3FMFA

Crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
229
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dethiobiotin synthetase
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 73
structure length 229
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmfA00
1N6PA 4JVNA 3B5JA 4RD3A 1QG4A 2W83A 4BGDA 3EPHA 2AKYA 4FN5A 4NP6A 3THWB 5JWHA 4A36A 3VTKA 2QPOA 2VP6A 2JLVA 2ZUBA 3QEJA 2BIFA 3U60B 2RAPA 1EX6A 2JAQA 4BFZA 5EXTA 1QZXA 1NMXA 2MSCB 3SHWA 1E2HA 2JIZD 4JBYA 1T3LA 1VCMA 1XD9A 1H8ED 4Q03A 4HZIA 1ZC3A 1XFAA 1Z2AA 2WOOA 5SZHB 5BXQC 3T61A 1DAHA 4Q48A 1NVVR 5H70A 4PAOA 3T1OA 3SQWA 2ZYUX 1K5DA 3V4RA 5TXGA 5BW8A 5GJVC 1FPMA 3QXJA 1N6OA 4GOKA 421PA 3CZQA 5EP3A 4M1YA 2Z0MA 1RC8A 1ESNA 4JMPA 1E2IA 4LJ7A 3OIUA 3W8NA 2CVFA 3NH6A 4ZCLA 1D2MA 3K8YA 3O47A 4PZZA 2QUZA 4UNNA 1ONBA 4DLVA 1NVWQ 3CM0A 3SDZA 1HV8A 4BFUA 2RGNC 4TYPA 4LV5B 4M53A 3SNHA 1CKEA 3OFND 2J0QA 2UVQA 1QHIA 4YMUA 3OEHD 2NIPA 1G3QA 5G3ZA 4MKFA 5EE3A 4QKQA 1OXSC 1GKUB 1F3OA 2ZUDA 1SHKA 1G21E 3FYHA 2ZE7A 2NO9A 4QRHA 1KZGB 1ZINA 4PHGA 4TL7A 4HUTA 1XMSA 4H1UA 2DBYA 3FHOA 2GILA 2CLDX 4KI0A 5AUOB 2VIIA 2EWWA 3NC0C 4LRWA 1E9SA 4BWYA 3V00A 3I73A 2V8OA 5A4JA 2IYUA 1Z0IA 4JLNA 4FWTA 5CB8A 5JJLA 2QE7D 3B1XA 4PSVA 4YONB 1QHHB 3LVQE 1KY2A 4O2LA 3B1VA 3GJ6A 4QM7A 1NN3A 3HR7A 1CULC 2WWGA 2AKAB 2ZJAA 3KTAA 3VU9B 3BD9A 4UJ5A 1VDZA 5KU1A 1Z47A 2I4IA 2RGAA 1VCNA 3CF6R 3NWJA 3BERA 4D6PA 3LFUA 5B2ZA 1Q20A 3PUYA 3QENA 1MRSA 4L9WA 1AKYA 2H8KA 3THXA 3AVUA 4PPGA 1XD2A 1H65A 3NEYA 2NG1A 3TH5A 4XWAA 1CJUC 1SULA 1UM8A 1GOTA 2CCGA 3ZJYA 2VA8A 4NPHA 2OE2A 3AVOA 4DBLC 2CBZA 1XTRA 3AVVA 1Z0JA 4UNSA 4DSTA 2V7QA 3EG5A 2VSFA 4B2LA 4X8HA 1DO0A 1G3UA 1KSJA 2ERYA 2J0UB 1SHZA 5KDLA 4ZKDA 4KO8A 1GP2A 1ZNWA 3FVQA 1P9RA 1KK1A 1QRAA 1LFDB 1XTKA 2WZQA 1TPZA 2DFLA 4MYUA 3UPUA 1DTSA 3VKHA 1TL7C 1TEXA 4IDQA 2G1JA 2FV8A 3RWOA 3PQCA 4DLUA 1TF5A 2O8DA 5G3YA 1G64A 2VHUA 2JATA 2AWNA 3K53A 3NTUA 2HCBA 4WXRA 1L2TA 4JLBA 1XX6A 3L8ZA 1GITA 2P5SA 3OAAD 1T4GA 4IOJA 5JRJA 4M1SA 4YQFA 3WRXC 4RD1A 2VP9A 4RZ3A 3ADDA 3GJXC 4C0AC 1CBUA 3RAPR 3DVLA 3KQKA 2ZS7A 2IS1A 1RPZA 1H8HA 4W5WA 3GLGE 1X86B 3P27A 1QBKC 3GLHA 1SVWA 2BDTA 4KLZA 5FOWA 4QNMA 4JVLA 1Z0KA 4EKDA 4QJ5A 4A9AA 4C0BA 1G3MA 1G20E 4AKEA 4OKSA 1KJZA 3GJ3A 2DFTA 3ZIAA 4A6XA 3R9IA 3Q72A 4LUCA 4Q4AA 2IUUA 3W6PA 3R7WA 1ZUIA 3LW8A 4DDVA 2XAUA 3QXCA 4IW3B 3EARA 1Z07A 2ZRKA 4S35A 3AQ4A 5KNDA 3K0FB 5C2JB 4Y0VA 5H68A 2AL7A 2RGDA 1JAIA 2IK8A 3U5ZB 3LWNA 1TQDA 3W3AA 5DN6A 1JPNA 3NHAA 3EC1A 2RH5A 1NN0A 4GBMA 2FPKA 1XP8A 4RD2A 2PCJA 3WMFA 2R6GA 2H1LA 4LHXA 4K46A 5E7JA 1VPLA 5FFMA 5K8LA 5GJCA 4B34A 1EGAA 3C16C 4LJ5A 3BE4A 5EE1A 2FFAA 2W2VA 3ZQ6A 1OH6A 2IS2A 4HUQB 1GRNA 1R5BA 1OB2A 3ZVRA 4ZI2A 1OJLA 1VIYA 1DAMA 3A4NA 1XNJA 4Q9HA 5KPDA 5C18A 4BPBA 2XZOA 3LX8A 3NG1A 2QI9C 1JQJC 2N42A 2FGKA 2CL6X 4JJZA 3U7EB 3TUIC 2ZE5A 3BWDD 4L9SA 4OQLA 2REXB 1Z6YA 2OCBA 1AGRA 1G5PA 5JI2E 2ZI6A 5JHGB 1RW4A 4HATA 4RVCA 2QENA 1F2UB 4N1AA 4M1MA 5J4HA 1GWNA 3VX3A 3GLFA 2QT0A 5H8WA 2J7PA 4OYHA 4QGGA 2D2EA 1I4TD 2PLFA 4MDFA 1R5OA 4URWR 3JZMA 2R8RA 1D6JA 3L0SA 4QHSA 4XJXA 4US0R 4IXMA 5KSYA 3DKPA 3C15C 2H7VA 3UIEA 4X8OA 4MGKR 2R6CA 2IEZA 1TQ2A 1CEEA 1AIPA 1W36C 2EYQA 2WTUA 4B48A 5L3SB 2FA9A 2IBMA 4EPXA 5AUPB 2SHKA 3CRW1 1Z0FA 4TSFA 4AY2A 2MMGA 1NIJA 4OHZA 1AM4D 5IK2D 1KI4A 3DM5A 4Q9KA 1P72A 2ZM5A 1OH5A 4R71A 5AJYA 2FEMA 2DHRA 4Q4HB 3CF2A 1EFRA 1W48A 1UDWA 1LF5A 1SXJA 5E7IA 2A7QA 1WF3A 4FMDB 4R2IA 3RDPA 2AN9A 4LOAA 2QZ4A 2Z4RA 3HU1A 3SJCA 1FMJA 5D3MA 1G8YA 1VMAA 3N5CA 1U8ZA 1ZNXA 4LGMA 5LB4A 1FW6A 4XWKA 2PT5A 3EZ2A 4HAVA 2HYDA 2O8FB 2H17A 4JSTA 2IL1A 2OAQ1 1DOAA 2LCFA 3M1IA 3R8FA 1P2VA 4LBVA 2WBLC 1XMJA 5EXXA 5TV2A 4DEYA 4AURA 1KI7A 2Q3FA 2NO0A 4PQRA 3S1AB 1XBTA 4B3GA 3VHXA 2QP9X 2JLXA 3KFXA 4NBSA 3GLIA 5JZVA 5JCZA 4U02A 3QQ5A 3SBEA 1Z28A 4LHYA 2O5VA 3DOEA 1SXJE 2GBLA 3NBYC 1KAGA 4ZIRB 1FOEB 4ZCIA 1US8B 1A5TA 2C78A 1OB5A 2R2AA 3CX6A 1ZIOA 2QSYA 4HAUA 3QG5A 4KHZA 2ORIA 2C04A 1BOFA 4KFTA 3RNLA 1E9DA 4YXWA 4WZAE 1UDXA 1SVLA 5JEEA 4PC2A 4WXPA 1CRPA 2QORA 1C9KA 2JJ2A 2ZR9A 4BZQA 1WBDA 4L4UA 3W5IA 2NZJA 1J8MF 4WA7A 1W44A 1DELA 2DB3A 2YWHA 4ZDIA 1E6CA 2HUPA 4AKGA 1G8PA 2V7QD 3ZVLA 4TZ0A 4JVSB 4QFMA 4B47A 4EPTA 3FPAA 3GJ5A 4HLUA 3NC1C 3K0AB 3QPUA 1GUAA 4I1VA 2VP4A 2WJJA 3GLIE 1OIWA 5JBQA 4Q1FA 4A0FA 2DFKB 2ZQ5A 1W36D 3J81k 4DSOA 1UEJA 5KUTA 4Z51A 5J4LA 1OKKA 3UMRA 2ZYVX 1XMVA 2LKDA 5L3QB 3A6PC 4PHHA 3CNOA 1Q1BA 2QSZA 2GWHA 4P4UA 3GPLA 2VPPA 3M6AA 1VCOA 4DZZA 1D2NA 1EFTA 2VP2A 2IT1A 2V1XA 2Z4SA 1WP9A 4LYJA 5AJWA 5SZKB 1Z63A 1E9EA 1KK3A 3E5HA 3I32A 4XSHA 4QOSA 2J9RA 2TMKA 1WB9A 1UPTA 2CLSA 2W0SA 3FFBA 4Q1AA 5E7MA 1SKYB 2RGGA 3WNDA 4TTQA 1TX4B 4URVR 2GAOA 1E0SA 4B3BA 1H8HD 1GM5A 1SVKA 4IOLA 2ZUCA 3MJRA 3MFYA 3REGA 2G0TA 5EUMA 4KFSA 3QXHA 4ZPXA 4PQYA 2RMKA 1UBEA 2YNMA 3ICEA 1XEXB 2BV3A 4B2IA 2ZJOA 3QJYA 3X1DA 2ASEA 3OE7D 1XZPA 4FMBB 2IYXA 1W2GA 3B82A 1WA5A 4TMVA 2BEKA 2FZLA 3IKJA 4X8LA 3I62A 4FMCB 2YHSA 4QBIA 1CJVC 2ORWA 1KO8A 2WWIA 4IOMA 2AFIE 2JJ1A 3AKCA 5EE9A 3FKSA 2ZYWX 2C9OA 