3FMJA

P38 kinase crystal structure in complex with 4-(5-methyl-3-phenyl-isoxazol-4-yl)-pyrimidin-2-ylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
344
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGRHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Discovery of Pamapimod and R1487 as Orally Bioavailable and Highly Selective Inhibitors of p38 Map Kinase
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 107
structure length 344
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmjA01
3K54A 3QQKA 5KMKA 3CXWA 4RJ6A 4GFOA 4LFIA 4AT5A 4I4FA 2F2CB 5FG8A 5C4KA 1CSNA 5I9YA 3VQHA 2GDOA 3EN6A 4S30A 4DFBA 3DAKA 5IA3A 4OTRA 1LPUA 2ZVAA 4XG6A 4BB4A 1WFCA 4AS0A 4OTFA 4APPA 2QODA 4NM0A 3C4FA 4ZSGA 3NVMB 3HAMA 4L45A 1M7NA 3NCGA 1PMNA 3OHTA 2W06A 2Q0BA 4PRJA 3WI6A 3NUSA 2PK9A 4ALVA 2J9MA 2YFXA 5AUYA 3QQLA 1XQZA 4ARKA 3EYHA 3PRFA 4U0IA 5IQBA 5DGZA 4PMSA 4J1RA 3NR9A 1QCFA 3LFAA 4LRJA 3EQIA 3TV7A 2XF0A 4ASXA 5HNIX 4ANOA 4BY9E 4A9UA 4DEDA 4FV1A 1ZOEA 2R3NA 5D12A 5EOLA 1PMEA 2ZB1A 2QCSA 3PPJA 1VYWA 2QO9A 4ZOGA 1H26A 3VS5A 4YMJA 1VR2A 4GCJA 1W98A 2WB8A 5I9UA 3FMNA 2BFXA 2FSTX 4L01A 3G51A 4GK2A 4GT4A 4DH7A 5JFWA 3CCNA 3VHEA 5JFVA 2QR8A 4ZJIA 3KFAA 4GVAA 3LQ5A 4R5YA 3MTFA 2JBPA 3NYXA 2ONLC 1R39A 4D9TA 2XIYA 4GMYA 3RKBA 5AV4A 5D41A 2ETKA 3FMEA 2UW4A 5HZNA 2NRUA 5LVLA 2DS1A 3AC5A 3U9CA 1ZARA 4EOSA 2VN9A 4EHZA 3QCXA 4CV9A 3DNEA 4RVMA 4TYHA 4YC3A 5HEZA 3ZRKA 4ZAUA 3LJ0A 4QP8A 4E1ZA 2JIUA 4HPTE 3DKCA 1SMHA 4YZDA 1GOLA 3IOKA 3HNGA 4D2RA 3UZTA 2PZIA 1OL5A 1IG1A 1XR1A 3DKFA 4P2KA 4AE9A 5J9YA 4C7TA 4RJ8A 4IQ6A 2OJJA 2J50A 3Q6UA 1F3MC 2YIRA 5CY3A 2XNNA 4UMTA 4BBEA 2XK6A 3RHXA 2ETRA 5IQFA 2C0TA 3UTOA 3E64A 4CYJA 5AR3A 4R77A 4RVKA 3ETAA 3KMWA 5BMMA 4ZTQA 3BQRA 3VO3A 4K0YA 1BI8A 1T46A 3OWJA 5D7VA 3LXPA 2R3JA 3WARA 2VO3A 3U4UA 3ENHA 4DLIA 3NW6A 2W1DA 3KMUA 1PYEA 