3FMFA

Crystal structure of mycobacterium tuberculosis dethiobiotin synthetase complexed with 7,8 diaminopelargonic acid carbamate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
230
structure length
229
Chain Sequence
FQSHMTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7,8-diaminopelargonic acid synthase and dethiobiotin synthetase .
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
molecule keywords Dethiobiotin synthetase
total genus 73
structure length 229
sequence length 230
chains with identical sequence B, C, D
ec nomenclature ec 6.3.3.3: Dethiobiotin synthase.
pdb deposition date 2008-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13500 AAA_26 AAA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3fmfA00
4R2IA 3HDTA 3AVUA 3K0FA 4KODA 3WHKA 2RH5A 1G3QA 3P4YA 3K09A 1E69A 3KJIA 4D0LB 4A2PA 4UXIA 1TQ6A 1TEXA 4PPNA 1VYTA 2FGJA 4FINA 4EJSA 4W5HA 2O0HA 4B2PA 2I3BA 2NOAA 4JVLA 2NQ2C 1S8FA 3IHLA 1MO3A 4QNRA 1W4CA 4NYJR 3V9PA 1FX0A 3RSOA 5IF9A 3QXJA 3BIFA 1QHSA 3PITA 4MA4A 4A1FA 3CF0A 2RB4A 5CK4A 1DVRA 4PC2A 4V0ME 2ZIAA 1LY1A 1E1RA 1GKUB 2NO6A 2P6UA 2QMHA 3DZDA 3WBKA 5FFMA 3U3MA 3DOEA 3D7MA 3KB1A 4P31A 4DCNA 2ZYTX 4EJSC 2Q3MA 1YJ5A 3QY0A 4I99A 1XMVA 1M34E 4EPTA 2KSQA 2GK6A 1NL3A 2QTFA 2RKOA 4EPRA 3ADDA 3CRRA 4GRAA 2MSDB 5GJVC 3RVBA 3K9HA 2IYLD 1OJLA 4JZKA 1Z3IX 5FTNA 2G0NA 5FUXA 1O87A 2L0XA 3ZD7A 5J4LA 2DR3A 4F4IA 1N0VC 3IO5A 4RJLA 4F91B 2P6NA 1LS1A 1KZGB 5TV2A 3SE0A 2V7QA 2BDTA 4IDPA 4V0MA 4I1VA 2WOJA 1RVDA 2UKDA 2X77A 2W6ID 2GEUA 4QOSA 5LB2A 4HB4A 3U3JA 3OEEA 4DEYA 1CBUA 1E96A 2CCGA 3LAWA 2CK3D 5CK5A 4ARZA 1MV5A 3W34A 5DYGA 5FI0B 4OQNA 4F4CA 1QHXA 1HA3A 3P1JA 3QOFA 4Q7LA 3F3YA 1TQ4A 1VMAA 3AVWA 2QMUA 3LX8A 5GJCA 5J4HA 4O3MA 2ZM5A 1W5SA 3VR1A 3UMSA 2ZUDA 4Q00A 4XSGA 4MGZR 4XOIA 3LO5A 2A2ZA 1F5NA 1Q20A 4Q9IA 5GJWC 3GLGA 4DHEA 3UKDA 2ODNA 1W2GA 3TW4A 1UDXA 2OCBA 3U7GA 3NHAA 4PSAA 1AQUA 4JL8A 3W5JA 2AL7A 5FUVA 1U98A 1BMFD 3X1DA 2DFTA 2IF0A 1U2RA 1K8RA 2P5TB 5FTLA 5FOSA 5E7IA 4NMMA 3Q7PA 3FVQA 4HAUA 4LJ4A 4TLEA 1UAAA 2IS1A 3FMPB 2Q9AA 3BK7A 3AVXA 3DM9B 2PEZA 1GWNA 1E0JA 1ZUIA 3CM0A 5FTKA 5IK2A 5M04A 2PL3A 3X1XA 1FMJA 1SKYB 3B60A 2AXPA 1P61B 1KYIA 4IOMA 1E9BA 2QSZA 4BGDA 1ZC3A 2OCAA 1YZLA 4DEXA 1KOFA 2QAGA 2O8DB 1SVWA 4YC7A 3QPVA 1OH7A 2C77A 2QM7A 5FBVB 1ETUA 1E9EA 1RYHA 1SVLA 2J9RA 2GK7A 3PUYA 3ICQB 4JJZA 5B57C 1OKKA 1VYVA 1MABB 2CNWD 2JA1A 1P9WA 3WP0A 4YMUA 1P5ZB 1TUEA 1Q12A 4ZI3A 3AQ4A 3WMFA 1L4YA 3B1XA 1JR3A 4NE2A 2IYQA 4B2LA 4QL3A 1ELOA 2BMFA 3THWB 3BXZA 5CIQA 2W6JD 3TUJC 2PH1A 2O52A 1U9IA 2FSHA 2XITA 3QKRA 2QG6A 4M1YA 3H84A 1TPZA 1WB9A 2EQBA 3RYTC 1ZM3A 2ZRJA 5AJVB 3S1AB 1ZM2A 3A1VA 4PQRA 3U6BA 3BH7A 3PUZA 2JJ8A 6Q21A 4M1TA 1CIPA 5KSYA 1LW7A 2IYXA 1NLYA 3OFND 3ADKA 4ILEA 1F60A 4BLQA 4FMCF 4M22A 3DHWC 3OAAD 1R8SA 2REOA 4GBMA 4AC9A 1MO6A 4IEIA 2YWEA 1XWIA 4KYIB 2ZI7A 1P6XA 3QSYA 5F9HA 1TTTA 1W2HA 3P20A 2ZJ8A 3GJ3A 2ZE7A 3HP1A 3I61A 1P2UA 2CHGA 3KKQA 1K5DA 3MMPA 4OJQA 3RSLA 2TMKA 4RCZA 1KIMA 1E2NA 4ZDJA 1DS6A 1DELA 1Z0FA 1EFRA 2J46A 3QI2A 5JHGB 3PG5A 4JL6A 2PCJA 3GFTA 4LHWA 4ASUA 1Z8FA 1DAHA 3BWDD 2G1JA 1CULC 2ATXA 3SS8A 3AVPA 5EQTA 1E9FA 2WOOA 2OCYC 1XTSA 2KI5A 3TNFA 3GEEA 3LVRE 4LHXA 4TYNA 1WDTA 3SYNA 3TR5A 2B92A 1U90A 2C96A 2IUTA 3B6EA 2ZXUA 3KQLA 1G21E 3RS4A 1YZUA 3K0AA 1VECA 4MDEA 4NDZA 3CB4A 2ZRBA 1KK1A 2NO0A 3RC3A 2OBMA 3ZIAD 5KSPA 4AYTA 4D0NA 5JEEA 1MT0A 5TVKA 4ZCIA 3MWYW 4Q18A 4YDHB 1DPFA 3T12A 1KSJA 3B9PA 4NU0A 4RFSB 4WAUA 3OIUA 5G3ZA 3PEYA 1XMJA 4BPBA 4PHGA 2BKUA 5JRJA 1AK2A 3DKVA 5FPSA 3FMFA 4QC2A 4PZLA 1F2UB 1TU3A 2ORVA 4O0MA 1ZD9A 3FE2A 4LPSA 4GOXA 1XD2A 1LFDB 1RYFA 2KB0A 1XCMA 2Q6TA 4QGHA 4N3NA 2AD5A 2HEIA 5FTJA 1BOFA 2JLXA 2QBYA 2HT1A 2VYFA 2BM0A 3U4QB 1Z0JA 2H18A 1V43A 3OE7D 3R9IA 4BFZA 1T3LA 1X8KA 2QQEA 2ZRDA 3UXMA 3WNCA 1HV8A 1NVVR 3A36A 2RCNA 3PEVA 2OBLA 2P0EA 4NCHA 4XIGS 5E95A 5AR1A 1KO8A 1NMZA 4E09A 4Q4JA 5KYKA 3NTUA 4PAQA 1CRQA 1I4TD 5GVRA 2HXSA 4AI6A 2WKRA 3PUWA 4KO8A 2D4HA 2XGJA 5CIWA 4MGIR 1YHNA 121PA 1SVMA 4URWR 2QEQA 4V0OA 4BLPA 4QKQA 3A58B 2ZRAA 4Q7MB 3ZZ0A 1SXJA 3BC1A 2QGZA 1G7TA 2GESA 2JEOA 1OIWA 3EZFA 1ZU4A 1P9NA 4BUJA 1EFCA 1IY0A 3DZ8A 3FKQA 1S4QA 1XEWX 4B44A 3ZVRA 2MSCB 1RIFA 2YOFA 2Z6VA 4B3CA 2A5GA 1G8HA 1YZKA 1DO0A 3EZ2A 1OLOA 3K70B 1GOTA 1DAKA 1E1RD 3RS3A 3ZJYA 3L2OB 2FFAA 3IQXA 4RD2A 1QDEA 1GKIA 2VF8A 3TAHA 3IBYA 5SZKB 4LGMA 1HQCA 4G0NA 2IEYA 2JDIA 3M1IA 3TVTA 4D4KA 2WJJA 3SBDA 1U0LA 4BQSA 4MDFA 1NN3A 221PA 3GLFE 5CDFE 3K0SA 1WA5A 2HDNB 1UPTA 2UZIR 1CR4A 4TTPA 4A82A 3I5YA 1E0AA 1W36B 3PVSA 1KO7A 3VR5A 3EXAA 1RRPA 4TYQA 2A30A 4UNNA 4HB0A 4IVPA 4POAA 4I1UA 4Q21A 2F55A 3CNLA 5EUQB 1S96A 2FN4A 1KAGA 1KI9A 3GLFA 3KKMA 3B1WA 2IWRA 2PMKA 1E79A 2WWIA 3K0FB 4N1AA 1XTIA 1KAOA 2YKGA 4BFUA 5KSZA 4HDCA 5EP3A 4QM7A 2GBLC 4ABYA 2RGAA 4KJZA 4QGFA 4TN1A 3WRXC 1WBDA 4JMPA 3I5XA 3AM1A 4KHZA 2I1VB 4UXHA 1GITA 2V4ZA 2XTNA 1E1QD 2IHBA 3NHBA 1XMIA 1G3MA 3NDPA 3QNUA 3NWJA 3LNCA 3GP8A 3CO5A 4DDVA 2BBSA 1J90A 2BOVA 4Q7JB 2F1RA 2GCOA 3T1OA 2OFWA 2V1UA 1VYUA 2ZYVX 4B3FX 3Q5EA 4JLMA 4RKFA 3OEHD 2I4IA 2NO1A 5DGXA 5KU1A 