3LVRE 4CW7A 4HB3A 4NDZA 4B75A 2DYKA 1H8EA 2GJAA 3IO5A 3EPJA 4MYHA 1EWRA 1KGDA 5DN6D 1GNQA 4V02A 4POAA 1IY1A 3P4YA 2VO1A 5JCPA 3MWJA 3P32A 1MKYA 4TLDA 4DT1B 3GP8A 5FPYA 1NKSA 4ESVA 2ZRAA 1KI2A 2XNSA 3ZZ0A 1P6XA 1XXHA 2F3RA 2GRJA 4B35A 3EWSA 2ZR7A 1NF3A 2XITA 1KO7A 1OT3A 2DY1A 4II7A 1P75A 5FOSA 4JLVA 4DCNA 4C0LA 4YC7A 2AXNA 3OIVA 2N46A 3ONWA 2HJVA 2GK7A 1P3JA 1PJRA 1VHLA 2GBLC 4G1UC 1M8PA 5KPJA 1YZUA 4B6FA 5L8VA 3A1TA 4FW9A 1XCMA 2O52A 2CDNA 5AUQA 4BQSA 3CKLA 4J0QA 1CR0A 4PC1A 1KI6B 1VECA 2WKPA 1NMZA 3CO5A 2IYWA 4LI0A 3TR0A 1OXTA 3QBTA 4R9UC 4DLRA 2FMXA 3QSYA 2R44A 2F55A 2J7PD 3B13B 4JZKA 3L0IB 4IEIA 3SJBA 2FH5B 1PLKA 3DKVA 3MD0A 5EP2A 2QP3A 2JEOA 1XXHE 4PX9A 1G41A 4IOKA 2WJIA 1XEFA 5GJWC 4MGIR 3OZXA 1C1YA 3IBYA 3W6NA 3B60A 5EQTA 4K81B 4A2PA 1QHNA 3THWA 4Q02A 2QE7A 1EG7A 3BFKA 1WMSA 1Z22A 3RHFA 4PTLA 3KX2A 3ZH9B 4GRAA 4TL8A 2GCOB 2QT1A 3SJZA 4QC2A 4JBXA 4TSFD 2FN4A 3AVWA 3T1TA 5DHFA 4LWZA 1IM2A 1DG1G 1P2UA 1LB1B 1ZC4A 3IO3A 2PJRA 4MRVA 4Q1CA 3ZGXA 1N0UA 1EFRD 1E9CA 2D3WA 4LYHA 4WW0A 3IPYA 5CITA 5LDDC 5D3QA 1I4LD 3HP1A 3DHWC 3RS2A 5EE5B 4ACAA 4TYYA 1CTQA 1M7BA 2DWQA 4M9XA 1LW7A 2B8WA 5TARA 4F91B 3NDPA 4UKDA 3THYB 2CEAA 2OO7A 4LC1A 3HPQA 2D4HA 1GL7A 2OCYC 4XH9B 3RS5A 4A92A 2ZRBA 4RD0A 5SZIA 3ZLJA 3K0SA 4B3CA 4JLOA 4OQXA 3Q7QA 1W2HA 4KVAA 1V5WA 4ZV4A 5B64A 4BZPA 3RYTC 2QPTA 2A5JA 3B1YA 5KDDA 2FEOA 2CE2X 2C5LA 1CJMA 3H0KA 1S0UA 2UZIR 2XNDD 3C5CA 2V9PA 1J2JA 3BRWD 2ZS9A 4DWJA 2VL7A 2CHQA 1SVMA 4NYIQ 2A3RA 1X1SA 2ZYTX 2XJ9A 2OT3B 1NVXQ 2ZS8A 1ZM2A 4RD6A 3Q9LA 1NP6A 1Z0AA 3IIKA 3T06B 3TQFA 4NCHA 3OAAA 3P26A 4HAWA 3CPJB 3AKYA 3V9PA 5AJZA 4KYUA 4G3XA 3SBDA 2C98A 4OBEA 4YXWD 2XGJA 3B6EA 1NNEA 4Q66C 1U8YA 2RHDA 3QG1A 1AGPA 2WJVA 1QHHA 2ECKA 1FTSA 2JJ2D 2GZAA 4I1UA 3PIRA 2GEVA 3KKQA 1FNNA 3L0OA 3T1VA 4QL3A 3VU9A 3TSOA 3A1SA 2BJWA 1KK2A 4Q47A 1KMHB 1D2EA 4PQFA 3VAAA 4Q19A 1YZKA 2BM1A 2KSQA 1N5KA 1HE8B 1YE8A 1DAFA 1FP6A 4URZR 1DG3A 3ZD7A 1G7SA 1AKEA 3H1TA 3U44B 4TZ6A 4B76A 5J47A 4LBZA 5JHHB 3R9XA 2HJGA 1OKKD 3ZVNA 3VR5A 2P67A 2WJHA 1R8QA 3QNUA 3FMIA 2ONKA 4Q21A 2IW3A 2NOAA 4WOPA 4GP6A 4Q4JB 2XB2A 1S9HA 2IF2A 2J0UA 1HYQA 2ZRIA 2KE5A 1WE2A 2C96A 3ZDQA 1AS0A 1N0WA 1BYUA 4W7SA 2EVWX 1NKTA 3ASYA 4OK3A 2Q9AA 2ZI4A 5CK4A 3TW4A 3DZ8A 3Q5DA 1P9NA 1IN6A 4NYJQ 4Q5IA 5F9HA 5GJBA 4P3YA 2ZR0A 1XRJA 4TMKA 3RC3A 5BYKA 1MO4A 4TQ9A 2GTPA 1UAAA 4FI3C 2QEQA 3CPHA 2OV2A 2WV9A 3AP3A 4C9BA 1UKEA 3KJIA 1U0JA 4KAXA 1KNXA 1IOZA 3FTQA 4JLJA 2G77B 3GCGA 1J8YF 2ZSEA 3EZ9A 2YVUA 1R0ZA 2JLSA 5J4VA 4O2RA 2PL3A 1Z83A 1QVRA 4NYMQ 3JZAA 3B7GA 1JXMA 2JJ1D 2JCSA 3LQQA 3FKSD 1D5CA 2OM2A 3LLUA 4NMMA 1U8AA 3KXIA 1XDBA 4D0LB 1E9FA 1I4DD 2XB4A 4XD7D 1LS1A 2QNRA 4F4IA 4HEJA 5JSZB 1YR6A 2CHVA 2O0HA 2OCAA 4NCJA 2IXGA 2WJGA 2Q6TA 4CDGA 1KDPA 3SS8A 4S2EA 1L7VC 4NYIR 4AWXA 4DCUA 1T91A 4DVGA 1YZQA 1KIMA 2PJZA 2WWFA 1QHGA 2OBLA 4MA4A 4JLMA 2CLCX 1TTTA 1JAHA 3QEOA 5J5CA 3A4MA 4FXPA 2PMKA 2X2EA 2FSGA 1VTKA 2BMDA 3K0FA 5IK2A 1MRNA 3KJEA 2L0XA 1TF2A 5DIFA 1VG1A 3X1YA 1PUIA 2J41A 1KYIA 3BK7A 3FHCB 3UG6A 1KKMA 4URYR 4PC6A 1Q44A 2ZPTX 1JI0A 3NIBA 4P31A 1P2TA 4AYTA 5LPNA 2BBWA 5FOTA 1ZM3A 4E09A 1XTQA 4BEJA 2Q21A 3B1WA 3NVAA 1R0WA 5IRCD 2J7KA 5KNBA 3PENA 4WAUA 2O8BB 1Q1QA 1ZAKA 3QE0A 4HUQA 4TYNA 2AFHE 2YWEA 4G5QA 2OEPA 1YZNA 2WIBA 4CYMA 2FSIA 2AXPA 4QGAA 4CRWB 1N3BA 4DC9A 3RC8A 1EFHA 1Q1ZA 2XX3A 1OSNA 1OXUA 4ABYA 4TMWA 3QF4B 1UKYA 1P5ZB 4LPSA 1OPXA 3T5DA 5CLLA 1VYUA 1XB2A 2QY9A 2QL6A 4RJLA 4PC7A 2DWOA 4EPWA 1G4UR 1G6HA 5EE0A 2IWRA 2QMEA 3AH8A 1IN4A 5JFGA 2QTVB 1RJ9B 1F2UA 5TB5A 3FKQA 3IILA 1NN5A 2IS4A 2G0NA 1EFUA 1E94E 2H57A 3G82C 4UXHA 3LAWA 5CM8B 4W9MC 4C2UA 1GKIA 4KBFA 1YRBA 3B2EA 4EFMA 3ZD6A 3O8BA 2H16A 2ZRMA 2OCPA 2D7DA 1RRPA 2EFDB 4GMXA 4OHVA 2Q0HA 5B58C 4IVQA 1P60A 2IYYA 1NVUQ 2CCJA 2QMUA 2QRNA 5L3SA 3CH4B 2EFHB 4MITA 4Z54A 2JJ8A 1S9DA 4FIDA 1UBFA 3TSWA 1A82A 3T35A 1LF0A 3JVVA 4TT3A 4AKHA 4GT1A 4F4JA 1UF9A 1RVDA 4HLDA 4PR0A 5JWOA 1II9A 1MO6A 2A5DA 4Q4HA 3RLFA 4MGZR 4JVMA 1ZD8A 1F2TB 4FCWA 2G1KA 1E2PA 4JKIA 1E1RA 3TUZC 2P6UA 3A37A 1CU1A 4Q9JA 3KJGA 5HE9A 3D8BA 3CBQA 4IEEA 3VNUA 4PPFA 2ATXA 5GVRA 5JS8A 4XVUA 4DLWA 1AA9A 1ZBDA 2HXYA 2J1LA 4QNRA 4A82A 1G7RA 3MG9A 5AWFC 5FUXA 4UQOA 2O8FA 3R8CA 3C7KA 1W49A 3W8RA 1Z8FA 4BLQA 2YINC 2IHYA 1JQLB 2VF8A 1Z6XA 3NKVA 2JLYA 2WOJA 2KBEA 1TUEA 2ZRJA 5HE8A 4MYTA 3S1AA 4LJ4A 4QBFA 2VH5R 4DLXA 2X77A 1G6OA 4KBGA 2IWHA 4QXAA 3SFZA 4HB0A 3WNCA 3K0CA 2R62A 3L43A 4M21A 5J4KA 2ZSAA 1AQUA 2B21A 4ZIRA 2YKGA 2ZRCA 2FX3A 1US8A 2FPMA 2HEIA 3OE7A 1NY6A 1XPOA 1HT1E 2FF7A 1TNDA 5FUVA 1TADA 1DAEA 4A15A 3ZVMA 3SEAA 4OL0A 1M34E 5FBRB 2CL7X 3KUDA 5P21A 3U6BA 3LO5A 1KI9A 1YR8A 5FBWB 3GFPA 1OLOA 5CIWA 2MMCA 4RCYA 3TQCA 1KKLA 5DHAA 1EESA 1CRQA 1YRAA 1FX0B 1XCGB 4D4KA 2ZROA 4LZZA 2W2TA 2GJSA 4TLAA 5L3RA 2BBSA 3CWQA 2P65A 3RWMB 3K0AA 2QGNA 2GA8A 3LY5A 5HZKA 4BFVA 4CEJB 1E9AA 2J3EA 621PA 2GCPA 3CNNA 2REBA 3GLHE 4C30A 1VCIA 5DO9A 5L3QA 4OI1A 4QM6A 2P5TB 2WIAA 4YMSA 3UWOA 2AD1A 1GDDA 4Q7MB 4MKGA 1II0A 721PA 2I1VB 4JJKA 1DAGA 3RVBA 3UK6A 4AD8A 1O3YA 2RGCA 