3UIXA 4EHEA 3CY3A 5LMKA 4EH8A 4G9CA 4Z55A 3ZOSA 2X6EA 1HCKA 3P08A 1J7IA 3Q04A 3PLAE 5GJDA 5AUVA 3FSKA 4BDCA 4U97A 3VS3A 2J51A 2OLCA 5EQEA 4BWXA 3EMGA 4FL1A 5J1WA 1TQMA 2JAMA 4ALUA 3CJFA 2OBJA 4DG0E 4F99A 4PL3A 4EUTA 1YWVA 3DQWA 5CSPA 4UXQA 4G6LA 3R9RA 3LAUA 5EYDA 3U6HA 4O0SA 4GFGA 3LKMA 4O7RA 3FAAA 3FMKA 4BYIA 4ZK5A 2XZSA 4CFNA 2O5KA 2OXXA 5HOAA 3UNZA 2VX3A 5DPVA 3EQBA 3RJCA 1PMVA 1Y6AA 3QTQA 4BCHA 2PE0A 3MY1A 3FL5A 3PWDA 4M0ZA 4X0MA 1YKRA 2ZMCA 4ASEA 5C8KA 3HRBA 4O6LA 2VO6A 4H1JA 3VBQA 4F7SA 3B2TA 5HE0A 3T9TA 2O0UA 4GYIA 2YHVA 2GU8A 3FPMA 2R3QA 2CLXA 2OJ9A 4FG8A 3K2LA 1YI6A 4NK9A 5EM5A 4V0GA 4DHFA 4I5HA 4DG3E 3F61A 3I5ZA 3I4BA 3QX2A 4FV9A 4IM0A 4QYFA 3RVGA 3NNUA 4UV0A 5KBQA 5KZIA 5E8TA 4U42A 4R78A 5DRBA 4ERWA 1OITA 5A3XA 2XK3A 1RDQE 4RMZA 1RE8A 3QKKA 1P14A 5AIRA 4JXFA 2AC3A 4XBUA 3HV5A 3FLWA 3FQSA 4M15A 4IB5A 4FIEA 2WQOA 4J71A 5H3QA 3A7FA 2DQ7X 4I6HA 4L44A 5HG9A 4U80A 4MF1A 3JS2A 4II5A 2EXCX 2WELA 5CASA 2PVMA 3GCQA 1H08A 1YI3A 1J1CA 3AC8A 3ZRMA 4EYMA 3RPSA 4AW1A 4C02A 5AV3A 4HGLA 3V5PA 3OBGA 4AP7A 1WCCA 5IA0A 1KOBA 4USFA 2HY81 5BYZA 5CAPA 3NUPA 4I6BA 2YWVA 5H8GA 3CTHA 4ZTSA 1VZOA 4QPMA 4WNKA 3TWJA 4BCNA 1PJKA 4MNEB 4DG2E 4FUYA 1JBPE 4HYIA 1ZZLA 1J1BA 1DAWA 5CEMA 2PVYA 4PF4A 3DB8A 3V5WA 3BYVA 3B8QA 3KA0A 4A4XA 5HNGA 4EZ5A 5KO1A 2XNMA 4M12A 4GFMA 1K3AA 3HYHA 2GPHA 4O27B 1XH9A 5HCXA 2IZUA 5FLFA 3R7VA 4NWMA 3HDNA 2XYNA 1NVRA 4G31A 4KD1A 4RA4A 3KVWA 3W2SA 3DNDA 4AFEA 3FKNA 1XH4A 4IC7A 1KE9A 3LLAA 4XLIA 2YZAA 1M2RA 3CC6A 2O2UA 3R7OA 4CV8A 3FI4A 3LCTA 2YERA 3CTJA 4KRDA 4O96A 1OIQA 4FKRA 4TYIA 5FBNC 3VIDA 4AN9A 4XP0A 3KN6A 3EFLA 3KVXA 2ITYA 3SAYA 4C4JA 4O38A 1W82A 2WMTA 2W5AA 1FMOE 3WF7A 2WIPA 3EKNA 2PZ5A 4WT6A 4OTWA 2B52A 3GP0A 1ZZ2A 3BLRA 3KB7A 4XCUA 3FQEA 2E9OA 3V3VA 4XG2A 4JDJA 4BDHA 3RPRA 4QTAA 4RX8A 1XBBA 3P4KA 3ZO4A 4AZTA 4MD7E 4JBVA 3KRWA 5DEWA 3MBLA 