1WBBA 1WP9A 3CPEA 5KPDA 2VTKA 3NH9A 3HU2A 1J8YF 3RS5A 3UIEA 1ODFA 3RC8A 2F6RA 4S35A 3A1SA 1T3SA 1YRBA 4JYBA 4LBYA 1HT2E 5EUMA 3V4FA 1A5TA 3KKPA 4BZXA 3FHCB 3B82A 5H8WA 4O2RA 4PO9A 1G8FA 4HDQB 4EUNA 1YVDA 4HZIA 4LC0A 2QE7A 3VKWA 3EPKA 4DLWA 2QPTA 3IQWA 1GRNA 4AWXA 1II0A 4RCYA 1PLLA 3EX7C 2W0SA 4CEHB 3ZIAA 1OHHD 2O8BB 2OILA 5BN5A 2Q3HA 1EFTA 1D9XA 2KE5A 4HLQB 2IYVA 2QMEA 2Z4RA 3OIWA 3Q9LA 3B85A 4L9SA 3HPRA 4US1R 3LV8A 4HUTA 3UG6A 1YZGA 3CPJB 2JAQA 1NJFA 3BJIC 4TTQA 2R6FA 2WAXA 5HTKA 2C8VA 1ZIOA 4B34A 3WBJA 4G5OA 3BH0A 1E0SA 4BECA 4DJTA 5G40A 2QPOA 1R8QA 2JJ2D 2V55B 1EGAA 4IOLA 2WJVA 3TIFA 1FPMA 1AM4D 3AEZA 2IS4A 1E2EA 4LJ5A 4GMDA 2XNDD 4RZ3A 1NSTA 2VA8A 2ONKA 1JPJA 3GJ7A 4FCWA 5LBIA 2PEYA 4IDQA 2WMNB 4OQMA 1U0JA 3K0AB 4Z8XA 5FOTA 3OEHA 4KVAA 5FR1A 3GLGE 5EP4A 1KO1A 1U81A 3Q85A 3UMFA 4X8HA 4PZYA 1AA9A 1G7CA 2XJ9A 4QNMA 1Z07A 4U02A 5EXPA 1DARA 2O8FA 2AFHE 2GKSA 4BZPA 4HB2A 1X3SA 4Z1MD 1XZQA 1Q21A 2HJVA 3PUVA 4PC7A 4O2LA 5H68A 4RFVA 1QZXA 3EA0A 1ZUHA 4M9XA 2KBFA 1E9DA 1Z6AA 4ZCLA 3WXMA 5DHAA 2D7DA 4LPKA 3QF4B 2A5DA 4P4TA 3SOPA 8OHMA 2QQ0A 5K8TA 4A9AA 3ADCA 1IQPA 5JFGA 3A1TA 3AB3A 4C0JA 2JDID 2W0MA 3Q5DA 2WKQA 4MGKR 1KKLA 1E2PA 3I8XA 5CM9C 4ZI2A 1Q57A 2J87A 2ZSBA 1IN4A 1XXHB 2CLCX 1GILA 1OXXK 2FA9A 2WAYA 1G9XA 3VQTA 1DG1G 2EWVA 4BLRA 4HAVA 3WHLA 4A8JC 1XTQA 4BRWA 5GADl 1ZM7A 4TMXA 5SZHB 3VR2A 5JMTA 2REBA 3GLIA 2ANCA 2D3WA 1R4AA 4Q9HA 3SHWA 4JLOA 3L0PA 2ZVPX 4QGAA 1EFRD 3N2EA 2DPXA 5DSZA 3UPUA 2H8KA 1US8A 4NONA 3T5GA 2CJWA 4YLGA 1QBKC 1VCMA 5TY0A 3CIOA 4M9SA 1G4AE 2GZHA 2J0UB 3RWOA 3W8NA 3AF4A 4A92A 4C7OA 2Z43A 4C30A 2CVFA 2ODWA 2FV8A 2G3YA 3GJXC 5FL7A 4RD3A 2BEJA 3BOSA 2ZUCA 1DADA 1DO2A 3OFNA 4TYPA 2QPAA 3VX3A 1EFHA 1IM2A 3AF0A 821PA 4B48A 2D2EA 5CB6A 2ZRKA 3EIQA 2FEMA 3C4JA 4FXPA 1W36D 1ZVQA 3G0HA 2BCJQ 1HY3A 5C2JB 4OHYA 5JJKA 4BWYA 2H1LA 1Z5ZA 3QENA 4EFNA 4CGZA 1XXHE 1DG3A 3ND9A 2QL6A 2GHIA 2IXEA 4HLUC 1YZTA 2RGGA 4CEIA 3VU9B 5ANRB 1E6CA 1Q1BA 4NZYA 3GD7A 1J2JA 4WZAE 4R9UC 1Z0IA 5E7JA 2GCPA 3EIEA 3TH5A 3VHXA 5KSOA 2WVJA 4GP7A 4MRSA 5B64A 1KZ7B 5L3QA 4ZKDA 2PT5A 3LLUA 3AH8A 3LW8A 1U8ZA 3KB2A 4LCBA 2C04A 1KNXA 4L4UA 2D06A 1JALA 1FQKA 1XTRA 1Z22A 4TLCA 1CRPA 1NF3A 2WSMA 3OE7A 2XNSA 3IEUA 1VIAA 3C7KA 2VIIA 3QG1A 3A37A 3EPHA 1CS4C 1OIVA 1NG9A 4LDJA 1R2QA 1ZW6A 4XD7D 2WWWA 5FBRB 5D3MB 2PJZA 1P2VA 3VNUA 3AVTA 1HTWA 1NIJA 2WBLC 1EWQA 1ZNXA 2DHRA 1A7JA 1LF5A 2RGBA 3X1ZA 3VKGA 2CL6X 1KI6A 3LBNA 5CLQA 4JLDA 4Z54A 3FKSD 1X8LA 5FR2A 4XTCS 4B74A 4TLBA 4CRWB 4KVGA 2ZSFA 3MFYA 4Z51A 3UWKA 4IW3B 2O0KA 1C9KA 4BFWA 3B78A 1TF7A 1G5TA 4JLAA 1VG9B 2ZJBA 2C95A 4EFLA 4TTRA 1XNJA 4Q48A 5DI3B 5DNYB 4D2IA 1FNNA 1LVGA 3PENA 4O25A 5JS7A 2VHJA 2ZI9A 4EIWA 4AG5A 4TZ0A 4MGYR 2XTMA 1Z6GA 1J7KA 2E9SA 2WWXA 5KDOA 1A2KC 2P2LA 1KSHA 3CR8A 3IILA 4LYFA 1E2HA 2LCFA 3HU3A 2VP0A 2JLWA 4AG6A 3R9WA 4N0DA 2E1RA 2WJGA 4LBVA 2H5EA 3TSWA 2OEPA 4CEHA 1YZQA 3U3OA 3NBFA 1OYYA 4TMVA 2RGNA 1XJ0A 4G01B 3LXXA 4E07A 5KTYA 3FHOA 5AJXA 1RKBA 3IDQA 4AY2A 1G8GA 1S1CA 5EE1A 1VCNA 4Q02A 2FSGA 2VSOA 4PO8A 3UMRA 3C15C 4I1OA 1CU1A 1ZCAA 3WYAA 2WWYA 3AF1A 4GZLA 4Q1DA 4Q66C 1GSIA 1A82A 2BHRA 1P75A 3EA5A 2IXGA 3BERA 2NPFA 2GWHA 2ZU6A 3QKSB 3AF2A 1KTVA 4DLYA 3KJEA 3ONWA 5JCZA 2J0QA 1Q3TA 4FI3C 5IHPA 3QF7A 4K8OA 4HI0E 4GZMA 3GLIB 2G1KA 2PT7A 1MO5A 3BBPA 5KOYA 1FQJA 2JGNA 5C46F 3EASA 2IYWA 3DEFA 1W4AA 4MYCA 1IN7A 2HUPA 2XTZA 4IFEA 2ZRIA 3IUYA 2O8CB 4HAYA 1BIFA 1YKSA 1WQ1R 2ZSAA 5KUTA 3BFVA 1FUUA 2X19A 1AJEA 1II8B 1OIXA 2OFOA 5JBQA 1RZ3A 3CR7A 4TQ9A 1QHIA 1Z0DA 3HR7A 5L3RA 1TUIA 3EC1A 3SFVA 4JLPA 4FCVA 2X2FA 3LD9A 1II9A 5KNDA 3CPHA 2NTYC 4L5BA 4URVR 3QF4A 1Y3AA 3FB4A 4FMBB 1ZM9A 1SXJB 4MYHA 2XB2A 1PV4A 1QHHB 3I4LA 1HE8B 3C16C 5IT5A 3QKRB 2CNWA 2ZITA 1M8PA 4AYXA 1KGDA 3DPUA 3QBVA 2ONJA 4AKIA 4D26A 2QBYB 1X8JA 1XP8A 2GILA 3EZ7A 4A6PA 2ZRHA 3VR6A 1W0KA 5B30A 1CR2A 3KXIA 1P2SA 2GETA 3U7EB 2VHQA 4QJ3A 3K0CC 2YWFA 1PLJA 3SNHA 1FP6A 1X6VA 1NKSA 5CYPA 3L8ZA 3KX2A 2IF2A 3U5ZB 3AKYA 2RGXA 1H8ED 4AD8A 3W6PA 3TR0A 2NZ8A 1NVWQ 1VDZA 4QBIA 5AJWA 3TKLA 2YYZA 3Q8XB 5B2ZA 4OK6A 4CT4B 1P2TA 3ZZTA 4JL5A 3T34A 3AKEA 2W6IA 1D2NA 3KFXA 2CEAA 3RRZA 4G5GA 4D81A 2F43A 4HLCA 1OE0A 3AUXA 4G5RA 3RAPR 3NXSA 1EK0A 4RKEA 1ZD8A 4JSYA 4ON9A 4RZUA 1JECA 1ZRHA 1GTVA 2J45A 3EZ6A 2BIFA 1N6IA 3B1ZA 4A4DA 3V4RA 2ZRFA 3KKOA 2LKDA 1VKJA 1W48A 3R7WB 1KI7A 1GL6A 3U3RA 4M1MA 1E2LA 3ECCA 1NMYA 3F8TA 3T1TA 1NP6A 3FDIA 2IL1A 1G3IA 2FPLA 1KY3A 2PMDA 5E3HA 2XSZA 2CLDX 2ZI5A 1G5RA 1GRQA 2WIAA 4UKDA 4GL2A 3B7GA 1BMFA 2IK8A 2W2TA 4NP6A 1E2KA 1S3GA 3QEOA 4C0KA 2A5YB 4IKEA 2RHDA 3U61B 4DSTA 4ESVA 1GIAA 1U9IC 1GDDA 4TLAA 4OKSA 3W90A 3L0IB 5JRZA 1L8QA 2VBCA 2ZEJA 4LYHA 3KJGA 5AUPB 2NPIA 4TQAA 4P4SA 1CJVC 3MRSA 4HEJA 4Q1FA 4TMZA 2VHUA 4V0LA 1UEIA 3X2SA 4PPFA 1QHGA 1NIPA 4Q19A 1AS3A 3IPXA 4YDSA 4JBXA 1F2TB 1QF9A 2PX3A 2G88A 4LBWA 3VR3A 1JEEA 2AHOA 3KXKA 3QIAA 4HDOB 4XH9B 5EE9A 4ZDKA 4GDFA 4HYYA 1E2MA 2FOLA 1UKVY 1NBMD 2QZ4A 4H1VA 4Q4LA 1W7AA 4KFUA 4IVRA 2DY1A 3Q7QA 1DAMA 4CEJA 1FTNA 4D80A 4A6XA 1COWA 3F5FA 4KBFA 2B8TA 3AP3A 3P32A 4F7WA 1GG2A 2DWOA 4NYMR 2J41A 2QTVB 3QKUA 3GJ5A 2GNOA 