3FMFA

Crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
229
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
total genus 73
structure length 229
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmfA00
4M4SA 4PZZA 1E2HA 5C46F 2CEAA 1P60A 2XSZD 2QL6A 2CVHA 2RGXA 3T1QA 4E5UA 1WF3A 2QA5A 4RD2A 1TQDA 1MH1A 1JI0A 5FR1A 4DT1B 3NWJA 3AF4A 3E1SA 3VR5A 1MO6A 3GJ6A 1G21E 5CLLA 1CF4A 2ZRKA 4C2UA 3VNVA 4MGZR 2N42A 2W6ID 4Z8YA 1CP2A 4DIDA 4IDQA 2ZJBA 3A4NA 1W48A 3OIUA 4GI7A 1IJFA 4EIWA 2YKGA 2PEYA 2I1QA 2ZI9A 2H16A 3FWYA 3PEYA 4WAUA 3B9QA 3FB4A 3AUYA 2RHMA 3TVDA 5KO2A 5SZIA 1VG9B 4Q1FA 4ACAA 1A2KC 2XITA 1E4VA 1TPZA 4Q4JA 4JLPA 4FMCB 1U8ZA 4U7DA 4GDFA 5K8UA 1ZM4A 4HAYA 5D3MA 4ASUD 5CIWA 3L0IB 2A2ZA 3LWNA 5JFGA 3U6BA 4JLNA 1YZKA 5AJYA 4F7WA 1IJEA 1VCOA 1XU4A 5EJEA 2R8RA 1J8MF 1ZCBA 5JRZA 3OEEA 4OK3A 4HAWA 4Y0VA 4DLRA 5HKKD 2AD5A 5L3QA 3DOEA 3AVQA 2OBNA 2J7PA 4TMXA 4F4JA 2BKEA 1S96A 2YZ2A 2IBMA 2NO7A 3ZS9A 1OXVA 4RVCA 4HEJA 3K8YA 3ND8A 1QHHB 4QHSA 2CE2X 2ODEA 2ZAOA 5BWMA 4H1UA 2Q0HA 3B1YA 2ANBA 4FXPA 4LYAA 1E99A 4KBGA 2D7DA 1ZNXA 2NGRA 1AGPA 1WRBA 2W00A 3AKYA 2PJZA 4M21A 1L2TA 3B1VA 1ZU4A 4RD3A 2CNWA 3UXMA 1AIPA 3ND9A 4NP6A 3TRFA 1KY2A 1G3QA 4OK5A 2QE7D 4AYTA 1MABB 1W0KD 1XCPA 1XZQA 1II9A 1Q22A 2OLKA 4A1FA 5KNDA 5HR5A 2RKOA 2YVUA 1E0JA 1P7CA 3QXHA 1SKQA 3CKLA 4MYHA 2G9NA 4DIEA 2DWOA 3I3SR 1FNNA 5DN6A 3BJIC 2IS6A 4MGIR 2W6IA 1EG7A 5KPJA 3ASYA 3AVTA 4B32A 1XMSA 1E79D 2V7QD 2ZETA 4A15A 5L3SB 2RGAA 1TX4B 3B60A 2YV5A 1XDBA 4TLEA 4Z54A 2B21A 3EZFA 1VCNA 2ONJA 3QKRB 2ZRDA 3HR7A 4GZMA 4EFMA 4TYNA 1YR8A 1C9KA 4FWTA 1AS0A 2DB3A 1W0JA 2PEZA 4B71A 4FMDF 3G0HA 2JIZA 3PEVA 3CF2A 5L3RA 1P5ZB 5EUQB 3OIVA 4ZI2A 3ONWA 3R8FA 1N6NA 3LH5A 4B3BA 2XZLA 5KDOA 3H4MA 2AFIE 4WZAE 3TAHA 4W9MC 4HB0A 2BEKA 4OQNA 4QFMA 3UMRA 2ZVQX 4MDEA 3HPQA 1GITA 3K0AA 4BZXA 1P9NA 4L4UA 1X3SA 1N0WA 3UG6A 4A9AA 5FPTA 3GLFB 3ZD6A 3IPXA 1GNQA 2QZ4A 1MR3F 2MMCA 4Q01A 3I1FA 4W5JA 3GLGB 1T3HA 5JEDA 3QOFA 2FPMA 3QPUA 2ZE6A 3CW2A 1XX6A 3A1UA 4KYUA 2A78A 4OQLA 5ANRB 4CF7A 3UPUA 1QHYA 1G6OA 2H92A 2FSIA 5B58C 1KK2A 2VHTA 1GTVA 2VYFA 4ZIRA 1DVRA 1TUIA 3MJRA 3LA6A 3WNBA 1D2MA 4V0LA 5FBQB 4TWZA 3FKQA 4IDHA 2ZJ2A 3FTQA 4HLQB 4DLWA 2JA1A 1L4YA 4C0BA 5J4YA 3F5FA 4QNRA 1GM5A 3L0OA 3D8BA 4WVFA 4CEJA 4OYHA 3U3RA 3CLVA 1XTJA 4A0HA 1P3JA 4TL8A 1M7BA 1EX7A 2WOJA 3RC8A 3H2YA 4JLKA 2E9SA 5JSZA 2F3RA 2F9MA 1TUEA 3VU9B 4PZYA 2LCFA 2IX3A 1MRNA 2ZJ8A 2ATXA 4DC9A 1E2JA 4LWZA 3B85A 1KJZA 1KI2A 1V43A 3GJ4A 2O8EB 4PANA 2GVDC 1R5NA 3FHOA 4XVUA 2A5JA 1HY3A 4D81A 2CCJA 5F3WB 1J8YF 4BRWA 4P31A 3J81k 2ZREA 4PX9A 4C0JA 4A92A 4DLZA 3RSOA 1K5GA 4QJ4A 1Z28A 5JCPA 2GTPA 2D7CA 3RSLA 2HUPA 2FWRA 2J0SA 2R6CA 1SXJE 3VKWA 3NIBA 1DEKA 2CHVA 4ARZA 3UWOA 3HYTA 1XJ0A 4DZZA 2B7CA 3GLHE 4X8HA 3IO5A 3PUYA 5FOSA 5JS8A 2YC4C 2R6AA 2ZE5A 4CT5A 1XTIA 1TTTA 1XWIA 4NYMR 4Q1EA 2EYUA 5FFMA 1E79A 2V7QA 3B13B 1FTNA 3MD0A 3RRYA 2FSHA 3UIEA 5JWHA 5IK2A 5KPDA 1U2RA 2CLCX 1GDDA 2ZYUX 3IKJA 3KX2A 3GMTA 3ADDA 4N0EA 4ON9A 3OEED 1PJRA 4TQAA 8OHMA 2RGCA 1E98A 5BYJA 1AZTA 3CPHA 1L4UA 3CNLA 4FMBB 2J0QA 2V6JA 2RCNA 2MMGA 4C0AC 2F43A 2BBSA 2FX3A 2X2FA 4UXIA 3C14C 2IS1A 5AJXA 1Z63A 2P0EA 4PHFA 1EFTA 5HTKA 3IBGA 4URVR 1PLLA 4NHOA 1D2EA 2JLRA 5FL7A 3CF6R 4NPHA 2DFTA 1OH8A 2F1JA 4B73A 2DHRA 2GJ9A 5FTNA 4A2WA 5A4JA 2FDCA 2FU5C 3NDBB 3MWYW 3BRWD 1KAGA 3B8HA 1QBKC 3A58B 2O8EA 1E1QA 3P32A 4IXMA 4MRNA 4GL2A 2IYWA 2A30A 2J0UA 5FTKA 1W7AA 2O0KA 3TJZA 5HE8A 3BD9A 1R0XA 2C04A 5KDDA 2P2LA 3VX3A 1JECA 3EC2A 5LPNA 1AQYA 1KMHA 1UKVY 4R71A 4MRSA 2ZRBA 4UNRA 2VSOA 3DHWC 3NHAA 5C2JB 3CH4B 4J0QA 3R9IA 1ZW6A 2OZEA 2JASA 3OE7A 4OQFA 1BH2A 2ORIA 2YWEA 1GRQA 4KI0A 5HZKA 1K6MA 4M2LA 4KHZA 2ASEA 2XTMA 4HZUB 3T06B 5FUXA 1SXJB 3TQCA 1ZNYA 2YOGA 2QP9X 4KU4A 5IHPA 2BHRA 2QP4A 3WY9A 1BOFA 1EFRD 2FG5A 3ASZA 3AVOA 2GJSA 1GRRA 1OH6A 1Z29A 1TEVA 4JLBA 4URYR 4KLNA 4NL4H 5JSZB 1OV4A 4URUR 1XFAA 3GJ5A 4L8GA 2IEYA 3H1TA 2BJWA 2JJ1A 4GOJA 1T4GA 1KO7A 3PUZA 4PQFA 5JECA 3ZVRA 3K9NA 3MWLA 2AKYA 3OE7D 4RD4A 4MH0R 4HUQA 4D0LB 1F2UB 2IS2A 4I1UA 1JR3A 1TF7A 2GDJA 2NO0A 1FMLA 4ZCMA 4IEEA 2O0JA 1XCMA 2G77B 4HZUA 4MRPA 1OXTA 1TL7C 4PC3A 2CDNA 3FKSA 1R0YA 1IXSB 3KJEA 4V03A 1ESNA 4RFSB 3T1OA 4M9ZA 2H1LA 4L9SA 1HV8A 1UFQA 4M1WA 2OBLA 1N6HA 1OKKD 1OXUA 1ZJ6A 4KYIB 4LCBA 4UQOA 4QGFA 1QHXA 2Q3FA 2QN6A 4UNPA 4B6FA 3GLGA 4LBVA 3VX4A 4B74A 2VLIA 1SVKA 4LZZA 2WSSA 4DCVA 3AF0A 3MWKA 2QPTA 1CJMA 1ZIOA 5EXXA 1GRNA 4FD2A 4D25A 3W6PA 3VR6A 3KKQA 3A1TA 3BB1A 1G1MA 4ZV4A 1ZM9A 1SQ5A 1UDXA 2DPXA 3IHLA 3ICEA 2H18A 2WWGA 4DLXA 4LI0A 4BEJA 2WAYA 1DG1G 1CJUC 3T1VA 1Z0JA 1E2NA 2W0MA 1JXMA 2QY9A 2Z5FA 1CR1A 3EWAA 4MUBA 2ZRHA 4JVNA 4BLOA 2FJUA 4EFLA 4RKFA 4QBHA 2C9YA 4TMTA 2P3SA 1HURA 1W4BA 1HEIA 2CLSA 3FFBA 4BLSA 3I62A 2JLYA 4WIAA 1QG2A 2DBYA 2EW1A 4WXPA 4PC2A 3RANA 5KSOA 4G0NA 3LAWA 2IYZA 4IDOA 1YZQA 2O0HA 1OW3B 2CNWD 2ZRMA 2ZYWX 3NVAA 5KDLA 3QG5A 4DCSA 4IOJA 3LBHA 3RHFA 4KFTA 3X1YA 2X2EA 4ITRC 4JJKA 1NJGA 1QHIA 2QQEA 1NI3A 1XXHE 4NYIR 3NEJA 4XWKA 4MGKR 5EP2A 2KBEA 3X2SA 4F4CA 3L0PA 