3IW7A 4YTFA 5LMBA 3FBVA 3MS9A 4NEUA 3PJ2A 4XOZA 3V5JA 4X2NA 4GSBA 2JDRA 4JG6A 4M69B 4XP2A 3E63A 4C38A 1WVXA 3D14A 3KU2A 5CSXA 1FPUA 3ZLWA 2QU6A 2QQ7A 2HY0A 1OMWA 4DEIA 1YOMA 4GKIA 2BRHA 3FXXA 1JAMA 4BTMA 3GU6A 5KE0A 5CF6A 3WZDA 1PXOA 2YAAA 3QQHA 5EI6A 4EOOA 5JQ8A 4QP7A 4BN1A 3DBCA 3EFKA 3PXRA 4C34A 3UPZA 5LARA 4UMRA 4C61A 1P2AA 2X8IA 3TDWA 4PL4A 4W4YA 3R7YA 4ZSAA 3ATSA 5CWZA 4JDKA 3UC3A 4FKOA 3LFSA 4D4VA 3OT8A 1ZY5A 2BMCA 3D7TB 4G16A 1BYGA 4JNWA 2VTQA 3JPVA 1WBSA 3O8TA 3V8SA 5C1QB 3UDBA 3UE4A 3F3TA 5BX0A 4FOBA 5I9VA 3O50A 4TWPA 1ZOGA 2CDZA 3P0MA 3I81A 4FTMA 5AP0A 4CFUA 4EBVA 4QRCA 4IX5A 4FZDB 4KS8A 2QOCA 2YISA 2CGWA 1R1WA 3E8CA 3MIAA 3R9OA 4A9SA 4TXCA 1H07A 4DBNA 3O7LD 4FF8A 3IW6A 2W1HA 2YLFA 5TKDA 4C58A 3ZO2A 4F7NA 4A9YA 3KF7A 3MYGA 3D2IA 5AUWA 4FTTA 5DRDA 5AP6A 3PUPA 4OTIA 3F3VA 4L7SA 1WBOA 4GK4A 4ZZMA 5A6NA 5IUGA 4GKHA 1YRPA 3N9XA 4JL9A 4JVGA 2I0YA 2EWAA 4V01A 1JSUA 5FRIA 3WILA 5BVDA 4AA4A 3OXZA 3TNHA 4QQJA 1R3CA 4YJSA 5CEIA 4C3FA 3WIKA 5I4NA 3NMUF 2EUFB 3PXKA 5HHWA 4ZZNA 2VTJA 3G90X 4D1SA 1O6YA 3NGAA 3I7CA 2WO6A 1H28A 2REIA 3UIUA 2XM9A 1W8CA 3D5UA 4RWLA 2G2FA 4IM2A 4MF0A 1JQHA 4RJ3A 3VS0A 2BAJA 4QO9A 3CSVA 4QMLA 4NM5A 4ZMEA 1JWHA 4ZJJA 3C9WA 2BAKA 2ZYBA 5GJFA 1U5QA 1FINA 4L46A 4W4XA 3DXNA 3SW4A 4ANQA 3BE2A 1R78A 2YCRA 3BHTA 3GGFA 4KIPA 2V0DA 2IVVA 2X1NA 3K3IA 2VNWA 2JIVA 1IEPA 2C5NA 3DS6A 2G01A 3TNPC 4FYOA 3NX8A 1E1VA 4NZWB 4BBFA 4AOJA 4U45A 4MD8E 4C3RA 3FMJA 4L43A 4LUDA 3TTJA 3TZ9A 4FTCA 4JI9A 4K33A 4E6CA 3JR1A 4CKRA 2W1ZA 1WZYA 4CMUA 4J8NA 4YU2A 3VUHA 4D5HA 3AT3A 2I6LA 2QOFA 4ITHA 3F2NA 3LCSA 2JDVA 3OY1A 2OZAB 3QTIA 5HIDA 2RFDA 3FZ1A 4CT1A 5JGBA 5LVOA 4XX9A 4LQMA 2F9GA 4FK6A 1KE5A 1WBNA 4YLKA 3FMDA 3QQUA 2QHMA 2UZOA 5M55A 1U59A 4O2PA 1M2QA 5HVYA 1JKLA 2HXLA 3A7JA 4ASZA 2WTDA 2J6MA 3DKGA 3WF8A 4CZTA 3E8DA 1JKSA 3PSDA 2C6IA 5CLPA 2ONLA 3F3ZA 3BIZA 