3CRVA 5HE9A 3ADBA 1ANKA 3QVUA 1E3MA 1Z6YA 4M4SA 2VP2A 2WWHA 421PA 5F3WB 2ATVA 3MG9A 4PHHA 2ZR9A 5AJYA 2FEOA 2R65A 4HAWA 1M7GA 3W9YA 3THXB 1N6PA 4PO1A 3I62A 1NMXA 2Q9BA 4PZZA 1T4GA 3X1WA 4B73A 5LD2C 1FP7A 1JQLB 2DB3A 2EFDB 1D2MA 2DWPA 4C0QC 3AF3A 5LB4A 2ECKA 4MRNA 2QROA 4RVCA 2OLKA 4MITA 4OQLA 3KXLA 2RAPA 2WJYA 4ZDWA 3U6KA 1MH1A 2D74A 5J4VA 5CM8B 1XDBA 3TAUA 1T0JB 4PAOA 1Y63A 1I4LD 1FL9A 1KMHA 1RJ9B 3D6TB 1EESA 1KY2A 3EW9A 4M0LA 4JT4A 5JLJA 4QHSA 4E22A 5IDVA 4OBEA 5KNBA 3K70D 1KI3A 5CLLA 1M7HA 2J1LA 3GQBA 2F1IA 2J7PA 5BQ5A 2E87A 1MABA 3PIRA 5DISB 2OE2A 3DMDA 3AVYA 2Q3FA 4RFSA 1XBTA 4QM6A 3QEJA 4OHZA 4OHWA 3IPYA 2OV2A 2PZGA 5JWHA 1ZAKA 1R7RA 3GLIE 1AZSC 2H7VA 4IXMA 2B21A 1A1VA 2JIZD 4DVGA 4DLZA 2IBMA 1JB1A 3KTAB 5EXSA 4FD2A 1J8MF 1G4UR 3O8CA 4NPHA 3TRFA 1IN8A 1XD9A 1WRBA 5AJZA 1OKKD 5BYKA 3VX4A 1N5KA 1SQ5A 1R0XA 4PSVA 1ZINA 4CT5A 2XEXA 1NSFA 2ZRPA 4J0QA 2GAAA 3BFKA 3IIMA 4A15A 1T5IA 4M1WA 4UJ3A 5DI9A 1R0WA 2O8EB 3IKJA 4FMDB 2EYUA 1KI8A 4U5XA 3EPJA 2GCNA 1OXVA 3KZ1E 1XPUA 2NO9A 2O0JA 2VSFA 4OK5A 4ZIRB 2C2HA 3CW2A 1XD8A 4HLUA 4ITRC 5FOXA 4I1SA 2XB4A 2GCOB 3K9GA 4P4UA 4URUR 1GRRA 4CYMA 1CTQA 1UF9A 4A0HA 2VHTA 3RHFA 1Z6XA 2JJ1A 3ZLJA 3MGCA 3EWAA 3JZMA 2D2FA 2P67A 3BE4A 4HAZA 5BN4A 4Q1CA 1HE1C 4M2LA 2D7CA 4NKRA 2ZRNA 4DSUA 5TARA 3DO6A 1SZPA 4WZ6A 3K0CA 4C4PA 4C3ZA 2O5VA 2PBRA 1B23P 3O8RA 1IXSB 4P32A 4Q47A 2IW3A 3WYGA 4DLRA 2ZS7A 1CLUA 4JLBA 1TL7C 1P73A 2GRJA 4LV5B 4P33A 5TMPA 2YOGA 3T1VA 4X8LA 2CXXA 1Z2AA 3GLHE 5DIFA 4A2QA 4E5UA 4JLJA 2VQSA 1MO4A 4DC9A 4IDHA 5AK0A 4EQ6B 3ZD6A 4QG7A 1B0UA 2ZI6A 3RLFA 4DIEA 4BASA 1OH6A 1WF3A 1XRJA 2V9PA 3QPUA 3PFIA 2FE4A 3THYB 3BAFA 1TEVA 4KYUA 1XTKA 2ZJZA 2VF7A 4BZQA 2IYTA 2IXFA 1IN5A 1ZU5A 4CIDA 1OW3B 4B3XA 1OF1A 4QXAA 4ASUD 5FPKA 2J0UA 4D82A 3B8HA 4EPYA 2VH5R 2XSZD 4KI0A 4MUAA 1TU4A 3TMKA 4FWTA 3GJ0A 3LBHA 3K70C 4B35A 2CK3A 4BFTA 4I4LA 1AN0A 2GJ9A 5FUWA 4QJ4A 2QUZA 1W4BA 2PLFA 1T8TA 1KDRA 1OXSC 3CKLA 5FOVA 1EXMA 2J3EA 4G5SA 1S3SA 4DXAA 1OFHA 2RGNC 1XJQA 2I1QA 1G18A 2ZU0C 4TYYA 4KV9A 1JBKA 4WXRA 5DI3A 2CVHA 2ZRMA 4MKHA 1W49A 5KNCA 1N6RA 3P4XA 5EZ5A 3K0EA 4B76A 4EPXA 3NH6A 4TMTA 4XWAA 4B32A 1CF4A 1W47A 2QNRA 3FWYA 2CHVA 5EE0A 5DH9A 3MSXA 1FX0B 1P62B 1OV4A 4GSYA 3LX5A 4BEJA 5JWRA 1ZNWA 3SJZA 1QHYA 2ZS8A 4LOAA 4M1OA 3PUXA 3CH4B 1GKYA 2FSIA 1DTSA 2AD1A 1F2TA 2ZANA 5EP1A 621PA 5ELXA 3EG5A 3UK6A 2H92A 4YONB 2A5FA 4L9WA 4NYIQ 4B6EA 4IOJA 3LFUA 4NYMQ 4AIIA 1G5PA 2RGEA 3I73A 2GXAA 2DFLA 4NTZA 4YMTA 2C5LA 2VPPA 1NLFA 3EARA 4US2R 4Q9JA 5A4JA 4A8JA 1UM8A 2CHQA 4YXWD 1G7RA 1IHUA 1NRJB 4DUGD 1Z28A 4D0GA 5CDFA 2GTPA 1J99A 1QRAA 1US8B 1ZJ6A 4UJ5A 1KI4A 2RGCA 5G3YA 3RWMB 2GXQA 4IXNA 2REXB 4MH0R 4NBSA 4X8OA 2O8CA 2GEDA 2HCBA 1LNZA 1JXOA 2CLSA 3E2IA 2XZLA 2XXAB 3HYTA 2OAP1 3CRMA 5FOUA 3UG7A 1W46A 3GFPA 4IJMA 4NCIA 5FBQB 1C1YA 2JLRA 1G3RA 3SC3A 4DDUA 3ZVLA 3BH6A 2WSSA 3I72A 2WIBA 2BKEA 4GP6A 4PSKA 1E2JA 2QM8A 3LRPA 2JLSA 2R2AA 1JEDA 2RHMA 2QENA 4OI4A 4UXJA 5J5CA 2BJWA 5KHOC 4D25A 4US0R 4RD0A 3GLHA 3ZVNA 1CJMA 3LQRA 2MMGA 1KJZA 4CEIB 3IIKA 1XEFA 4ZPXA 3NC1C 1R5BA 1XFAA 1A2BA 3M6AA 1G1MA 1AS0A 1HT1E 3O8BA 4JS0A 2HV8A 1NJGA 4DT1A 1I2DA 1JR6A 3MCAA 2CCKA 2ZQ5A 2J59A 2C98A 5BYJA 1E4VA 4LV6A 2YWGA 4RZXA 1ZP6A 3WRYC 5J40A 1AS2A 1LS6A 3KQKA 5JJIA 3TQFA 2FG5A 1MRSA 4ZO4A 4TL7A 2ZRCA 3PCRB 2GF9A 3GEHA 3MLEA 4LJAA 2ZJYA 4M53A 1EFUA 1XMSA 1H8HD 3LW7A 1NVXQ 3I8SA 1NBME 3B13B 3X1YA 1UKZA 2Z5FA 1AZTA 2V6IA 1ONBA 4RD1A 3DVLA 1R5NA 1HQYE 1C4OA 2F9LA 3ZGXA 3KJHA 4DCTA 3R8CA 4G5QA 4ZIRA 2AKAB 2WTUA 2X1VA 4B3BA 3CRQA 1G16A 2ZR7A 4M21A 1KNQA 1WCV1 3WY9A 1VHTA 3CZPA 1NN0A 2CL0X 2O8BA 2ODBA 1S9HA 3LDAA 1GVNB 4JJKA 2FGKA 1TX4B 1Q22A 2QP4A 4JYCA 4Q03A 4W7SA 3TSZA 3FOZA 5L3QB 2NMVA 4GMXA 2N46A 1N0UA 4U00A 1CJTC 1YU9A 2ZSEA 1PLKA 3CZQA 4TSFD 5DHFA 1M2OB 3KDSE 5EJEA 4F38A 1HURA 2F3TA 1D2EA 4RD4A 5AUNB 4LY6A 1SGWA 5JZVA 4D4JA 1FFHA 3K1JA 2GA8A 4M9QA 4Q4AB 1DOAA 1U99A 1Q1QA 4TL9A 1L4UA 1MR3F 2HT6A 3GFOA 3MJHA 5P21A 5HR5A 1E2DA 4HZUB 1XPOA 2ZI3A 3SFZA 3IGFA 1XEXA 4LUCA 1W0JD 5F2EA 1SXJC 2IS6A 1S2MA 3RS2A 4PAMA 4M1KA 1D8TA 3QVVA 5L8VA 2CBZA 5C4MA 3PV0A 1TADA 2QU8A 4JLVA 5EE5B 3U2QA 1HYQA 1FW6A 3KQHA 1GUAA 3LVQE 3WYFA 5D3QA 3MJRA 2H16A 2VP9A 3ZDQA 2GJSA 5J4YA 1Z63A 4ACBA 4BLTA 4Q4JB 3GEIA 2QAGB 2O8DA 2XOKD 3Q72A 3PEUA 1KSGA 5DN6D 3CONA 5B58C 4AKGA 1A4RA 2SHKA 3AGQA 1VG1A 4URYR 2ZJ2A 3IIJA 3CBQA 1DE0A 2FWRA 3QPWA 5CYOA 3QUSA 3GMTA 3U44B 2ERXA 2YINC 1JI0A 4EKDA 4TZ6A 4Q7KA 1OFTA 1NY5A 3VR4A 2JLYA 2EWWA 2BJVA 4Y0VA 2GBLA 4LC1A 1NY6A 4IVQA 5KO2A 4LYJA 1E79D 4QHTA 1W44A 2ZSDA 3C14C 5AUOB 5D3MA 3AUYA 1OH5A 4IRUB 2A78A 1E94E 1CJKC 2CE7A 3C8UA 1R0YA 5HKKD 1TQ2A 2XX3A 2NO7A 2NG1A 1WMSA 2BMJA 2BV3A 3WMGA 5FPYA 4UNQA 2WM9B 1GM5A 3P26A 3HR8A 2B6HA 2Z83A 4JVNA 4P3YA 1L7VC 4C0BA 2ZAMA 2ZRGA 2AR7A 3SR0A 2IEZA 4A0RA 3A1WA 3T61A 3SYLA 5FBLB 4JVMA 4MRPA 4QBFA 2VP6A 1YZNA 2ZS9A 1S1MA 3QE0A 3KFVA 2GXSA 4TMKA 4LX0A 3C5CA 3TW8B 2VP4A 4E03A 4BFXA 2QRZA 4DB2A 2P6RA 3MWJA 2FH5B 1PVOA 4A2WA 1N5JA 1QG4A 1VG0B 2V6JA 4C9BA 1JR3D 2RMKA 1U8AA 2A3RA 3H86A 4CVNA 3ZH9B 3OIVA 4NL4H 4HATA 3SQWA 1L2TA 1CXZA 1FNMA 