2F3TA 2OBMA 1P9RA 1J7KA 3ZYCA 1TQ4A 4JBXA 4LJ9A 4IXNA 5FBRB 2VF7A 1KTVA 3F3YA 2CLDX 3CM0A 5DO9A 2A5DA 5FOWA 4ZI3A 1BIFA 3CR7A 2QTFA 2YJTD 4Q7LA 3LQQA 4BFZA 1Z6YA 1N6OA 1W4RA 1KKMA 3B7GA 2QRZA 1G7SA 1ETUA 1RJ9B 3FMOB 4PQYA 4F91B 2ZSAA 4QOSA 4FIDA 2QM7A 3LLUA 2IYTA 2EFHB 3NG1A 1HTWA 2A3RA 4IDNA 2I1VB 4M1KA 1NMZA 2PLRA 4V0MA 2OFWA 1LVGA 2ZUDA 2V9PA 2Q6TA 2A7QA 4I99A 3SYLA 1G7RA 2CVFA 3VTKA 1KK0A 2BEJA 1KNQA 2BDTA 1UADA 2HDNB 2ZI5A 3EARA 1GKUB 3V9PA 3GLFE 1N0VC 3HWSA 4LOAA 1R0WA 3PITA 3ZVLA 3BORA 1WDTA 1HH4A 2V3CC 1UEJA 1WCV1 3PG5A 3BFXA 1CULC 3VHLB 3RYTC 4R2IA 4GZLA 2K5UA 2AK2A 1G7TA 1EGAA 3ZQJA 4AKGA 1II8B 1NKTA 3A37A 4GFDA 1KOFA 3EC1A 3LQRA 4RZXA 5B30A 4QG7A 2QT1A 2BV3A 3FE2A 2R62A 3EIHA 5DSZA 2D4HA 2PCJA 3ZQ6A 4D6PA 1IN8A 2HYDA 4V0KA 5IT5A 3GPLA 4ESHA 1F2TA 2HV8A 4PR0A 3THYB 4LGMA 3OIYA 1Q1BA 1UM8A 1X86B 2ZR9A 3K09C 4CW7A 1VYVA 4XWAA 1E9DA 1KDOA 1E9CA 3PFIA 4P32A 4YDSA 5CK5A 1G20E 1GIAA 2GCPA 4NCKA 4W7SA 4E07A 3UWKA 1KAOA 3ZLJA 2PBRA 2WMOB 3IIJA 4GBMA 2A5GA 4BE7B 1OFUX 5AUOB 4NCJA 3QKTA 4QBGB 1ZM2A 4TYWA 1CBUA 2CHQA 3KB2A 5SZHB 4XTCS 2OCPA 1XZPA 4XTRA 2WZQA 4M9XA 1RYFA 2GAAA 2Q9AA 1IM2A 5KSZA 2BKUA 2EWWA 1H8ED 3NXSA 5KSYA 3R9WA 4B3CA 3I8SA 5GVSA 1O87A 3SC3A 4YMSA 1P61B 1AS2A 1OH5A 2IC5A 4D2IA 1Q21A 2HEIA 1ESMA 5G3ZA 3CNNA 3U4QA 5CYPA 2IUTA 3I61A 1W46A 4A2PA 4QRHA 4NYJQ 1AK2A 3M4YA 2NMVA 1N5IA 3O8DA 2BM0A 3OFNA 2IUUA 1N6IA 3KTAA 3Q8XB 3UMFA 1LNZA 4Q1AA 2J45A 2ZEJA 3K0CC 4NYJR 4LBZA 4QBFA 1QZXA 4HB4A 4LBYA 2IA5A 2QENA 4GT1A 1KDPA 2R6FA 1ZP6A 4PZLA 2OCYC 4URWR 1OYYA 1E2LA 2YINC 4Q1DA 1E9AA 3KQNA 4G3XA 3RS7A 4LJAA 4CIDA 2CK3D 3UATA 1RRPA 3QVUA 1A1VA 1YR6A 1KI9A 1Z8FA 5GJBA 3IQXA 3VR2A 3FYHA 5D3MB 3RS4A 4AIIA 2GCOA 5LD2B 2KI5A 4BGDA 2NPIA 4HDCA 3THOA 3KQKA 3SE0A 1II0A 1ZMXA 2J3EA 3MCAA 3ETLA 2IHYA 2C96A 4US1R 1XEXB 2GESA 1VCIA 3NKVA 1S0UA 1UBGA 4LYFA 4A8JC 2V6IA 1M6NA 3H84A 1IN5A 1IY2A 2P65A 1H65A 3QENA 3S1AA 4URXR 1JAHA 2WJHA 1SKYE 3O47A 4NMMA 2O8BB 1SVMA 2XNDA 3AGQA 4EKDA 5FOVA 2XNSA 1PUIA 3SYNA 4EJSA 4AKHA 2VHQA 3AF2A 4HDQB 5EZ6B 4U00A 4BFVA 1GG2A 1KZ7B 4DB2A 1T3SA 1G16A 2X1VA 5AJVB 2QMEA 2VP2A 3A4MA 1PZNA 2PJRA 4L9WA 1WE2A 2OXRA 1U0JA 1YVDA 3PQCA 4MRVA 1Q1ZA 3H86A 4DUGD 1ZC3A 1S2MA 1N2CE 1FUKA 4TN1A 3CRQA 1S4QA 2ANCA 4JL8A 2ZI7A 3U3KA 3A8TA 1ODFA 3N2IA 1ZINA 3SJCA 3TSOA 1M1YE 3LBNA 3E2IA 3GJ7A 2ZSFA 2QI9C 4HLUA 4LDJA 3WYAA 2WTUA 4LY6A 3L82B 1W36B 2RAPA 4XOIA 1WBDA 5SZJA 3RWMB 5FL7D 2KWIA 4TZ0A 1ZU5A 3IHWA 1XJQA 2WJJA 3AEZA 3TQFA 5EE5B 4B35A 1VIYA 2W2XA 4LC0A 1PLJA 4HSEA 4JVLA 3PIRA 1E94E 4RZ2A 5E3HA 4Q9HA 2CL7X 1GSIA 5GJCA 4YMUA 3N70A 3B2EA 2PH1A 2RMKA 3RLFA 3KJHA 1VG0B 5KTYA 4BWYA 3CO5A 2H17A 1YKSA 3C41J 2XX3A 1Z5ZA 1RYHA 5UKDA 2GF0A 4PSKA 5DLQC 3TR0A 1XEFA 1WP9A 4CT4B 5TXGA 2QRNA 4IFEA 1BYUA 1H8HA 4JYCA 4PPGA 1SXJC 1JPJA 2DCUA 2FFHA 2EU8A 2HF8A 1P73A 2SHKA 2WKPA 2KSQA 4BFTA 4D80A 2WOOA 1KI6A 1MO4A 1Z0AA 2WVJA 2ZRFA 4OI4A 4EJSB 1JBKA 4QJ3A 4DDVA 2FN4A 4FCVA 2QGNA 3UMSA 4CEHB 1IN7A 5BN3A 1II8A 3AH8A 5EP3A 2VHJA 5HCNA 1LY1A 2OG2A 4I1VA 4M1MA 1LF5A 2JCSA 4ZCIA 4Q1BA 4YQFA 3AP1A 2J46A 5BYKA 3BFKA 1F5NA 3GQBA 3K53A 5IRCD 3WP1B 2GETA 2DFKB 3GEHA 4NCHA 3CB4A 4N3NA 3RWOA 4R2HA 3NH6A 1R0ZA 2ZRCA 3A1WA 5D3QA 3LRPA 1M74A 1JEDA 1DAKA 1NN5A 3X1ZA 3EPKA 1BMFD 2IXFA 1MT0A 3BERA 1YRBA 3THWB 4N1AA 1T8UA 4I1SA 4LV5B 4B76A 1JAIA 3KB1A 1VYUA 4NZYA 2ZXUA 1ELOA 2ZI4A 1PUJA 2R9VA 1X1SA 4BZPA 1CKEA 1MABA 2IL1A 3TUJC 5L8VA 2VIIA 4QM7A 1GOTA 4U5XA 2GA8A 4MKHA 2H7VA 3BWDD 4AYWA 3K70C 2OM2A 1E2EA 1N6PA 2V1UA 2MSCB 3KXIA 3OFND 3EIEA 1KO8A 4ASUA 2GRJA 4EPRA 5C1BA 5IDVA 3P4YA 3AQ4A 1XTRA 3G5UA 4W5HA 3KXKA 1BMFA 4BRUA 1I4TD 3U7FB 1A7JA 2XTNA 3EZ6A 1JJVA 4KO8A 3WNCA 2N1BA 3CH5A 2BBTA 1GFIA 3QBVA 1NVUQ 4NH0A 1FTSA 1XTSA 1X8KA 4A4DA 2OE2A 2GILA 2J9RA 4JIMA 3TBKA 1NIPA 1SZPA 1TNDA 1YZGA 4YONB 4XD7A 4X8LA 1T8TA 4KFSA 3CONA 3TW8B 2JJ1D 2R44A 2R6GA 1U94A 3AKCA 5K8TA 3VHXA 3OEHA 1FP6A 4JKYA 1XBTA 3HPRA 4A36A 4LJ5A 3BB3A 4B75A 1U9IA 2BMFA 1NLYA 2PLFA 5JWRA 1U99A 2IYQA 5FUWA 2A9KA 2EQBA 2GZHA 3K9LA 1LF0A 2WWWA 3CUEF 4HAXA 3SQXA 4DWJA 2W58A 4GP6A 4HAUA 6Q21A 4UNSA 2XSZA 821PA 4B3GA 2NO6A 1I4DD 1FX0A 2ECKA 4NCIA 3GFOA 3QKUA 4TLBA 3CX8A 3NBZC 1W47A 2C8VA 1SGWA 3WMFA 1T5IA 4KAXA 4PC1A 2OCBA 4LJ4A 1Q20A 3V4RA 3V4FA 4B3DA 2Q21A 1N5JA 2BC9A 3RRNA 1KHTA 2HLDD 2ZTSA 3Q7PA 1G3MA 3OAAD 3EPHA 3S1AB 1TQ6A 1HE1C 5CDFA 1QHNA 5JJLA 2ZS7A 1Z0IA 4I4LA 5EXSA 1KGDA 5DNYB 3SBEA 4OHWA 5G41A 5B57C 4D4MA 4HAVA 5JJIA 3TUIC 4NU0A 5G40A 1E2GA 5FUYA 3TAUA 5KOYA 1S1CA 5DH9A 1DAGA 1UBEA 4JSYA 4OHVA 5L3QB 4F92B 2FA9A 1Z06A 4MYTA 1NY5A 1NLZA 4RJLA 1DBSA 2FZLA 3L2OB 2BOVA 2WIAA 3VKGA 1EESA 2QROA 3F0TA 1S1MA 2W0SA 1KMQA 3BH6A 3TUZC 3NDPA 3CRMA 1KNXA 4XJXA 3LFUA 2AK3A 1UAAA 5DHAA 5JRJA 4JJZA 2IYVA 3AP3A 2IYRA 1GP2A 4HYYA 4BFXA 1U90A 1NVVQ 1X8JA 3P26A 2GEVA 5JMTA 3LDAA 2IXEA 4QGHA 5E7JA 1XP8A 3QEOA 3R9XA 3F8TA 4A2QA 5LD2C 1SULA 2IHBA 4NYIQ 1W2HA 3U3JA 2YWGA 1SVLA 2B8TA 2QAGA 4H9GA 5K8IA 2IYUA 1KI7A 1F6BA 1U0LA 1ZD1A 2AD1A 3A1VA 3IIKA 4FCWA 4MITA 3GLIE 2VQSA 5FI1B 