3SDJA 4EOMA 2R3LA 1RJBA 3NCZA 2CMWA 2ZB0A 3MVHA 2B4SB 1LR4A 2X7GA 4GVJA 4IFGA 4WO5A 4C4EA 4WNMA 2YAKA 3N4UA 5ANEA 5DVRA 1TKIA 3W16A 3QWJA 1UVRA 3GUBA 4Q9SA 1BKXA 2XK4A 4ZLYA 1R0EA 4I41A 3GB2A 2CCIA 4N6ZA 2P2IA 2PZRA 4P90A 5DT4A 5BMSA 2P55A 4HGSA 1EH4A 4FL2A 4JT3A 2VD5A 4GG5A 3P86A 3UG2A 4PX6A 3VBXA 2P33A 2PWLA 5CAUA 4AAAA 4AGDA 3R28A 3RAIA 3Q2MA 4L6QA 1M7QA 1PXPA 4FZ6A 5FGKA 3TCPA 3KRRA 5HCZA 4AQCA 4ORKA 3AMAA 4C4HA 3KK8A 5J79A 2WOUA 1P4OA 3TZMA 1UKHA 3KXZA 4QOXA 4I5PA 4WUNA 5HU3A 2OF2A 1FBNA 5FTGA 4CNHA 3RBWA 3S2PA 5ANJA 1OBGA 3L8SA 3UZPA 2I0EA 2R0UA 3E92A 2OJIA 4N70A 5CZHA 4CFFA 2EB2A 5A4CA 4DT9A 5AWMA 3RP9A 3PXZA 3ACJA 4I94A 3EJ1A 3OXTA 3FZTA 3R71A 3FXZA 3W18A 4FV0A 4K1BA 2V62A 4ENYA 2F2UA 5IDPA 3SQQA 4QQCA 4BDDA 4BL1A 2X9EA 2JITA 1U4DA 4FGRA 5JKGA 2A0CX 4RIYA 3PA5A 3FPQA 3RI1A 5DYJA 3AD4A 4BDEA 3GC7A 3KQ7A 1Q8YA 3FMMA 5ANOA 4BDBA 1FGIA 2G15A 3QHRA 5E8YA 4B6LA 2Q83A 3VBWA 5AV2A 4FSZA 3Q9ZA 4O83A 5E7RA 3R8ZA 2V7OA 3DJ7A 3VUMA 3HX4A 4RX7A 1Y6BA 5E8UA 4N57A 1JSTA 3ZUVA 2QD9A 2HZ4A 2C5XA 4JX3A 1SVHA 3MVJA 4IEBA 4TW9A 3O7LB 4IX6A 3Q96A 5J87A 3U9NA 4FVPA 2GNLA 2YJRA 1JKKA 2IWIA 1NY3A 3UP7A 2C6DA 2VTTA 5L2TA 1BX6A 4RLLA 4QTDA 4FI1A 3VBVA 3L9MA 4MXYA 3QKLA 4AZFA 5EQPA 5HD4A 3D15A 3CQUA 4I6FA 3ULZA 2R3PA 5HE2A 3F7WA 1DI9A 3L1SA 3A99A 2I7QA 2W96B 2BTRA 2FA2A 2XJ2A 4H3PA 5J95A 2ZJWA 3RPOA 3FSFA 2VNYA 4CFVA 3R21A 4ZSEA 2WU7A 2J0KA 2UW0A 4FTAA 4NFNA 5HBEA 5ACKA 2UW8A 2PE1A 3VQUA 1U54A 5KCVA 3DDPA 5IA5A 3PXFA 3BEAA 3B8RA 2QVSE 2W1GA 3SG8A 4KRCA 2ZV9A 2X8EA 4RX9A 4UYNA 3L8XA 2QG7A 3A7HA 3BBTB 4UWYA 2XIKA 4DITA 5IMXA 3BYMA 2XBJA 5CEQA 1J3HA 1URWA 1OPKA 4IVAA 4O7NA 2VAGA 3LFCA 5HQ0A 4XBRA 3QXOA 4TTHB 4YSMA 4D5KA 3P7BA 1H00A 4M68A 4QYGA 4DTBA 1YI4A 2F7ZE 1M2PA 4B8LA 5M53A 3CR0A 1H4LA 5BVFA 4O0VA 5HG8A 4AN2A 3CP9A 4FVQA 3VRYA 3PTGA 4M0YA 5TO8A 2GTNA 2PTKA 2X81A 3ORMA 