A 2J9RA 4D0GA 5FH9A 1G7SA 4RD4A 2C95A 4LC1A 4DLVA 4L5BA 2O8DA 4Y0AA 5M04A 4TTQA 4V0LA 1W1WA 5CLQA 2HCBA 5H8WA 2BEJA 4G5QA 2WHXA 3DMNA 1BIFA 2DWOA 2GJ8A 4RD6A 4BFSA 4NONA 3KUDA 4IDPA 1NG9A 1O3YA 3U4QA 4TQ9A 4A8JB 2C96A 2ZJOA 3LNCA 2FJUA 1SVSA 4WXPA 2UKDA 3GJXC 3H4MA 1GIAA 3OE7D 1OW3B 3HR7A 5FBRB 1FP6A 4HZUB 4AI6A 3UK6A 4A0HA 1W36D 2P6RA 4LHWA 5A4JA 1YRAA 4AYWA 1SVLA 2J41A 4MITA 2P5SA 4DHEA 3AVYA 3WBKA 2IX3A 1ZM4A 2W2TA 3UMSA 2JATA 2IUSA 2AFIE 2REXB 3BOSA 3IPXA 2CVHA 4AK9A 4M8NE 4C2TA 4IXMA 3IGFA 1T6NA 4UXJA 1Z5ZA 1JAHA 3ICEA 4A4DA 4BLPA 3U2QA 1ZU5A 4D4MA 1GKYA 1PZNA 1XMIA 2Q9BA 4JL5A 1KZGB 1N6OA 5HCNA 4NCNA 4LJ8A 621PA 1QG4A 2OCPA 3WMEA 1DPFA 2CLSA 2H7VA 1XNJA 2ZSFA 2R2AA 3T34A 3PV0A 1E2JA 3MCAA 4HB2A 3HU3A 4UNPA 3A1UA 2QP3A 2GTPA 5FPYA 3VNVA 3ZIAD 1Y3AA 4FN5A 5AJXA 1G8GA 1TPZA 1ZW6A 4FMCF 2H8KA 2NO6A 2OUKA 1LV7A 3CB4A 3EG5A 3IO5A 5JSZA 2QTFA 2Z43A 1S4QA 2KJQA 3T5DA 1E2NA 2JA1A 3A1WA 1YR8A 4OK5A 3I92A 1JB1A 3CR8A 1HT1E 3GQBA 2JLVA 1ESMA 3NC1C 1I4TD 1YKSA 2CBZA 2HDNB 4P4SB 1XXHA 4PR0A 4PSVA 3CRVA 3QXHA 4IJMA 4Q4JA 1FNNA 5G3ZA 3A8TA 4KYIB 4KSBA 2A5YB 4B3GA 1GG2A 2W58A 4W5WA 2H16A 4RJLA 2O8CA 4NP6A 3ONWA 2I4IA 1QG2A 2VHUA 2EFCB 1Z08A 3REFA 3Q8XB 4FMDF 1II8B 2AL7A 2VHTA 5AUPB 5FOSA 2BM1A 4Q4AB 1LB1B 3UMFA 3THYB 2QAGC 1D9ZA 2AKYA 3DOFA 4PXAA 4H9GA 4OJKA 1L2TA 4IVRA 1M74A 2F43B 2JAQA 2JJ8A 3C14C 5DN6A 1KI6A 2JLYA 5JSZB 1M6NA 4C0SA 1GAJA 3D6TB 4US2R 3L43A 2IYTA 2ORVA 4A9AA 2YWFA 2QBYB 3KXIA 1WQ1R 4G5OA 4PPQA 2IF0A 1CXZA 3UG6A 3PG5A 3IIKA 1KI8A 2J7KA 1E9BA 3EZFA 2AR7A 2IYWA 3FFBA 1KDOA 1FTSA 3A58B 2J0UA 4L8GA 3FHTA 1MO5A 5IF9A 1IXRC 1IN7A 2DWQA 2ZRMA 3TW4A 1CLUA 2FWRA 4LWZA 1P5ZB 1UF9A 2CHGA 1XFAA 3CZQA 3QXCA 1OHHD 2GAAA 3R9WA 3PEYA 4KJZA 3WMGA 1VECA 1KMHA 1VCIA 4C0BA 4PQFA 2ODBA 3CPEA 2PZEA 2GZHA 2VYFA 4DSTA 4F4IA 3B9QA 1U81A 1T3LA 2ZRGA 1XTKA 3A1TA 3CKLA 1G5RA 3GFOA 3LLUA 4PSKA 3PJRA 1Z0IA 2PJRA 2O52A 4JVSB 1QZXA 2VP0A 3U6KA 4MGZR 4MRSA 3FVQA 1M7BA 1ZCAA 1XJ0A 1DBSA 2EW1A 3LVRE 4Q9LA 2ZSAA 2V9PA 1T8UA 5IHPA 4HLDA 2XZPA 1GM5A 3Q5DA 4DLXA 1KKMA 4TYNA 5IK2A 2CJWA
chains in the Genus database with same CATH superfamily