2XGJA 2G83A 1T91A 2CXXA 2RHDA 3LVQE 3UK6A 2G88A 3EZ9A 3QF7A 3R8CA 4Q19A 4P4SB 1HA3A 3B9PA 3CWQA 2P5TB 4L16A 3W8RA 3U60B 2XZOA 1LFDB 1OE0A 4JLVA 1Z07A 4LK2A 1LB1B 1Q0UA 3BK7A 4UXJA 1CXZA 3W5JA 2OLJA 2OO7A 5DI9A 3QXCA 4D4KA 4IVPA 4L5BA 1P6XA 4DLVA 4NCNA 3VAAA 1CJVC 4LJ6A 1Z0KA 3TH5A 2FGJA 3LY5A 4CEIB 1S9DA 3U3MA 1FPMA 1KI6B 4PTLA 3FMPB 2ZIAA 2XEXA 1QVAA 4Q4JB 2GHIA 4HUTA 2O8CB 1D9ZA 5J4VA 1J2JA 4V0NA 3MSXA 1WXQA 1XMVA 2IT1A 4HATA 4CEJB 3T35A 4EQ6B 1G3RA 2ODNA 3LBIA 1CRQA 1DOAA 3DM5A 3T12A 4O2RA 2FSGA 1TMKA 5B64A 5FBVB 2UVQA 3QKRA 3MJHA 4HLUC 3U2QA 4OJKA 2JDIA 4PAMA 1SVOA 5CM8B 4Z8XA 4ACBA 1G8PA 3EA0A 3FMIA 2WWYA 4HB3A 2W6JD 2RGEA 1NN3A 3IBYA 4C0KA 1WBBA 2RGNA 3KDSE 3QXJA 1W5TA 4DSOA 1GL9B 1W2GA 4CYMA 4DVGA 2XJ9A 5E4FA 4M1OA 3I5YA 2ZU6A 1KI1A 3G82C 3BAFA 4QNMA 2ZS8A 5E95A 1E9RA 2ZS9A 5JHGB 2JDID 2Q3HA 4C30A 3D6TB 1OYWA 1G19A 1Y3AA 2WM9B 1UKYA 1COWA 1XMIA 1BYIA 4TL7A 4KSBA 1SVWA 2GVZC 2OESA 3SR0A 5CITA 1OIWA 2QGZA 2VEDA 1VG8A 4LJ7A 3K9HA 2FPLA 2GXUA 4R7ZA 4LUCA 2V54A 1OXXK 2VH5R 2H5EA 2WICA 2GAOA 4GMDA 4O25A 2GJKA 3VNUA 1FP7A 1EK0A 2Z4SA 1E1RA 3B82A 3B1XA 3K70D 2AXNA 4C7OB 2GZDA 3BGWA 3QF4A 3T1TA 2FZ4A 3CZQA 1E9EA 3O8BA 4D26A 4G01B 2OFXA 5EE1A 2VTKA 4OKSA 4HI0E 3U44A 4QHYA 1R5BA 3GCGA 5EXPA 3C5HA 1KYIA 2P5SA 5F98A 3LW7A 4BFWA 1KY3A 2ZRIA 5C4GB 2AHOA 4UKDA 3OEHD 4DBLC 1G8YA 2QBYA 3BXZA 1ZUNB 3GD7A 1VHTA 4O2LA 3K0EA 4UJ5A 1HUQA 4TLDA 4YMVA 4DDTA 4ESVA 4QHTA 1MO3A 1R10A 4C0LA 4OI1A 2P6RA 3NH9A 2UZIR 3NBYC 1NVXQ 3B5JA 1A2BA 2J59A 2WJVA 2IF2A 1G64A 3MLEA 4K46A 1G8FA 3P4XA 4RFSA 4AG6A 1IOZA 2IUSA 5J47A 2FNAA 3WMEA 1NY6A 1CR2A 3QBTA 1OFIA 1ZBDA 5FPYA 4MKGA 3WNDA 1W36C 2X8AA 4M0LA 1NN0A 2JATA 1S3SA 3FDIA 3QJYA 1RFLA 1HYQA 2RGGA 2H8KA 3Q3JB 1VKJA 3TE6A 3KJIA 4UNNA 1M2OB 3ZZUA 4CEHA 4US0R 1YR7A 1SHKA 3QG1A 4NYMQ 3CIOA 2AR7A 4URZR 621PA 1E0KA 1Z0FA 5CYOA 3AV0B 2RH5A 4RY2A 3T5GA 2VO1A 3M6AA 3NBXX 3KQHA 1Z6XA 4LPSA 4W5WA 1X1RA 4O0MA 3PVSA 1S8FA 1U98A 2C95A 2OSBA 4Q4AA 1AJEA 1E2PA 4JLJA 1NNEA 1AM4D 2ZRNA 2UKDA 1ZVQA 2WPDD 1FQKA 2GCOB 2J87A 3DVLA 3AF1A 3AUXA 4WZBE 1DADA 3KZ1E 1BKDR 2ZR0A 1KSGA 3AM1A 5KSPA 1ZD9A 1T9HA 2BCGY 4JVSB 3TR5A 4BPBA 1C1YA 2IW3A 3QVVA 1TU3A 1YU9A 4RSGA 1OT3A 1TU4A 2ERYA 4NE2A 3A4LA 4AD8A 2KBFA 1XNJA 5JWOA 3QKSB 3C16C 2JJ2A 4II7A 3RABA 1EX6A 1EFCA 1KI3A 3RS3A 2VA8A 1OXSC 4F93B 1Z6GA 1KO1A 4KITB 3GP8A 1VG1A 3GEIA 4IOLA 2WWFA 4RCYA 4Q9LA 3HU1A 1OB5A 4U02A 2ZYVX 2BMJA 4AY2A 4E03A 4DLYA 4HLDA 4PPNA 2D2FA 3SDZA 2F1RA 3Q7QA 4C3ZA 2Z83A 4IDPA 1NBMD 2VHCA 5AR1A 2AL7A 2FSFA 3NEYA 4Z1MA 4IRUB 1RE0A 4DT1A 4JZKA 3RDPA 3SOPA 4JMPA 2FH5B 3I92A 3U5ZB 5L3VA 2W2VA 2DFNA 5FH9A 3NHBA 3U7GA 2REBA 4M1TA 3LX8A 4NKRA 1ZD8A 3RVBA 3QNUA 4Q48A 1KJWA 1NLFA 1KDRA 4TT3D 1NMXA 1FW6A 4Q9KA 3DOFA 4JT4A 4CEIA 2V55B 4GNKA 4Q9JA 1VTKA 4NBSA 2L0XA 5EXTA 4Q00A 5BXQC 1P2UA 2ODWA 3CR8A 1G4UR 4Q5IA 2HJGA 1KSHA 4IEIA 2O8BA 4QXAA 3W6NA 4Q4AB 2WPDA 3P20A 4LPKA 4PQRA 1MV5A 3B1ZA 3EA5A 3LX5A 2WSSD 2WAXA 5JI3E 5FI0B 4M1SA 3EG5A 3LLMA 4JSTA 4MKFA 2GJAA 3Q9LA 3ZGXA 2Z4RA 1ZNZA 1OH7A 5JHHB 1G6HA 2QBYB 3VMFA 1K8RA 1OFTA 3QKSA 4IVRA 1AS3A 5KNCA 1TEXA 5BN5A 1YRAA 1E0AA 3Q5DA 4D0NA 3IO3A 1ZCAA 2HLDA 4QGAA 4FCTA 1T0HB 4KCGA 1GUAA 3SHWA 2REOA 4V02A 3AGPA 1A4RA 3NBFA 5AUPB 1C4OA 3WRXC 2ORWA 2JIZD 5H8WA 4P3YA 4LRWA 2J0UB 4H1VA 2ZAMA 3GFPA 4MQBA 4WZ6A 1M7GA 2PT7A 1P2SA 2JLWA 3CX7A 3A1SA 3RAPR 4A8JA 1XRJA 4XSHA 4YXWD 4BZQA 4TYPA 4HLCA 5FBWB 3GLIA 1E2DA 1WQ1R 1I2DA 4OL0A 1JEEA 3T15A 1EFRA 2ZRLA 5FOXA 1W49A 4PC6A 1MOZA 4DEXA 1T5LA 4I81A 2X19A 1CS4C 1B23P 3U4QB 5A0FA 2CJWB 3CPEA 2JLZA 4ZO4A 1GVNB 721PA 1W0KA 4F4IA 4V0ME 4PPQA 4IFBA 2EYQA 4TMVA 3I4LA 2QQ0A 3ZS8A 1R2QA 1VPLA 1NRJB 2YWHA 2F6RA 4MRRA 4LSGA 4QBIA 3L8ZA 4PAQA 1JQJC 4C7OA 3QE0A 1DELA 1UPTA 4DRZA 4AC9A 3UANA 2R6DA 2VP0A 3SS8A 1KO4A 2EWVA 3OESA 3FMFA 2FF7A 2O5VA 4LJ8A 5GJWC 3ZVNA 4B2PA 2AFHE 2FFQA 5TMPA 1Q12A 1NIJA 1TAGA 1Q44A 2AX4A 2NIPA 2QSYA 1D8TA 4JLDA 3REFA 1RJ9A 2VSFA 2D3WA 3QY0A 3CX6A 4DXAA 2OT3B 1J99A 2KE5A 3AF3A 5BQ5A 2WHXA 4M9QA 1QG4A 5HKKA 2GXSA 1IBRA 3P27A 4TTRA 1AGRA 1DO2A 5IK2D 2RB4A 4DSUA 4B6EA 2OV2A 2GF9A 3OZXA 4EDHA 1JB1A 1Z3IX 2QE7A 4PSAA 4P0TA 4A0RA 3TK1A 1CR0A 1OF1A 1XEWX 4KLZA 4C0QC 3MG9A 3DEFA 2PX0A 2FMXA 3BB4A 3SYKA 1US8A 1E9BA 1F48A 4IOKA 4CDGA 1Z08A 1EWQA 2FGKA 3AVPA 1KMHB 4YMTA 5LBIA 5DIFA 5AUNB 2ZSDA 2QAGB 3CWZA 2VP9A 3I72A 4EPXA 1NG1A 3DDCA 2VHUA 3A6PC 4FWIB 3K70B 3FHTA 3JVVA 3BC1A 2E87A 3WBKA 3KKMA 4Q03A 3LXRA 2QEQA 5CM9C 1E2KA 2ZE7A 1UKZA 121PA 3ZIAA 3JZMA 1KO5A 2XXAB 2O52A 2IWRA 3R7WA 1Q3HA 2B6HA 4TL6A 3SJBA 2G0TA 4AURA 3GFTA 2F55A 3O8CA 1CLUA 2JLXA 4TT3A 2WSMA 2YOHA 5A5GA 3KKPA 2C5LA 3VU9A 1NG9A 2EVWX 1YZTA 3EZ7A 2O8DB 4KJZA 2J5XA 2GEUA 4FI3C 3SBDA 1YZLA 2CBZA 4LC1A 3PJRA 3HJNA 3FHCB 4M8NE 1OB2A 4NTZA 1VYTA 1Z0DA 3Q5EA 4X8MA 2XNDD 1AN0A 3E70C 4LYJA 3EASA 1XXHB 5DYIA 4XWOA 4K81B 1HT2E 1UKEA 1F2TB 4WXRA 3THYA 2JJ8A 4TMKA 3C7KA 4PHGA 3BH0A 4Y0AA 3AVVA 2GXAA 3LD9A 1CIPA 1ZAKA 4KVAA 3AVWA 5FPSA 3AB3A 2NQ2C 3ZZ0A 2GEDA 4MA4A 3UG7A 2HCJB 3AKDA 1CR4A 2JGNA 