4FKSA 4FKJA 1RQQA 4M13A 4F9AA 4CRLA 2BZKB 1OL6A 1ZYCA 2GS6A 5CANA 2C6OA 4I93A 3S95A 4E3CA 2VO0A 3D5XA 3FZRA 1Y8GA 3TJCA 3U55A 5B7VA 2DYLA 3F3UA 3RWQA 4EH4A 2LGCA 2UVYA 2YM8A 4LUEA 4G17A 3SW7A 2J5FA 5HO6A 2WMSA 3RPVA 3PXYA 4FV4A 5HO8A 4KIQA 1JLUE 4EWQA 4C62A 1TQPA 4E93A 3WZKA 4FZFB 4WBBB 2EU9A 2I1MA 1WVWA 2JFMA 3A2CA 3JVRA 3LZBA 2G2IA 4ID7A 4MNEA 4AT4A 4TT7A 4XMOA 2HOGA 1DI8A 4RWJA 4PV0A 5IH4A 4QYHA 3OP5A 3F2RA 2Y4IC 3VW6A 2PYWA 2J0JA 3F6XA 4X3JA 4DH1A 4JAIA 3MVLA 3SVVA 3MESA 4HW7A 3G6GA 2GCDA 2W0JA 3I6UA 3DJ5A 3LM0A 3BEGA 2Z7QA 4QP2A 4IW0A 3W2OA 2YM7A 4S34A 4YJTA 2C69A 5JMSA 1JVPP 5LQFA 2PVKA 4LMUA 4CG8A 4BCMA 2UVXA 3L8VA 5CXHA 4D2SA 2YITA 1NA7A 5JN2A 4FGBA 5DA3A 5AMNA 4NH1A 4HVSA 1Q3DA 3GU4A 2UZUE 4U7ZA 4C33A 3OROA 3FMLA 1IAJA 4BDFA 3ZBXA 5GZ8A 4DFUA 3O17A 4M14A 4UZDA 2OWBA 5KHWA 4JOAA 4CEGA 4QT1A 3MJ2A 4YPDA 2BAQA 4BTFA 2UW6A 2GNJA 2QR7A 4R7IA 4W8EA 4BFMA 4IZ5A 4X2KA 4K9YA 3E62A 4EK6A 4L9IA 3G9NA 2HK5A 1QPCA 3VUIA 1AD5A 3A61A 3DU8A 4RQKA 1Q8WA 4LMNA 5K5XA 1URCA 3PZEA 2BIKB 4QMYA 2A4LA 3IW8A 4FKQA 4PMTA 5K0XA 4Q2AA 3VS4A 4RVLA 3R8LA 5HU9A 4E7WA 5M4UA 3Q9WA 1GAGA 3L9PA 3LIJA 1ZMVA 5CF4A 4MXAA 4BVUA 4NL0A 5AFVA 4WUAA 5T3QA 3BPRA 3EYGA 3QRIA 4FKIA 5DBXA 2HCKA 4JIKA 1FQ1B 5D10A 3RMFA 3ZYAA 4BICA 3QCYA 4V05A 3SLSA 3R22A 3CQWA 4BZOA 4OTHA 4GL9A 4MXCA 3HVCA 2NPQA 3LMIA 4HNIA 3NUUA 3TIYA 1YXUA 2B9HA 5M51A 5L2SA 2F7EE 2JDTA 3R02A 3NZ0A 2PHKA 4H36A 2HYYA 4YJQA 3OWKA 2IG7A 4OAUC 2Y0AA 4YHFA 1Y57A 2IW6A 2ZMDA 3SXRA 4R3PA 4O22A 1OBDA 2BRGA 4FKLA 4L3LA 4EI4A 3SGCA 4B8MA 4IHPA 3V5TA 1SYKA 2FUMA 2IPXA 4YTIA 3AGMA 4EHVA 4FV7A 4BI0A 4IX4A 3EQGA 3HL7A 4L3JA 4L53A 4QMMA 3C1XA 5ICPA 5IEVA 4BCPA 1G8SA 4ITJA 4FC0A 4GYGA 2X9FA 4AW0A 4OW8A 3E3PA 1OIUA 2WMAA 4DTAA 2Z02A 4DINA 1BLXA 2GTMA 3V51A 4F6UA 2Z7LA 3MFSA 4KSPA 5JFXA 4IZ7A 3DA6A 3PJ1A 4O0YA 4TZRA 1ZAOA 4O0TA 5FEDA 