3BOSA 1T5LA 3KJHA 3PVSA 3UMFA 2QAGB 4JT4A 4LV6A 1W5SA 3HDTA 2PLRA 1Z0DA 4NONA 2G9NA 5F98A 3LBHA 4DCSA 4R98A 1U98A 4WIAA 3IQWA 3TR5A 4EFLA 4PAQA 5JI3E 1W7AA 4BZXA 2BWJA 2FG5A 2ZU0C 1Q12A 2IYQA 2X2FA 3F5FA 1OFHA 1IN7A 2XOKA 1A4RA 3PEYA 1S8FA 1QF9A 2J59A 3RRNA 1BS1A 1UBCA 3A1UA 2GEUA 2WPDA 5JEDA 2NPFA 4A1FA 2ZJ2A 1T8UA 2IYRA 3C41J 1XEXA 1SVOA 4CGZA 1QG2A 3K9LA 3ZZUA 1KDRA 2OFWA 1X8KA 4PHTA 4GFDA 4HDOB 1Q3HA 4OHWA 1OE0A 4XTCS 4C7OB 1XJCA 1U94A 1T0HB 4FINA 4C0HA 1EWQA 1KDOA 1NLYA 1KJWA 2WWWA 3P1JA 4YDSA 5BQ5A 1XPRA 1S3SA 4GNKA 2QGZA 4BFXA 2ZAMA 4Z8XA 1DAKA 1Z2CA 2H92A 4FD2A 1FNMA 5JECA 3X1WA 2RGBA 2VSOA 2XTNA 4P32A 4DJTA 3WP1B 5FPKA 3U7GA 2D2FA 1SKYE 2P3SA 3JVUA 4QHTA 3MUFA 2RGEA 2QQ0A 4A2QA 3GLFE 2PZGA 1VKJA 4DT1A 2ZIAA 2ZRDA 3C4JA 3BB4A 4M4SA 1LV7A 1A2BA 3B9PA 4B73A 4YMVA 1GRQA 2H5EA 4RFVA 3WMEA 1TAGA 4FCVA 4O0MA 1W5TA 4PO1A 5FBVB 5F3WB 5EJEA 1Q0UA 1YU9A 5DNYB 1GNPA 4K8OA 4QGHA 2YOFA 2YV5A 3K0CC 1M1YE 3H86A 5EUQB 1M6NA 5H1YA 1Z08A 3W90A 4WVFA 1OYWA 1GAJA 1T3HA 3GEHA 4P0TA 2CE7A 1RZ3A 1N5IA 3EASA 2KBFA 3PG5A 4IDOA 2GVZC 2CCKA 1E0KA 1KI6A 1ZCBA 2XNDA 1ESMA 2JGNA 2JLWA 4BLOA 4D82A 1T3SA 1QDEA 4DB4A 1Z5ZA 3VR3A 2C03A 3KKNA 1OV4A 5CIQA 1XCPA 3OIWA 521PA 2B7CA 1VYTA 3BJIC 2WICA 3SFVA 3EZ6A 3CF0A 2J87A 3LXXA 2Z5FA 4P4SB 2W6IA 3PJRA 2YOHA 3ECCA 4RD4A 3B8HA 3HU3A 1NSFA 5FTMA 3BH7A 3EIQA 4GZLA 4B32A 4G5RA 1UADA 4TMTA 2H18A 2JLZA 1DADA 1GILA 4US1R 1II8B 3Q5EA 1W0KA 3QXXA 2GCOA 2ORVA 5IDVA 4EPYA 5FTNA 1TU3A 1IJFA 3FWYA 3KL4A 1P2SA 2F9LA 2ZJBA 4Q7JB 2VBCA 4TT3D 2NZ8A 4V0OA 3KKOA 1RYFA 1P7CA 1DEKA 1JR3A 2VHCA 2O8CB 3GJ7A 2RHMA 3VKGA 5FL7D 3AV0B 3G0HA 2ZRLA 4JL5A 5FL3A 2QMHA 1F5NA 4V0NA 2ZITA 3K09A 3TE6A 1WCV1 3TK1A 1Q3TA 4Q00A 1G291 5E4FA 1C4OA 1E1RD 1YZTA 2IHBA 2XZPA 5AJXA 4N0EA 2QQEA 3B78A 3NBFA 4JLAA 2WAYA 1A2KC 2ZANA 1EK0A 1DVRA 1HT2E 1R5NA 3NBZC 3THYA 3K70C 5C4GB 2IS6A 2ZE6A 3RRYA 2Q9CA 1PZNA 3BH6A 3KKPA 2QA5A 1FL9A 4P33A 1KHTA 2A5FA 3H4MA 1YJ5A 2C95A 4HAYA 4EDHA 2LWIA 2V6IA 4YDHB 1M2OB 4XOIA 5LD2B 4KITB 1F48A 3G5UA 1BO6A 1QVAA 3K70B 3PUZA 1JJVA 4HB2A 4RFSB 4DRZA 3PEWA 1HTWA 1IHUA 1G7CA 4E07A 3L2OB 4D81A 4MRRA 3FHTA 4V0KA 4F7WA 2GXSA 4GL2A 2OFXA 3LXRA 4D0GA 2F43B 3WNBA 3D3QA 3OESA 1PLJA 4FCTA 5L3VA 1E98A 3U4QB 5LBIA 2VHJA 1P9WA 4OQMA 2C99A 4HLQB 4AK9A 3KDSE 3WYAA 1NY5A 2F9MA 5BWMA 1GIAA 2ZI5A 3A4LA 4RSGA 4LJ8A 4Q7KA 5IT5A 4OJQA 3M4YA 4I1OA 4GZMA 3AVXA 3QKTA 2X1VA 1R2QA 2P6NA 1S96A 1KY3A 2ZVPX 4IDHA 4AYWA 3QKSB 2K5UA 4V0MA 4BECA 4XD7A 2J46A 2YYZA 4AIIA 1ZNYA 3EA0A 4N0DA 2WSSA 2XXAB 1OFUX 1KMHA 1ZU5A 2ZRGA 3FMFA 4G01B 4Q01A 1GZSA 4ACBA 4I81A 4KYIB 2REOA 1IQPA 3CW2A 1YHNA 4UNRA 3U44A 1DE0A 5FUWA 1OYYA 4CEHB 5KHOC 5DYIA 1FMLA 5GVSA 3FFAA 5FBQB 2NQ2C 1S4QA 3RSOA 3FB4A 3OIYA 1J99A 1JPJA 3VR6A 1LTQA 3W6OA 2QPAA 1G5TA 1KDTA 1BMFD 1P73A 4Q4JA 1FTNA 3KXLA 3I61A 5BN3A 4AG5A 4NCKA 1OFIA 3DEFA 4ESHA 3IIMA 3TVDA 1EX7A 121PA 4NH0A 1MO5A 1Z3IX 2OLJA 2ZJ8A 3LRPA 4NTZA 2V54A 1IONA 4V0ME 2OFOA 3EWAA 1G8FA 2BC9A 2I1QA 2W6JA 4I99A 2RGXA 1GL9B 2XOKD 1PV4A 3SC3A 3K70D 1HUQA 1ELOA 2AK2A 3I8XA 3VNVA 1ANKA 4V0LA 2WPDD 3SI7A 2F6RA 1KTVA 1RKBA 4MQBA 1E2FA 4ASUD 4A0RA 4KODA 1XF9A 4LV8B 5EXPA 3UG7A 4QGFA 3DOFA 3BB3A 1W46A 1J7KA 1LNZA 3U7FB 4OI0A 1WDTA 3TJZA 2BBOA 3VR1A 4LBWA 2ANCA 4YMTA 3OF5A 1YR7A 3K09C 4E22A 3TNFA 4OHXA 1N25A 2OUKA 1IAQA 2BMJA 3B1ZA 4F93B 3PV0A 2XTMA 3CRVA 4PZLA 3U2QA 4OQFA 4EAQA 1OHHA 2KI5A 2IF0A 4D4JA 3CRMA 1L4UA 2ZRPA 5K8UA 1KO5A 5JSZA 2HLDA 5KTYA 4TYQA 2PMDA 3PUWA 1RYHA 1OW3B 3CRQA 1NBMA 2FU5C 3PFIA 5JLJA 1E0JA 2GKSA 4PHFA 3T15A 3BS4A 1T8TA 3AGPA 1AQYA 4H9GA 1AZTA 2FFBA 3N70A 3PUVA 4JL6A 3QY0A 3P20A 3HU2A 1RRFA 2PZFA 2WSMA 5C1BA 1B23P 3HJNA 3IIJA 4MKIA 3KQHA 2AHOA 5JJIA 1G8HA 5JMTA 4LSGA 4RY2A 1KOFA 4WZBE 1GFIA 1YZLA 3Q8XB 3IUYA 3LW7A 3IGFA 2QTFA 3B9QA 2O0KA 2OG2A 3VX4A 1U90A 1CF4A 1N6IA 3KFVA 3PEVA 4IHQA 3UATA 4DDTA 5J40A 3KQNA 3SOPA 3SE0A 5KOYA 2DPXA 2O8BA 2OAP1 1E32A 1DBSA 3WHLA 2BM0A 1E69A 2BJVA 4EJSB 5DISB 2KWIA 2NMVA 1P4SA 4CZ2A 2IYZA 1F60A 4CF7A 2W6ID 5HKKD 4UXJA 2GETA 3AKEA 5TY0A 3QF4A 2A9KA 4DIEA 5KO2A 1N5LA 2ODEA 1E1QD 4XIGS 3K1JA 3EIHA 2XZLA 1A1VA 5EP4A 2R9VA 4DLZA 4TL9A 3EZ7A 1RJ9A 1W0KD 2BEJA 4AC9A 3VQTA 1XMIA 2Q3MA 4Q1DA 1AS3A 3QI2A 4TMZA 5B57C 3UWKA 1NG1A 3X2SA 4LHWA 5DI3B 2XJ4A 1JR3D 1AZSC 1HE1C 1OIVA 2GCNA 3U61B 1KMQA 2J0VA 2IUSA 3BIFA 3GJ4A 2XEXA 3EX7C 2LKCA 4LJ6A 5FR1A 2FGJA 3AP1A 1W4AA 1JJ7A 5CDFA 2YWFA 4EUNA 3TAUA 3ZS9A 1MOZA 1FZQA 5DSZA 2W2XA 1UFQA 4HLCA 4A8JB 1WXQA 4LYAA 3WBKA 1E79A 1NL3A 2WM9B 3TLXA 1Z29A 2P2LA 4YLGA 3I5XA 2D62A 3O8DA 5KSPA 1TF7A 3FE2A 4AG6A 5M04A 4GI7A 3I5YA 5HCNA 1OH7A 3F3YA 4G5GA 1U9IC 4DCTA 4TQUS 3D7MA 4LHVA 1F2TA 2D06A 3AVTA 2Z6VA 4C4PA 1W0JA 1VYVA 2GZHA 1G17A 1YZGA 2V6JA 1RE0A 1ZM9A 1W1WA 1MABB 3I72A 1A7JA 1M7GA 2ZI7A 4TTPA 5DE3A 5DLQC 3ADCA 2EFCB 3LV8A 4CT4B 5DYGA 4D4MA 4ZKEA 1AK2A 1KI1A 4BUJA 4BASA 4BLTA 4CVNA 3LLMA 2HV8A 4URXR 2Q9BA 3L0PA 2FPLA 3PXGA 4A2WA 1HQYE 5CDFE 3KKMA 2KJQA 2QN6A 1W47A 3RS4A 5FH9A 4Q1EA 3VHLB 1CR2A 2ZJYA 4MKHA 3D31A 5EXSA 5K8IA 2GXAA 2QAJA 3RS3A 