4OQMA 4TMWA 2AWOA 3C4JA 1RPZA 3VKHA 2DWPA 1OHHD 4TSFA 2P6NA 1QVRA 2WWHA 1D5CA 1ZM3A 3KTAB 2ZYTX 5FR2A 4B48A 2GK6A 2IYSA 4JBWA 3K0AB 2IXGA 3SQWA 2QAGC 2NPFA 3M1IA 4M22A 1JNYA 5DE3A 3IPYA 1RRFA 4MGYR 3X1XA 1E0SA 4XVRA 3CRRA 3HR8A 3W3ZB 2V4ZA 4KSCA 4YC7A 4DSNA 3Q85A 1XEWY 2F1IA 4D4LA 2ZJAA 3BIFA 1N0UA 3AKEA 5HPYB 2HXYA 3ADKA 4AK9A 1CRPA 2J1LA 5H1YA 1CJTC 2BBWA 3W9YA 3FGNA 1KZGB 2XAUA 3MRSA 2LWIA 3DKVA 4RD0A 3QPVA 1XPRA 1DG3A 2Y8EA 2NTYC 3GJ8A 2ERXA 3SEAA 4UJ3A 3RNLA 3PCRB 1M8PA 4HAZA 3MGCA 3RS2A 521PA 3CRW1 3U44B 4KFUA 4EPVA 2ZROA 4LJYA 4TQ9A 5DN6D 1IN4A 1MKYA 1CJKC 1XEXA 2F43B 2R2AA 5G3YA 3IILA 3SHFA 4C0SA 1NKSA 2H57A 1UBFA 2BVNA 4E22A 4ZDIA 4Q7KA 1VDZA 1T3LA 2VP5A 2HXSA 5EQTA 4TLAA 1E32A 4LV8B 4D82A 3C15C 4ABYA 5JCZA 4DHEA 1W0JD 5TDHA 4A0GA 1N6RA 1Q3TA 3K0FB 5JEEA 5KU1A 1FOEB 2I4IA 2Z0MA 4TTPA 4PC7A 4YDHB 1IY1A 2NG1A 4QM6A 2WWXA 3NTUA 2JAQA 4V0OA 4Z51A 2G0NA 1ZUHA 3SN6A 1KI4A 4IOMA 4B3XA 2VRWA 4EFNA 5FTLA 4LHWA 2QU8A 4ARZB 4QKQA 3B6EA 2C78A 2HT6A 1XJCA 4JYBA 4PFSA 4PO1A 1DAEA 2FFAA 1K5DA 1SHZA 1E6CA 1D9XA 4Q4HB 4UNQA 1OIXA 3MMPA 2JEOA 3W3AA 2JJ2D 3BE4A 3U61B 2J7PD 3ZH9B 3ADBA 4CVNA 1JXOA 1LW7A 1VCMA 1Z6AA 4IKEA 4K8OA 3TW4A 4TYYA 1G9XA 2C99A 4ILEA 1PLKA 2GZAA 3EW9A 1AKYA 4MYUA 3ZDQA 1CTQA 2ZRPA 5E7IA 1ZM7A 1NBME 3QQ5A 3THXA 2EFGA 1ZUIA 2IYXA 5AUQA 1OFHA 2GKSA 1X8LA 2OUKA 4QJ5A 4KODA 5L3SA 3REGA 4OHXA 2PX3A 3DZDA 2R65A 4FMDB 4EQ6A 2OEPA 1G18A 1H8HD 2ZJZA 1YE8A 3VR1A 1HQCA 4X8OA 1GAJA 4DDWA 2IEZA 4TYQA 1TQ2A 1DS6A 3MFYA 3PXGA 4DSTA 3TSWA 2HYIC 3PEUA 3TSZA 1U8AA 2XZPA 3WBJA 2UZ3A 3GJXC 2ZM5A 2WV9A 3EWSA 2GWHA 4XH9B 1ZIPA 3WMGA 1BS1A 3HU3A 4YMWA 2IYYA 4CRWB 4KV9A 3EZ2A 3QPWA 5BW8A 5JBQA 3AP2A 3LW8A 4HDOB 2VL7A 4JKIA 1XTKA 3V00A 5ELXA 1WMSA 3K0FA 4R9UC 2G3YA 4LHZA 3WYGA 2ZJOA 1W5SA 2GCNA 2YYZA 4HB2A 1JR6A 2NOAA 4D4JA 3QF4B 2QM8A 3VR4A 3RS0A 1F60A 1V5WA 4BQSA 5CIQA 4M53A 4ZDKA 3K1JA 1VHLA 1IXRC 1E1RD 2XB2A 1ZNWA 2XOKA 2CCGA 1E96A 1JQLB 3IQWA 3W6OA 5C4MA 2YOFA 4B44A 1DAFA 4B2LA 2ZANA 1YR9A 4IHQA 2QSZA 2C9CA 1AA9A 3QEJA 3JZAA 4DCUA 2QTVB 3EPJA 5EE3A 2NO9A 2J41A 4LHXA 5M04A 2ZI3A 4DUGA 1O3YA 2YWFA 3PEWA 3FOZA 2O8FA 3LVRE 1KDTA 4KBFA 2CMKA 2JLQA 1XD9A 2XOKD 4HZIA 2FV8A 2RGBA 2WIBA 1OPXA 1CEEA 4LX0A 2KB0A 3KKOA 1OIVA 1FQJA 2XTZA 4A6PA 4ZDJA 4PO9A 3GJ0A 2O8DA 5HZHA 1I2MA 2RGDA 3I8XA 3KUCA 2FE4A 1FMJA 5AJWA 3OHMA 5GADl 2VP6A 5FPHA 1IXZA 1Z83A 3HU2A 3DZ8A 1M34E 2PCLA 4F38A 2B7BA 5K8LA 1FZQA 3MUFA 1FFHA 4G5GA 3FPAA 3P1JA 2JLUA 4UXHA 5JLJA 1NJFA 2F9LA 3NC0C 5KNBA 2AN9A 1NL3A 5CB8A 1IN6A 2QMUA 2ZSEA 3IDQA 4GOXA 4JBYA 2B8WA 4Q47A 2FFBA 5AJZA 3U6KA 1R6BX 2O8FB 1OSNA 1UDWA 2FOLA 4R98A 1G3IA 2WKRA 3PENA 2IWHA 2ZU0C 4P4SA 3TVTA 4S2EA 3DL0A 2VBCA 2VSXA 2HT1A 1Q1EA 4BASA 3WYFA 1MO5A 1SVIA 1P2TA 1VIAA 2YHSA 1QRAA 2E1RA 2AWNA 2QUZA 3I32A 2ZUCA 4YLGA 1GKIA 2CK3A 3U7EB 2WBLC 1N5KA 1W4AA 4XSGA 5J4LA 3IGFA 4BLQA 4Q1CA 5G53C 4DDUA 2LKDA 2PZFA 1RZ3A 4AYXA 3EX7C 1P72A 5J4KA 3M0EA 3BFVA 3PUXA 2G1JA 5AWFC 2QORA 1KKLA 1KK3A 4JS0A 2DR3A 3NC1C 1RRCA 3QI2A 4G1UC 3O8RA 2PT5A 1W4CA 1E4YA 4YXWA 5KUTA 3FVQA 5FBLB 1GNPA 1KI8A 3ZD7A 3HDTA 3THXB 1QHGA 1U9IC 1CU1A 2CE7A 4P4TA 1VECA 4L15A 3MWJA 1LV7A 5TARA 4LV6A 4Q18A 1FUUA 5DI3B 2FEMA 2C77A 2OFOA 2BWJA 3ECCA 2Q3MA 4JL6A 4EJSC 5J4HA 4PHHA 4TTQA 4EPYA 2C03A 2ZE8A 4O3MA 3WHLA 4US2R 3SFZA 1SXJD 2J7KA 4B33A 1UF9A 3KJGA 4C9BA 1XF9A 3OF5A 1IONA 1KSJA 4GP7A 3SJAA 5TY0A 3ZVMA 2IS4A 3OIWA 2AKAB 2F1HA 2G1KA 1COWD 3KFXA 3QXSA 3TNFA 2OILA 5FPKA 4Q66C 1N6KA 4B2IA 1DAHA 1TF2A 2WJYA 1GILA 3KKNA 4P33A 1NVVR 5CLQA 3WHKA 1SVSA 5P21A 4Q4HA 3RS5A 1JPNA 3CRVA 2JLSA 4LBWA 4AG5A 3DMDA 1HE8B 2VF8A 2X77A 4WA7A 5FL3A 3DM9B 3HP1A 1W36D 1P4SA 3SI7A 1OKKA 5LB4A 5FTJA 3D3QA 4GOKA 4OQXA 2QPAA 2QAJA 2XJ4A 4MUAA 1Z22A 4AKIA 3IIMA 1R5OA 5FUVA 2A5FA 2N46A 3A36A 1SXJA 2NZJA 4OBEA 5E7MA 4DLUA 2ZVPX 2QNRA 4MYCA 4BFUA 2WWIA 2OCAA 3LXXA 1JR3D 4AKEA 4BLTA 4PHTA 5J40A 4P4UA 2NO1A 4LHVA 4D0GA 1N25A 4WOPA 3EXAA 4CGZA 1KIMA 3BH7A 4LHYA 3TMKA 3CF0A 2PZEA 3K0SA 3EIQA 3ZZTA 3CPJB 2VP4A 2ZITA 1E3MA 1KSFX 4A0FA 5EP1A 5EP4A 2QMOA 5B2ZA 4Q9IA 3QIAA 3C5CA 1R4AA 4KVGA 1B0UA 5JJKA 1Z6TA 2V8OA 3DO6A 1E69A 2QP3A 1SKYB 2D2EA 3E5HA 1F3OA 1LTQA 3HYRA 4ZPXA 1XTQA 2F7SA 2WMNB 4JLOA 1HQYE 1MRSA 1E2IA 1U8YA 1TADA 1Q1QA 4MKIA 1IHUA 2D74A 1YZNA 2C98A 4Q4LA 4EPTA 2D06A 1PV4A 4XD7D 1Q57A 1S9HA 4NDZA 2BCJQ 1AQUA 5FOUA 5DISB 1TF5A 2ZUBA 3VR3A 2CL6X 4AWXA 5EE9A 4TL9A 1LS1A 4Q02A 1Y63A 2CJWA 4POAA 2I3BA 5BN4A 1WA5A 1LS6A 1XPUA 4ZCLA 421PA 3K0CA 3GJ3A 4AI6A 3TGPA 4G5OA 3W5IA 3CBQA 5F9HA 2IYLD 2ZI6A 3PR1A 4EUNA 5CB6A 1XMJA 2JLVA 4RD1A 4DLTA 1FNMA 4FW9A 2ODBA 3PUVA 4Q7MB 3W34A 4Q21A 2OAP1 1G3UA 1R8QA 2DY1A 4B47A 4FN5A 4BUJA 1G5RA 1XD2A 2NZ8A 2V1XA 1A82A 3IEUA 4CZ2A 2BMEA 1NN1A 3UKDA 1QDEA 1XB2A 4OI2A 3KUDA 5EUMA 3AVXA 4TSFD 5CK4A 1UEIA 3I73A 1DPFA 1YJ5A 5HE9A 3KQUA 1E9FA 4C2TA 3T34A 2XXAA 1FX0B 2DWQA 3T5DA 4OK6A 5TVKA 5DI3A 4RFVA 1ONBA 3W90A 4Q7JB 1KK1A 3D31A 4JLMA 4M1YA 3T61A 5EE0A 4PPFA 2QMHA 1DARA 5HCIA 3QUSA 3RC3A 1NP6A 2GXQA 5TV2A 4ERNA 3GLIB 1NSTA 4EAQA 