3AVVA 5HKKA 2H17A 1XXHA 1YE8A 3H1TA 2GF0A 2B7BA 2O8EA 1W4RA 4EFMA 2FZ4A 3D31A 2VL7A 4NH0A 4ACAA 1GZSA 2K5UA 2NIPA 3O47A 4V0KA 5FI1B 1LF0A 2WWFA 3SEAA 5JECA 1MRNA 1TAGA 1IBRA 3NDBB 4KFRA 4CEJB 3PR1A 4G3XA 1R0ZA 4MKGA 3REGA 3CWQA 3FKSA 3LXRA 4MRVA 1M1YE 2AWNA 2YV5A 3DDCA 1T9HA 4URZR 1LV7A 4PPQA 1ZD1A 5JHHB 3A4MA 3NVAA 1DAEA 2BEKA 2DBYA 4WXPA 5FTMA 1RRCA 2WPDA 2DFNA 1S9DA 2FFQA 3SN6A 4KLZA 4V02A 1IONA 1TNDA 5K8LA 1OXUA 2FMXA 1U0HC 4LHVA 4K46A 1OB2A 1XX6A 3U3KA 1KDOA 1SVKA 5JCPA 4H9GA 3U7HB 3WP1B 1VTKA 4UQOA 2AK3A 1S0UA 2IS2A 1T3HA 2EFCB 4A0FA 3I92A 5IRCD 4PFSA 4P0TA 4II7A 1CR1A 1W1WA 4D4MA 4TYWA 3THYA 1W0JA 4GOJA 4LHZA 1SVOA 4TQUS 2B8WA 2J7KA 2IYUA 2R44A 3MWLA 3FFAA 3TK1A 1F48A 2EW1A 1VHLA 3M4YA 3LY5A 3W3ZB 1E2QA 4M9ZA 4IOKA 3VTKA 3ASZA 2WWGA 1OHHA 4XD7A 4DZZA 4D4LA 4JSTA 4IEEA 1H8EA 2ZJOA 521PA 4C2TA 1Z83A 3EWSA 1I4DD 1NVUQ 1Z08A 2QT1A 2IHYA 4RY2A 5JI2E 1Z2CA 4RSGA 4RD6A 3KTAA 4QGGA 4CDGA 4G1UC 2PJRA 2FU5C 1UBEA 3CF2A 4LI0A 2R62A 5LPNA 4TL8A 5JS8A 4HLDA 1SULA 5SZIA 4GNKA 3SBEA 3ICEA 2G9NA 2EFGA 4C0HA 2ZETA 1Q3HA 1XB2A 1NVVQ 1M7BA 2YC2C 4NCKA 4TL6A 2NGRA 2QAGC 1RC8A 5FL7D 3UANA 1G19A 4DWJA 1AIPA 1DEKA 1KDPA 4LBZA 2BVNA 2A7QA 4B2IA 4ESHA 3LBIA 4ZV4A 2J0SA 3IBGA 5C4GB 3FGNA 2C99A 3BFXA 1LTQA 4F93B 2QAJA 2XZOA 2YJTD 1G8PA 1JAIA 1G20E 4AYWA 1FUKA 3SI7A 3AVOA 2GJKA 3PXGA 1CP2A 2AX4A 2JJ1D 2IYZA 4LRWA 4QHYA 1VG8A 1HUQA 2QRNA 1RW4A 2BCGY 3CX8A 3QJYA 4HUQB 4XVRA 1XPRA 2AN9A 4PR0A 4B33A 4LJ9A 4V03A 3A6PC 2FX3A 1Z0AA 3AKDA 3CNOA 3QKSA 2J5XA 5FBWB 4ZKEA 5HCNA 1N6KA 2FFHA 4EAQA 4Q1EA 1UBCA 2BC9A 4FWIB 5FL3A 3H2YA 4JBYA 3VMFA 5JSZA 2DFKB 3DL0A 1ESMA 2KWIA 1YR9A 1RFLA 4QJ5A 2YZ2A 4F4JA 3CNNA 2FJUA 1JR3E 3LA6A 3NEJA 3C5HA 3NBYC 5G41A 3EAQA 3R8FA 2F7SA 1II8A 3T5DA 1DAIA 3WMEA 1NNEA 1QVRA 1U8YA 2WJIA 5L3VA 2BMEA 2DCUA 1AQYA 3NEYA 1Q1EA 2O8FB 4PC1A 3FMOB 1O3YA 2ZYWX 3T06B 1BYIA 4JIMA 4KBGA 4JLNA 5F9FA 1P4SA 2OHFA 1HH4A 1K6MA 1UJ2A 1R10A 1SKYE 4FMDF 4WVFA 5HPYB 1ZBDA 4OI1A 4C0AC 2GVZC 3LH5A 4LJ7A 4UNPA 4KLNA 4KSBA 3EZ9A 4UNRA 1X1SA 2ZPTX 1OYWA 3SU8A 2OXRA 3BS4A 3M0EA 3QXCA 2OAQ1 5LD2B 2WICA 5L3SB 1YR8A 4TWZA 2QN6A 5J4KA 1NLZA 4Y0AA 3J81k 3L8YA 5C18A 1OT3A 2GXUA 1JAHA 5JI3E 1T8UA 3FTQA 4MKFA 2OG2A 4OQXA 1E9SA 5UKDA 1KK0A 1KHTA 3VU9A 4DLTA 1UKEA 2EFHB 1MOZA 1XZPA 2A5JA 3CH5A 2GEVA 1Z06A 1KO5A 2DYKA 4LJYA 1FZQA 3EIHA 1UDWA 2C78A 1KI1A 4DRZA 4A0GA 2F3RA 4W5JA 1G6OA 1IAQA 3HJNA 5TB5A 1EX6A 2QY9A 5HZHA 2JCSA 1UBFA 4R7ZA 2ERYA 5J47A 3THXA 2VP5A 3JZAA 1N5LA 3H4MA 2R6AA 1VIYA 3EC2A 5EZ6B 3TJZA 4TSFA 2OSBA 1R5OA 3BD9A 1OSNA 2JLUA 2F1JA 2XZPA 2ZJ5A 1RRGA 4KU4A 2DWQA 5DYIA 3ASYA 2JATA 1JQJC 4PQYA 5K8IA 1KMHB 1RJ9A 1KMQA 4OQFA 1PJRA 2D62A 2P5SA 5BN3A 4RZ2A 1F3OA 3LWNA 2AFIE 1UEJA 1ZNYA 1PZNA 4GPTA 1QG2A 4BFYA 1IXRC 2XJ4A 3AP2A 3PEWA 3NKVA 2PX0A 1GL7A 1BH2A 2R9VA 1X86B 4HSEA 3NC0C 1ZCBA 4CF7A 1IJFA 4Z8YA 1D6JA 2GVDC 2IWHA 2F43B 1Q0UA 1N0WA 4K81B 2EU8A 4AKHA 1SVIA 4BFVA 4BE7B 3K9LA 4GT1A 3SQXA 5HZKA 4PQFA 4BFSA 2ZAOA 1XU4A 4XJXA 4XWKA 1G8YA 1ZYUA 2ZR0A 5FUYA 3TGPA 2QMOA 5CJPA 3OHMA 2UVQA 4QRHA 1DAFA 3C41J 3OAAA 2KJQA 4OK3A 4TMWA 3TQCA 2AWOA 3AVQA 1E1QA 4B3GA 3VHLB 3OIYA 1XEWY 5HCIA 1T6NA 2R6CA 4JKIA 2YHSA 4M8NE 1SKQA 3NBZC 4DCVA 2WZQA 5AUQA 2IYYA 3BB3A 4PTLA 2ORIA 1P60A 2VSXA 2ZE5A 3LQQA 4QBGB 3RRYA 1I2MA 2J7PD 1SXJE 4DLUA 2WPDD 3TSOA 1TMKA 2OLJA 4LZZA 2HLDD 1OH8A 3WNDA 5FPTA 4A36A 2X2EA 1IN6A 4P4SB 3K09C 4HZUA 4YXWA 5CITA 4DBLC 4MQBA 5KDLA 4GFDA 3LLMA 1EG7A 2N1BA 3I32A 2G0TA 2QI9C 2CCJA 2MSEB 4IFBA 4KXFB 3W5IA 4B3DA 4GOKA 4C0SA 2R8RA 1Q1ZA 1P7CA 3SYKA 2FNAA 1W0KD 2C03A 2PLRA 3AV0B 3I3SR 5E7MA 4EDHA 5TXGA 2F1HA 2IUSA 3IEVA 2OM2A 5JSZB 1E32A 1ZMXA 2OO7A 3KUCA 3Q3JB 1PUJA 1Q44A 2GJ8A 1KO4A 5EP2A 3HWSA 5TDHA 1E2IA 2Y8EA 1N6HA 3H0KA 4YQFA 4WZBE 4FN5A 4B43A 1KI6B 2VHCA 3MWKA 5C1BA 4HAXA 4OHXA 4MYUA 3SDZA 3VFDA 2ZROA 4DLVA 1NN1A 4PANA 4HUQA 3AP1A 3HU1A 1T0HB 3JVUA 2ZE8A 2B7CA 1YR6A 1ESNA 4OJKA 2ZVQX 2ZRLA 3A8TA 4XTRA 5FOWA 2QA5A 1G17A 1W5TA 3CF6R 3VKHA 4LYAA 4LJ6A 4AURA 2CMKA 3L0OA 1SXJD 4KCGA 2XNDA 2J0VA 3FPAA 3T1QA 3I1FA 3SJBA 4EPVA 1JXMA 2YC4C 2ZUBA 4B47A 4DUGA 3T35A 2CDNA 3L43A 3AGPA 3E70C 4WW0A 3RDPA 4AK9A 3IO3A 1G291 1WE2A 4TLDA 3W6OA 1GP2A 3ZZUA 2WKPA 4Q4HB 1P72A 2UZ3A 2QORA 2Q9CA 4KSCA 1KDTA 4NCNA 4Z1MA 3RRMA 3VNVA 4MKIA 1RE0A 3E1SA 4YMWA 2ZYUX 4DB4A 1E2GA 3QQ5A 1G3UA 4WBSA 3DMNA 2C9OA 1N5IA 1E2FA 4L16A 5JJLA 2R6DA 1H8HA 2VLIA 4Q5IA 4WOPA 3REFA 4MYTA 2OFXA 3EPLA 5JWOA 3T15A 1XTJA 2PZFA 4DIDA 2QE7D 5F98A 3IHWA 4L15A 2F9MA 4N0EA 3F0TA 3PQCA 3RS7A 2LWIA 3ETLA 5DE3A 2XAUA 1QHHA 3R9XA 1IXZA 1ZUNB 2AK2A 3K8YA 4WIAA 1N6NA 1EX7A 2HF8A 2OBNA 1D9ZA 3QXHA 2MMCA 2HYDA 3RS0A 1QVAA 3FMIA 3ZYCA 1AGRA 3KQNA 1BKDR 2BBWA 1FOEB 1ZC4A 2V7QD 2VEDA 4ARZB 2P65A 1XD2B 4EPWA 1JNYA 3GLHB 4DLSA 1E9RA 2JJ2A 1KSFX 3L0SA 4DSNA 4C0LA 4CW7A 5GVSA 1FTSA 2OT3B 4BLSA 4PHFA 4KITB 3OEED 5A0FA 3TUIC 2IYRA 1GFIA 3CX6A 1NG1A 1K5GA 5LDDC 4LWZA 4FCTA 4DDWA 1V5WA 2G6BA 4H1UA 2BWJA 4DLXA 4NCJA 2ORWA 2IT1A 2V54A 5SZJA 1ZIPA 4U7DA 2XXAA 3SJAA 1P3JA 1YQTA 2BMDA 3K9NA 1N3BA 3D8BA 2ZE6A 3TE6A 4R71A 2ZJAA 3P27A 3A4LA 2W00A 5GJBA 2OCPA 