5FI0B 5A0FA 3K0EA 2WKQA 3UKDA 3HYTA 1AS2A 4HAXA 4PANA 1E4YA 2VEDA 3OEED 4W5HA 3T12A 1Z6AA 3BORA 4QG7A 4US2R 3WBJA 2WSSD 1SQ5A 4EQ6A 3E70C 4LDJA 1NSTA 3T34A 2PZEA 1T6NA 3NDBB 1WBBA 4I4LA 1U0HC 4HI0E 4C0JA 2Z83A 4MRNA 1CIPA 4NE2A 2OSBA 1T5IA 3IDQA 4JT2A 2D7CA 3DM9B 5SZJA 4KLNA 3U6KA 4KU4A 1KI8A 2DCUA 3EA5A 4JIMA 4NCNA 4CEIB 2A78A 3QKUA 4IRUB 1GRRA 3KZ1E 4BEBA 3VR2A 1FX0A 3AF4A 4B2PA 4QJ3A 4B6EA 1CJKC 4X8MA 3TBKA 1G8GA 2JLQA 4MRSA 4DSNA 4BFWA 2HT6A 1TEVA 4PO9A 1NMYA 4CEJA 1N6KA 4OQNA 2W0MA 4M0LA 2C9YA 4JLKA 4HZUB 1TMKA 4PZYA 4U7DA 2OLKA 1R6BX 4OK5A 5F9FA 4TWZA 1E2MA 2W6JD 3CIOA 1JNYA 3K9GA 3T1QA 2GZDA 4N3NA 1NJFA 5B30A 1O87A 2ZJZA 1U81A 2QAGA 2YC2C 4HDQB 3DMDA 4TN1A 3BAFA 2I3BA 1OF1A 4DB2A 3ZS8A 3EPKA 2WWHA 4URUR 1N6NA 4M1TA 4ZCMA 2WKRA 4C0SA 1NRJB 1NJGA 1ZD9A 3QF7A 1RIFA 3SZRA 1BIFA 3W5JA 1EFCA 1QHYA 4LYFA 3E2IA 1AN0A 2QRZA 4ZO4A 1OHHD 4NYJR 2JDIA 2ZTSA 4OHYA 2BBTA 2Q3HA 2HLDD 1OIXA 2ZSBA 1Z6TA 3BFVA 1E2QA 3GD7A 4A0HA 3AEZA 4Z1MD 1NBMD 1W4RA 1UKVY 2BCGY 4MUAA 2QBYB 2O8EB 4C7OA 2R6FA 5FTKA 1XTIA 3I92A 3TKLA 2MSEB 4B43A 1BYIA 4KVGA 1SGWA 1G19A 2CK3D 2J0SA 3PITA 1PVOA 1HA3A 3LH5A 1P61B 3A36A 2BMEA 1E2JA 4NYMR 4MH0R 1XD8A 1BKDR 2PBRA 5AR1A 5FTLA 3DO6A 3QKRB 4L15A 5FL7A 3NH9A 2VHTA 3WP0A 2QG6A 1CLUA 4BLSA 2B6HA 4UJ3A 1VIAA 5ANRB 2IYTA 1W4CA 1E4VA 1S3GA 2E1RA 3CH5A 1S1MA 2ZSFA 1G3IA 2BKEA 2J5XA 5FUYA 3TAHA 2IYSA 4UNPA 2BVNA 3AM1A 2R6DA 2GEDA 4L8GA 1NN1A 1GL6A 4AI6A 1OXXK 5EP1A 3ADBA 2UKDA 3LDAA 1NIPA 2GF9A 3GLGA 2F7SA 2XSZD 4TLEA 3QBVA 3CRRA 5C46F 2WWYA 4RCZA 3ICQB 2FWRA 1E2DA 3A1WA 2FNAA 3I3SR 4KXFB 4GPTA 1ZVQA 2CMKA 3QXSA 3VR4A 1L4YA 1SVIA 3CUEF 1XZQA 2ZETA 5HPYB 4ZI3A 1CJTC 4M22A 1HY3A 4MDEA 1FUUA 4HSEA 4IDNA 3AF1A 1U2RA 2RB4A 2YJTD 2CL0X 4XSGA 3GQBA 1K8RA 2C77A 1ZM7A 4EQ6B 4NCIA 3HPRA 3ZQJA 1JB1A 3AUYA 1N6RA 4LX0A 2ANBA 4P4SA 2VLIA 4DLSA 5G41A 1KSHA 3TUJC 2DWPA 2CVHA 4MGYR 5GADl 1Q22A 2HCJB 3EIEA 4H1VA 4M1WA 5FOXA 1R0XA 1DS6A 1E9RA 3QVVA 2ZRNA 3AVPA 3M0EA 1KK0A 4P4TA 4C2TA 3C14C 3MSXA 4RZ2A 4DUGD 1E0AA 1W4BA 2B8TA 1KNQA 1G1MA 1II8A 1YR9A 1JALA 1DPFA 1GKYA 3MWYW 2WMNB 3SN6A 5AK0A 2HYIC 5E95A 3SJAA 4HAZA 1RRCA 4B71A 4EIWA 3MWKA 1M74A 2HF9A 2PX3A 4C3ZA 3SQXA 2DR3A 1E79D 1Q57A 3EPLA 2O8CA 2GESA 2ZREA 1HURA 2QAGC 3PUXA 4LY6A 2ODWA 2MSDB 3TIFA 1IN5A 1ZJ6A 3Q3JB 2BKUA 3THOA 2QP4A 1W0JD 3CR7A 2YOGA 4Q4LA 3MMPA 1I2MA 1XJQA 4KSBA 4RZUA 1X6VA 4B74A 4C0KA 1BMFA 1N6HA 1VHTA 2CNWA 3CZPA 2AK3A 3BXZA 1UEIA 2QTHA 5CYPA 1KO4A 2V1UA 4KV9A 5DI9A 1T9HA 3GJ0A 5EZ5A 4IVPA 4DDWA 2OESA 2C2HA 3GEEA 2VQSA 4JYBA 2WAXA 1IJEA 3HWSA 5UKDA 2VP5A 4XVRA 1IY0A 1JXOA 1SZPA 4RKEA 3SHFA 1KI3A 2IYVA 4FMDF 4RFSA 1TU4A 2NO7A 2EW1A 4ERNA 5JS7A 3EC2A 2EWVA 1EXMA 2E9SA 4BRUA 4ASUA 3REFA 4XWOA 4HDCA 4BFYA 2F43A 1CS4C 2PCLA 1V43A 5CJPA 3B85A 3TVTA 5BN4A 3R9WA 1XEWY 2UZ3A 4ON9A 2QM8A 4U00A 4IFBA 2GJ8A 3LBNA 3U4QA 3PEUA 1ODFA 1ZYUA 3C8UA 4JL8A 1IBRA 4IXNA 3CPEA 4W5JA 4ZDKA 1NLZA 5A5GA 2IXFA 2EYUA 3KTAB 3MWLA 3Q7PA 4LK2A 2N1BA 4JKYA 4E03A 3QKSA 1M7HA 2JASA 2X19A 3W9YA 4NU0A 3EAQA 2XXAA 3ND9A 2GK6A 3QPVA 4LJYA 5C4MA 5HZHA 4IDPA 4ARZA 2IYLD 2W00A 2P0EA 1S1CA 2WVJA 3F0TA 3N2EA 1YVDA 5CJ2A 4RZXA 2GJKA 4BFSA 1XD2B 4DDUA 4MYCA 3THXB 1BH2A 1FP7A 4BFTA 4KFRA 4ZDWA 3U3JA 4A6PA 4CEHA 3VKWA 1OXVA 4LBYA 4DIDA 1E96A 1N2CE 3SYNA 4A4DA 4QBHA 2PT7A 4PC3A 3RANA 2WWXA 3BFXA 4KFUA 2FZ4A 6Q21A 3GLGB 1X1RA 4DLYA 3E1SA 3FMOB 1IXZA 4MRPA 1R0YA 1D9ZA 3PCRB 4DSUA 1NLFA 2ERXA 5BN5A 2ZJ5A 1W36B 1N0VC 4WBSA 2YWGA 4UNQA 4ILEA 1UKZA 4JLDA 1FUKA 4KCGA 3IBGA 3VFDA 1G18A 3CONA 2R6AA 2O8DB 4D4LA 4TL6A 3LX5A 3A8TA 3WYFA 4TTRA 1ZCAA 1NI3A 5LB2A 2GXQA 3MLEA 3WHKA 4AYXA 4DXAA 5KSOA 4Q1BA 5KSZA 5TMPA 3F8TA 3N2IA 3IEVA 3TRFA 4JLPA 4PFSA 1KO1A 2VF7A 1RRGA 2JDID 2B7BA 5HKKA 2ZI9A 3LQRA 4G5SA 1UJ2A 1D8TA 1Z06A 2HF8A 2QROA 3D6TB 3QOFA 5HTKA 5IF9A 1COWA 3FOZA 3H84A 2GDJA 3X1XA 1E1QA 3U3KA 4M9SA 3DZDA 4PO8A 1IY2A 1HH4A 1GNRA 2A5YB 2Y8EA 2V3CC 3TGPA 2GAAA 2F1JA 221PA 3L82B 5JWRA 5K8TA 2JA1A 3GLHB 3IHWA 2OHFA 2GNOA 1X8LA 3CX8A 3AF3A 3ZYCA 3MCAA 3UMSA 3MAAC 1LVGA 4JBWA 2FFQA 5AJVB 2F3TA 3RRZA 4Q4AB 3CLVA 1SKQA 3R7WB 4ITRC 2OBMA 4LJAA 1QHXA 2IEYA 5JRZA 1KSFX 4LJ9A 5CK5A 1JEDA 3V4FA 3O8RA 4IJMA 2KB0A 2A2ZA 4I1SA 3KQUA 1X3SA 1DARA 5LD2C 4Y0AA 1R10A 2EFEB 2NO6A 2JLRA 3BGWA 4FMCF 2JLUA 5KYKA 1FQKA 1R4AA 1LS6A 5FBLB 3VMFA 3DPUA 1MV5A 3SR0A 3WRYC 4U5XA 3BH0A 2VYFA 5FOVA 4B3XA 4DEXA 2G6BA 5G40A 4GSYA 4NHOA 2OZEA 2VRWA 4G5OA 3GFTA 4M1OA 4TQAA 3WMGA 2OBNA 3TW8B 2BCJQ 2G88A 2NPIA 2ODBA 1G7TA 2YC4C 3ND8A 2YZ2A 2NO1A 3IEUA 1JR3E 3UANA 1WRBA 4M9QA 3LD9A 3NEJA 3KXKA 4MUBA 1KAOA 4Q18A 4KJZA 3C5HA 1KZ7B 4EJSA 1K6MA 3AP2A 4TLBA 4DHEA 1B0UA 1N6LA 3X1ZA 3RRMA 4LHZA 2GJ9A 4PAMA 4UXIA 2NTYC 4B3DA 4Q9IA 4EPRA 1PLLA 3KQLA 2GXUA 3DL0A 3GLFB 2V4ZA 2V55B 3ADKA 1E2LA 1J90A 3I1FA 3W34A 1K5GA 1XWIA 4M1KA 2IXEA 3OEEA 1VG0B 2F1HA 5HR5A 3FGNA 3AF2A 2A30A 4G0NA 5CM9C 4ARZB 4M8NE 4PSAA 4BLPA 3LBIA 1YQTA 5DI3A 2VSXA 4C0QC 5FPHA 5DH9A 1ZU4A 3LNCA 3SU8A 3ZIAD 1ZP6A 3IPXA 3KB2A 4HYYA 2CHGA 3WXMA 1SXJC 2ZAOA 1OH8A 3GJ8A 4D26A 2W58A 