2QG6A 4GRAA 4G5RA 4NONA 4DCTA 3Q72A 4RZUA 1XD2B 1HT1E 2OHFA 1T0JB 1IQPA 2AXPA 2TMKA 4E09A 2ZSBA 3SZRA 4RKEA 1ANKA 5AK0A 4A82A 2A5YB 4TZ6A 1RIFA 3IUYA 3KXLA 1XPOA 2B92A 1G8GA 2C9OA 2P67A 1GKYA 1DO0A 2BIFA 1J90A 5C18A 2ZRGA 4QL3A 3X1DA 3QXXA 2Q9BA 4B3FX 2ZJYA 1WB9A 1I4LD 4C4PA 5LDDC 1D2NA 2OAQ1 3BBPA 4HUQB 4IJMA 4IVQA 3WRYC 4JLAA 5TB5A 4OI0A 2WJIA 5H70A 1R7RA 1J70A 3K9GA 1UJ2A 1RC8A 2MSEB 3JVUA 2VPPA 5GVRA 3ZIAD 5DYGA 4G5SA 2CCKA 3L8YA 3DKPA 4BFYA 4LYHA 1RW4A 4JT2A 1E2MA 1GL7A 1DAIA 2DYKA 3C8UA 3KFVA 3MAAC 4FMCF 1ZC4A 1GZSA 1NMYA 1GNRA 4QGGA 5F2EA 2GBLC 2ZRAA 3I5XA 1D6JA 1IY0A 1P2VA 4M9SA 4DKXA 1XXHA 5SZKB 4DB4A 2GJ8A 3SNHA 3FKSD 4RCZA 1PVOA 3WXMA 2Z6VA 3LV8A 3RRMA 4JL5A 4JVMA 4KFRA 2ZJ5A 3SFVA 3GLHB 1RVDA 1E1QD 1E9SA 1L7VC 4B34A 3EAQA 2DFLA 1ZYUA 3KL4A 4RD6A 3KQLA 2YNMA 4OHZA 2ORVA 4N0DA 1EXMA 1P9WA 2PL3A 2J0VA 1JALA 4TMZA 1GWNA 3U3OA 2Z43A 5J5CA 1RKBA 1FL9A 1NBMA 3CNOA 2MSDB 2W83A 2WKQA 2CHGA 2ONKA 2PMKA 3BOSA 3LO5A 3WP0A 4BLRA 3GEEA 1EFHA 4PAOA 2ZR7A 5CDFE 1ZRHA 2QPOA 1XD8A 3OAAA 3ICQB 1NF3A 2RGNC 2ATVA 4PSVA 3X1WA 3IEVA 1F2UA 4DCNA 3AVYA 3RRZA 1G7CA 4BEBA 2BBOA 2LKCA 3TIFA 1G5TA 4MDFA 1N6LA 1Z47A 1G5PA 4A6XA 3BS4A 2BM1A 3N5CA 4DEYA 3K09A 4OJQA 1RRGA 3L43A 4ZKEA 4EPWA 4XIGS 4Z1MD 1U81A 1US8B 3D7MA 3B1WA 4S35A 2HF9A 4GMXA 3GLFA 4OHYA 221PA 1S3GA 3VQTA 1DAMA 1OJLA 1R8SA 2GNOA 5GJVC 1E2FA 1QF9A 4ZKDA 1QHHA 1EFUA 1L8QA 1Z2CA 2EFDB 1N3BA 1W1WA 4KXFB 2P6UA 2FEOA 4C0HA 2G6BA 1JJ7A 1NVWQ 5LB2A 3TKLA 3ADCA 1P75A 1E2QA 3L0SA 2HCBA 2GBLA 3AVUA 3FFAA 2EFEB 1N5LA 2ZPTX 4DLSA 3SJZA 1YQTA 4DJTA 4ZDWA 4BLPA 1XCGB 1GL6A 2ZQ5A 4BFSA 1G4AE 1OLOA 1YHNA 3EPLA 1P62B 3DPUA 3GLHA 1AKEA 1T6NA 1G17A 1VMAA 3THWA 1DE0A 3U7HB 1KJYA 1UBCA 1X6VA 2IK8A 2KJQA 1YZUA 4WBSA 5IF9A 1M7HA 4ZIRB 3SU8A 2OXCA 4WW0A 5KYKA 5JS7A 2XB4A 3LNCA 4PXAA 4TLCA 4BECA 2EFCB 3TLXA 3QSYA 1OHHA 2C2HA 5FTMA 5CJPA 4G5QA 1JR3E 2HJVA 4I1OA 5JZVA 4TQUS 3W8NA 3R7WB 1EWRA 3GLGE 5CJ2A 1W44A 5H68A 2O8CA 2D62A 1BO6A 4IW3B 3R20A 2W6JA 4GSYA 3VFDA 2W2TA 2IF0A 3PUWA 5F9FA 1G41A 3N2EA 1G8HA 1U0HC 3H0KA 1H8EA 2YC2C 5DGXA 2FPKA 4RZ3A 5JI2E 5EZ5A 1QHSA 4GPTA 1IAQA 2Q9CA 1DTSA 2PMDA 1NSFA 2REXB 3CZPA 4XVQA 2WJGA 3B78A 2BMDA 2ZRJA 4FINA 2GK7A 3PV0A 5DHFA 4PO8A 5KHOC 2BJVA 1Z2AA 1A5TA 3ZJYA 2QT0A 5FOTA 3DMNA 4A8JB 4QC2A 1G291 4B43A 1AZSC 2QTHA 2CL0X 2PZGA
chains in the Genus database with same CATH superfamily
4L78A 4HPXB 1E1CB 4M4SA 1E2HA 1PYDA 2V7BA 2Q5QA 4PZZA 4ZAZA 1P60A 1Y4AE 5C46F 2QL6A 1AHIA 3COVA 4E5UA 1WF3A 4Y2XA 4RD2A 3DLIA 3KAJA 2D5IA 2FE1A 3PR2B 2ZYHA 3DDHA 1XZCA 5FR1A 4D9BA 1V11B 2CHFA 3E1SA 3H5AA 1AUXA 3HLTA 1DQSA 2BEWA 3QLVC 4MWZA 1TUBA 2ZRKA 4JI5B 3ZE2B 5CDUA 1F1BA 4EHAA 4BU1A 1O96B 2HA2A 2R00A 2WFLB 3MCUA 4GBED 5BN4B 4KI7A 2P9QA 1V1JA 3A4NA 3JVIA 4WLUA 3TLYA 4JZYA 2VDQB 4GI7A 2YKGA 1CCWA 2JFXA 3GZ4A 1G8MA 2BH9A 1CNFA 2WSLA 2ZI9A 2H16A 2E55A 5ALRA 3FWYA 1I3LA 4I50B 4J6EA 4MW7A 3OUZA 4WAUA 5HS4A 4KQXA 5KQLA 4ZC8A 2AEJA 1LZKA 1ORVA 3TVDA 3PTAA 1D0SA 2FMFA 5SY4A 4Q1FA 4KGZA 4Q4JA 3H9CA 1WABA 4JLPA 3HJAA 4R31A 5FRDA 3WQBA 5BSEA 2AN4A 2ABWA 5E9AA 4U7DA 4ADSG 4CIXA 5BVHA 4QUAA 4HAYA 5CP8A 5JFGA 5AJYA 2Y1GA 3ZDYB 3BMNB 2QT9A 1IJEA 3D4IA 1VCOA 1VSQA 2VNIA 1DQYA 1GGFA 1XU4A 1P9OA 4X62B 5KREA 3H5RA 1ZGHA 1CNMA 4HAWA 3THRA 5HKKD 5EL0A 5A03A 1USWA 3DMTC 4TMXA 4L85A 1FTYA 3T4UA 3LU1A 1S96A 2YZ2A 1TW3A 5HFJA 4AG3A 1K08A 1XF1A 1F0KA 3OI7A 4L0QA 3ZS9A 4IFIA 1VLLA 4P81A 4EKEA 4DG5A 3A4YA 4AWAA 3GL9A 3TQSA 1XZBA 4B8ZA 2CNKA 4I9UA 5K0BA 3G2LA 4ZGGA 3MIZA 4QHSA 4WE3A 3KHUA 1IU9A 5TNXA 1U2GC 1O5TA 2MOKA 3DJYA 2YJ4A 2Q0HA 4N3CA 4FFMA 1WZCA 4WBXC 4AJ4A 5FX2A 4A6DA 3JASA 4LYAA 2LCQA 3UC9A 2JZNA 4KBGA 4JBGA 1EM8B 1VE1A 2ZDQA 1WRBA 1BHSA 2W00A 2PJZA 3K16A 5DASA 2RAVA 3K3PA 4GRIA 1G3QA 2NVOA 4GZ6A 2QE7D 3L7JA 1MABB 4L5AA 2HDHA 2WP8J 4A1FA 1YTUA 2P6PA 1EUDB 5K0CA 2I03A 3WIOA 1SMKA 2RKOA 2YVUA 4C7BA 2EGHA 4ENVA 5DHRA 3WNZA 4YIKA 4LC9A 3BSSA 4P54A 2PRKA 2HWXA 4JUBA 1FNNA 5DN6A 1Q0RA 3ASYA 3WGOA 1WM1A 2LVBA 3F2IA 1QQ6A 1XMSA 4NMLA 1E79D 3RFUA 1CUFA 2CB9A 4F9FA 5C8XA 5L3SB 3GRCA 3GGJA 3LO8A 3OQVA 4IHJB 5U4QA 3JYNA 2KM1A 2YV5A 2BJHA 3A6FA 4JASB 5AHKA 3MAGA 4CM9A 4WY8A 1A9YA 2QTRA 3ABZA 4QFCA 4FFPA 4EFMA 3TL2A 4BP9A 2H54A 4FWTA 2EARA 2RH4A 2PEZA 4J0GA 3LHDA 4CMEC 1Y89A 5H82A 3G0HA 3PEVA 4B9AA 1JG1A 2GM5A 3ZCRA 4K6FA 4LSMA 2P4EA 2GVNA 3E22B 3RUHA 1N6NA 1QH8B 1Y3BE 2X9QA 3D2CA 3LH5A 4TS4A 2AZTA 5KDOA 4XWWA 4RTMA 4WLOA 2WT8A 3KWLA 3V1KA 5HKOA 3H13A 4W9MC 4HEA6 1LGYA 2BEKA 3IKTA 3B6MA 3UMRA 4C7JA 4U0JA 2PBFA 1P9NA 3TZKA 1VMDA 1X3SA 4OHKA 4MQFB 4D9IA 3OZCA 1TM2A 2ZB7A 1NXOA 4LIPD 2AJBA 3R6TA 4BQIA 1MR3F 4INAA 4B5KA 3LZCA 1IUPA 3FG9A 4MYDA 1AKWA 4BVGA 4R3UC 3SEQA 3CW2A 2ZUFA 3F6CA 2E4YA 2Y67A 3D6VA 3FJYA 3I76A 4FHFA 1SU4A 3LSYA 3TTYA 3UFXB 3AFGA 4U39A 1ZCJA 3C7AA 2JH9A 1HK7A 4XX0A 2D6FA 5KTPA 3O7WA 1S3IA 3BL6A 2H92A 5IFKA 4R3NA 4ME6A 5IDXA 4WLFA 2UZ1B 1NT2A 3PYMA 3OA0A 1YA4A 1U04A 2PX6A 3HP4A 2RI6A 3R3UA 3RTEA 1EWKA 4ZIRA 3LA6A 3WNBA 4ZTZB 2HTEA 3TQTA 4HUJA 5FBQB 2G25A 1AT1A 1LPNA 2ZJ2A 