1IY2A 2VRWA 2FDCA 2HXYA 1OB5A 4W9MC 1BO6A 2AXNA 3B1VA 3D3QA 3NIBA 2LKCA 3R20A 2JASA 2QT0A 4DSOA 2OESA 4PXAA 1KJWA 2IYSA 3BORA 4ZDIA 1H65A 3SJCA 4FW9A 4KAXA 4Q9KA 1KK2A 2GZDA 4MUBA 2QGNA 1IOZA 1X1RA 2Q21A 2HYIC 2ASEA 4M1SA 3PJRA 1PUIA 2GJAA 3QXXA 1JJ7A 4XSHA 1N6LA 4UNSA 3W3AA 2C9CA 1E98A 1GNQA 3QXSA 3U60B 2C9YA 2FSFA 2P3SA 2A9KA 4Q01A 5EXXA 3CX7A 3B2EA 1GNPA 3QBTA 3N5CA 2FFBA 4R98A 1KJYA 1GL9B 1EWRA 4Q4AA 2JIZA 4OYHA 4X8MA 1YRAA 4LSGA 4PHTA 3BB1A 5K8UA 5BXQC 5JEDA 5KDDA 4C7OB 2HLDA 3S1AA 1M6NA 4DCUA 4QFMA 2YNMA 1SVSA 1AGPA 1TQDA 5E4FA 3CLVA 3K53A 3NG1A 2EYQA 4YMSA 3NBXX 4C2UA 1DAGA 3B9QA 4Q9LA 4TT3D 1T91A 4XVQA 1JJVA 3N70A 1ZNZA 2ODEA 3V00A 2BBTA 2BBOA 4PX9A 3A4NA 2WHXA 3GJ4A 4IDOA 2OUKA 3MAAC 4FIDA 4L8GA 3TLXA 1Z47A 3DM5A 1TF5A 2JLZA 4NHOA 1VPLA 1CJUC 3W6NA 5CB8A 4KFSA 1Z29A 5FH9A 3UATA 4BRUA 5IK2D 2Z0MA 3ZS9A 3CUEF 2IX3A 2QSYA 2WJHA 2WV9A 3OESA 3FHTA 4NYIR 5DN6A 4MRRA 2NZJA 4EJSB 4JVSB 1KKMA 4JT2A 2CE2X 4W5WA 4I81A 2YWHA 3TVDA 1NBMA 3GJ8A 4PPGA 2QTHA 1XF9A 2PZEA 4BLOA 3G82C 1CEEA 4Q4HA 2KBEA 2ZI4A 5H70A 1BYUA 3QKTA 1GNRA 1M74A 4CZ2A 4JBWA 1OFIA 2W2VA 4ERNA 2W58A 2OXCA 2QP9X 1VCIA 1IJEA 1MKYA 4OL0A 4BEBA 1D5CA 4QBHA 3U4QA 2YOHA 1N2CE 1RPZA 3FFBA 2PCLA 4OI0A 4PC3A 4R2HA 2H57A 3W8RA 3O8DA 3OF5A 2HF9A 2ZTSA 1NN5A 3N2IA 1W36C 2QP3A 3UWOA 1N25A 3ZQ6A 1F2UA 1E0KA 4FMCB 5H1YA 3GLGB 3BB4A 4Q1AA 1N6OA 3BGWA 1G64A 4F92B 2JLVA 1COWD 3KUDA 4JLKA 3B5JA 3GJ6A 2CL7X 2V3CC 4S2EA 2VO1A 4LV8B 1UFQA 2HCJB 3ZVMA 4YMVA 1T5LA 2OZEA 1OFUX 4JKYA 1U94A 4GI7A 1R6BX 4NYJQ 4DDTA 2X8AA 3BRWD 3MUFA 4HB3A 5DO9A 3E5HA 4OHVA 5AWFC 1G41A 3WNBA 3ZQJA 1SHZA 3KQUA 5DLQC 4OI2A 1XCGB 3GPLA 3FYHA 1UBGA 1SHKA 4A8JB 2EFEB 4B71A 2RGDA 2WMOB 1YR7A 4DKXA 5KPJA 3GCGA 4DCSA 1AKEA 1WXQA 2FPMA 3CRW1 4V0NA 3RABA 5BWMA 3JVVA 3RANA 1GAJA 4AKEA 5A5GA 2EVWX 2W83A 1E9AA 1CR0A 2R6GA 1Z0KA 3SZRA 2CJWB 3L82B 721PA 4D6PA 3DOFA 3QG5A 1RRFA 2Q0HA 1TF2A 1E4YA 5L3SA 4URXR 4LJ8A 4B75A 4XVUA 5BW8A 2N42A 3AKCA 2W2XA 3OZXA 1NKTA 2W6JA 1P9RA 1JPNA 2GZAA 1VCOA 1OPXA 2HJGA 4LK2A 2ANBA 2GDJA 5G53C 4XWOA 1CKEA 2YVUA 2WSSD 4IHQA 3DKPA 5CJ2A 1ZM4A 4B6FA 2G77B 4EQ6A 1FMLA 2JLQA 3ND8A 1LB1B 5FPHA 3ZS8A 5HE8A 1G7SA 5EE3A 2V8OA 4KFTA 1OXTA 3A1UA 3B1YA 5EXTA 4DT1B 3SHFA 3HPQA 4TT3A 1IY1A 1AKYA 4WA7A 2BM1A 2AKYA 3RRNA 2V1XA 2ZREA 1UKYA 3HYRA 2IUUA 1E99A 1KK3A 2FF7A 4Q1BA 3TBKA 1BS1A 1J70A 1KI2A 3U44A 1UADA 3THOA 3GLFB 4LHYA 1XCPA 3VAAA 3THWA 3KL4A 1XJCA 2FPKA 4PC6A 3CWZA 3U7FB 4IDNA 2G83A 1QHNA 2Z4SA 2FZLA 3G5UA 1F6BA 1XEXB 2GAOA 1DBSA 1E9CA 2IA5A 3KKNA 4ZCMA 1Z6TA 2XOKA 1HEIA 1NI3A 2IC5A 1G6HA 3MD0A 3RNLA 3R7WA 3TUZC
chains in the Genus database with same CATH superfamily
3H4VA 2XD9A 3TLBA 2RK4A 3A7DA 2E37A 3K0FA 3AVUA 1UMDB 1SQ0A 1I3CA 1F7VA 3ELWA 3R5KA 5HQJA 1MX3A 2G9QA 4HNUA 2UUBB 1G3QA 1DRVA 1ZJYA 4EMUA 1BNCA 4CEHA 1LBHA 4YY3B 1ATIA 3DF7A 3ILSA 4XJSA 2FI1A 2LD4A 3IQZA 3WIUA 4W5HA 1VSUA 2C7QA 3TIVA 3X1MA 1GPNA 3BM5A 4JVLA 3UH1A 2CLHB 3V9PA 5IF9A 3F9IA 3SQDA 2PBFA 1PZFA 3AIMA 2WAMA 1AK1A 3EUAA 2RK6A 1A8HA 3SIWA 4A1FA 1DVRA 4C2BA 5F1PA 4ETMA 5FHRA 5BYBA 2J5QA 5AW3A 4CIYA 4N3GA 5I7VA 1XMXA 3VHRA 4ENPA 4IUYA 3I05A 3R7NA 1Z5OA 3HKCA 2Z08A 4NCXA 1F7UA 3ETHA 3H1BA 3IDSA 3NV7A 1WCWA 2P6UA 2ZTHA 2C1XA 4MAMA 2MYNA 5A4MS 3DOEA 3EQ7A 1Z4PX 2RH4A 4K6CA 1QCYA 3R3SA 3PF9A 3A05A 4FZ3A 4QULA 3ZLBA 1NJ5A 5KYXB 3QY0A 2C0PA 1WUTA 1M34E 2D6FA 1KQ3A 1T29A 2G4CA 2GK6A 1C0LA 1IY9A 2IJGX 4PBRA 4BNLA 4GRAA 5JNSA 3IP3A 3K96A 1UBUS 4NLLA 3S3TA 3CX3A 5G0SA 1Z39A 3N6RA 5CBPA 3C3CA 3K9HA 1OJLA 1F9AA 2XMSA 3EDYA 2Z2XA 1D0VA 2K2WA 3L7BA 2G0NA 1ISSA 1O87A 2L0XA 3NOXA 4Y2TA 4AKSA 5DHTA 1R6UA 2Q4BA 4RJLA 3CZAA 4F91B 2CJYA 1KZGB 5JZSA 2V7QA 1PS8A 3FHJA 4IDPA 4V0MA 3ZE7A 3M6MD 4P5EA 1WLYA 1LI5A 2UKDA 3EFOA 4N7MA 3TSYA 4ENSA 3KPJA 4ZO8A 1EA7A 3IELA 4HB4A 4TGLA 1NATA 4Q4CA 3QE2A 1QRUA 4LZAA 3LAWA 4NVRA 4UULA 4YHBA 1BDBA 5JXWA 5DYGA 5FI0B 1NZDA 2EGUA 4Y1RB 1NBHA 4YP6A 4YJ2A 2BFEB 2VNSA 4OCZA 2HRDA 4BMDA 1NC1A 2F8MA 4M98A 3R7LA 4D3SA 2Y1XA 2FWIA 3OZDA 4Q7LA 1UFVA 5BN1A 1VMAA 3JYOA 4CM9A 4Y6QA 2QB5A 3RM3A 1K1EA 3FNEA 5KQGA 3LKVA 3DE6X 2ZM5A 4F3CA 1KE2A 2VPWA 1IBCA 1DCKA 1MB9A 5TMEA 4XSGA 3PHJA 1I7PA 1FQOA 4FE4A 3LO5A 1N0IA 3IULA 2QL7A 2UZ1B 1UPFA 1QSGA 2Y1GA 4ZAVA 1F5NA 4MJ3A 2C3OA 4EY6A 1SOUA 2XGGA 4IO1A 5GJWC 5I9MA 3GLGA 1OLUA 1DFGA 3PQ7A 5HUQA 2FPIB 4AFNA 2P2SA 2H1VA 4MR8A 4HH0A 1AGYA 4DG9A 2RHJA 5G0TA 4R8RA 1CY1A 3KQPA 2R4UA 2WZBA 4P98A 2HDOA 4AVYA 5A5VA 3DGFC 3CUWA 5FUVA 1U98A 2REQB 3GCXA 4QYXA 3GIDA 2VDMB 2JZCA 1R6AA 4OX9Y 3HXPA 2OGSA 1HYEA 4DJ5X 1NUSA 3TZKA 3DTVD 3UTCA 1KOLA 3JQ8A 2B4TO 4BP9A 2PGJA 4MUNA 1WZEA 3FVQA 4LJ4A 3UWDA 1UAAA 5J2UF 2IS1A 2Q9AA 1PL6A 2D54A 2PEZA 4CMCA 3MPUA 1GWNA 1Y48E 1Y7TA 4KIWA 1S8AA 1A8SA 1O08A 5C8YA 3LSTA 5K4AA 4C78A 3BZBA 1X8XA 2PZBA 3F98A 1SKYB 1IY8A 2Q6LA 5KB3A 1T5HX 2A9RA 1V4BA 4OLJA 4J94A 4B6QA 3LHSA 2CXQA 1KYIA 3ZGVA 3GLRA 3NOQA 3LOUA 3IUEA 2HJ9A 4R81A 1KAQA 1SVWA 3TX2A 3WMRA 3HSSA 3ZNPA 5HRAA 1RPJA 1KH3A 3DMHA 4HQLA 1R88A 4CLEA 1SVLA 4X1OA 1XL0A 1UIRA 3AZQA 2FPPB 3VNSA 3G49A 4JJZA 1CEXA 3JQBA 5SICE 3ER8A 2HMYB 1PSDA 2VJBA 