5CYIA 1GIJA 4ZSJA 2V22A 2UZBA 4YLLA 5AR4A 4O7YA 2E9VA 1IASA 3LJ1A 2GNGA 4IAFA 4NKSA 2OKRA 3PE2A 4DFLA 3E88A 5FTQA 1DM2A 1QPEA 3A7GA 2BPMA 5BYYA 1XO2B 2WMXA 3RHKA 4DBXA 3BYOA 1O9UA 1Q61A 2OI4X 2OJGA 3C4EA 1QPJA 3FLQA 3H4JA 3PPZA 5CU0A 1FMKA 1B6CB 1ZRZA 1BMKA 3QUPA 5HIEA 4BWKA 2PU8A 3DAEA 4IJPA 2HAKA 4Y8DA 3ZS5A 4PP9A 1GNGA 4IWPA 3DY7A 2BFYA 3QUDA 4EH2A 2IN6A 4TYHB 4ANLA 5GZAA 2XCHA 5M4CA 3UOHA 3ZSHA 5IF1A 4RPVA 4YZBA 2PZPA 2XKDA 3RK5A 5LVPA 5C8NA 2YJSA 3ELJA 3RTPA 5CNNA 1TQIA 2RG5A 5D9HA 3QTXA 1ZYDA 5EKNA 4E26A 4OTDA 5AP2A 5ETCA 3V5QA 2CNQA 4FNYA 3QD4A 5IZFA 1YDSE 4O1OA 1F5QA 1OECA 2VWBA 3EL8A 4I5MA 4DCEA 4FT9A 3H0ZA 2FVDA 5F1ZA 3FQHA 3MVMA 1OM1A 4UB7A 4QQ5A 3VVHA 5HICA 3WBLA 4E5BA 2W4OA 2ITZA 4PNKA 2GHMA 1Y91A 4X6RA 2WTJA 2W1FA 2OICA 2W05A 4QMTA 3U8WA 3DBEA 4YHTA 5L6PA 5CAVA 4I23A 2QLUA 2XIXA 3WF6A 4EH5A 4JDIA 3W2PA 3OT3A 2OSCA 2P0CA 4KBKA 3D5VA 3V6SA 3QXPA 3CJGA 2VTIA 5HCYA 5BVEA 3E8EA 3IW4A 5AM6A 4D55A 1Q97A 4KIOA 4GT5A 5DE2A 4L8MA 3QZHA 3GU5A 2IJMA 3FI8A 2WQBA 4HVHA 3QRKA 4WSQA 3RGFA 5KMNA 5FD2A 3ZZEA 1Y8YA 1UA2A 5BUIA 3BU6A 2HELA 3LVPA 4FVRA 5EK7A 3S3IA 1JKTA 2WTVA 1PXKA 4EJNA 2WFYA 3SHEA 4YPSA 3RAWA 4XHKB 4F1TA 5GIPE 4RFZA 5DWRA 5HG5A 4FTLA 1H1SA 3ZONA 3FC1X 3VJOA 5AAEA 4CMTA 4U3ZA 4Y5HA 5AR8A 4UX9A 5HGIA 4O7VA 5EM6A 4IBMA 1LEZA 1A9UA 4F64A 2FO0A 3BCEA 4EOLA 2Z60A 1G3NA 4AG8A 5EQYA 4IXPA 2X6DA 1WAKA 2J5EA 4BGQA 3MB7A 4UYAA 3BHUA 4K77A 1XH8A 3PP0A 5ETAA 5ETFA 4KBCA 5K3YA 5KMLA 1V0PA 1DS5A 2PVFA 2V7AA 4CRSA 4F7LA 1H1RA 4A06A 1QMZA 3BELA 2WKMA 3CPCA 3HMMA 3LM5A 4MNFA 2G2HA 5AR7A 5IEXA 5A54A 2FSOX 1KE7A 5JRSA 3NRMA 4BTKA 3R1SA 3DTWA 5JH6A 4PTCA 3DXQA 2B53A 5GJGA 4CQGA 3ZFMA 3EWHA 1IR3A 4NCTC 5AX9A 3PJCA 2O3PA 3PP1A 4DGOA 3ANRA 5M07A 4HYSA 3MH2A 4KA3A 4XV2A 2ERKA 4QMXA 3TACA 4USEA 4X21A 3BU5A 4Y5QA 5HTBA 4ZY4A 1VEBA 2GHLA 2P2HA 4FIJA 3DTCA 4CVAA 5M4IA 