3KZXA 1WTAA 3PNKA 2GAJA 5J4YA 3DE2X 5T4FA 1KYYA 3K2EA 4QNRA 4PX2A 4UOZA 1BXRB 1TOAA 3CLVA 1XTJA 4WY2A 1MIHA 4AJLA 4CEJA 4TL8A 1GUFA 1LK5A 2DUUA 3V8RA 1H2AS 3HEAA 5DWQA 3CLSD 1MQ8B 1XWWA 3H2YA 3U4AA 4QG3A 1TUEA 5KTRA 3GMDA 5ALOA 3A1NA 3I42A 1ZS9A 4N47A 3TZQA 3UH0A 4DWVA 1CUYA 2IX3A 3STTA 5A5DA 2ATXA 3DAGA 1X7GA 1UXIA 1ADGA 3B52X 4HWKA 3I37X 3L7CA 3MS7A 4RQTA 1E2JA 2E5FA 2XDYA 4LWZA 1UP6A 2VAMA 3B85A 1GLNA 3ZWNA 4AZ0A 5AM5A 1V43A 3O1HB 2IPAB 4ZXPA 2FMUA 5HS6A 3VHQA 4CT0A 2QE6A 5KSWB 4G1BA 3I09A 2OECA 4W7IA 5PGMA 4H2DA 2A5JA 2UUBB 1NBIA 1TYEB 4F60A 1A9ZA 2ONZA 3KR1A 4IMJB 1L5HA 4OLJA 5P8WA 1YZHA 3GLSA 1L8LA 3N0RA 1OX6A 3RSLA 2D7CA 2ZZNA 4OXKA 1KJ9A 1HDYA 4MP6A 5B1SA 2D4AA 1RZUA 2HUPA 1NDUA 3ANMA 5A0TA 1QXSA 5K6AC 1L4FA 4KQ9A 2CKMA 1SXJE 2ZB4A 4ARZA 4UEQA 2DC1A 4BMNA 3UWOA 1E2UA 1ZISA 5AVVA 4X8HA 3MLAA 4DARA 1EK1A 3H99A 2XI4A 2ZE5A 3CE6A 3IP5A 4FTWA 4GI5A 1C80A 2IYEA 1XWIA 4F2WA 3IQZA 3A9RA 4CKWB 1E79A 3U0BA 3DEIA 4KH1A 4M36A 2OZKA 4XYGA 4YROA 3UIEA 1K86A 2I6GA 2H65A 4DG8A 1CB7A 2QVGA 5IUNC 3CVOA 5KPDA 2ZIXA 4PX3A 1GDDA 2YS7A 3PQ8A 5FLEX 3OZGA 2B9EA 2QTNA 1SBQA 3L0DA 4OLHA 4TQAA 4CIAA 1VGQA 2VEOA 2AFVA 3IA2A 4ZVNA 5BYJA 1FX1A 3CPHA 2BI4A 3R5SA 3PR3A 4RPKA 2FW9A 5KYXB 2P9YA 3H2KA 4OOFA 2V6JA 4IV5A 2PKRA 2X1HA 4DOMA 3RK1A 3ORQA 2F43A 3IT1A 4BFCA 1YBHA 2SCUB 1SXPA 2M6KA 2AI1A 1Z63A 1NLMA 2DFPA 4RXTA 4PHFA 4XM1A 1ZN8A 2X7XA 3WJ2A 4I19A 4HGQA 1DT3A 1V25A 1D2EA 4CMIB 4L95C 5AJHA 2OKGA 5K99A 1NJ2A 2DFTA 1U1GA 3LCJA 3UGQA 1C81A 1GQOA 2K2QB 2ZUWA 5FTNA 5H3HA 4BQQA 2XF8A 4JELA 3NDBB 4X1IA 3C8MA 1QBKC 1P1HA 2I62A 2XE6A 3EW7A 3KHSA 1J8DA 1E1QA 4IXMA 4MRNA 4JJ8A 2A30A 5L7YA 1YBMA 5I6DA 1JDBB 1M2JA 5HE8A 1R0XA 2FZEA 4PQEA 4YALA 3RYIA 2P2LA 4HQ0A 4RVFA 1GXSA 4DE5A 3P9KA 2O57A 4MR7B 3MQFA 1OWMA 1L7BA 5ESDA 2ACWA 1ZX1A 4MRSA 3DUFA 5D3KA 1G21A 1X0VA 4AQYB 1QQAA 1FZTA 3JQ7A 1Q95A 2RK4A 4INOA 2JASA 4RZSA 2ORIA 4RJIA 3O74A 4EB8A 3BWCA 3PC4A 3EXEB 1K7CA 3WDLA 1KY5A 3EVDA 4IXWA 4CM9D 3CZMA 1CQJB 1U2PA 3GIDA 5HZKA 2PH3A 3UNXA 3E3MA 3FF4A 2ASEA 4WEQA 1NVBA 2GBIA 4HZUB 2V7PA 4R5MA 4YT5A 3FNFA 4D0RA 3GVIA 4ZAGA 3LOUA 3DP7A 2HA6A 4BNIA 3ZKWB 5JXJA 4MWEA 2YH2A 4RHEA 4CI0B 2I80A 5DNUA 2ACVA 5C7OO 1BE8A 3STVA 4MW6A 3KYCB 5C53B 1EFRD 4XQCA 2JD1A 5HIJA 1GZ5A 3ASZA 4G0QA 5F73A 2CNBA 1PZMA 1T9GS 4ZD6A 3FTCA 2IVFA 4ZOCA 1TEVA 4O33A 1ML3A 3DQPA 1OV4A 3DD1A 1EINA 1ODKA 5AI4A 3BGIA 2JJ1A 4GOJA 2F90A 3C6QA 3O4JA 3VPHA 3F9IA 1RYZA 1KO7A 2ECFA 4PQFA 3V7UA 1IFXA 3MWLA 5ICFA 4GMFA 3FOBA 3GJSA 4B6RA 3GA5A 1DL5A 1MLDA 3OE7D 4EVSA 3TLEA 1REQA 1JBQA 4IILA 3GQVA 2EJCA 2IITA 4GPD1 4HUQA 1TVEA 2PUGA 2PSHA 4I1UA 1T4CB 3LUBA 2GN6A 2NO0A 5F5XA 3S2FA 5B6JA 3WAGA 3JX9A 1NNUA 1KEEA 2O0JA 2G77B 2WG0A 3F96A 3WQRA 4B31A 4ZRMA 3UMCA 4F97A 2SKCA 1R0YA 3HXMA 1T43A 2BSQA 1Y9AA 5EG5A 3ZGNA 1ESNA 4LWPA 1WVGA 3OF2A 3W8DA 4YAIA 5HIKA 3IUSA 1HV8A 2JI7A 4M1WA 4OIFA 2R8XA 1OXUA 4F6RB 1MJGM 1QHXA 3R7SA 5EEHA 4B6FA 4CIYA 4V38A 2N1MA 4L0MA 1OWOA 4B74A 1NKVA 2VLIA 3FWZA 1SVKA 3KTFA 3MQ2A 1KZYC 3ESRA 4LZZA 4PLZA 2D5CA 4KE9A 3MWKA 2QRQA 2DETA 1GRNA 3D59A 3G1WA 4RKWA 1L5ZA 3SXJA 5EMLA 4CF3A 2Y9PB 4AZVA 3BB1A 3GV0A 1TJ4A 2R1TA 4TWIA 5IM4A 2DPXA 4ETWA 4R69A 5KMGB 4LI0A 4BEJA 3CMMA 1R4MB 3T1VA 1Z0JA 3AR9A 4OO3A 3LRTA 2Z2KA 4F3TA 3EWAA 1T4CA 4DUZB 4MUBA 1J06A 1UMKA 1WXWA 2IP1A 4JVNA 4M7OA 4EFLA 4CETA 5HXAA 4G8DA 4QBHA 2GS9A 4G5HA 3BQNB 1XMQB 4GU5A 1NQ5A 2X0KA 3KAQA 4AM8A 1KEKA 4D3DA 3GZNB 1U31A 2XQJA 2R0QC 2HJHA 1H4QA 2BFWA 1USIA 3W0LB 4ARIA 3IE0A 5BWCA 1SCAA 1YQEA 3C3BA 5I7FA 5F3WB 4P5PA 3PKIA 2VCEA 2Z2ZA 1FRVA 1YZQA 2O0HA 1OW3B 2VJNA 3OCYA 4IDOA 5KDLA 3DVAB 5AVZA 5JJ5A 2PV7A 3NASA 4IP0A 4DPMA 4OFZA 2GNAA 1JJAA 1ZVJA 3O38A 1TIBA 3OZAA 3M4NA 4ITRC 4HMQA 1QHIA 2J9FB 2WFAA 3HI6A 2QTAA 3NEJA 1AD2A 4G41A 4IFTA 5EKUA 4H7IA 4YACA 1ISGA 1PG5A 3V2HA 3WTBA 3D2LA 2P78A 4BRSA 1UDRA 4JU8A 4IXNA 4YV2A 2YHIB 2DBQA 2V7EA 3O4IA 2QMQA 1YRHA 4DV3B 1KFEB 4PF1A 5DO9A 2A5DA 5FOWA 4Z4CA 1BIFA 3D7RA 3JQFA 4L72A 2CSXA 4RPCA 3PUIA 4NVRA 3LQ1A 4M0FA 1Z6YA 5NLLA 1GAXA 1PFUA 1ZI9A 1ETUA 5TE9A 5BN1A 1AF7A 1UQTA 2Q27A 4JOCA 4N0MA 2YVQA 4PQYA 4AAYA 4JJGA 4QOSA 2V9CA 2EFHB 3O3CA 3PXUA 3NG1A 5I9SA 1HTWA 1GZDA 2E4VA 2OD9A 1FLVA 3FJOA 3LXUX 1MF7A 5B7GA 5A5FA 1NMZA 3ZCVA 4CF5A 2QL9A 4ZAWA 2Q6TA 3VZSA 2MR6A 3ISJA 4RADA 3SYLA 1FB5A 2CVFA 1KK0A 2HDNB 2CNNA 1TM3E 2B37A 3GLFE 4H4DA 2CVPA 3HWSA 3RQIA 1X92A 2H4YA 2QXUA 2AEMA 1V11A 1U9YA 1V3TA 1WDTA 3TLCA 4EEKA 1XO1A 4N8DA 5IMBA 3R7LA 3N2GB 1R0BA 4J1NA 4V0RA 2ZKLA 4H59A 2AK2A 2X7HA 1OWPA 1Z2DA 5BNIA 1BMTA 3E9YA 2OGUA 2I66A 4IO0A 1WUYA 2O2SA 4GFDA 1Q77A 3LQRA 4J7UA 4RZXA 5B30A 2IOHA 2ZK7A 3PEFA 2BV3A 4RWEA 2JEZA 1V3UA 3FNIA 4FOOA 3RVMA 4D6PA 3FF1A 1KJJA 3COPA 3GNQA 2ZWIA 4R2WA 4D56A 3QVWA 1F2TA 2HV8A 4PR0A 4DR3B 3THYB 2HQOA 2VZEA 1R6VA 3C3JA 4M46A 1MVNA 4Y2HA 3RCBA 1T2AA 2IPNA 3UTCA 4O4HF 3ACBA 1X86B 5T8KA 2C7RA 1LDGA 3BJRA 1U80A 4JH0A 3GMIA 4CW7A 2APJA 1VYVA 1C7RA 4YMIA 1F5SA 1N5RA 3GNLA 2XBLA 1O03A 1E9CA 3PFIA 4P32A 2NUTA 3GUYA 5CK5A 2W2NA 2GCPA 1RHMA 3BGOS 