5EZ6B 2QTLA 4KMRA 2XBUA 1WSWA 2O3JA 1X42A 2ZZMA 2NP7A 2YFHA 2OV8A 1A0OA 2QUAA 2UYYA 2VJAA 5IBRA 4IFEA 4W9NA 2R2GA 2IYAA 5DT9A 5EJMA 1U04A 2NOAA 1EAYA 2BI7A 3ZCXA 3GEHA 4GC5A 3ONNA 3AEYA 4X00A 1S7GA 2ZT6A 4BQQA 5BT8A 5I5EA 2AK3A 1P1KA 3TAXA 5HDQA 2RGWA 2D3WA 3GUCA 3MTBA 3OKAA 3U5TA 3ABRB 3FWZA 4GLOA 4HDCA 3UKDA 2GBLA 5J1SB 3IUQA 4MPTA 1I0LA 5C3UA 1ZKDA 2CNKA 2V58A 5DGXA 2PMKA 3M82A 3BIJA 4TKLA 2NTJA 5E8RA 3KEFA 4PAQA 3S2UA 5IEJA 4KAAA 1QRAA 1VJ1A 1BSVA 2B92A 3ISJA 2DFLA 2CD9A 5J23A 3HCEA 3Q8WA 4LJ4A 3AYZB 4ID9A 2OG1A 4B6PA 2OYRA 4F84A 1G42A 2UYHA 4KXFB 4OQDA 4OD0A 4MYUA 3PZBA 5ALKA 1XLTA 4UMVA 5TXGA 1H2RS 3JRXA 4YUXA 4IJKA 4RLQA 3VR0A 1G64A 4R9SA 4EY8A 2REBA 4UREA 4EG3A 5F23A 3H3JA 4HQLA 4BDTA 2Z1DA 1KJ9A 2YV2A 2HFKA 2HJGA 4TV8B 2XF2A 3J80A 1U1EA 2DFKB 4X95A 1E58A 3QWFA 4HDNB 3SIPA 1A9TA 1JVSA 4Y6LA 4CL0A 2NO0A 1H0KA 4IUDS 1H66A 2W93A 4X90A 5KHAA 4M1WA 3SZLA 2GZ2A 1LGYA 1N75A 4CFZA 3SHTA 1JSRA 4ASUD 1T8YA 1SVOA 1TO2E 2TMYA 4J0KA 4JLOA 1OZ0A 4KGXA 6ABPA 3NHMA 4EFMA 2AW5A 2IW3A 3F6CA 5KSYA 3T15A 3LRPA 1LQ2A 3TSAA 5IDWA 3B7GA 3KXKA 1OXUA 1FUUA 3AM3A 4UM5A 5JJBA 1P7WA 3BTOA 5DNYB 2VYQA 2HA4A 2C1ZA 2IUUA 3RVJA 3R5TA 2GZRA 2WICA 5AM2A 1M6WA 5B30A 4HDOB 4TMZA 3T0GA 3A1EA 3IT0A 1K08A 3OPYB 3HACA 2G04A 2PZJA 2QMUA 4RS4A 3U3OA 3WGOA 2ZW9A 3KAJA 4OB7A 2O2SA 4PO9A 4DGSA 5KPJA 4UTOA 1OB2A 4JJIA 3BD7A 2EWVA 3MS2A 2BL4A 4X93A 2B36A 3O8QA 3UOAB 3Q0EA 2W6ZA 1MZPA 1AK2A 1DAOA 3WKCA 3ZDAA 5JADA 4S12A 4YO8A 2C97A 1MORA 5M29A 1Y6RA 5AJZA 1YB6A 3O4GA 4R1PA 1BH6A 3ZIDA 2R8PA 4YJFB 1ZGHA 3I9FA 3M2TA 3UMYA 1WD7A 2SCUB 4U2EA 2VAPA 2GNPA 3TW8B 4LC9A 1MTZA 1Y63A 3VH3A 1M1ZA 2QTVA 4B75A 3LHIA 3LY7A 4BMYA 4PLCA 1T2UA 3A10A 2A78A 4JGIA 4MV7A 4IDHA 2CXUA 3ILHA 1A8UA 2GBLC 4UJ3A 3A26A 5HCUA 3PP8A 1QO0D 4HGQA 3UAVA 3B85A 2C2MA 2CC2A 3Q0TA 4GOXA 4Q12A 4CR6A 5E1MA 1NW8A 3ZGNA 1MTOA 3OSZA 3B9RA 1UM8A 2RGUA 4R8KA 5D00A 4DMLA 3D7MA 2Y1GA 1KYYA 2XMPA 3KJGA 3AFIA 1YR1A 1ESEA 5IAEA 4ZI7B 1JI0A 1YQEA 2AJLI 5KWSA 1PJAA 2YQZA 1QU2A 1GQOA 3KE9A 3U4DA 3M7IA 5DPMA 3O8QB 2BVNA 4YRCA 1H8HD 2E85A 2RIPA 3AVPA 4FUTA 1RLOA 2I0FA 3LPNA 5L7WA 3ZWCA 1RHRA 4L16A 1Z4NA 3CBQA 1T2VA 4JU9A 3CT4A 3DV0A 2BR3A 4W8HA 4ACAA 3PJEA 3KUXA 5DLEA 3ZWNA 3U5ZB 5TNXA 2FMHA 4HQ0A 2V6MA 2BFEB 1SHZA 4DIBA 1JAYA 1RWNA 2G63A 3A2NA 3OJ0A 4I6JA 4OHVA 5J5AA 2OSVA 4K5QA 4I1SA 1X7DA 1M76A 4KQ2A 4LK2A 1HEYA 3Q85A 4K9MA 1FYEA 5TMDA 4CQJA 3EA5A 1NAHA 2WJPA 2EGHA 1W0JA 3QXXA 5A4MS 1XZJA 2DERA 3DW3X 1NPDA 2C5GA 3G8CA 2PKYX 1MH1A 1F6DA 2XEDA 1K63A 3TI7A 3W6OA 5JCJA 5CB8A 2GHIA 2J1LA 1RAFA 5G4LA 4BVLA 1G3RA 3LUCA 4OB8A 4PBSA 4JI1B 3GYBA 3B48A 1AZSC 4F45A 1NR7A 1QDUA 1DQRA 4FE4A 2V4ZA 4R8RA 1YIAA 3SR0A 2DR3A 5GZ1A 4YCMA 2ZM5A 1DWPA 2GEBA 1ODLA 2B3DA 3DE3X 1YQXA 2CNWD 1C9YA 2J5BA 5CU7A 2YICA 2IYEA 2P9CA 3ABQB 5D3MA 