4FKVA 1STCE 4FEWA 1YVJA 2WTIA 1IRKA 3Q4UA 4H58A 4ITIA 3KXNA 3KF4A 4W9XA 4YZNA 4XG8A 4AA5A 4AU8A 2J0IA 2RFEA 4HCUA 4QP1A 3UJGA 3O96A 4FT5A 3OTVA 3VUDA 4G3CA 4IAYA 3W8LA 2OO8X 3M1SA 4FTQA 3CY2A 3DQXA 4MAOA 1PXJA 2BIYA 4JQEA 3MY0A 3P9JA 3U6IA 3FY0A 2EXEA 2GS2A 3Q9YA 4RFYA 2PY3A 3AXWA 5E9EA 5DR6A 3ZUTA 3QF9A 4ACMA 4NYEA 4GIIA 5LCJA 1IAHA 2BROA 2KTYA 3CD3A 3R04A 5L6WL 4CG9A 5EG3A 4ZJVA 2B9FA 5AA8A 4CYIA 3EQRA 3OD6X 3R2BA 3UODA 1GIHA 4X2GA 4NKAA 3GT8A 3Q60A 2O65A 2WOTA 4D2VA 2GS7A 4QPSA 4DH5A 1CTPE 2E2BA 4OAVB 4FSRA 4RA5A 2BDJA 1XWSA 4LYNA 3VBTA 3MPTA 4ASDA 3AGLA 3OW4A 4EK8A 4M67A 5L2QA 3IDCA 1E9HA 3OCTA 4E6AA 2CSNA 3GOPA 3LLTA 3PIXA 5FP6A 5KMJA 4CZUA 3ORKA 3UYSA 4H1MA 3D7TA 5AEPA 2YCFA 1FVVA 4PTGA 2X0GA 2R3GA 3TI1A 4F9BA 1YXXA 4XEYA 3BKBA 3HDMA 3OCSA 4NUSA 2W9FB 3C13A 5CVHA 1XBAA 2YIXA 2ZV2A 3FYKX 4TNDA 3MJ1A 3RPYA 4NIFA 2QG5A 2UW7A 1YXTA 3D9VA 4QMVA 4X6QC 4ZS0A 3RK9A 3RZBA 3VN9A 4U3YA 4WOVA 4AW5A 2PVLA 4EC9A 1V0OA 2VV9A 1OKWA 3KN5A 4EJ7A 4QMSA 5AADA 2C1AA 5CEPA 3G0EA 4WKQA 2P4IA 4B7TA 5I9XA 4CLIA 2R3MA 4LG4A 3RM6A 4CFMA 4O7TA 2NO3A 2XEZA 4NM7A 3NUYA 3HA8A 4WSYA 2GHGA 1H1QA 4FV3A 5BQ0A 2PULA 4MQ2A 4BKZA 2JDOA 4Z9LA 3TKUA 4EHGA 3DCVA 3RNYA 3FZOA 2VTNA 3UVPA 2VTLA 4ZY5A 2PL0A 3NIZA 5ANKA 4PMPA 2WEVA 3ORZA 4EOIA 2RFSA 4IACA 3ULIA 3U51A 4FIGA 2O64A 4EOKA 5HESA 3P7CA 4XS2A 3E5AA 4RJ4A 3E87A 4APCA 3TNWA 4BDIA 1F0QA 5EKOA 4JR3A 4UY9A 4Z7HA 4ANMA 2ZM4A 3COIA 5F9EA 3P1AA 3U6JA 4C0TA 3BLQA 5HBHA 1MRUA 3EN4A 4KIKB 3D5WA 4BHZA 5D1JA 4S2ZA 5F20A 3PVUA 2YACA 4EOPA 1PXMA 2X2LA 3PDTA 2JC6A 4E4LA 3FYJX 4HZSA 4YTCA 3TKHA 4FT0A 2H34A 4PUZA 2XP2A 2HW6A 4P4CA 4EQUA 2ZDTA 5KMMA 3EH9A 4D0XA 3FL4A 3GENA 3VC4A 4QYYA 3NEWA 5LJJA 4NTTA 4S33A 4LRKA 3IDPA 5FUTA 4Y72A 2VRXA 2IW8A 1QPDA 2IW9A 3NYOA 5TF9A 4DFXE 2R7IA 5A4QA 2PMNX 3N51A 5K4IA 4A7CA 5DT0A 4TPTA 5CAQA 2HW7A 3R9DA 2ERZE 3ZLYA 