3K9HA 4CT5A 2Z43A 2JIZA 5EZ6B 1JBKA 4NL4H 1Q1EA 2FJUA 4IFEA 2NGRA 1ZIPA 3CWZA 2CNWD 5DGXA 4A8JA 1TQ6A 1E9BA 2EU8A 2D74A 3HR8A 2ZRHA 1SXJB 3GFOA 4OK6A 2B92A 1AJEA 4EPVA 2VHQA 2IX3A 2GVDC 3IQXA 2RCNA 1E2GA 3DDCA 4Z8YA 5D3MB 3RSLA 4QBGB 4TYWA 2ZI3A 2XTZA 4A0GA 3EXAA 3A58B 3FMPB 3DMNA 1MABA 1T0JB 3R20A 2QMOA 3RABA 2P6RA 4NZYA 4PPNA 2O0JA 2CJWA 3BB1A 1FFHA 4HB4A 4O25A 4D2IA 5J4YA 4QHYA 1TUIA 4TMXA 3TSZA 4B44A 4NKRA 1U9IA 4PXAA 3I8SA 2EQBA 3OFNA 1ZNZA 1JECA 3OEHA 2OXCA 5CLQA 2FOLA 1ZRHA 3QUSA 3RS7A 1U0LA 1ETUA 1UBGA 2WJYA 4D80A 3GLIB 4PPQA 2AD5A 1R8SA 3GMTA 4M2LA 4QJ4A 4F38A 3AGQA 1KJYA 1WQ1R 3A1VA 1YKSA 2PEZA 3AB3A 1J70A 3ASZA 4R7ZA 1N5JA 4BRWA 1JR6A 4BLRA 1XTJA 1G3RA 1VG8A 1G4AE 2ODNA 3GEIA 3NBXX 4HLUC 4L5BA 2F1IA 4B33A 2ZXUA 3AKDA 1G16A 2G3YA 4Z1MA 2RKOA 3U7HB 4GMDA 4F4CA 4KSCA 2FDCA 1GSIA 1Y3AA 3AF0A 4E5UA 1D9XA 3CB4A 3K9NA 2FSFA 2CK3A 3CR8A 1ZW6A 4DCVA 3TMKA 5FOUA 3ZZTA 5CB6A 2ATVA 2F1RA 4GP7A 1ZMXA 4CEIA 1DO2A 3QVUA 3ETLA 1ZUNB 3WYGA 1MT0A 4AKIA 4Q9LA 1I2DA 5FI1B 3SYKA 1CP2A 4EJSC 4CIDA 5F2EA 2GHIA 1SXJD 4JS0A 2HT1A 1CR1A 3HYRA 2C9CA 4D25A 4DLTA 2WHXA 4HZUA 4RKFA 4YMWA 4JSYA 2G83A 3NHBA 1IN8A 4JYCA 821PA 3LA6A 1NBME 3OHMA 5G53C 1ZD1A 2XSZA 2J45A 1L8QA 5FTJA 3U3OA 2X8AA 4WZ6A 4GOXA 1CR4A 4D0NA 1COWD 2ZVQX 2ZRFA 2FSHA 1ZM4A 2DFNA 1XU4A 4FWIB 1Y63A 2R65A 4XTRA 4V03A 2C8VA 1LY1A 1OFTA 2OILA 3SYLA 1NVVQ 2AX4A 3I4LA 3T5GA 1Q21A 1VG9B 1KSGA 2OXRA 3MRSA 2FE4A 3MJHA 4Q7LA 2PH1A 4IKEA 5JJKA 2RGNA 1QHSA 4OI4A 3BC1A 3WY9A 5AUNB 1P62B 1FQJA 1IXSB 2PEYA 2QM7A 4A8JC 1GTVA 5FPSA 4OJKA 5KDOA 1Z6GA 2BMFA 3IHLA 5HCIA 2QBYA 1R7RA 4LC0A 2O8EA 2AWOA 4DUGA 1JEEA 3KUCA 3H2YA 3CNLA 4DKXA 2ZE8A 1SVSA 3L8YA 1GVNB 2PX0A 5CYOA 3AVYA 4EFNA 2HXSA 3EW9A 4LCBA 3NXSA 4XVQA 1X8JA 2ZEJA 1XJ0A 3QKRA 2IA5A 4PSKA 5KNCA 2WMOB 2VP0A 1NG9A 1XXHB 1E99A 2FFHA 5IHPA 1E2NA 2E87A 4TLCA 4M9ZA 1XEWX 2IC5A 3RS0A 4F92B 1RFLA 2HDNB 2EFGA 2IUTA 3QIAA 3BBPA 1U99A 1MO3A 4R2HA 3O8CA 1XPUA 2VTKA 2CXXA 5TVKA 3Q85A 2ZSDA 2AR7A 4O3MA 5E3HA 4ZDJA 2CJWB 1ZUHA 3U3MA 4L16A 1E2KA 3CX7A 5TDHA 2BHRA 1S2MA 3AVQA 5FR2A 3U3RA 2GF0A 8OHMA 4IVRA 1E3MA 1F6BA 1XTSA 1IXRC 2BOVA 3AUXA 2ZU6A 3EZFA 4B3FX 2A5GA 5BYJA 3FDIA 1CXZA 2QU8A 3PR1A 4OI2A 1GG2A 1HQCA 3UXMA 3QPWA 1TQ4A 1G9XA 1E2EA 4BE7B 3MGCA 3P4XA 5ELXA 1HEIA 2ONJA 1MH1A 1G5RA 3KB1A 4LPKA 1MR3F 4GDFA 4GOJA 1PUJA 3W3ZB 1DAIA 5FPTA
chains in the Genus database with same CATH superfamily
4JVNA 3L02A 2QDKA 3QQPA 2BEVB 5KAMA 2WJ3A 1M2VB 2CXHA 4NP6A 2VK2A 3OMLA 1H6AA 1NR5A 4XXHA 2QPOA 4WD3A 5K0NA 3VTKA 2ZUBA 2JLVA 4DG5A 2B8NA 4DNXA 1E92A 3MT0A 2CXQA 3PCTA 4MWTA 4V3BA 5IEBA 2CNNA 2WEKA 3VDMA 1NW4A 1QZXA 2DLCX 1U4SA 4IS3A 3L7BA 2C2GA 4ZXPA 1E2HA 2JIZD 3RVPA 1KF0A 2QJRA 1T3LA 4PNPA 1VCMA 3GPDG 1CZHA 3NLLA 4FLEA 4L4SA 3QVMA 1WHTB 3GRRA 3GGPA 3T9BA 3WOHA 3LHDA 1QGUB 4LXXA 4C6SA 3DTNA 2EX1A 1HE4A 3H7AA 3AILA 4OYYA 4R8KA 3T61A 5BXQC 2WSYB 3R75A 4RDXA 1JWLA 2EL9A 4ARSA 4BB6A 4Y30A 3WVNA 2RHOA 3V4RA 5K3FA 1ISIA 1VJ5A 5TXGA 2W4QA 1QBGA 1QGAA 2BFWA 1FPMA 1WF6A 4WCFB 3QXJA 5IVKA 3PNQA 1DQSA 4AZ0A 3NJRA 5EP3A 3AY3A 4QUDA 2H65A 4JMPA 1E2IA 4LJ7A 2AJTA 1JVSA 3W8NA 1RQLA 5JJ5A 1J8DA 2DHCA 2O7QA 2XT9A 4HKTA 3K8YA 3I58A 3B9BA 4PZZA 1ONBA 5I7UA 1M2FA 3NNNA 4BNZA 1NVWQ 4KB5A 3SDZA 1L1RA 3ZDYB 1DT3A 4GI2A 1OTXA 4L5IA 4LSZA 3RM3A 4BFUA 5IM4F 2NLOA 3HN2A 1DXQA 2P4QA 4HUJA 1EWYA 2J0QA 3E23A 3B7WA 3I37X 3AOGA 3COWA 4J16C 4YMUA 3FUXA 3WLNA 1BA3A 4QKQA 4CKEB 3FFXA 1RJGA 1F3OA 3MT9A 1QH0A 5MN5A 3R5FA 5CFPA 4IIDA 2NO4A 2DUUA 5ENDA 5CHEA 3C8DA 1ZINA 4D99A 1G59A 5DGDA 3O90A 3C45A 5KEIA 1T1EA 3SX2A 1CUXA 2RHGB 4ZA2A 4KI0A 4E5NA 1KMIY 1OGJA 1PP4A 1NDQA 4MVJM 1E9SA 3MBOA 3CC8A 2CLIB 1LJ8A 5E38A 2PRIA 1L6IA 1Z0IA 1J2YA 1J09A 3PDCA 3L7IA 3OFSA 4FWTA 4REQB 1B6SA 5JC1A 5JJLA 5CTJA 4PSUA 3DGFC 4PSVA 4R84A 3U62A 1NN3A 1CULC 5L95A 1ZD2P 3HKCB 3HVJA 3UF0A 2FE1A 5EVJA 4MEJA 2H2IA 3VU9B 1K97A 1TKRA 2XPCA 1VCNA 2XOEA 3O4HA 2ID4A 4UE2A 4XGKA 1E89A 2P35A 5BXYA 2I9KA 3BERA 2OLEA 3TPZA 1ECFA 2FSUA 1WB4A 4ZOLB 2B25A 5B2ZA 5K0GA 4HGPA 2Q2VA 3OZSA 3URKA 4ZVKA 2WT9A 1ACMA 4PPGA 2B9VA 3AVUA 2NG1A 2D1SA 2Q4EA 3MQFA 1A97A 3W2GA 1PT5A 3OU6A 4H6PA 2DPLA 4EYSA 1JIIA 3AX6A 2CBZA 1XTRA 4YV1A 1MO2A 3OPVA 2AYYA 1THGA 2GYUA 2O2CA 2ERYA 3FDJA 3WDLA 2J0UB 5BR4A 1GP2A 3KOUA 2PDAA 5LQNA 2A59A 3OT1A 3JCZA 3C7CB 2XCTB 1QRAA 1W52X 1XTUA 3N76A 3ID6C 1EUDB 3G5MA 3VKHA 1E4OA 2VNIA 1TEXA 4IDQA 2G1JA 4DNQA 5CFOA 4QQFA 3SZMA 1KU6A 2H11A 2I0FA 1YBMA 4UPVA 1R4ZA 2VHUA 2ORYA 4UBNA 2W9XA 2JATA 4KXWA 3UENA 1GRVA 3DOIA 3L01A 4JLBA 3SR3A 1GGMA 2IYOA 1XX6A 1RFGE 2P5SA 3GEBA 3L8ZA 3KK0A 4HWKA 4KGXA 4WJKB 1A27A 1WUYA 1Q0RA 3QFHA 3VI3B 3MBKA 3W0LB 4BNMA 4P58A 3UB4A 2C82A 4RD1A 2QN2A 4OQZA 4EW3A 2EF0A 5JCXA 3ADDA 3B38A 3GN1A 3MJSA 1VMEA 3RCBA 1CBUA 1ORTA 4C0AC 2I67A 2H2DA 4MVJG 1LC3A 1TK2A 4JOSA 5ADWA 2IS1A 1J0XO 3GLGE 4HH1A 1PO7A 1Z6PA 4S2UA 4FDVA 1P39A 3QEBZ 2YBEA 3KUKA 5ALMA 4LVCA 4BHTA 5AI5A 1O5OA 6ADHA 1ATIA 1AGYA 3H8JA 3BMOB 2AFHB 4M0FA 3K1ZA 4GOLD 3WGVA 1BX0A 3QHQA 2ID9A 4OKSA 2P7HA 4Q4AA 4RHTA 