1GITA 5FOVA 1DBRA 1XDSA 3TIIA 3VVLA 1QHNA 3E8MA 3VO1A 2JAXA 4DM3A 4EWLA 2I7VA 2B8JA 5EXDA 1XEXA 5LQNA 4KPYA 4TLEA 3QA9A 1O03A 1WRBA 2O1WA 4BFCA 1GCGA 1W0KD 2BGLA 1DXOA 1JMKC 1A96A 1CZUA 1L1EA 1X7HA 4UHEA 4Y2JA 2IQ5A 3BHMA 2Y1WA 7GPBA 3DB1A 3AOGA 3Q7QA 4ABTA 3QJGA 1O87A 3WLKX 4AJJA 1CBUA 1Y5LA 3NM6B 1DG3A 4ESOA 3ZQ6A 1TAUA 2X4IA 1TMOA 1RYFA 4N7JA 1JQLB 3RHTA 2A94A 5I4IA 1N3IA 2DAPA 2G06A 3KT8A 2A1TR 4UU1A 4CLHA 4DIFA 2HX1A 4WNAB 5C4IA 2VH2A 4BCDA 4ZGWA 4BE4A 1TTTA 3EVAA 1TO6A 4CEHA 5L8VA 2JI6A 3QMMA 1A9SA 3V7NA 2AR0A 3Q7TA 1Z12A 1U9CA 5MFPA 2XWQA 1JZSA 4LQ4A 2JDIA 1NYQA 4FCVA 4M1OA 4RHTA 1B16A 4ZOLF 1OFUA 4M0CA 2XUFA 4M8KA 3TG2A 4MSUA 4HNAA 5BQXA 2MIIA 4XLZA 3JD4A 3M3HA 2WD8A 4NBWA 3QJ5A 2JHGA 4JVNA 2WUEA 1NT4A 2FRDC 4OK3A 2PG3A 2B6HA 2GH1A 4YRDA 1T1RA 3GZ4A 2XHEA 4LOAA 3ZDDA 1RKXA 4ZQHA 5IYZB 4QRDA 3SI7A 2Q9CA 1YCDA 2B9EA 3QVVA 4I9HA 3O1IC 5HJ7A 3G6WA 1QGZA 1C4XA 1GUZA 5KJ1A 5DSTA 3KD3A 1J9ZA 2RAUA 4QU0A 4BEJA 3I2GA 1EBBA 2A58A 5EP3A 5AVXA 1ATIA 3QKWA 4XGKA 4OQPA 3K70C 1WZ2A 1ADCA 1DC7A 3HKBB 4KZKA 4RZIA 1UEXC 3H75A 2ZP1A 2X0DA 1ORIA 5FL7A 2RHCA 3ND7A 1ZAKA 3DBHA 4RMIA 5B6PA 5EWJB 3GGOA 1N92A 2PY6A 2P2NA 3OECA 4XR4A 3I04M 2HY7A 3L0DA 1QZUA 4O02B 2KBEA 2R68A 4BY9E 2FFJA 3BG5A 5IM4A 5FEMA 1A71A 3RH0A 3D4PA 4LYAA 4D1YA 1S2GA 2EBUA 3CGWA 1TIPA 3FPBA 4U7WA 5IARA 2RGDA 3D7RA 3GT4A 3WGGA 3QLUA 2P2LA 4KTTE 3GLTA 1OIVA 3M34A 4UHJA 1PZEA 3SYTA 3HCFA 4OI0A 2R87A 3TX6A 5H02A 3CZAA 4UTNA 2G9ZA 1FFEA 1QORA 1XFDA 2JJ1D 4HHEA 5IJ0B 5JU6A 2VT3A 4WERA 4WZ6A 5E7MA 4EGQA 2AXNA 2I2BA 2XW6A 2AOXA 1AZWA 1KYXA 2I67A 2PPVA 3FPSA 1FSFA 1NNEA 3SPXA 4Z49A 4XB1A 2OUIA 2J4DA 2PWYA 3EXIB 2G77B 3LKBA 3EDQA 1H93A 4JBXA 3BZUA 4MVJE 4PFJA 1EK1A 4BFYA 1LBHA 4RPGA 4S0ZA 2PXCA 1CIJA 3QYJA 2OT3B 4LV6A 5KX5A 3QK7A 3OJLA 1NQAO 2ZVDA 3CKYA 5C1PA 1IJKA 1HFEL 2XUPA 3LKZA 4UCFA 3D7SA 1IXZA 2XCUA 1XCGB 3DMTA 2QG9A 2WJIA 4GHWA 4N7RA 5F7ZA 1GCOA 3FE2A 1CLEA 3SD7A 3VR1A 1D7OA 2QMYA 4D44A 2QYHA 3SZMA 1EVYA 3SZRA 2GB4A 4FDUA 1J97A 1J9EA 1E3LA 1W4ZA 4DR1B 3OLZA 5I7HA 1JDTA 3LL7A 2X7XA 1GA4A 3F3SA 4C7XA 2BELA 2C7PA 2DUNA 1F14A 5LC1A 1FFHA 1O6FA 1VIYA 1ZYUA 5JCJD 5A2GA 1T2FA 2PFKA 3GI1A 1YDHA 1TM4E 2ZIFA 3GEGA 3M6MD 3HCWA 2QD2A 4II7A 1Z4LA 4TYYA 1ZWKA 2PBFA 2VKTA 4K9NA 3V1YA 1DE0A 3Q7RA 4UBKA 5H59A 1K4YA 4I81A 2ZR0A 4IGFA 1I3CA 2F6RA 3DG9A 1Z17A 5TIIA 3R3XA 1B6GA 2PUHA 1A69A 3KR9A 3OIGA 1U1DA 5LP6F 2B94A 1TF7A 5J2TB 4RO0A 4YP7A 5K3DA 4OXIA 3R7AA 1TEHA 1CUZA 2BFWA 4RCVA 2AHOA 