3ZWMA 4RX1A 4GUDA 3I6QA 1QAQA 2BZ0A 3ESZA 1T10A 1AF4A 2WG0A 5F35A 5YASA 4ZYYA 2WFLB 2HSJA 4N54A 1R6DA 3S70A 1TUEA 5K3OA 2F8TA 1OT5A 3M34A 4V39A 3DBRA 4LKRA 3WMFA 3SXJA 1P0IA 2DRIA 2IYQA 2OZVA 3C3KA 1OGJA 2QG4A 2BMFA 4L2IA 3ANTA 1XFDA 1NQ5A 3P0JA 2UUPA 1U9IA 2XITA 2RI6A 2WB4A 1LW6E 1WMFA 3RYTC 4XCQA 1WPRA 1ZM2A 3A1VA 2GT1A 4PQRA 4UBNA 3WBBA 3EE6A 2ILVA 4M1TA 1YACA 2GEBA 3T7JA 1FFXA 2VYQA 1CIPA 1U0TA 2XVMA 4AROA 1QRTA 2JJQA 2WNHA 1MIOB 1Q83A 2C20A 3DL7A 2AFRA 1U8FO 4ILEA 1I32A 2OYCA 4ZEMA 1G20B 4BLQA 3WXBA 3DHWC 3GN2A 2REOA 2CHEA 1LA2A 4GBMA 1SH7A 1N3YA 4YP1A 1KPIA 3DXXA 4IEIA 8GPBA 1GGJA 1KDZA 1XWIA 1FNDA 5CFNA 1P6XA 5F9HA 3F47A 5K0SA 1W2HA 4OO3A 4IIJF 2ZJ8A 5G1OA 3UMMA 1TTTA 2XQJA 2LVBA 3H1AA 4V1CI 2YH2A 2TMKA 4TS4A 5D5PA 4A5SA 4BMSA 5HJEA 1E2NA 1QZ3A 4BRZA 1DS6A 1DELA 2NZYA 1EFRA 5EZYF 3GU3A 4NBLA 1GTRA 3MBOA 5HMMA 1USUA 4G56A 1SC1A 3PG5A 4RVFA 3RKRA 3UMJA 2X23A 2PCJA 3GFTA 3PA8A 3AUAA 2PR7A 4L4SA 3TQHA 9LDBA 3EUFA 3KR2A 2ZWAA 2VI5A 1EEXB 1T1JA 2G1JA 4QPJC 1WCXA 1CULC 3BREA 1SBIA 2B78A 4ESOA 5KOJA 3AVPA 4MWDA 1E9FA 2BF7A 2OCYC 2WOOA 3VVLA 3I8OA 2PUVA 3TNFA 3HGTA 4CDRA 1YRYE 3RYFB 1JE1A 2HMSA 1PT8A 4DLBA 1JKJB 1WDTA 2ETXA 3SYNA 1WZIA 2IUTA 2C96A 4IJ5A 3KQLA 4QUGA 5EMHA 1YZUA 1V1MA 5LWHA 3EZNA 3CB4A 1R8YA 3V55A 1KK1A 1V2HE 5A71A 3UJ7A 4BMZA 1J1ZA 1NASA 4JEHA 1T6ZA 3D3WA 5TVKA 4ZCIA 5K0LA 5K3FA 4YDHB 1DPFA 4BJ5A 3KUKA 4ZAYA 3DLCA 1KSJA 4RFSB 5LJLA 3TRJA 4EUEA 2EF0A 3C39A 3O4HA 5JCJD 3PEYA 3EUEA 3O84A 1DC4A 3FHLA 4PHGA 4ZI7A 3M5DA 4RF2A 1L5OA 1TLLA 1IUOA 3DKVA 3E7FA 2I65A 4U2DA 1XALA 2OTCA 3IAUA 3L7IA 1GRCA 4PZLA 1U0EA 4O0MA 2O2XA 2DXIA 3PLNA 5T67A 2Q49A 1L1FA 1EZZA 1J97A 3OFSA 5KINB 1XCMA 2Q6TA 3K0HA 4N3NA 5FPPA 4NWIA 2BISA 1THMA 4CL0A 3G2HA 3U4QB 2Q4DA 3QW4B 4G0XA 1RQ2A 3O1HB 3TL6A 1X8KA 4C0XA 3OTIA 4KPGA 3PEVA 1L1QA 1NVVR 5FUMA 2OBLA 3G5MA 2VBIA 2P0EA 2XVXA 4I14A 5E95A 4ZCQA 3FSGD 1GKKA 1X9GA 2AFHA 2D3TA 2IPXA 1IVSA 4H2DA 4E09A 1ZI9A 2V03A 3EZXA 4Q4JA 3NTUA 3K9WA 1CRQA 4IH9A 4JI3B 3M83A 3A0UA 4E3WA 3OZRA 1NZJA 2HXSA 2VJMA 3PUWA 5FAXA 3VR6H 4M60A 4X44A 1WMDA 4MGIR 1DDOA 2XE6A 1PR4A 4AMGA 4AJEA 3WWPA 1FUYB 5K20A 2XA9A 4LXQA 3ZCRA 2ZRAA 2PXXA 1SXJA 1SKUA 1YVEI 2E48A 5E4YA 3W9UA 1K2WA 3GJRA 3QUTA 2GESA 4HMPA 4G2NA 2XYVA 3WLNA 1P9NA 4EY8A 1KEWA 2JCXA 3DDOA 4HH3C 3CEHA 3WE7A 1QPGA 3LG2A 3JQFA 1JIIA 1HG1A 4W7HA 4X3PA 3RIYA 1X7ZB 5HX7A 1DG9A 3L8CA 4NULA 1RIFA 3UHOA 4R05A 2VRCA 1WCIB 2MWMA 4XDZA 1X74A 2EKZA 4J2HA 3OQHA 1YZKA 1Z2PX 1DO0A 2XAAA 1GOTA 5CLHA 1EJ2A 2VR1A 3CRZA 4Y2QA 3RS3A 3ZHYA 2Q5IA 4ZCPA 4X54A 4ZJUA 3FOEC 1PZXA 3AWIA 5DTRA 5FB3A 5ICCA 3TAHA 4LGMA 1HQCA 2OV3A 3IBTA 3HHEA 3M1IA 1NDHA 4OB6A 2WJJA 4MRMA 2ZTVA 4OQEA 5CGZA 8MHTA 221PA 1GPWB 2JL1A 5B3LA 3K0SA 3E7PA 4YHHB 1JFFB 3DNFA 1UPTA 3IP6A 5A3JA 3I5YA 1IBSA 2ACKA 1FYDA 2Z3ZA 1YMUA 3VR4D 2GHQA 3L8FA 2D1TA 4K3UA 2YBDA 4MVJM 5DEIA 4UNNA 4JI6B 1FYXA 4H60A 3BK2A 4C7KA 3HNPA 3HZOA 4QIHA 4CR8A 4GHWA 2VJCA 1ORHA 1AA6A 3D6UA 1KI9A 2YNMC 4YJKA 3RARA 1MZVA 1ZKDA 2IE0A 3F3SA 2A5LA 3AWDA 4ER0A 2IWRA 1E79A 2WWIA 4Q9AA 3FTCA 3KAQA 3WMWA 2O3JA 3OCZA 4BFUA 5KSZA 2NVWA 3ZV6A 4HDCA 1EWKA 3W5BA 2WP8J 2C58A 1ZCJA 4KQ1A 2PJDA 4N3AA 3FPSA 1XA4A 1G5QA 3IX7A 1NXQA 4ZMBA 5DOVA 3WK8A 1VLJA 3T7SA 4KHZA 3H2GA 3CPSA 1T2UA 2O3SA 2A9QA 2LBPA 2V4ZA 4AJ1A 3SXUA 3IP5A 3L84A 2O2SA 2C88A 3TSAA 1L1EA 2ZP1A 1YC2A 2CW5A 1DQSA 3NWJA 4RQTA 3GP8A 3CO5A 1H42A 2BOVA 3PFHA 4Q7JB 4DYDA 3T1OA 2HA2A 1HQKA 3CZCA 4N03A 4QVIA 2GRUA 1VYUA 3JPYA 5IJXA 1V16B 2FHPA 2FHSA 3Q5EA 4JLMA 4B3FX 1AG9A 2EW8A 4RPIA 2I4IA 2C57A 2Q5JA 4PAGA 4EG5A 1Y6FA 3L1IA 3RJMA 4JXJA 1WBBA 1T8PA 4BTVA 1W87A 4N47A 3HYLA 3HU2A 3CYFA 3RS5A 1OGYA 4B0PA 2F6RA 2BGGA 3LS2A 1XWWA 1XZBA 4PQGA 4QXOA 1Y81A 3K2QA 1GZ7A 2QYSA 4RV4A 3O03A 4BX3A 5EUMA 3QVLA 3KKPA 2H51A 4KP7A 4O2RA 4EUNA 4HDQB 5FJIA 3GJTA 1KFCB 3LPAA 4HZIA 4L95C 2XBUA 4IYJA 5EA2A 5ALLA 4DLWA 2QPTA 3S5JA 4AWXA 5BUZA 2EBFX 2SKDA 1BCSA 1N2OA 4UD6A 2CFTA 1II0A 2AGVA 4J6FA 1DOZA 3KLPX 4QICA 4L75A 4M7PA 2HL6A 2FUNB 3ENWA 4EOGA 1P19A 1JXQA 1WU8A 3BTVA 3QWHA 2Q0SA 4RIEA 1D9XA 1BG6A 3PL5A 3TI7A 3V2HA 4KL8S 4R2LA 1MN6A 4PXYA 3OIWA 3Q9LA 3G3EA 1A71A 1MAHA 2XECA 3HPRA 4X1YB 4ZEVA 1FP4B 3UG6A 1YZGA 1FSPA 4HPWA 2JAQA 1B42A 4CKZA 4F3KA 3EIUA 4B34A 4R84A 3WBJA 4DXDA 2ZQZA 3ILYA 4QPZA 4CM4B 2O3TA 3LCRA 3BHNA 3O82A 4DJTA 3MMXA 4ZYZA 1N9GA 2JJ2D 1EGAA 5LP6F 4IOLA 2WJVA 5LR6A 2QVLA 1KE1A 4RJTA 2F00A 5ARCA 1K75A 3JQBC 5JJCA 1AM4D 1XHFA 4LJ5A 1HGXA 2YRFA 2XNDD 4UAJA 2ZBQA 3ZDFA 3O7MA 2QKYA 3WL4A 1QX3A 3ZY2A 4B4KA 3EVZA 5F1KA 2WMNB 3K0AB 3E82A 4Z8XA 2HQ1A 3T4UA 4CN9A 3OEHA 3DT8A 1UJBA 3OPQA 3A6EA 5FA8A 3MHPA 4RZSA 5EJ5A 1KO1A 3Q85A 2WJPA 5DNEA 3ZE0B 4U02A 1Z07A 2IUFA 2OFPA 1GPBA 4GD3Q 3FYTA 4UVHA 2PFKA 1Q21A 1KH2A 1S2DA 3ESDA 3KQSA 3ZY5A 4OQQA 3MJVA 2IOHA 4ROTA 5A4FS 2H59A 2YW9A 3E0QA 3EA0A 4UZSA 3FNBA 1EM8A 5HKBA 2RH9B 2IH5A 2HGZA 1YFLA 3H5NA 1L1RA 4WACA 3QF4B 1KARA 2OYSA 4MQEB 4QVKA 4UFOA 3L1JA 2A5DA 5IM5A 7GPBA 3EQ8A 3SOPA 5J2UA 1WP4A 1I1QB 2QQ0A 3I2FA 4RVUA 2DOKA 3SYMA 2WG1A 5JFGA 1TLTA 2MR6A 3Q5DA 3QHQA 1H0RA 1LVHA 2VZ0A 4RSRA 4C08A 4MGKR 5CVTA 