2CDCA 2Y6UA 1RWMA 4JODA 4R81A 1UAGA 1SCDA 3PHCA 2WYOA 2VNAA 3G9QA 1X77A 4N5IX 4RHXA 3T5PA 3BXPA 3IIIA 4CTOA 4WESA 2WU0A 1KFBB 3M6UA 2YMLA 3NQ41 4YCNA 2C3PA 1QK4A 3WDKA 3DHEA 3E03A 4LZNA 4XTRA 4MZDA 4FC7A 1WIWA 3TW0A 5KSZA 1GTRA 3BHNA 1HE4A 2CBGA 3UBTA 4B3CA 3ZTWA 4UTRA 1XMXA 3I8SA 1JSLA 4PE5B 1QV6A 5DGDA 3O5AA 2W5UA 1OH5A 5SICE 1PGQA 3DBRB 1I24A 1Z62A 2D2IA 2XRZA 1O5OA 1A9OA 1W46A 4R8RA 1TAQA 1VGRA 3WGZA 4A2PA 1PWXA 3M4YA 3UKOA 2J5KA 5TF0A 3E23A 4ZYVA 3F3SA 4X3OA 3KTAA 1XZHA 4R0NA 3I9V1 4UASA 5AOVA 1LNZA 3UMFA 2XA1A 2DBVO 2ZEJA 3OPYI 4NYJR 2IELA 3SIXA 1YQGA 9ATCA 3QWBA 4HWOA 2QENA 3DXZA 3OQIB 1KDPA 2G6TA 4URWR 1ZP6A 3CZ5A 2NYVA 2I22A 2EF0A 4IJWA 4EHFA 1J0XO 5C5CA 1F7VA 3RS7A 1URPA 3KZCA 1S3FA 1XI2A 3L7MA 4HTAA 4I3FA 4KLRA 5DEIA 3UATA 1RRPA 1V8PA 1DRUA 3NBAA 1ZK2A 3WKCA 2G8NA 2QRVA 2YXPX 3D0KA 3NJ8A 1HMPA 2FN8A 4OKIA 4QUIA 5DBFA 3SDBA 1TMGE 1DB3A 1QR6A 4IL5A 3T7EA 1QO0A 2W2PA 1YFJA 3DFFA 5HFNA 1SQFA 2QTMA 4GXNA 2IKSA 4KQ1A 3GZTB 3M1YA 2NSHA 3GWZA 3M6MD 4EZBA 3DDSA 5LD2B 2GYYA 4W5QA 4RV9A 3THOA 5FNVF 2WDZA 5GIPE 1ZMXA 5CB8A 4I1IA 3NUQA 4WEOA 2IHYA 4MV5A 2WA2A 3RIGA 1DDIA 3ETGA 3SAJA 5ECWA 3MBOA 2GESA 5DW3A 4JI4B 3NKVA 1JX6A 1CYDA 2IRWA 3KQMA 1M6NA 4HGPA 2HHLA 5JD5A 1TM7E 2XWSA 4M9UA 2P65A 1H65A 2QX8A 1W9MA 1I0ZA 2BL4A 4TROA 1YMVA 2C4VA 2WJHA 3DYBA 1NDQA 2FR8C 2E4XA 3G0OA 2O8BB 2XNDA 1V8BA 1Z4MA 3HH8A 1Q1NA 5BORA 1YS4A 4EKDA 5HDQA 2I4RA 2RH9B 2XNSA 2Q8PA 3B9BA 3FOAA 3T9AA 4CKCB 2E2WA 1GG2A 2OUIA 3NTOA 3MJ4A 1W9HA 1UBUS 1PZNA 4HYTA 2R6HA 4R8KA 4WDRA 3L5OA 5FWAA 1GPH1 1U7XA 1UBNA 1ZJ4A 4RGQA 1YVDA 4NS1A 3TTWA 2VDLB 3L9WA 3ZHYA 4MRVA 5CHEA 1J49A 1DFHA 2J5BA 1W85B 2X9GA 3HL0A 1NUSA 1U5AA 1Y1PA 3M2TA 3BA6A 4RW0A 3L8FA 5CBKA 5TSDA 4U3JB 4J2TA 1R74A 4MW1A 1AKMA 4J94A 3D9QX 2ANCA 5CAEA 3KT0A 2ZI7A 1WHSA 2I6FA 4W5RA 5E1BA 4GKAA 3U3KA 1ZINA 2VTVA 5HF9A 2QTVA 5A5VA 2ZIWB 5J2TB 5AYVA 1MTOA 2VPZA 2A9FA 3QM1A 1MDBA 4J76A 3L82B 3A3PA 1OYVA 1IZ7A 1A96A 2C7PA 4XOIA 1P18A 5SZJA 4JUAA 3RWMB 4R8VA 5BWNA 3LKDA 1SCUA 4TZ0A 1ZU5A 1JHVA 1ULTA 1XJQA 5F1OA 2VXBA 3DSRA 5JSFA 3VNVA 1EP3B 2GWRA 2B0CA 2GF2A 3AEZA 4B35A 4FYYA 3MF4A 4LC0A 4QATA 3PNBA 3QU2A 3PDWA 3RS8A 1DXHA 1H0HA 3GYBA 1DUSA 3P2MA 4E08A 4Q9HA 4PX5A 3A6KA 4O8ZA 4XYBA 2XUKA 3TDNA 1GSIA 1L9XA 3ZN2A 5FWNA 2ZWVA 1PL8A 5L4NA 1OC4A 2PM8A 4GUDA 4K6KA 2PH1A 3GPCA 2FFRA 2NT3A 4P7FA 2KQUA 4Z9BA 1VG0B 2D59A 2W4QA 2ZKIA 3SD7A 3C41J 4LX8A 4E07A 1Z5ZA 1RYHA 1DC4A 1DV1A 2GF0A 2R86A 5FBHA 3HXQA 3BFJA 3QOXA 1T1RA 1NE7A 5DM4A 1BYUA 1N9ZA 1AE1A 1EFVB 2J4CA 3Q88A 1P44A 4A0SA 1SXJC 1YS7A 3G6KA 2DCUA 3ABOB 4R8MA 4CQMB 2HF8A 4EI8A 2WKPA 4BFTA 1E77A 1ISFA 4D80A 5BSWA 1KI6A 2WVJA 2NQTA 1DDGA 2V97A 4ZANA 5I4BA 1N8NA 1OYOA 4MAMA 1G5QA 4AY5A 2IY7A 5L95A 4QARA 2PKQP 4J8PA 4BFLA 1BFUA 4H6PA 2ZPUA 5HCNA 3C24A 2CUKA 1GFZA 3IERA 1VSVA 1OLSA 1LF5A 2IDJA 5D51S 4G23A 2IHJA 3AP1A 2EGUA 1HDXA 1YGPA 1LPOA 4KEAA 3WP1B 5FFFA 4CFYA 2AV6A 1XAJA 3CX3A 3FUTA 5TJHA 1U6IA 3CB4A 3FN4A 3ZWVA 5D3QA 3NH6A 2ZRCA 3A1WA 1SAYA 3OIDA 4QUEA 4JSRA 1ND6A 1S8AA 1DAKA 4DJFC 1E7MA 4AICA 3ELDA 3EPKA 4B4OA 4KGVA 3DCYA 2I54A 2NADA 1UMDA 4D0SA 3BERA 1V1MB 2XKJE 4JITA 3IP1A 2B4AA 4RXUA 3THWB 2C9BA 1T8UA 3JRNA 5CEJA 3H2HA 1O95D 4L74A 1NVKA 3AL3A 1JAIA 2I5PO 3G0BA 3KB1A 3OLQA 4DZTA 1L7OA 2YWXA 2ZXUA 4Q82A 2IBSA 4UM9B 1PUJA 2R9VA 3DAFA 3Q2OA 3A6LA 3TUJC 2H07A 1EWTA 2IQ5A 4WT7A 5AVKA 4U5XA 4DXDA 1BRMA 1L7DA 1LSOA 2GA8A 3F98A 3IR7A 3Q8WA 4RM3A 3KPYA 3U17A 1E2EA 3KDAA 2V1UA 2NU9B 4MAFA 4I55F 4RSMA 1DJLA 4DJJA 2E49A 3EIEA 1JDPA 3IYLW 2XWPA 4NI5A 1OFUA 1OWLA 2C29D 4V3BA 4TUYA 5TRTA 1OU0A 3AERA 1BMFA 2GZMA 1QC5B 4H7DA 4BRUA 3IP9A 2CUZA 4L3VA 1WKBA 2XTNA 3EZ6A 4WCFB 5F51A 4P0QB 4TWAA 1BQEA 2AOTB 2N1BA 3KR9A 5HJ2A 3U4GA 5B7PA 1O8BA 1FTSA 1XTSA 2W22A 1K0FA 1X8KA 4A4DA 3V7FA 4RY9A 2GILA 3TBKA 3KXDA 3CLRC 3NB0A 2H7YA 3PICA 4DIUA 1YZGA 6CHYA 4X8LA 3CONA 2FQYA 2JJ1D 4TM7A 1EFPB 1QE0A 4GWKA 3URKA 2CGEA 1EXVA 3AKCA 2AFRA 1MPXA 3IEXA 4GPZA 1QKJA 1H6CA 2JGDA 5JY1A 3H5TA 3VYVA 4M1QA 1X0XA 3LL4A 1Z88A 1ZXXA 1LU9A 1U9IA 3O0TA 4K1XA 4UHBA 5JWRA 3HU5A 2FW6A 4W1PA 3MJSA 1YDMA 3P0IA 5FUWA 2EQBA 3LKZA 1RFGE 3K9LA 1PKEA 2WWWA 4FHGA 1CUAA 5DX1A 3SQXA 1CUCA 4GP6A 1EBUA 1OLXA 3LUAA 3MS2A 2N47A 2XSZA 4N8SA 4UNSA 1DQRA 4RDHA 1I4DD 4G4SO 1ZK0A 1TB4A 3CLSC 4L50A 3L6OO 3QKUA 4JN6B 6PFKA 2C8VA 2HWUA 1U2TA 4RGVA 1FMCA 5U9CA 3R41A 2CF5A 3HBFA 4KAXA 4LCJA 5DNCA 3R3VA 4HMPA 4YBZA 5AKZA 1D2CA 3V4FA 1PL7A 5FBZA 1ZW1A 2BC9A 4CKBB 2J3LA 4UTNA 2HLDD 3NIDB 2ZTSA 1U3CA 3G88A 4B2YA 3E8XA 3OZSA 4BZWA 1B15A 4ZOEA 3KR0A 3ABRB 1JQBA 1TQ6A 4FEYA 4S0ZA 5A2QA 3ZQ4A 3SWWA 5CDTA 4TT8A 1D2AA 3HBNA 4I4LA 2JVKA 4ND3A 4FKMA 4OF4A 1PZFA 4RE5A 5FP0A 3SBEA 4OHWA 1KDYA 5DNYB 4O5OA 4Z4QA 1JGTA 1ONSA 3LLVA 2HBYA 5AKJA 5HOQA 5JJIA 3PDIA 5ELMA 3MOIA 4HTFB 2C4HA 3OFKA 3TUIC 1E2GA 3TAUA 4M49A 3EG9B 3PFKA 3DG9A 4P3XA 5C34B 5KOYA 1S1CA 3K9BA 1CY1A 5DH9A 3ZWCA 1DAGA 4JSYA 2PLNA 5C0OE 2G4VA 4GZ5A 1Z06A 3S1SA 1SUSA 2XYQA 1N1DA 3ML1A 4KQJA 3TPFA 4AWBA 2C2WA 1DBSA 3L2OB 3N2ZB 2VJMA 6GPBA 4RANA 4F3NA 