2ZB7A 1KSHA 1YGPA 1E2DA 4H77A 2VUSA 2JFUA 4Q9AA 1DC6A 1CD5A 4JYPA 4NS4A 1YJ8A 4O4HF 1AD2A 2ZIXB 4ZQCB 3CISA 4HPJB 2ZS7A 4N1AA 5LDHA 3E35A 5KYTA 4MUAA 5IKOA 1PVOA 1C9JA 3UGJA 2P7IA 1PU2A 2IGBA 2OV6A 3B6MA 2WV7A 3QTTA 3V1LA 4DMMA 1RWKA 4BRZA 4XYGA 1XTSA 2QVBA 4PC3A 4G9GA 2G72A 1E0DA 3FI9A 1R00A 2JVJA 5J5CA 2R751 4URXR 2PZFA 3JQCA 3EZXA 3PQCA 4PFSA 4TQUS 1YRYE 2GOYA 2P3QA 3RFCA 4MMXB 2IUFA 2P40A 2FPUA 2X5JO 2UZ3A 1A8QA 2I8AA 5EZYB 4C7VA 2OM6A 2J4CA 3VGJA 4GICA 1DUIA 4F96A 1H9CA 1JR6A 3NBUA 5DH9A 2QN1A 1Z7GA 3BIFA 3TTTA 1Z4KA 2HO5A 1K7CA 1PK8A 2O6LA 4IDGA 4O2BA 2Q7DA 5HKKA 2A9RA 3DBHB 4WOPA 5E1OA 4BVAA 3P9NA 2B34A 4GKBA 3P52A 1FFXB 3FWNA 3OMXA 4R1LA 1SELA 2ONZA 3F6PA 2AQ8A 3BXOA 2A2ZA 4RIFA 3F5QA 5EGNA 3GD5A 1C3OB 3WL5A 5KTTA 5JPIA 2HB6A 4PINA 1M75A 3MHPA 2V6GA 2H2WA 3DCYA 2A5FA 1YWGO 2QN6A 2WJ4A 4N5DA 4U5XA 2I91A 1VB3A 1DHRA 4BCBA 2W2QA 3DMDA 3FYUA 3MTQA 3U9LA 4X1KB 1E8DA 1IBKB 4IJVA 2BUAA 2DHQA 3FWKA 1Z62A 2VAWA 4LRYA 5LYJA 2GRJA 4F2WA 2BH9A 5GAJA 2PGIA 5FWNA 2VK4A 3KQUA 5DV9A 3WLPA 4YJGB 3O73A 4WDQA 3N0WA 1M0TA 4HAUA 4HUQA 2PMBA 1OAKA 1EFHA 2Q27A 5ENZA 2VT7A 4KWHA 3P9IA 2J09A 1YA4A 5E6RB 1J7JA 1V11A 4K9LA 3IBTA 2J59A 3G5MA 1U2ZA 3LY5A 3M4ZA 3VSEA 4JI0B 5AR1A 5SYNA 2GA8A 5F3WB 2PE5A 2GK6A 3PDJA 3PFHA 1PFQA 3Q2OA 3W9YA 1JEEA 4BGUA 4D46A 3NWEA 4X45A 3QSYA 1A7JA 1R66A 1TKAA 1OIXA 3BXFA 1G5IA 1D04A 3EVFA 5EIBC 3MFYA 4HFNA 1XCBA 2GPNA 3JQEA 1EUCB 4NU0A 4X66B 2RFLA 1K2WA 4EBFA 2VJDA 1TTHA 1C9EA 1KZ4A 3DNFA 3ODGA 4DT1B 1UPTA 1CY6A 3P9XA 3F1KA 5JXJA 4QASA 1AN0A 4WK2B 2Q3CA 5JCOC 3JQDA 1M0EA 4OK6A 4KVZA 1WBDA 5KQMA 5JNWA 1AS0A 4M1SA 5ESXA 1KARA 3MJCA 1H2YA 1Z8NA 4OFWA 1JQBA 5HMMA 3KG2A 3Q1KA 4B6QA 13PKA 1U6JA 2HHCA 1XDDA 3NHLA 4YRJA 2J9ZB 3KS9A 4YJGA 5DI9A 3X1DA 3DBRA 5GV8A 3HWX1 3HCAA 3OM8A 3W77A 2PRSA 3EEYA 5JNTA 2EZUA 4P3PA 4EMUA 4CEJA 1ECLA 2B6NA 2W5UA 2XYHA 1JE0A 1RM0A 5DU2A 1B41A 1SC4A 1QCZA 1R6BX 4GEGA 4DHWA 4DQDA 2VTVA 1BN6A 3JWHA 4ETWA 2JKYA 1Q17A 4DDKA 2YIVX 2VDUE 2I4OA 4G84A 4G63A 2P0AA 1T3SA 3BIOA 1WW8A 4MB2A 2EJBA 2QL5A 1H0RA 1Q0QA 3GXOA 4MMYB 1T34A 4EAAA 1HMPA 3VZRA 4DY6A 3T3DA 5DNCA 1L4MA 1ULUA 1NQUA 1XOIA 2QLTA 3O26A 2PGAA 2Y2VA 1U7OA 1UDCA 1FYVA 2ZB4A 3PQDA 3HBJA 3QHQA 4FFOA 5K6TA 2QIOA 1X7GA 3LV8A 2IV2X 2H48A 4TWJA 4FKMA 1P45A 5DBFA 1U1FA 4MVJG 4YH1A 4PN3A 2DKNA 1OAOC 5DHRA 3VYSB 2H17A 4L1KA 4V1CA 1P2TA 4INOA 1GR1A 3EFBA 4G41A 5AKHA 3EEIA 4BJHB 2CFIA 1A50B 1X9GA 5DOVA 1FDVA 4O1MA 4CTMA 5C81A 1L4UA 1W7AA 1CFJA 