1KKLA 3KSZO 3AR2A 1E2PA 1MVLA 3I8XA 1C0EA 3DBLA 1SIBE 2J87A 2Y6UA 1I4EB 3Q6NA 1XXHB 5DULA 5E6UB 3PIDA 4ZP1A 1LEHA 1ATZA 1RM0A 3SWWA 4GAEA 4HAVA 2O2JA 4RABA 1Y3HA 1D1QA 2JGEA 4H77A 4EHKA 3QYAA 1DBIA 1VB5A 1E1CA 1XQ1A 3RVSA 3GLIA 3ADPA 3SYRA 2PRJA 3HKDA 1P1BA 1R4AA 2V65A 3SHWA 4CKEA 2EW2A 4IINA 5HRCA 4BMNA 3A6GA 3KPYA 3UGTA 1OWLA 1IOWA 4QGAA 1KQGA 2R8ZA 1NUAA 3I37X 4MW7A 5DSZA 1G21A 1K6EA 3OY2A 3LI2A 5AM5A 5F1OA 4BN0A 4YIHA 1CRZA 3UPUA 1L7DA 1OASA 3EIOA 1IEQA 4RZQA 3UK1A 2CJWA 1QBKC 2NT3A 2PVSA 4LS3A 1I0LA 1DNPA 4M9SA 2CKDA 3RWOA 3V4SA 2Z43A 3G0GA 4ZT2A 1TKAA 1X7XA 2O1EA 1VSTA 3HYNA 5JPDA 1SCQA 2FV8A 2G3YA 4HTFA 4PFQA 4X85A 4MRMB 1WG8A 1T9AA 3PFKA 1DO2A 1OC2A 3NBAA 3E6AA 3OFNA 3HKBA 4GR5A 4XFJA 1EFHA 5IBPA 1KIFA 4YRGA 1IM2A 2Y05A 1DU4A 3CMCO 1ZISA 3WGOA 4BDTA 4E94A 1U2GC 4WL0A 1RCTE 3B38A 3NP7A 3HMQA 1JSRA 2FEMA 4MCJA 3ZNNA 3FUCA 4L4YA 3RHSA 2BCJQ 3R6DA 4Y6OA 2GN0A 5JJKA 2F3QA 5LQJA 1OX5A 4LOHA 3HVRA 4EK9A 3MNFA 4CGZA 4U9IS 5SY9A 3DLBA 4KIJA 3WYCA 2GHIA 3GPDG 2QD1A 3AO0B 3B3QA 4KWTA 1XZGA 1YS6A 5HKLA 3ZW7A 3VU9B 2VPQA 5CW2A 1XZCA 2WFMA 1E6CA 1Q1BA 4KNWA 1N3IA 1J2JA 3OLYA 3K7EA 4WZAE 2HMWA 1XVAA 3KWFA 1Z0IA 5E7JA 5D00A 2FVXA 3TH5A 4JYZA 4MRSA 5LQMA 2PT5A 3LLUA 1OX4A 1PZGA 4FSXA 4RMJA 1GG8A 2B4RO 1JR4A 3LW8A 4YFVA 3CINA 2FSSA 1AUVA 2YHBA 3EXG1 4LCBA 1D2HA 4L7VA 5HOQA 3PUIA 4Z0PA 1KNXA 3BTOA 4GPZA 3KOXA 3R1IA 1OY1A 4O6VA 1HI9A 3L7LA 3LIIA 4L4UA 2QZJA 1XTRA 1Z22A 1FFCA 3G02A 4FMPA 4KWIA 5EIWA 5J63A 4P54A 1NF3A 2WSMA 3OE7A 2XNSA 2X7XA 3FNFA 4BNFA 2VIIA 5LQDA 2LCIA 1FJ2A 1JLMA 3OD5A 3PUHA 5DCWA 3RK1A 4D8UA 1OIVA 2X6RA 1QPBA 4LDJA 3VAZA 5U9CA 1GY8A 3ZHVA 1L4NA 5FBRB 3BTSA 1QH1B 1PR3A 1RI3A 2PJZA 1E5QA 3A7EA 2J3HA 1UMDA 3QYFA 1UBKS 2WWTA 1NIJA 2WBLC 3AHJA 3TLCA 4B17A 4H3KB 1ZNXA 4PYLA 1A7JA 5HS6A 2IHKA 3COWA 3I0NA 2KW5A 1UP4A 3ELBA 3IS3A 1BQEA 2P41A 2R66A 3MTIA 3LECA 4DYHA 4JLDA 4B3TB 1KC1A 2HA7A 3FKSD 3WGUA 2FWNA 5FR2A 4XTCS 2YJNA 2JZOA 1H5UA 1HOTA 5G2OA 3PBKA 4GGOA 1FTQA 1Z5WA 4C7BA 1ZN8A 2RBKA 4Z53A 4Z51A 1NXTA 1FU7A 2GD1O 2PWZA 3A6ZA 5T41A 4P08A 3UWKA 4BFWA 5E4JA 1QB8A 3MMSA 1TF7A 1BH6A 1UK9A 4R0NA 4ETNA 2BEWB 2F67A 5TVGA 4TTRA 4Z0TA 1Q0QA 3D3WB 3HJHA 3RYCB 2D1QA 3OM0A 1Z7YA 1OV6A 2O05A 3UK7A 5KWVA 1DC5A 4EB6A 2ZI9A 3BILA 1ZGHA 3DUWA 4MEAA 4G4JA 2BLLA 2XQVA 1L5SA 3CO0S 3WGKA 4EPYA 5TGDA 2QTCA 3PR3A 3I09A 3KYBA 5FBZA 1PT6A 4JOBA 4ZVTA 2VP0A 3JQQA 2JLWA 4O8CA 4AG6A 3R9WA 2GBIA 3OUZA 5HZGA 2B36A 2WJGA 5E3IA 4KK3A 4JU8A 4YRNA 2PGAA 3JQAA 2WSLA 3OM1A 2R85A 3VNBA 3WGGA 2GSDA 4XOUA 4ETIA 2QX7A 5K3DA 3GUCA 3ZHUA 3LXXA 1ZH4A 4F4HA 3FHOA 1YK1A 2B2CA 3EG9B 3VKUA 3WK9A 1PU2A 2QMZA 4CLRA 5AVRA 2VPTA 2NZWA 2ONYA 2QWXA 1ODTC 1GGHA 1ZZEA 2XYRA 1VCNA 5EE1A 3M4ZA 2ZRQA 5DNUA 4O4HB 3VBEA 4KREA 3WNZA 4UOZA 4ZD6A 1QYCA 5IVDA 4J16C 1UZNA 3TXAA 2WWYA 3ZWVA 1O9HA 4Q1DA 1CUJA 2P62A 1QGUA 4NECA 4WZBB 1QRDA 2PO7A 3DCJA 3TBFA 1KTVA 4LMAA 4PFKA 4CIWA 1A98A 1QS0B 3MJCA 3UN1A 1NVFA 3C85A 3EQ2A 1Q3TA 1BW9B 1F12A 1TM7E 2O2EA 2A86A 3FDZA 3OBIA 2ZWOA 4FI3C 3WS7A 5IHPA 3ZHOA 1S7GA 4FHFA 4K9RA 3OJFA 3V7YA 3O94A 5C46F 4HNHA 1W4AA 3IUBA 3GW8A 3QPBA 1VGQA 3W5SA 1RC0A 3WKAA 2JBAA 2YJ3A 4GZ6A 2ZSAA 4HFNA 4IF6A 1THTA 3IT0A 1FUUA 2B35A 3OX2A 4PYRA 5E1OA 4EGSA 4YPVA 2FDXA 3OX3A 2QHXA 4RLQA 2LIPA 2QGFA 3V8EA 1ICEA 2DT8A 1S2LA 1XQ9A 3EC1A 5IBRA 3MWDB 1B1CA 4JLPA 5BP7A 1NWCA 3AIIA 4C3OB 1NP3A 5JZ9A 2NTYC 4Z7JA 5DX8A 2REQA 1Y3AA 3TQOA 1BS2A 5F5NA 4RAQA 2UXDB 3WDSA 2OAGA 3NHPA 4E0BA 1L7BA 2QX9A 4RNDB 4BNDA 4DMHA 1R15A 4EYSA 1PV4A 1A04A 1REQB 1U5BA 2P90A 4BC1A 1HE8B 3C16C 4L8VA 1NI4B 1M8PA 3OE5A 4EITA 2QTTA 3DPUA 4PG8A 3QBVA 3ZGZA 4AKIA 4BGVA 1R0LA 2QBYB 2GILA 2J9GA 1XA0A 3D6MA 3U7QB 1J20A 2O1XA 3QLUA 3VR6A 1E1DA 1W0KA 2DTXA 5B30A 3KXIA 2HFKA 1P2SA 5K6AC 3EMBA 2ZOSA 4LY0A 1EDDA 4QJ3A 4IGIA 3DOHA 3K0CC 1VIDA 3ICVA 4FYJA 5JJBA 1NKSA 5CYPA 3L8ZA 1Y6JA 5DBGA 4KQHA 1ISHA 2QRJA 3N2GB 3ZZNA 1PR9A 2B3DA 1V11B 4YRDA 5ICMA 4W7IA 1I1OA 1V95A 4IL5A 4MWBA 1ZZGA 1ACLA 3HP7A 3TR0A 2FEWB 4QD3A 1C1XA 3DQZA 3FNRA 4IJ6A 4KN5A 3BF8A 1YB7A 1QH0A 5AJWA 2YYZA 1L5WA 2BP7A 1YASA 4QPDA 4M8IA 1P2TA 1Q3KA 3GDOA 3IA7A 4P7JA 5DNVA 4BQRA 4JL5A 3T34A 3NBUA 3QLUC 4R7TA 3R75A 2R79A 4G5GA 1D4ZA 1H05A 5EJ9A 3P96A 2IU6A 4GDMA 2BM9A 3MILA 4AX8A 3AUXA 4G5RA 2PTHA 1AZLA 3OKAA 1J00A 1EK0A 3ZCVA 5F2NA 4RTKA 1Q7RA 3UPDA 2JFGA 5JD3A 5HXAA 3HC7A 1JECA 3OTHA 3EZ6A 1IK6A 1JHRA 1ZOPA 3GB9A 1WCIA 4BNZA 3V80A 1VJRA 2BDEA 2LKDA 4DR5B 3R7WB 1CQPA 3CR3C 2J3LA 4DV3B 3KDPA 3V46A 4JYMA 1RWPA 2VT7A 3Q1KA 4I55A 2IXAA 1K68A 2WQZA 5ULLA 3WAKA 1HNXB 1U0SY 1G3IA 3NGXA 5M7EA 1RI5A 1PQUA 3QBEA 3RTAA 1EK5A 1UM9A 2XSZA 4UDNA 3ZE2B 1WUKS 1G5RA 4L28A 1B8VA 1JIKA 1HETA 1PI3A 3B7GA 1R0SA 4QJBA 1BMFA 4GEGA 4L3VA 1S3GA 3LQ4A 2A5YB 5LMNB 5M29A 1U9IC 4R3UC 2BSAA 4TLAA 1QVVA 1Y5NA 3PHIA 2YXDA 1L8QA 1QNFA 2HMTA 2XUIA 3D4LA 3CVXA 3JPWA 4MI3A 5I7FA 1JDPA 4FZVA 1TM4E 4BOYA 1T5DX 2BEVB 4HEJA 2I7TA 3OPNA 3H9BA 2OUIA 1QTIA 1QHGA 1NR7A 5E9AA 5IJAA 4Q19A 5IWAB 1AS3A 3INTA 4YDSA 2M9MA 2ZBVA 4K9MA 2RHRA 2HK7A 4TV9F 2R1UA 3U9SA 2PXHA 3UUEA 2C2WA 3VR3A 5JVDF 4JJ6A 4GDFA 1SXHA 5DLEA 5JIBA 1WPGA 