2WIAA 1JI3A 3UJDA 3TWOA 3VKGA 3HBMA 5I5EA 2QSJA 2FG7C 2EEZA 1AQ6A 2QG4A 4DR5B 4B0OA 1YL5A 2NVBA 4EEZA 4ND8B 3OLWA 5DLDA 1Z45A 4U7TB 3NDIA 1JE1A 1I1OA 4HEA1 3H2BA 3WOHA 4KXVA 2J3MA 3CNHA 2AUTA 1GP2A 4B83A 2GD6A 1U90A 4HT3B 5AESA 1P1RA 4HWRA 3LDAA 1YBVA 4QGHA 1NXPA 2HZBA 1T4BA 2YXNA 3AJAA 4MV4A 5ALLA 5E7JA 4BTVA 3TLMA 4TKVB 1IEXA 1KVUA 4RY8A 3X2FA 5LD2C 4NYIQ 2EJVA 4JGGA 2JFGA 3W6ZA 1ZOSA 1KJ8A 3RUEA 5EJ6A 5LOVF 4C22A 1C30B 4E4RA 3PQ4A 4DCCA 5A3RA 2J3HA 1RCTE 4FEEA 2POQX 3PLRA 5K8IA 2JIOA 3OUUA 1XV5A 4RPLA 4WCDA 1R0SA 4MITA 4CDRA 3HA7A 1P7YA 4IUDS 1UMDB 5FI1B 1HNNA 1GU7A 2EQAA 1B2RA 1X7ZA 4BBJA 3NHKA 5IWAB 2JGAA 2RHDA 3RW9A 1K3UB 4HV4A 2QRKA 2G88A 3EXFA 3KUKA 5EAIA 4P4SB 1CQJA 3B9PA 3CWQA 3W8RA 2P5TB 3OU7A 4BJHB 1GTSA 1WOYA 3VZDA 1HDGO 2O2YA 1T1JA 5FWDA 1Z07A 2L82A 2P1RA 2XE7A 2K6GA 3LC0A 1Y8RA 4MUEA 3IL2A 1IG3A 4LYDA 4RVNA 4TV9F 5BMVA 2QM3A 3BK7A 1TIKA 3ELBA 3HCBA 1B93A 1WS6A 4QQFA 5GAJA 4A2CA 4D4KA 2JVIA 1QAQA 1QSGA 5K0SA 1O0BA 2FPSA 3VAAA 3DDWA 3ETDA 4LJ6A 4R05A 9LDBA 3TH5A 1HSZA 2PHZA 4C04A 1S9DA 1KI6B 1HWYA 1NJ1A 1L5VA 3QKWA 4PTLA 2XGGA 1WHTA 1ADFA 3E8MA 2IOFK 1OT5A 2XEXA 1AB5A 1Z35A 4B6GA 2GHIA 4CCWA 2ZUTA 1D9ZA 3SHOA 4BNLA 2O8CB 3ETJA 1S7GA 4IO1A 5J4VA 2FWMX 2PUFA 1MRZA 4FFBB 3OMXA 1FP4A 3A10A 1XMVA 1NNI1 3QUTA 4HATA 4XR9A 2H63A 3EMDA 5THKA 3LBIA 1CRQA 4OFBA 2BYTA 3EXHC 3LY9A 3GGGA 3K6SB 2ZZKA 3ET4A 4NDAA 1TMKA 4WGGA 3RK0A 2PR7A 3VPGA 1YB2A 5C3MA 3UWSA 3O93A 4XVHA 2JDIA 5L40A 2O2HA 2NX2A 4LHEA 3TIVA 4OP2A 2OPBA 4ZQCB 2GEKA 3NYWA 4EG6A 1NMQA 3EA0A 2J6BA 3I0NA 5CVDA 3U4MA 3O0DA 1B8VA 2RGEA 2W6JD 4C0KA 4OHUA 3OZVA 1W5EA 1FLAA 3GUVA 3HB0A 1GL9B 1JE0A 3KDSE 4DSOA 1I10A 1V48A 1XKXA 4DVGA 1Z8NA 3PJDA 3W5HA 3EVAA 5DEOA 3FNQA 1DEHA 3ZGLA 3FRJA 2E4ZA 4AY4A 4DIMA 1LPMA 5E95A 2P27A 4TLLB 5ALVA 3PQ2A 5JHGB 2JDID 3I30X 4GZ3A 1Y3AA 4N3GA 1C4WA 4BVKA 1VLHA 1BYIA 1KYVA 2OXIA 2A9RA 2VFAA 4KSBA 1CFZA 4L75A 4KIGA 5AVYA 3U19A 1SVWA 3OM1A 1X1TA 2CXUA 5LP6C 2G09A 4UCQA 2WHEA 4LJ7A 4Y2QA 4P6VF 3I34X 4OLAA 2FPLA 3MYRA 5AI9A 1H9AA 2IHTA 1OXXK 2PKWA 2H5EA 4ZREA 3LG2A 1SUFA 3WGHA 3NIWA 3RVPA 1XNQB 2AT1A 2NLOA 2CXHA 3B82A 3E35A 5GONF 3K70D 2L19A 4OJNA 5C1IA 5LA6F 3BGWA 5KBYA 2GUGA 2JFNA 3K2QA 1R8YA 1XRRA 2YZGA 3CZQA 3O8BA 1TK2A 4LKRA 5EE1A 1C8BA 2Q4OA 3AQIA 2VTKA 3W9BA 3OOSA 1K97A 3K73O 4PM4A 4B6OA 4H18A 2AN1A 4QHYA 3HWWA 4WASA 3U44A 5EXPA 3KSMA 3LW7A 4BFWA 1EVQA 1YJBA 3ROMA 2G7ZA 4W6QA 2ZRIA 3FCXA 1H6AA 3S8MA 3JZIA 2BFAA 3DE5X 4MR7A 1H23A 2HM7A 4JKOA 2O2IA 4YRKA 1L4GA 1VKZA 1ZUNB 3GD7A 4U8GA 4UJ5A 5IH7A 3W4JA 3NIFB 4BB6A 2VWGA 3SM3A 2XDQA 5E4YA 3UT0A 1NW6A 4C0LA 1ZJJA 3HJCA 3TIXB 4HWTA 1NOKA 1FUIA 2RGYA 2IF2A 1G64A 3MLEA 4FPXA 3ER8A 1G8FA 3P4XA 4MI6A 2IUSA 5J47A 5IASA 3DBLA 3QBTA 3U7IA 1SXQA 1OFIA 2J3KA 1W36C 1JYEA 3A2LA 2BFOA 4MUXA 1MAHA 2GLTA 2JATA 2C1EA 4FUTA 5BV1A 2RGGA 4HK4A 5DP1A 3KJIA 4X6XA 4MQ6A 3UENA 2VQDA 2QR2A 1R9MA 3GFRA 1FPQA 3K8OE 4CMGA 1P5RA 3LUGA 1YZ3A 4KX5A 1YR7A 4IHJF 2ZIEA 2E4UA 5AVXA 4MS4B 5L53A 1H22A 1YOBA 3HB7A 4MVJD 1RZVA 4NYMQ 3MC1A 4JI6B 1IEQA 2PT6A 1E0KA 1Z0FA 3UO8B 4HTFA 3I9JA 3JRXA 2AOVA 5DXJA 3U4HA 2SECE 3NI2A 3KQHA 4K9NA 2NNLD 4W5WA 4MIOA 2O5RA 3M34A 1XIVA 2NZWA 5U4XA 1Y9DA 3DLAA 2OCLA 1N3YA 3UAZA 4Q4AA 1KBOA 2WTNA 3S2EA 3SZ3A 3NKLA 4EA7A 3LZDA 3BPSA 3FWNA 3IQEA 3QHQA 5ICEA 5JUWA 2B3TA 5KCZA 2G04A 2XYVA 3GZJA 3UCEA 4M8IA 1JG6A 3HKBB 4QPPA 4ZICA 4MUKA 1BKDR 1KSGA 1SH7A 1ZD9A 4JVSB 3HJTA 4QO7A 1C1YA 2IW3A 2YWJA 1J1IA 1FP4B 1PNOA 1TU4A 1ZKDA 4TTTS 4AD8A 4OQDA 3TLGB 5JWOA 1AKQA 1ICIA 1J24A 3C16C 3ETCA 4BGVA 1B73A 2JJ2A 2GBFA 4OMUA 4EMSA 1SRRA 2GK3A 1UDAA 1OLXB 1A8UA 3ZGOA 2A9JA 1IE3A 1Z6GA 1KO1A 4KITB 1BDJA 1VG1A 3GEIA 4C2BA 4S05A 2I76A 1EU1A 2HGZA 3IJPA 1OB5A 5FA6A 2X42A 5BNWA 5JQWA 2ZYVX 1TKBA 4PG5A 2QW1A 3I6ZA 4KVFA 1OUMA 3D6NB 4PPNA 4DLYA 5ALQA 1O4WA 2ZLBA 3BD7A 3TS1A 2QJTA 4GC9A 4R1SA 1MAAA 1V7ZA 2VHCA 1EZ1A 3K20A 2AL7A 3W79A 1M2GA 3NEYA 4Z1MA 1RE0A 3IUNA 4JZKA 1OTXA 2NYRA 2Q6VA 3GX1A 2BFEA 4P35A 3SOPA 1F0YA 1SNYA 3I92A 4Q7EA 3A31A 4LDPA 4WD3A 4WGFA 4XEUA 2XUOA 5E0KB 2YIVX 3U1TA 2BN4A 3AFMA 3T7KA 5TMBA 4ATNA 1Q3KA 3DBRA 1AZWA 4BL5A 2OHGA 3G5LA 1JEYB 4QVKA 3RG2A 3LX8A 1BQ4A 4QLAA 2JFQA 1FU8A 1ZD8A 4PIMA 3RVBA 4P22A 3EG9A 4Q48A 1M2OA 4QTUB 2JJMA 3LYUA 3WYEA 4TT3D 1NMXA 1FW6A 1RLJA 4Q9KA 4RTNA 1P4GA 4KLAA 3ROPA 1P39A 4R7GA 4UE2A 4F45A 5C80A 3VZPA 4CDNA 2L0XA 2DXIA 4M6WA 3CR8A 1T0PA 4WZAA 4F46A 2O8BA 3WL4A 3WB9A 4QXAA 1M1YB 4HQ6A 1I7PA 4DTCA 1Z7GA 5DF1A 2C5SA 4ZGBA 1LZLA 1Z4LA 2XB6A 3DW3X 3EA5A 3IV7A 4PQRA 2GPYA 4YRPA 2WSSD 4MRMB 2HFJA 4RVOA 1MORA 1TECE 3Q3EA 4JSTA 4EBFA 5K8JB 3BREA 1YJ8A 2WF9A 2GN9A 2NU7A 5JCOC 2Z4RA 1SBTA 1DRJA 3DNMA 1XZNA 1ZNZA 2HI0A 1G6HA 1XZIA 3F8SA 4G0PA 4LJLA 3VMFA 3ZU6A 1OFTA 4QLBA 1OZFA 4UBIA 1WB5A 2JI6A 4X1KB 3VOSA 1U1CA 4HVAA 3HA5A 5F4BA 4KX3A 4BNGA 2GZSA 2HSJA 2Q1WA 4MW9A 2VSNA 1GUAA 3VZQA 3ESXA 3L40A 3NC4A 4JJEA 5BVHB 4V02A 1UOQA 3LOQA 4TOIA 1JN0A 4HVCA 1UBKS 3OT1A 1MQAA 1L5QA 1QJ4A 3DXFA 4KQWA 4N3BA 5A4DA 2XDWA 3GFQA 4LRWA 2J0UB 1HL7A 2ZAMA 1R6AA 1BJRE