1U9YA 1E4YA 2Q5HA 1G9TA 3VRHA 3D6VA 1ZNWA 3H16A 2YWJA 3P9ZA 1M7HA 2PKEA 1JSXA 2Z83A 2BFNA 3HCNA 3PENA 4HWOA 4EJFA 2ZTVA 4LRQA 5FOTA 1BHQ1 3M4NA 4PHCA 5C2JB 4LMPA 1RCUA 4CVNA 3R3VA 1ID8A 2AZTA 5FEUA 2RHBA 1P2DA 4F6RB 3K9BA 1JPUA 4ZIRA 2PMWB 3CN9A 1AY0A 5LMZA 1B3RA 1EVJA 1O2DA 3RAJA 2QU8A 2JLXA 3AL3A 2HRQA 1UK9A 1VMAA 2OILA 2XDWA 4NJOA 5DNDA 2GXQA 2EKZA 2EJWA 2O0MA 1XVAA 5FWAA 2A1UB 3C16C 5CVTA 2A92A 1SHTX 3G17A 3KNZA 4RTNA 2QR2A 2G80A 3KFLA 1GEEA 1B8UA 3EOZA 4QECA 2VK8A 1D6SA 4OYHA 1HFKA 2P7HA 2Q1SA 1RRVA 2R4TA 1J4AA 3IDOA 5IT0A 3H97A 3K94A 4MTLA 4CQLB 5J2UA 4WL0A 4AJHA 1QAQA 1ONOA 1O0BA 2A9PA 3FJ1A 4U8HA 4D7AA 2EVWX 2GO7A 2WV9A 4QU8A 3UYKA 1R16A 2Q5JA 2RGGA 4PRZA 4X0EA 2O59A 4URZR 2VIIA 4JJZA 1PFYA 5TQJA 3BRQA 1UBJS 3OETA 3FPAA 4HXEB 5A3SA 4MPJA 3ZQJA 5H4GA 1OXVA 4FT2A 3QBJA 3SEZA 5FPSA 2YQ4A 4YMVA 2WNHA 2YJ3A 4D0SA 3QEBZ 2E21A 1QAMA 2CVPA 3OJXA 3ZIUA 2JVIA 4RZXA 3THWB 4YJDA 2CHQA 4ZPJA 5HYVA 2WT9A 3ZI0A 2PUVA 4YGXB 5AXBA 4XTRA 2NU7A 2PRKA 2PXAA 5C1BA 3R0XA 3IDQA 5GM1A 3K8OE 3QVGA 5HFAA 4IMRA 4PZPA 2A9KA 3I5YA 2G5TA 5B2FA 3CEJA 2PUCA 3LC1O 5KVQA 1GSHA 4ZAGA 3OEWA 3DTTA 4N6NA 5DHSA 2QR3A 1FP7A 2P6OA 4HEA6 1N0IA 1U7XA 2W6PA 1KFBB 4LFAB 3PEEA 2XV1A 2R97A 3SR3A 4Z51A 3ZWYA 3ON5A 1EA7A 3DHVA 1MX3A 5IW8A 2O19A 4F04A 4KR6A 4AUNA 5FXMA 1ODJA 4Y1GA 1DV2A 1GT6A 4TRJA 2IHYA 3K20A 1LBQA 2P79A 3DHYA 2CV0A 4TWAA 4NI5A 3TTSA 5ITZB 5EEHA 2FZGA 4WLNA 5EQDA 2HA6A 3GJ0A 1LLUA 3G2JA 3LI2A 3LC0A 1QUEA 1XMJA 2R7KA 3Q3CA 5NLLA 5IM4F 3L05A 3AVXA 4ZYZA 2MMGA 1AO0A 1UBTS 4YCAA 1PL0A 2ZBRA 4OKNA 1ORTA 4ON9A 1JHZA 2HMTA 1DHTA 5DYWA 3R7DA 1Y8ZA 2YHBA 3GZJA 5JT1A 1PJTA 4PX3A 1BCSB 1GQYA 4K0RA 5CNKA 1B0AA 3I37X 4EF6A 4D3SA 3WGJA 3A31A 4M0MA 4KE7A 4R31A 3U17A 4DADA 2A30A 3L1UA 1FRNA 4BU0A 2FJ0A 4B79A 2XPCA 3O8BA 4U2KA 5U1PA 4BX9A 5JUWA 2IPNA 3AINA 3W90A 3VNQA 1R18A 5IC5A 3KBBA 3RYFA 2HXYA 1ZUHA 4ZYYA 4AJ9A 4AZWA 2HN9A 2H18A 2QVGA 1H6AA 3GPDG 1QZZA 2PUTA 2AXPA 4K3UA 4LJ5A 4CF6A 4I4CA 4GI3A 1F0PA 4BO1A 3U40A 4B80A 2C2HA 2YDXA 1WZNA 2JC3A 3AEUB 3RRZA 5A6VA 3U6BA 1KNXA 3CNLA 3E9MA 5DVZA 1AKWA 1V41E 4MYSA 1A82A 3G8BA 1P1BA 3FDIA 4Q6WA 3KSDO 1FLAA 1QPBA 2H07A 4EPWA 1NF9A 4W9MC 3FGOA 3ODPA 2Q29A 5KSWB 4BLOA 2AMYA 1X1QA 3GXBA 3RJZA 1UH5A 3BFPA 2CT8A 5C80A 1A9QA 2FR8A 3WQQA 1GQFA 3CPHA 4EKGA 5IDVA 4Q01A 1D8TA 3SSOA 1MDBA 3C3DA 1XUOA 3SF8B 3LGXA 3MGCA 3EGCA 4ILKA 3H2JA 2XMQA 1VZ2A 2X0KA 4ZAFA 2YFKA 4MYRA 1BWQA 1EA5A 2Y27A 3O3CA 3N0XA 3WDKA 3FTEA 3D64A 2IZ6A 