5FF9A 2FOLA 4JC5A 2FUG1 4IFTA 4UC0A 4C76A 4DWWA 1NBMD 2D13A 4WBNF 4IJQA 4ZT4A 3FNGA 1W7AA 3L6OO 1S2IA 2WUGA 1HT0A 3D8RA 4UARA 4BVKA 3P9QA 3T3HA 3BJZA 3LQKA 2RD2A 3JWHA 1FTNA 3NM5A 2D5CA 2MSKA 3GCDA 3NKFA 4NZZA 4D80A 1TPYA 4NPCA 1WB6A 3T0GA 1T43A 4MWEA 2B8TA 3P32A 2BTQA 2RGRA 2DWOA 2ZVDA 3BMNB 3U81A 3BGVA 3IE1A 3GJ5A 3M70A 3CRVA 3OZFA 3OLXA 4IV8A 1GAEO 4AMYA 2YVKA 4ZXFA 2WWHA 421PA 1VIMA 3JAMA 3MG9A 4ZJYA 3L8GA 4BXOB 5JARA 3SICE 3THXB 3CNEA 4HDNB 2PSEA 1MDBA 1NVKA 3I62A 3OZSA 1YKGA 2PWYA 2BFCB 2CLEB 2Q9BA 4G1VA 2I2AA 1FP7A 4PZZA 4M46A 4LE1A 3KSMA 3JATA 2LRHA 4C0QC 1AXGA 2NACA 4I5IA 1Q7EA 3PXXA 4IX1A 1MW8X 1EVZA 4DUPA 3ZXXA 4OXYA 2PUBA 2A58A 2WTNA 2X4IA 4PWYA 2RAPA 2WJYA 1G2QA 4PNEA 3UHJA 2A1TS 1HFEL 1EWVA 4JODA 3LRTA 1Q1NA 1GPYA 5J4VA 3W5DA 1A9RA 3TAUA 3DV9A 1GPUA 5HIMA 2JGFA 3TM5A 1I4LD 1B00A 1F1BA 2XWJI 3O2SB 1X7YB 3EW9A 1BEZA 2Q5LA 1XZMA 1U7PA 2Z2ZA 3JQ9A 4J90A 4JT4A 2B9EA 3ELUA 3GJYA 4QHSA 5HCUA 3ZWKA 4BIIA 3K70D 3GV0A 3DULA 4JI4B 4GECA 4Z9XA 1FSSA 2J7PA 5BQ5A 1THZA 3VHQA 3PHLA 1K0UA 2OE2A 3DMDA 4HK4A 3LVBA 5H3CA 4BMPB 4C05A 2RE8A 4GPIB 1ODLA 2AKEA 3S2UA 3IPYA 5TPZD 3VSBA 3ESBA 3E9ZA 3F49S 3GYBA 1FXWF 1SBTA 3DAHA 2B21A 5KYYA 2AUNA 3JQGA 4LZLA 3WLKX 2BKVA 1JB1A 2IBMA 3AR7A 3MIIA 1XRPA 3B6ZA 1L8AA 4FD2A 4UM9D 5IFLA 4NPHA 3TRFA 3H3JA 3O8CA 1TAHA 1XD9A 5KAMA 2R00A 1J8FA 4TTJA 3O1IC 3ETJA 4IIDA 5BYKA 4NBWA 1PK8A 1WKCA 3VX4A 1N5KA 4BO3A 1AQIA 5CXQA 6LDHA 3I64A 1MDFA 1OX6A 4CT5A 2X76A 3BL6A 1QWSA 5TQ0A 3JQAD 1X80A 2ZRPA 3DD1A 1XN1A 2UUAB 2WM8A 1IN1A 4TLLB 3SMVA 1ZRSA 2EP5A 2BFNA 2ID9A 3AINA 2GCNA 4B8WA 1OXVA 3KZ1E 2NO9A 4U7TB 3UAGA 4ANFA 3CVYA 1J42A 2WUDA 2XB4A 3K9GA 2P4EA 4URUR 3NHJA 5L40A 5AW1A 4KNYA 1QFMA 1RAFA 3WSTA 4YV0A 5L4SA 4FONA 1A96A 4TLMB 5KSWB 1BX1A 1SQSA 3RHFA 4XQEA 3ZLJA 1BGVA 3MGCA 3JZMA 3ZKWB 2TMDA 4UUNA 3ZWXA 2XEDA 2I3DA 3OZVA 3L7CA 1Q17A 2VT2A 3INGA 4NKRA 1MUUA 4RK6A 2I22A 5I3CA 3GX1A 3ML1A 1Y8CA 3PJEA 3DO6A 5TARA 1WKVA 3GA0A 1L4LA 4KQ2A 3ROXA 3IV7A 4NZ9A 3CLUC 3RG2A 1B23P 2R96A 3HWX1 2ZS7A 4GUAA 2ZAYA 1TL7C 1ZEJA 1LQUA 4LV5B 2FLWA 2CJPA 5H9WA 4K9PA 2YOGA 5MN6A 1SQGA 1M83A 5DIFA 3GN1A 2YMLA 4JLJA 2VHWA 3G9TA 5CLGA 3T5BA 1FFBA 1O77A 2NXJA 2QJTA 4GZ3A 4YUVA 4IDHA 5AK0A 3TEJA 4DC9A 4QG7A 3HXOA 2HTFA 4PONA 2IYOA 2P2CA 5EYPB 1N8KA 4HQKA 1Q0TA 4J3JA 3PE3A 2NT4A 2PD6A 3SS7X 1G21B 3BAFA 1WDWB 1H66A 1L7QA 1R9NA 4ZO6A 4REQA 1OW3B 5EJIA 2I2DA 1OF1A 2A3NA 1HYBA 5FPKA 1P2FA 4D82A 5AHWA 3HMKA 2QR5A 2CL5A 2XSZD 5I8ZA 1UDCA 1ND6A 5AM0A 1IDOA 3WJ1A 4EEKA 2O07A 5HSGA 1K8XB 1N9GB 3DWFA 4N3BA 4I4LA 1DJPA 1GSOA 1AN0A 1S3IA 3IAM1 4BFTA 4QYSA 4G0OA 4QJ4A 1EXDA 2PLFA 1T8TA 4I6EA 5T7BA 3EISA 4FFBA 4GL4A 3FUWA 5L6LB 2J3EA 1YMQA 4DDKA 5CR9A 4DCGA 2RGNC 2VSQA 3GNLA 1XJQA 4QUHA 2DCMA 3SJUA 4LF8B 4C4RA 4KRXA 4WN9A 1T2EA 2QW1A 2ZU0C 3H2ZA 4TYYA 4KV9A 2X0IA 5DI3A 1V4VA 2CVHA 4KZKA 1F0PA 1JKJA 2F17A 3DQPA 3GAAA 3EGCA 5E1BA 4WV3A 3WO1A 4C4TA 5CDUA 4O4JB 1BE8A 2ZW9A 3DE0X 1NU8A 4FYIA 4R40A 4L7QA 1HK7A 4HJRA 4PLWA 1H1DA 3BL5A 1YB1A 1D4FA 2DT5A 3FR7A 3K0EA 4EG6A 3UGJA 2AFIA 1BCSB 4GVPA 3DTTA 2CBXA 1ZMRA 2E6KA 4DRYA 1GG9A 3NH6A 3MB8A 3M6IA 4OUDA 4XWAA 4EYEA 3P94A 3RVDA 4EYOA 3BA6A 5CDHA 4KFCA 4FGUA 5FIUA 3UK0A 4IIYA 2QNRA 2C4HA 2NWQA 1J8DA 5EE0A 1DEHA 1OZHA 1YJCA 5THKA 4OSEA 3F5DA 4F4FA 5IDQA 3T5PA 4WEQA 2H2AA 1HDGO 3WGIA 1IHDA 1OV4A 4GSYA 4OHFA 1ZNWA 1H0SA 5ENZA 3N2LA 2ADFA 2HBRA 3WQHA 7REQA 1WUIS 5KJCA 4C04A 1PJCA 2O7NA 2P27A 4WGGA 1BW9A 3HCPA 4CCSA 1U4NA 1G2IA 1CY0A 1J5PA 3CH4B 1F2TA 3ET4A 2IZ6A 1SHTX 4JH0A 621PA 3D7KA 5ELXA 3EG5A 4J0EA 4AMZA 3LF2A 4NATA 1RZVA 2PKXA 2QJOA 1E5LA 3N8GA 1V35A 4RK7A 2FPGB 1SUFA 1E66A 3G2IA 2G9RA 3I34X 2B0CA 3M5PA 4A6EA 3LFUA 4BXOA 2B3TA 2GXAA 4HPJB 2Z5LA 4TTVA 3IVXA 1NUPA 1LGYA 3JD2A 2VPPA 4FT2A 1X9IA 3ISJA 4RK4A 4YXWD 1UM8A 3GAMA 3KJZA 3VDRA 1W52X 4IJUA 1EVQA 3Q3HA 4J49A 1U1GA 4DUGD 3M2TA 3GGJA 4M0CA 3CSDA 2HBYA 3FZQA 4JEMA 4UJ5A 2BEUB 2FSUA 3G2MA 4IDBA 5GV7A 2E5WA 5G3YA 1L5GB 5EHQA 3RWMB 3D6HA 2LTAA 3S2IA 4KDFA 3SBOA 4YMIA 3LUBA 2C2YA 2GEDA 2B99A 2R1VB 5HUHA 4W1QA 1JXOA 2GSWA 1RJFA 1T13A 4TM8A 5ES3A 2EIXA 2CLSA 3E2IA 2XZLA 2UXBB 1P17A 3QU4A 3RJZA 5KTKA 5EAIA 5FOUA 3UG7A 4WLOA 4EF5A 1C1YA 5BMVB 4JV5B 2I2WA 5AKGA 5KYUB 2ZCJA 2GLTA 1F0KA 5A9RA 3WB0A 2VJDA 5EINA 4IJVA 4EH1A 2AZDA 4PSKA 1XK6A 3LRPA 4X0EA 4GMFA 4DG8A 1QHEA 2YS6A 3IIEA 3UT5B 2RHMA 4UVIA 5IP5A 2RAUA 1NFFA 4UXJA 3FR8A 5J5CA 2CUKA 4F8EA 4G0VA 1OOEA 1CUAA 4D25A 2W8BA 3KQOA 1ISRA 4RD0A 4EW6A 3HNRA 1XDZA 1B74A 1JZSA 4YRSA 3LL4A 3IIKA 4FXOA 4ZVKA 1VA4A 3T3PB 2WJ6A 2OR3A 2FZGA 1IIBA 3EF3A 1RHJA 3M6AA 4OP3A 1G1MA 2VUSA 1CD5A 3FUVA 5JSFA 1XEAA 1I2DA 4XM0A 4IF4A 5F76A 1P9OA 1QKIA 4MEBA 4G0YA 3JARB 5PNTA 3LYAA 2V7GA 3LK7A 4J7AA 3S5UA 2P1ZA 4MB2A 4RY0A 2IV7A 2ZG6A 3DFKA 4G0MA 4NDNE 3AL2A 3CZ4A 5AK4A 3DZHA 1KYQA 3QVGA 4JXZA 1PWYE 5F7JA 1AS2A 5J40A 2IPLA 2RHCA 3I23A 5AHRA 2FG5A 1PDOA 1G55A 4ZO4A 4A27A 4PN7A 2R48A 1NA5A 3PCRB 1U4SA 5A3RA 1HMYA 4MV9A 4J2TA 5IDWA 2XCRB 1R18A 2R1TA 4XUCA 4PZAA 2X15A 3NT4A 1V7CA 3ZJVA 5LKRA 4ALIA 4F3RA 4S1NA 1X1QA 1AZTA 1RZRD 4EX7A 2WB2A 3SE7A 4LRXA 4WCFA 3SZMA 4F97A