4CDRA 1QZZA 1SVUA 2IUUA 3R2JA 3W6PA 3U5TA 1W88B 1JX6A 1MW8X 2Q3CA 1OFGA 4UQLA 4W6ZA 3OECA 2IE0A 3QXCA 3FMVA 2IYEA 1R4MB 4FSDA 4S35A 3VR5D 2WU1A 4ZCRA 3TZCA 5TRTA 2IZZA 4K9QA 1ULBA 5H68A 2AL7A 2ZTMA 1NOIA 2IK8A 4L2IA 3LWNA 1RHUA 1TQDA 3W6UA 3FPBA 5IJAA 3NHAA 4DSAA 4IFIA 1L1QA 1RWVA 3WIOA 3EC1A 4QOJA 2RH5A 3CUTA 1K63A 1XP8A 3OZGA 2CUKA 5G0SA 4JBNA 3DXFA 4UTNA 3BZBA 2H1LA 3STHA 4K46A 4B81A 5CB4A 2FWAA 1BZYA 3GY0A 2VH1A 4B34A 1CUSA 2J5KA 4KQ1A 4LF7B 3LQKA 2O7NA 1YS2X 3GT3A 2UXBB 4JQCA 3RFUA 2ZPUA 2OHXA 3UBTA 1OH6A 4HUQB 1GRNA 1R5BA 1OB2A 1C3OB 4NBWA 3A4NA 4KBYA 4NV3A 5EFOA 3BA6A 4KN9S 2GQ0A 5DXJA 2XZOA 1GA4A 3NG1A 4GVXA 4HQFA 4V3CA 3ESZA 3HJHA 4ZGBA 1G55A 4U6NA 1U1CA 5KAPA 3RVNA 3TUIC 5HOEA 2WYVA 2VQFB 2REXB 5TS2A 3DFUA 3WLOA 1UANA 1Z6YA 4TV8A 4U4AA 4UEKA 4F6RA 4OJYA 1G5PA 3HU5A 2V45A 2B4YA 1FIUA 4PLZA 1M9NA 1KTIA 1PFYA 1A5AB 4D42A 2RGYA 3EE6A 1XQXA 4RVCA 2W93A 1HFJA 2BFBB 5EESA 2GPNA 1HEYA 1ISMA 3IQZA 3EW7A 4UDOA 4QGGA 5CBPB 1I4TD 5EL0A 2W2LA 3C43A 4IUDS 4QPDA 4URWR 2E49A 3JZMA 3L0SA 5DF1A 4US0R 5F33A 4J4TA 1NM5A 2E21A 1I6WA 2QTAA 1QGDA 4QTYA 2ZBFA 5CVEA 2NU8B 2UZ4A 4BMXA 5SY4A 4F8YA 2DJ5A 1M33A 2OBYA 2WG2A 2WJWA 3E3AA 3ED5A 4Z99A 3G0DA 2R6CA 2IEZA 3OF2A 1E60A 3LZCA 3RUPA 4B48A 4LY9A 1VPVA 2BM8A 3WLQA 2XCOA 4UE3S 2XGSA 5AKHA 4BMSA 4EPXA 1B42A 3RJ5A 1UZMA 2XE6A 3TI9A 5AUPB 4YRAA 4BGEA 4U2DA 3MMXA 1XEAA 4LK3A 4G1MB 3SLRA 1JNXX 2FX2A 4EI7A 1CQIB 3SZUA 3BCRA 3ZU5A 5C4IA 4CM8A 2CDCA 2XCRB 2Z6QA 1OH5A 4R71A 5AJYA 5IZ4A 5ARCA 4E30A 4XX0A 5BQ3A 4CETA 4YRIA 3WNQA 4M0EA 1CJSA 1GU1A 3C6ZA 5E7IA 1Z74A 2A7QA 1Z7GA 4JN6B 3FM9A 2AG1A 4R2IA 4ZXFA 1O03A 3OKCA 4Z4EA 4HQRA 3PDUA 3SJCA 2AEFA 1IOWA 3HU1A 3JARB 2V3VA 4EL0A 5D3MA 3IXQA 4GI1A 4ARCA 2IHTA 2XQFA 1Q7CA 1U8ZA 1FW6A 4CTOA 1KP9A 4M9CA 1UOPA 3UMGA 4XWKA 4ZVTA 4W5QA 3WK6A 4H3VA 4U7TB 2W42A 2IL1A 2H00A 2OAQ1 3FYUB 3OUZA 3R8FA 3BWBA 3GCWA 1EEHA 1KEWA 3LM8A 3WADA 1CJBA 2QL9A 5FI5A 5K7SA 1VSVA 2QAIA 1Z4IA 2O2DA 4N48A 2GO1A 2JPDA 2Q3FA 5K0ZA 3FZQA 2Z6AA 1XZMA 2Y0DA 3IDFA 5EXEA 4B3GA 1PK8A 5LMNB 2QP9X 5F5XA 4D92A 5T41A 1W8DA 1T0IA 2ZB8A 4NBSA 5A5DA 4K6CA 4HADA 1U2DA 4IIBA 2Y0EA 2H9YA 1W34A 1QMGA 1XTZA 3Q41A 1JSLA 4ZCIA 3CSUA 2QRJA 1KA9H 4NJMA 4XB2A 4RXUA 1K3FA 3NVDA 4J8PA 4EGFA 4L74A 5JOQA 4OX9B 4ND7A 3ZWOA 4DWWA 1YRQA 3IVAA 1D6MA 2FF5A 4LTDA 1CETA 2C04A 1EXWA 1UDRA 4KFTA 2PUGA 4HTAA 4DWOA 2DLDA 1JLRA 2VUTA 3F3KA 1KAQA 1PL8A 2OY0A 2HFKA 3KS9A 1ZN7A 3WFIA 3MF4A 4WXPA 5JE8A 2QORA 2JJ2A 2ZR9A 3VR4H 1ATZA 1RADA 2D5BA 2O1SA 4GRIA 1V5IA 3DDUA 5GM1A 4I3HA 4AZVA 4WOKA 1E3QA 4ZT6A 3S44A 2DECA 2YRWA 2YWHA 2RI6A 1E6CA 3M6IA 3MQ2A 1L5GB 2ZFUA 4AKGA 4EY4A 2V7QD 1L3BA 3FI0A 1J07A 3E1KA 3G2PA 4QFMA 3TQIA 4WXYB 3UC5A 4B47A 1TYDE 3QPAA 4HDRB 2ZIWB 4HLUA 1X80A 4MJLA 3TQTA 3NC1C 2ZIGA 1DC5A 1JA0A 1V9CA 2VP4A 4DIKA 1JDBC 3GLIE 4RHXA 1C0IA 2D0PB 1OIWA 3R9KA 2WAOA 4JUAA 1MXHA 1VJDA 4QYIA 3V97A 5AW4A 5IXYA 2ZULA 4FFOA 1ZJYA 2OMKA 3BCSA 5KUTA 3A6PC 4E11A 1QYXA 3DMFA 1H0HA 5DLYA 4MRAA 4JK3A 5J3JA 3IE2A 2Q9UA 4AO6A 4K2HA 1JT2A 3DOJA 3LBFA 2VPPA 1D2NA 2VP2A 1Q17A 2HIAA 1PR9A 2YXDA 2Q8NA 1IBKB 2V1XA 4B09A 4LYJA 3I0MA 5SZKB 1Z63A 4I4CA 4K0RA 5EHNA 1SZJG 4CODB 3RYCA 1BVYF 1PTJC 1WB9A 4HWSA 3QUQA 1CNMA 5EFZA 3T4EA 3FFBA 5TPWA 1SHTX 3E9MA 3NTXA 3VRHA 5HQ3A 3HM9A 3WKBA 3QMVA 1TX4B 1QG6A 2QWXA 2R3SA 2PQ0A 1E0SA 2GAOA 2X8JA 1ABEA 5CVVA 3ETNA 5K3BA 2MTBA 1RC1A 2R6R1 1RI5A 4IOLA 3KT8A 3MJRA 3RIXA 3AEQB 5F21A 2G0TA 1T8RA 5EUMA 3M89A 5DGCA 4BMZA 1U8TA 1CUFA 3QXHA 5A5VA 1UBEA 2PUTA 2YNMA 3LT1A 3QJYA 3U4IA 2IZ1A 4H18A 3TJMA 1R9MA 5BQXA 2QVXX 3LK6A 1WA5A 1UOQA 5DHSA 3IV6A 3WO0A 3LYHA 3MB8A 4WGFA 5KOIA 2V0NA 3A1EA 3U0BA 2C7VA 1O89A 3I62A 1UXOA 2ORWA 3TB6A 1UC9A 2ZIEA 4FFSA 4R83A 5EE9A 2ZYWX 3E48A 1I0ZA 2C9OA 1H1LA 3AL3A 5AI8A 5KVSA 2PYIA 2Z8XA 4BBJA 3L0DA 3W05A 2O2ZA 3IUEA 2IUEA 1MOQA 2A1IA 2BKXA 1GZ6A 1JSZA 3AJ8A 1JFTA 3EPJA 4LY3A 1AMNA 4KO4S 3D4BA 1QQ6A 3HL4A 1L7OA 5DN6D 3PTLA 4POAA 2P9QA 3I2KA 4YMLA 3PSHA 1IY1A 4UAGA 5JCPA 1CZNA 1WUIS 3DDNA 3MWJA 1MKYA 3O3NB 3P32A 4CPDA 4DT1B 4RZHA 4YACA 2A4MA 2ZRAA 1SHUX 1P6XA 3CUVA 4MTCA 2EF1A 5JAIA 4YTEA 1N8TA 3FNIA 5C1IA 2FG7C 4B6GA 1JHQA 2YHBA 4N5MA 1ECJA 1TZCA 2GN6A 1TZJA 4ND1A 1HG0A 2AXNA 1T43A 4E3ZA 4FZ3A 2GBLC 1SKUA 4HLNA 5K3AA 3ETGA 1W87A 4ECEA 5L8VA 1Z2EA 5HK8A 1QLHA 1DIGA 2CVPA 2QTGA 3KSRA 4C4AA 5LP6A 3WAKA 2O20A 1XCMA 2O52A 2CDNA 4OHUA 5I9IA 2JS7A 4JXXA 4IHJA 1CR0A 1TCUA 1KP3A 1IQUA 1ZHFA 3VO9A 3P8ZA 1VECA 1UXJA 2RHCA 1EP2B 3CO5A 4N5LA 4PLYA 1H3FA 1M8GA 3G2MA 4X92A 4L4YA 2FLKA 4IMRA 1L7EA 1Q0HA 3IT2A 4NG4A 3LTNC 2ZUFA 2X13A 3H3FA 4DZTA 2J7PD 1H2HA 1EE2A 3B13B 4MVCA 2FH5B 2LDXA 1CZRA 4WT7A 1ENZA 1PLKA 4MOWA 3ZWQA 2JEOA 3HCOA 2I4NA 1G41A 1K89A 1EFLA 1GUZA 5IAJA 2JZCA 5T3YA 1B8PA 1C1YA 1XA4A 2ODQA 3IBYA 1CDZA 3L6RA 3THWA 2QE7A 1PKXA 1TK9A 1G8KA 3BFKA 3SX4A 3WGUA 1CYEA 4BMDA 4WZBA 1W93A 4EJFA 3NWBA 3B8EA 3G7UA 1CVLA 3B3GA 4LGVA 4PTLA 2V74B 3M6VA 4GRAA 4TL8A 4AKSA 4YFYA 5IH3A 4AY4A 3OY7A 4MCHA 2W6PA 1BEEA 4D45A 2ZUUA 3H11B 4DDKA 1AHIA 2FN4A 4EABA 4TTVA 4RVDA 3M83A 2N47A 