2GERA 5LD2C 1JIKA 3L0YA 2OG2A 4H0FA 4M9XA 1Z0JA 3FDJA 4RL4A 3RIGA 1FA9A 1INLA 1WMAA 4X71A 3MCTA 3DDUA 2PH7A 1WMBA 3B6ZA 4MCJA 4BFXA 5C8YA 4NENA 5AI5A 2NYAA 3CTMA 2Q3HA 2VDMB 3BF7A 4ZQGA 2RARA 2V6JA 3VH4A 4D9EA 2OZEA 5GOTA 3GLGB 3E81A 4J4TA 2HA2A 1DG1G 2CUZA 2QZ4A 5I9MA 2WTEA 3DKPA 4J03A 3HVRA 1GPH1 1BRMA 4G4JA 1XTRA 4PPNA 1K6IA 3NIBA 1A5SB 3G7SA 4F46A 5KU1A 2HHJA 3DL4A 1TUEA 3W79A 5DT2A 1TAQA 2QPLA 1UT5A 1E2IA 2VZEA 5I01A 1WW2A 2B99A 3L7DA 4HWKA 4JJEA 2DSTA 3L0CA 4JLJA 3FY4A 1AGNA 2UVPB 3I0ZA 5AKZA 5ECDA 5HFNA 4BNFA 4Z5XA 2NU8B 1KPGA 4Y2XA 2V7QD 1V16B 3N2GB 3K2BA 5FI5A 3URKA 1CU1A 2IEDA 2P3SA 1I4WA 3BSYA 2BTEA 1ZBDA 4DCNA 4TYWA 3MLAA 5KVSA 1BS1A 2YWEA 4LJRA 1U1IA 3A25A 4DCOA 1JB9A 3HZRA 1Y1KE 1KETA 1HUQA 4B3HA 3C85A 1KY5A 2HIMA 4HYEA 1CUVA 2ZB3A 4O4JF 1SBYA 2UUAB 4EB3A 4QATA 2NTEA 1X1SA 4L28A 4X41A 1NJGA 1EIZA 2R62A 3FMIA 5T57A 1WAMA 3DMHA 3C4JA 2PD3A 1G2QA 1L3IA 3I2IA 2BLLA 2XECA 1VB5A 3KT6A 2TRSB 4FX5A 1TUIA 3GMDA 2YJNA 1G6OA 3LDHA 4WW0A 3LPAA 4D43A 4CUJA 1PKEA 4PFKA 2LCIA 1HQCA 2R6DA 3KXPA 2BEWB 4KPUA 4I50A 4EY7A 4MHTA 4L9SA 5JZSA 5D1NA 5FCDA 4LECA 4MLCA 3OOJA 2XQVA 1HWYA 2N42A 4KAXA 1E4VA 5FJIA 5F9HA 1FRFS 1T3ZA 4P38A 1IBLB 3ZHCA 3FN4A 2LIVA 4KIWA 5ELLA 3SM9A 2HMAA 3FCEA 3LYUA 2H65A 3FMOB 3AHDA 3COWA 3DV9A 4A3SA 4R0MA 2V3CC 2YYYA 1AZTA 3LRTA 2WU8A 1SULA 1X1CA 4J6EA 4B84A 4AJIA 3TGPA 4M98A 2HLDD 1V37A 4OHPA 4JJ6A 5BSWA 2R44A 1JIVA 1GO2A 3KQSA 3OLXA 1C80A 5DCUA 1P80A 5KKAA 1Z5PA 4BO9A 4WESB 1FJ2A 4PW0A 2H1RA 3S5JA 1E64A 2OQ2A 1VG8A 2AJDA 5HQ3B 1Q19A 1J9GA 1T5TA 2O5RA 1B1CA 2M1ZA 4UDYX 4QM6A 4WCFC 2A57A 2QK4A 3MCZA 3N07A 1G7CA 3AM5A 2CVOA 4AF7A 1WCXA 1QE5A 2GCNA 4PS0A 3TVYA 1E9VA 1T3GA 2IZ7A 1JDBC 4I5GA 3PUIA 2JFVA 2FMFA 1R5OA 3DM9B 4QEZA 1V11B 1Q16A 4Q9DA 3RAFC 2NUAA 1EZZA 4C2UA 1JI3A 2UAGA 2X15A 3QVGB 3R5JA 3DFMA 1RC1A 5LKRA 3F6RA 4D9JA 3W78A 3HKCA 1CUGA 3HU1A 4DQXA 5ICSA 4TYQA 4OBEA 4R2HA 4KPEC 1RPZA 4IUYA 1SY7A 1RHJA 4D4GA 4FT4A 5ERXA 2AYYA 3Q41A 3V1NA 1L8OA 2Z6AA 3SYRA 1V2GA 4G8JA 4GT1A 5DBHX 1EFDN 1L5HB 1IHOA 1MG0A 2HF7A 2QNBA 3D59A 3GT7A 3GUYA 4M53A 4O2BF 5PGMA 1NHWA 1YO6A 4P58A 3WKEA 4D02A 3PE3A 4IDQA 5KYXB 1BW9B 4JLSA 2ZJ5A 3A2MA 3NWBA 2D06A 3LJKA 4EG6A 4GC9A 3ZKWA 4EI7A 4F71A 2XDYA 5JS7A 1SM4A 3PKJA 5BR8B 1U3UA 1SU8A 2YC2C 3L8MA 4S1VA 1AMOA 2R1ZA 4N3GA 2XZLA 3KWJA 3AF4A 1N6RA 2QTGA 1PRYA 1TC1A 2EFGA 5D3QA 1QH1A 1NBMA 4PIMA 2BHNA 3VH1A 2CZQA 1LI7A 2O3RA 1FMCA 1XJWA 1E61A 2DECA 2ZQZA 2ZR9A 3CZ4A 2EKQA 3WWPA 5KTRA 1BQ3A 4B76A 4V02A 2CWWA 2HDOA 2VQ6A 3BK7A 3HVJA 1VQ1A 1H6BA 4H3KB 4HNQA 2B98A 2ZI9A 3TINA 3WGVA 3HY6A 3AR7A 3FM9A 1T5HX 2I7CA 5EL0A 3DHNA 3T1QA 2ACEA 3IX7A 2RH4A 3FR8A 1CY4A 1TKCA 2AN9A 3EGIA 3RVKA 2CDAA 4C87A 1IYZA 1CZRA 1E79A 1NQOA 4PGMA 2IY7A 2WZQA 3PYXA 4NAHA 4UBLA 3A4IA 5D3KA 1SBCA 4F2DA 5MN4A 2CDCA 5K2OA 2ZZNA 2JPDA 2YR0A 4H27A 5KIAA 2M98A 4WA7A 4V1CB 4KFCA 1CF4A 3PDUA 1WW3A 1M10A 4TYMA 3FB4A 3W4IA 5AW2A 2NU9A 2BTQA 4ZU3A 4G24A 4U1RA 1E66A 3N2ZB 1Q6ZA 3PXXA 4QPJC 4ZZ2A 5TT0A 4KNYA 1W30A 5E7IA 2AZDA 1CDOA 5F78A 2P2SA 3TJZA 2OSBA 1A95A 1SKUA 3GROA 4QEDA 3K9GA 4MKRA 3S2EA 3C3PA 3DLAA 1NUHA 2Z1NA 3FTDA 3VPDA 4A03A 1EDBA 3PXAA 1ZVJA 4KEAA 1VHJA 5L3SB 2UYGA 3NALA 4TRRA 3HN6A 4LV8B 2BAGA 4EMBA 2X4DA 1SKYE 4NMWA 1RE1A 3S7ZA 1U0GA 2C2OA 2X2PA 5JH7B 1Q3HA 2CJYA 1M8PA 4K1LA 1QZTA 3AHJA 1RPAA 2VH1A 1OE0A 1TJ4A 2JBAA 3EYAA 1SXJE 2LV8A 5JI3E 1QGED 3S81A 4HC4A 1YV9A 3PUHA 4DV5B 1HFWA 4AF6A 1EH5A 1AA9A 2NVOA 4Q1AA 1KYWA 3IR5A 4OHMA 3RS9A 4PHFA 2QX6A 1N78A 4IIDA 2OXIA 1NI3A 3UJPA 4C0LA 1SN7A 4P7GA 3X0DA 4B2PA 5JZBA 3DBOB 4CKYA 3AH8A 1QANA 3L6BA 4NBTA 3WYCA 4KN5A 1Z2PX 3IO3A 3B3QA 3NCHA 3E9RA 3ZVMA 1HDYA 1X1AA 1YL6A 2CSUA 5TB5A 2ATCA 5KNLA 3WLFA 4CDRA 4CMAA 4LF7B 3DB2A 2V1XA 2VJQA 5IAJA 5CD1A 4E1VA 1U7HA 2AW3A 3U7IA 3ER8A 1YA6A 1KAHA 2IXDA 2O2GA 4UNIA 4G56A 4ZHQB 5CEEA 4OMFG 2PR7A 1M7GA 1W85B 1G7TA 3KKKA 4JQOA 4LI0A 4KTVE 1K75A 3GK3A 3C3CA 1Z0AA 5DTIA 3PTZA 1NQXA 1OPRA 2UDPA 1KZ7B 1N2OA 3Q10A 5HM6A 1W4LA 1N2BA 1UDBA 3I6IA 1SG6A 1M2HA 2X8AA 4HUQB 5IJWA 4PNEA 1M2FA 3NBXX 3L1VA 2JHCA 5AHKA 1J06A 1HKUA 1E32A 1MEOA 2QWXA 3GEPA 4IOJA 2P2YA 3WQRA 2WKQA 1A98A 2XCQA 3WLMA 3Q7SA 1WCIB 4AY3A 4M46A 1Z8HA 5KYVA 2JRCA 3GFTA 3VKWA 1XYGA 4TLCA 4DARA 3E6AA 3V34A 4ZDIA 1QU3A 4P32A 4L5IA 3UJAA 2QA5A 1NNUA 3RT7A 1I32A 1P3DA 1S3GA 3UB2A 2BJWA 3NYRA 5L4LA 1C14A 3UKOA 1BW9A 4KV9A 3TOCA 3K9CA 3ROPA 1SQGA 1C3EA 3HO6A 4RCZA 3V80A 3AQ4A 1YI0A 3SMQA 1AQLA 1S4MA 5I4CA 4RF4A 1EHCA 3VOBA 1V47A 1LK0A 3ZNOA 1CEXA 3LO8A 1WXIA 1SUWA 1AHPA 2O3SA 4LF5B 5DGHA 4CDGA 1Y9DA 5L3QA 3ZD7A 3GL9A 4M0LA 1HDZA 3RAPR 3KZXA 3T9EA 5LQRA 4IM7A 2NX2A 1C9MA 1Z5UA 2Y6VA 5KAMA 2JFGA 1EP3B 2QY9A 3G89A 4M99A 3IOEA 1J90A 5E9AA 2GJ4A 5F4ZA 4CE6A 4JLMA 1ZIYA 2HJSA 4OV6B 5AW4A 1WZIA 1AMNA 3L7OA 1BMQA 4NZMA 1DFHA 4Y1RA 1GFSA 3WRXA 4NK5A 2W8ZA 1WBJB 5HF9A 3IHKA 2W2XA 5HQ3A 9ATCA 5I48A 2WJJA 4CIVA 3GVHA 5M3BA 5EKSA 3MRTA 1HNZB 3TI9A 1TQHA 1Q1QA 2WG1A 3KZKA 1Z34A 4FE7A 3FX2A 4X97A 1NG1A 