5DCYA 1HYEA 2EBHX 1IM2A 1W6UA 1X9HA 1LB1B 2XE4A 3H5RA 1ZH4A 3MJ4A 4MRVA 2QN8A 1GJRA 3CISA 3HQ4O 4WI1A 1EFRD 4WW0A 2D3WA 3ZGXA 5CITA 5BUCA 1BHQ1 1I4LD 1FDWA 3HP1A 4MW5A 4XFJA 2I33A 1EBBA 3WA7A 3D8UA 4XOUA 2BJHA 5EE5B 4FFMA 1U3UA 1U8UA 1Z4JA 1Z45A 3K15A 4TYYA 3CBGA 2OECA 2K4MA 3NDPA 2R751 2F59A 2Q62A 3HY3A 2OO7A 3D8RA 4I3FA 1WXEA 1SD5A 3G2JA 2HQRA 2XNKA 4LC1A 2B5WA 3HPQA 3JZFA 4BL5A 3RS5A 2IQIA 4A92A 1NXVA 1BE8A 1JPUA 3RC2A 3MNFA 3J7AC 2FKAA 4GKVA 3PGVA 5F2KA 1DQYA 1X1CA 1XTPA 1JHOA 3O93A 3OT5A 3PR3A 5E3IA 1UXGA 2OV6A 2R8EA 4MUGA 1V5WA 4TZKA 2PKQP 4X7MA 2ZQZA 3Q11A 2FW1A 2BGNA 3BIWA 1SVNA 1OGIA 2A5JA 2QPTA 2RK6A 4KWIA 5B3JC 5KDDA 2KW5A 2C5LA 1CJMA 3S5UA 4YJ2A 2IJGX 3DAOA 4U8GA 3RTBA 2XNDD 1XVIA 4WKCA 5ALPA 1L1FA 4KREA 3BRWD 5LA6A 4D43A 1GDTA 4DWJA 2XVZA 3EJWA 4FCCA 2Q7DA 1C81A 3SYRA 2B34A 2OCGA 3D5EA 2H3HA 2O1EA 1YULA 2VJOA 3Q9LA 4RD6A 3IIKA 1NXSA 2PWZA 4G24A 3CJTA 1HF3A 2C1XA 1L5YA 5ESDA 2OQ2A 4EYEA 3UBMA 4KYUA 3ZWYA 3SIRA 3OFVA 4ND6A 3QLVC 4OBEA 1W9HA 4BIMA 1FYDA 1KAEA 5HEKA 5JQGA 1SCJA 3B6EA 4Q66C 2XGJA 1RWOA 2RHDA 1VC2A 2FRDC 3DBOB 1QHHA 1BN6A 4WHMA 4W1PA 1OZGA 1NV8A 3VPSA 1EP3B 3D6VA 4IZOA 4NBRA 3K1AB 1HOTA 4YCJA 5GPBA 3L0OA 2REQB 1XZHA 4NECA 3T7SA 1YUMA 5K3CA 3ZH2A 3WOVA 1E2BA 4RA6B 4ZYZA 3AR5A 3A1SA 2Y1LA 4CM3A 1I3KA 4L51A 3VAAA 4HGQA 1GZVA 1YZKA 2BM1A 4DABA 3GRPA 3C5EA 4NNOA 2G82A 3CNBA 4IWXA 5HIMA 3ZD7A 3UT0A 1DG3A 1JEOA 1H6CA 4XR4A 5YASA 1B00A 2BP7B 4B76A 4LZJA 4LBZA 4C4RA 4H60A 5D1NA 3R9XA 1XGKA 1JEYA 2HJGA 4Z2YA 1OKKD 1EBFA 3ZDDA 1Z73A 2BMAA 4ES6A 3JAWA 2P67A 3H05A 2WJHA 2J6HA 3QNUA 4B2YA 4IIJA 3NHRA 5K4AA 1LV8A 2YN4A 3LC1O 5FYDA 2F90A 1BWRA 2NOAA 2BM9A 5B7GA 4Q4JB 5C37A 1YCDA 1QIGA 1ZK3A 1S9HA 3A9TA 2IF2A 4OOEA 1B6GA 5BN3B 4BKUA 2ZWVA 4FUTA 5A9TA 2C96A 4NMHA 3ZDQA 1AS0A 5I51A 4F0JA 3ZXUB 2BT4A 1FP1D 4EG6A 4CMEC 2EVWX 1UOEA 3G8DA 3OG9A 4Y6LA 5CK4A 1P9NA 4QO8A 2YZ7A 3LZDA 1UWLA 3MTGA 5F9HA 1NW8A 4R2LA 5BYKA 2QLJA 4NCBA 3W7VA 2QEQA 3CPHA 2OV2A 3FDZA 1GPMA 4N5HX 5CW1A 3UNXA 1DLIA 3KJIA 1U0JA 1M5TA 1KNXA 3I2JA 5DX0A 3RFCA 5FD8A 5KYWB 4GR5A 5TT0A 1WL8A 2QX9A 4CMIA 5LNK1 1KQFA 4BV8A 5CLIA 4G8CA 5BRJA 1X2BA 2IH2A 2G77B 5DM0A 2ZSEA 3H4TA 4X61A 1RCTE 5HMLA 5JYBA 3L1KA 3ZJ4A 4CMAA 2B30A 1TLFA 5C1PA 3JW8A 1ZGBA 2AIRA 4FYWA 3GGOA 2YJZA 2E89A 1JXMA 3IR7A 3K5PA 1QFZA 5L4LA 4MV9A 3LQQA 4KLRA 2W48A 4LA4A 4WCFC 4KPEC 3WL3A 1Z5UA 1IOLA 1D5CA 1U8AA 1DLJA 3WQHA 1P80A 2IUYA 1W581 3KXIA 4BNKA 5JMOA 2QK4A 5FKJA 2MYUA 1E9FA 1N9ZA 1R8JA 1XWFA 1HFEL 2QNRA 2VRCA 4IF6A 1P2DA 4RSRA 4XD7D 1YR6A 3WC4A 4R4JA 2O0HA 3B52X 4WKNA 2OCAA 3VDQA 1CUYA 1GZ5A 3SS8A 4NYIR 2QUJA 2V03A 4AWXA 4DIBA 3R7FA 4DCUA 4O2AA 3R7NA 4DM4A 3ESRA 4OQEA 1RYNA 3PRYA 4MA4A 5AVSA 1E1CB 5AOBA 5FADA 1JAHA 1XF1A 2KPOA 3QEOA 5J5CA 3ROTA 1Z2DA 1GUFA 3OHPA 4QU5A 3K0FA 4QLBA 2I6GA 3L7MA 3DNPA 5B37A 3KOOA 3JD0A 1VG1A 3FETA 1CY2A 2CFCA 2VJCA 4UM7A 3H5LA 3P9NA 2J41A 4XIYA 2PL9A 1CS0B 4IDDA 3RSZA 4AW9A 3IUJA 2HHHB 3IEMA 4URYR 4PC6A 5HQTA 1Q44A 3FHJA 4ND5A 4L02A 3LU1A 4C6TA 5AVQA 4AYTA 4MW0A 5BQPA 2OZLB 5FOTA 4JJ4A 4E09A 3QHAA 1A8UA 5TQ2A 4FE3A 1MQSA 2PH5A 3M5CA 2D1RA 4PG8A 1ZOSA 1WHSB 3TMAA 1VSUA 2G9ZA 1FRNA 1H5UA 2J7KA 2C57A 3CUYA 3MCUA 5KNBA 3PENA 4N18A 1ZESA 4H3HB 4PYMA 4WAUA 3O31A 1Q1QA 1ZAKA 2DPHA 3KWMA 1P74A 4RW0A 3IP8A 4JZYA 4TYNA 1FTGA 2ZCJA 2YWEA 1K9VF 4ZAGA 4G5QA 5ALOA 1YZNA 3V48A 1E0DA 1LVHA 2TMYA 2AXPA 3BMCB 3RC8A 1EFHA 3H04A 4J43A 4FQ8A 3DFZA 4JMLA 1EZ1A 1ENYA 4OJTA 2X0FA 1V3UA 1UKYA 1VRWA 4EEKA 4EHJA 4LPSA 3T5DA 3BHMA 2QL6A 2NW6A 2P9FA 4DQUA 4EPWA 3PQ2A 1XT6A 5EE0A 4MI9A 3AH8A 2IWRA 1IN4A 1GZUA 4N47A 5FX2A 2GEFA 3IS3A 1F2UA 1IK4A 2O0LA 1JKIA 2D4AA 3AU8A 3K96A 4GECA 1T4CB 1GPDG 2OKCA 4KAJA 3WLJA 3OZIA 2IS4A 4QQ8A 4IILA 3GB9A 4FDTA 3IR6A 1EFUA 1E94E 4UXHA 3JR7A 4UATA 4YPVA 3LAWA 3EGIA 1G98A 9ATCA 1M1NB 1QUFA 1S5PA 1GKIA 4JH0A 4KBFA 1M6VB 2PKQO 3B2EA 3GX1A 1BE1A 4TXJA 4ZPJA 3HVKA 1PFUA 2QRPA 1JLSA 3O8BA 3R0ZA 2H16A 2ZRMA 3UN1A 4YY3B 1RRPA 4OP2A 5AOVA 2PUCA 3RTCA 1FVOA 3NW9A 3W5BA 2QD3A 4XCVA 1DWPA 1YB4A 5KYGA 5TLSA 1P60A 5BOSA 5L3SA 1P8JA 2JNWA 3AEYA 4LCEA 4DREA 2EFHB 2FZCA 3KQQA 2JJ8A 1S9DA 5G2OA 2C3UA 1QFJA 4MKRA 5L51A 1EXDA 1NWHA 2WG0A 2GK4A 1RP1A 3BXOA 1Q2UA 3JVVA 4FFPA 1G8AA 1QJCA 2GAJA 3N8NA 1BHO1 4UU8A 3DBLA 1A7AA 2HOQA 3D7LA 1IFXA 2IY8A 4HD8A 4RMIA 3KEOA 2YJGA 1II9A 1MO6A 1O8BA 4JCCA 4RBNA 4GEKA 3RUIA 2BGRA 1GGJA 2CXSA 4KP7A 4PZCA 3FAZA 3DQZA 4JB3A 2X7HA 3RYFA 2P6UA 2GERA 1CU1A 3IP3A 3S2ZA 2ICAA 3KJGA 2C61A 2FR0A 2FSVA 3M6UA 1I9CA 2X0EA 1LD3A 1G2QA 4PPFA 9LDTA 5GVRA 4NNJA 5JS8A 2ZT6A 1P1RA 4H7HA 1OZAA 3RIEA 4DLWA 2HXYA 2DHQA 3ZY2A 3TR6A 4XUCA 3K9QO 5HS4A 5JPDA 1KJNA 2AR0A 4K28A 1RBMA 3FR8A 4QPNA 5BN1A 2IOFK 3PL1A 5CGZA 1O6BA 3LUAA 2G76A 3SIWA 3QX9A 2MINA 1YMQA 5E9WA 3U81A 1IYZA 4YQZA 4D3DA 2QYTA 2O3RA 2BF7A 2OCDA 1KZ4A 1Z6XA 3NKVA 3H5AA 4IH4A 4AJ2A 2KBEA 2Y0PA 4ZCQA 1GNTA 1MC1A 2CYBA 5LWHA 3MT7A 1O08A 4MYTA 3WLLA 3IH5A 1G6OA 2RH9B 4KBGA 3KD2A 3ZDXB 2R97A 5DMXA 5GOZA 4HB0A 2J32A 2AW3A 4G0MA 4J91A 3ZE9A 2CHUA 3L0ZA 1G60A 1QH1A 1IL0A 3K0CA 