1IWOA 1I3KA 1RXCA 4NCXA 4PC7A 2OORA 1ZGCA 4YRRA 2XMZA 4HEQA 3C5WP 4J7AA 3LVQE 1GU1A 2ZYHA 3NO4A 2JGAA 3F97A 1UBLS 2H63A 3OLYA 1P7CA 2P65A 5LUAA 3L7IA 3WO0A 4WHMA 4QYIA 3WTCA 4LSGA 5C5EA 5CFQA 1EFRD 1QC5B 4D0LB 4C4TA 2VZLA 1KZ9A 1YJAA 3LM8A 4JP2A 1SA0B 5IJXA 2FLKA 1NUUA 1ECBA 4MQFA 4G26A 1GNRA 4L75A 2WHQA 3AOEC 3P9QA 3AVOA 4ME6A 4YJ3F 1XZNA 4X1YB 1SIBE 2QN7A 4P53A 3HV0A 1M34B 1P4GA 2XGGA 4IDEA 4D41A 1Q91A 1M1NA 2DSNA 3DE1X 4IV0A 4R6WA 2J6HA 4J2OA 4W5NA 2LW7A 5DNVA 2JCYA 2YFQA 3ULKA 4ENVA 2HJVA 1NXTA 3H2BA 4LMAA 4AWBA 4KQ1A 3CLUC 1ES9A 4JOQA 4QHTA 2CHEA 3UJ3X 2OMKA 2O7VA 2QV7A 2XADA 4TYPA 3ZCTA 5BN4A 4B09A 1KL7A 3G2LA 2G9QA 3FFWA 1W0JD 3HDGA 3R0VA 4Z7QB 4UEOA 2CMKA 1OX4B 3G5AA 2C5BA 3LTNC 3WB1A 4Q1DA 5FFMA 2F8SA 1ZZGA 3IIEA 2BEUB 4V0QA 4DCPA 2OD7A 3FFTA 1LWNA 3DZJA 3ZU4A 4OAQA 1AKRA 1ZJ6A 2REQB 4BIMA 3FVVA 4DM4A 5CDGA 3G9UA 3P9RA 5E9JA 3V6MA 3A36A 4YRZA 3QKRA 1ZQ1A 3E8XA 3WSVA 3W2TA 1MHTA 3EGDA 4PVCA 3ZGZA 3AFOA 3DEIA 1N77A 2ODWA 3OQIA 1DKUA 2WMOB 3GQBB 1QQ7A 2HCJB 2GLXA 2VF2A 3FZNA 5CM9C 2HA3A 4JDUA 5DBOA 1H2HA 3WV4A 2PZBA 3C6KA 5JC8A 5IC6A 4ZU1X 5C53B 3SR4A 1RHQA 4G65A 1UMDA 3H7AA 3KSUA 3RADC 4BNUA 2GZDA 1ECJA 2C2YA 4EARA 3AETB 4IMPA 4CR7A 4EO4A 5FKJA 3M1AA 1GRNA 4KUEA 2CXRA 2R79A 4R3NA 4C2BA 3CO0S 1VFNA 4CI9A 4H4EA 3TR5A 5KSOA 4XJTA 1G38A 2BTQB 5EKDA 1KJNA 5JD5A 3MTGA 1TECE 3FD8A 3PWKA 1QGUA 3WK5A 3E15A 3D54D 2G17A 4HAVA 4DOMA 1ZAYA 2ID7A 5AKJA 5JRJA 1Z5NA 5E0KB 2ZDHA 4FGWA 2FPPA 4MO2A 3CH5A 5DK4A 2GVNA 1B93A 1N6HA 4XPIA 2C57A 2VBIA 2K7ZA 3HO1A 1GPDG 1MX9A 4PGGA 2CFRA 2DFTA 4IYJA 4XRRA 2NVWA 2OBMA 4OHBA 3QX3A 2IPAB 4DXDA 2K5UA 3V8VA 1YAJA 5DM2A 1MA3A 3C3KA 4ZVPA 4K3VA 3OU2A 1I7SB 1BX0A 3L7JA 4R05A 3CEHA 4L78A 3CF4G 2X7JA 4TKUB 1IQUA 5KWIA 2QV0A 2ECKA 3TPCA 5JFOA 4ECAA 5DHUA 1YJBA 4I4NA 4RA6B 4AUMA 2WAMA 2XHZA 2HPAA 1GPLA 4EPVA 1EYZA 3R9IA 5CDSA 2BGNA 3E1GA 4UE2A 4RH3A 3ZWVA 1T9KA 4BTEA 4JYCA 5COAA 3I9KA 4Q66C 3UGKA 1YQ9A 1CNFA 1RQ7A 3COVA 1RAEA 3NORA 1M6VB 2OR3A 4D9CA 3KZCA 1SC9A 3OD1A 1E92A 2WHEA 4D56A 4X24A 1DTEA 3OF3A 3JATA 4KLNA 3O47A 4MWCA 4QJ4A 5DISB 1BQ4A 3K6SA 2RKOA 2FR8C 2BR4A 1I2DA 3CUSA 3M4YA 4IY1A 5EP4A 1T26A 1MQ8B 1P4JA 1EGQA 2P9ZA 2AOTB 4PLYA 1T2EA 3DHEA 4W8GA 1QRRA 1EZ1A 1E0AA 5TR9A 1D2AA 3PC4A 2Q6OA 4GOLD 3CLUD 3KQWA 2BUBA 2D7CA 4B6GA 1LC0A 5IVDA 3P9SA 2ZRLA 1U0NA 2FP3A 1N0VC 2L19A 4ZEXA 1WJGA 3FPEA 4B4UA 2II6A 5BV0A 1O4VA 2XVZA 3AHEA 3N2NA 1G8YA 1QR6A 1O5TA 2XX3A 1QPZA 1HZZA 2FSFA 1LDYA 2X9QA 3STUA