3L43A 4EGQA 4V1CI 5K45A 3DW1X 1PZFA 1IZ8A 1F9EA 1MBZA 3NOVA 4ER6A 4F72A 2VYNA 2ZRCA 5ALLA 2FPMA 3NUQA 3QNMA 3L1UA 3RKUA 2XD4A 4C1BA 1XPOA 4YAKA 2P0YA 4IJKA 1PJ8A 1YVEI 3AHHA 1F38A 1TADA 4FHEA 1F2VA 1YA6A 3GELA 1S6YA 1PVDA 4WH0A 4EUKA 4OL0A 3OJ0A 3V1MA 2IU6A 3LRXA 3DVRX 3OEYA 3GFRA 4LOJA 4WNAA 5FBRB 3GZTB 2ESRA 1FXUA 4AF8A 5JY1A 4IVNA 3NNSA 3DEHA 3GFPA 4A27A 5A4FS 2ZTLA 4IGIA 2BFCA 5IKEA 1KKLA 3N2GA 1ADCA 2UUAB 1EESA 1IULA 1F1JA 1K7FB 1J20A 2NP6A 2P3OA 3GJZA 1ZH2A 4IQ0A 5AI0A 3UWDA 2W2TA 2GJSA 3EXHC 1ZVKA 3CWQA 5CA0A 2VK1A 3LF1A 5DM2A 3RWMB 3K0AA 2QRKA 1OAOC 2HIGA 2ZBGA 4PSDA 3GEPA 2Y4OA 4BO2A 4ENVA 5HZKA 4KVFA 4P6VF 3AESB 3MRTA 3MXOA 3CNNA 4LYGA 4MR9A 2EOAA 3GA0A 4MR8A 4PBSA 4C30A 4WK0B 1DJOA 4IR7A 4HX2A 2XBMA 4DY4A 2HO4A 4MV7A 3UWOA 2V5VA 5FO0A 5KJEA 1EDOA 1UBOS 4JB8A 2QV0A 3UTDA 3GFBA 1C8VB 2RGCA 3EODA 1T5LA 4YEDA 1FRVA 1HM5A 3GFQA 3H2HA 1N34B 3UMFA 4JT4A 1F6DA 5COAA 4LV6A 2FPXA 2B35A 2G9NA 4NONA 4L08A 1W4ZA 4JYPA 4DCSA 4NVRA 4YAGA 1A95A 2BGTA 2I7DA 3IQWA 4WIAA 4CFZA 4R41A 1P1FA 1W7AA 1PD1A 4O4JF 2FG5A 4CL3A 4K0KB 2ZU0C 4CU2A 2JGAA 4Q9NA 3G2QA 3H9BA 2RSLA 3K5IA 2R66A 3WK9A 4JOBA 1RZRD 3DE3X 1U3CA 3LPMA 1A4RA 1SXIA 3LDGA 1S8FA 4IDBA 4QUJA 5BWCA 3ONFA 4HQ0A 4YQYA 2W2KB 1UBCA 4P81A 5U1PA 4CLDA 3TF5A 3K92A 4ER3A 1XE3A 4TVBA 3A3KA 2NPFA 3WBFA 4BO0A 4DG9A 5IZCA 4LFCB 3WAGA 3HABA 1BGWA 2YTZA 1ISJA 5BRNA 1XEXA 4YP7A 1A7UA 5K0JA 1I7QB 1Z4LA 5DP1A 1QG2A 3K9LA 2RK3A 4DPMA 4F2HA 2OFWA 2QM0A 1UJNA 1YQQA 1T8SA 1Q3HA 3C5WP 3TZHA 2Q0XA 1L7PA 4PRKA 1UDBA 1PHPA 4NS4A 2ZSHA 2B8EA 2X5JO 1GTL1 4KC0A 4NQZA 4IJUA 2IEDA 2QNBA 1SY7A 1EWQA 2NAFA 4Z3DA 3GR6A 2AE2A 4Q3KA 5BMVB 1S3SA 2JANA 2QGZA 4RHFA 2ZAMA 1OVMA 1KR5A 1MX3A 1PBTA 3UC9A 3V7UA 1E7WA 4QPPA 2H92A 1FNMA 2GF2A 3IOMA 3X1WA 2BSQA 2BDEA 4DJTA 3FCEA 4RKWA 1X87A 2P3SA 1H6BA 4U3JB 1H4TA 2BTQB 3GO4A 2FDXA 3GG2A 4E5PA 3K6SA 2Y1CA 2TYSB 2ZIAA 1HK7A 3AEKB 4PWZA 1H22A 2XYHA 3JQ7A 1A2BA 2HTEA 3PHBE 3OP4A 5GONB 4C6RA 4CUJA 1GRQA 1LNSA 3WMEA 2DHDA 3BQ9A 2LCQA 1N5OX 4FCVA 4O0MA 4R1OA 4OH1A 3ZWAA 1QQBA 5F64A 4B7ZA 1SKBA 4ZVSA 1YU9A 4HOYA 3WIUA 3DXXA 4G09A 5DYWA 2NU9A 3C3XA 3U7QA 4AICA 3PDIB 3PSAA 4O4JB 4M8IA 3WIVA 1OYWA 3R3ZA 5ICMA 2NXJA 3VOSA 3EXIB 4HFRA 4WTOA 5FLXA 3CGGA 3ECSA 4KR2A 1N5IA 4F21A 1K8QA 1V7PC 2IYNA 3EASA 1U0NA 2HBZA 2PFGA 4OIFA 3WGHA 3GRUA 1Y8QA 4RS4A 1J21A 1IEWA 3MTQA 4CIXA 4AS1A 1KI6A 2H08A 3DG9A 3PCXA 2L69A 3HB1A 3IBCA 1WVIA 4BLOA 4D82A 1LSOA 2I7TA 4MV4A 3UTCA 5CB4F 4BMCA 5BWBA 2YL2A 3VR3A 3DEJA 2C03A 1BNCA 3PNBA 3KKNA 1BX1A 1NVEA 1HKUA 3OIWA 3OWOA 3RVMA 4JBHA 4XQGA 5CB0A 2O1XA 4YJKA 4DBVO 3HZHA 4TN5A 4DLPA 4XQ9A 1J5EB 2DXIA 1U80A 1GLGA 4DSZA 1LPMA 4XPIA 5ILOA 3ZWDA 3BL6A 1PEDA 4X6UA 1A8SA 2PUDA 5E2IA 3ZY3A 4FQ5A 2VPYA 3BTVA 1SCUB 4RD4A 4EGAA 3HU3A 5D6NA 1N36B 5FTMA 4R5MA 3BH7A 4RVHA 4PLFA 1BE0A 1A9PA 1GILA 1ZD5A 4TV8F 1FTQA 1QCYA 1SA0A 3DV9A 4B45A 1A1SA 3QXXA 4CUKA 2GCOA 2O7VA 2ZB7A 5AM4A 2VKQA 4MZDA 4FK8A 4HXFB 4FNGA 4OSPA 1BKSB 5GIOE 4O33A 3FWYA 2AEEA 1LDYA 2F9LA 5HIAA 2WF7A 1ZGGA 1P0FA 3KPJA 3WK4A 1XJ5A 2PWAA 1JR3A 3TYXA 5LMUB 1EIZA 1S01A 3GJ7A 4DMCA 4BNTA 4L8VA 5FL7D 4JL5A 2WUDA 3IHTA 4URHA 5FNVB 1J0EA 2D3TA 2ONZA 2X3YA 4Q00A 2DRIA 1G291 4Y1RA 3OQBA 1KMNA 4K3UA 1JFRA 1GPYA 3ZCTA 1GTSA 4N0EA 3HFGA 3KSMA 4TUYA 1VSTA 2OFFA 2RAVA 4D1YA 1ZCZA 2WAYA 4TLMB 1DVRA 4KQCA 3WQBA 1BCRA 1P0CA 2XA2A 5C4GB 3S2EA 3BA1A 1F2DA 5IASA 3MTAA 4ZK2A 4QU9A 4MUYA 2OYRA 1V1MA 1XAJA 3ESBA 1FL9A 1CHDA 2OXTA 3PXDA 3OLZA 4WLOA 5ESWA 3ZXIA 1YJ5A 3DOUA 3IODA 2LBPA 5FB3A 3B1JA 3PX7A 1K27A 5BUZA 7MDHA 2LWIA 4HGOA 1M2OB 4BN5A 5GMOA 1XQYA 2OOSA 2WU0A 5LD2B 3UJ7A 1Q0LA 2JJQA 3KTOA 5IABA 2M6RA 2DY0A 1CZUA 4XYLA 3KZKA 1NQTA 3DBIA 3PUZA 4RFSB 4DRZA 1HTWA 3VC7A 3Q9NA 4PO3X 3VVBA 3H2JA 4CM9D 1D2AA 2BKVA 2OFXA 4U2KA 1KYYA 1Q0PA 3AW8A 4P54A 5B3AA 4NULA 3WWPA 2R0QC 1HX7A 2CMHA 3PEEA 4RPGA 1I3LA 1N2CB 1OI3A 2Q6VA 3AJEA 4HWGA 3V2GA 2I76A 3WNBA 3WZ2A 3OESA 4DA8A 5ISMA 1TT7A 3GGGA 1H2BA 1BMDA 4OYRA 1PGPA 1AKUA 2MSLA 4QFCA 1F8YA 5LZ4A 3AEXA 3NU1A 4HLQB 4AK9A 3KDSE 4ME6A 5EZYA 6AT1A 3F6YA 2ZI5A 3GLQA 4CKZA 1QO0D 4RSGA 1ID8A 4J76A 2E6UX 2SECE 3RH0A 3U49A 4GZMA 5LXTA 4UUNA 3RVKA 2HK8A 2Q1YA 2X1VA 3Q10A 2IOQA 3DSRA 1XV5A 1ETHA 1OLSA 1KY3A 1LDBA 3KOXA 2ZVPX 4KVZA 3QKSB 1I32A 1P3Y1 4OXRA 3U7RA 2YYZA 4AIIA 4CLRB 3EA0A 3MHTA 3BMNA 3DC2A 4N0DA 4B7AA 2XXAB 3AY0A 2Q3JA 1NBIA 1PX2A 1T6YA 2ZRGA 2FEAA 3MJDA 3ROEA 3ZWNA 1E7SA 4JXZA 4Q01A 1GZSA 3U7IA 1IIRA 4ACBA 4I81A 1S4MA 1IQPA 1DKMA 3FWZA 4JELA 3J80A 13PKA 3U44A 4MRMB 4LOHA 5JC8A 1DC4A 5FUWA 5I4BA 1ZK1A 3ZCRA 3TKYA 2R8OA 5FBQB 4I36A 1U2EA 4MARA 3RSOA 3FXAA 3GQVA 2F2TA 2HK6A 3E0XA 1YR1A 1FFAA 3FB4A 4OO3A 3OIYA 1J99A 4J29A 4QUGA 4DANA 4X62B 1TOAA 1ZX1A 1BMFD 5B6PA 1VJ0A 2ZIXB 1FTNA 1UJBA 3IOEA 4RE6A 5HG0A 1XXLA 1RM4A 1HFWA 3BSYA 4W63A 4C04A 1JGTA 4U0JA 4TWRA 4FE7A 1YUBA 1Z3IX 2OLJA 3IPCA 3LRPA 3RAJA 1IONA 5GOTA 4PLCA 4KK3A 2HMAA 3AJ9A 4K1XA 4BNFA 3G85A 1ZOLA 1PV4A 3KAJA 5KCMA 4LVNA 2YS7A 2WIKA 2ZJ1A 3G68A 3HI4A 5DK4A 1DDIA 5LMCA 2JKZA 1ANKA 4P2GA 2WPDD 4PRYA 1PFQA