4AA0A 3UO5A 1OUYA 3DGKA 2J7TA 3IQ7A 3MDYA 3S0OA 3R0TA 3NW5A 5GZ9A 2UZLA 3RALA 2VTSA 4E4MA 2QKWB 2ITPA 3QYZA 2W9ZB 4MH7A 2ITQA 4D4SA 3LFNA 3OXIA 4XG9A 3DJ6A 4IB1A 4DGNA 4I21A 4RRVA 4OR5A 2XMYA 3QL8A 4FNXA 5AP5A 2Y6MA 4FSQA 4QTEA 2PUPA 3CE3A 3QBNA 4LV8A 1Q24A 4RT7A 4JBPA 2RFNA 2XK7A 2CCHA 2ITXA 3OF0A 3VS2A 2JKOA 3SD0A 2VX0A 3OOGA 4K11A 2XJ0A 3IECA 3FV8A 3R1NA 1BL7A 1Q5KA 3JY0A 5DEYA 5CTPA 4HVDA 3TUDA 4BDKA 2R64A 4FTUA 5HX6A 3DXPA 2GFSA 4MBIA 2C0OA 3QGWA 4JG7A 4D4RA 4ZLOA 1S9JA 1FGKA 1WBVA 2GNFA 1KV2A 3OY3A 3FLNC 2W7XA 3BRBA 4EZ3A 4BC6A 3LXNA 2VTAA 3E7OA 4PL5A 3H9FA 3AC3A 4QMQA 3D7ZA 4GG7A 4BWPA 3QZIA 3KRLA 4JBQA 4U9AA 1NVSA 2NP8A 4F1OA 3HUCA 3ZCLA 2IVUA 4MXOA 2BDFA 2JIIA 4J53A 1ZOHA 3MIYA 3ZH8A 3QAME 1Q8ZA 4ZEGA 3P23A 4ONAA 1U5RA 4RFMA 4G5PA 4MXXA 4PQNA 3WYYA 1K9AA 3HP5A 1PF8A 1SVEA 3O0GA 4FSYA 4HYHA 2YIYA 3ZEWA 4KKGA 3POOA 4F6SA 3PSBA 1PKGA 3HZTA 5TR6A 4AZSA 4C4GA 2ZM1A 2UVZA 4C4IA 3UOJA 1IA9A 3II5A 4XG3A 5CNOA 3HP2A 2VO7A 5F94A 1M17A 4R8QA 3V8WA 5IQDA 2B54A 3HV3A 4LOPA 1OUKA 2OIDA 3EQCA 3R9HA 5BVKA 3TNQB 1YXVA 4QMZA 3DK7A 1HOWA 2CKOA 4AW2A 4ZTNA 3V8TA 3WZEA 2VWVA 3UPXA 3I60A 4G3EA 4I0TA 4KKHA 1SVGA 3PJ3A 4HNFA 4YHJA 2WNTA 4LI5A 5I9ZA 1TVOA 3W33A 4X3FC 1GIIA 1BL6A 4BHNA 2XM8A 3PY1A 4LGHA 4U43A 3HMNA 3LFDA 5K0KA 3LXLA 5FXSA 3QD0A 3FY2A 3R8UA 4UMPA 2XA4A 4HGEA 3E8NA 5FTOA 4E6QA 3R73A 4WRGA 2ITVA 3UYTA 3W2RA 2WTCA 3GC8A 4M97A 4AUAA 1XKKA 5AA9A 1GJOA 4XG4A 1UV5A 4XYFA 3D0EA 2CLQA 2QKRA 4AOTA 5IA1A 2YZLA 2JKKA 1MRYA 3IG7A 2YA9A 4TKSA 4ANSA 4D1ZA 3VAPA 5BVOA 5EOBA 3QU0A 1XH6A 4ALWA 3ORTA 5FQDC 4BDGA 5AJQA 4JG8A 1J7UA 5LVNA 3EZRA 3U54A 5DNRA 3AC4A 4F0FA 5EYMA 4ACCA 4FIFA 3GNIB 4XV3A 5CX9A 3OFMA 2BCJA 1W84A 4FNWA 3R7EA 3ZLXA 3KREA 3NWWA 2CGUA 5HVJA 4JDHA 3PG1A 4I3ZA 2OH4A 3KC3A 3M11A 3C5IA 4IH8A 4IWOA 4DFNA 2PE2A 1LUFA 3IOPA 4I0SA 1YWRA 5IKWA 3I7BA 3VUGA 4AGWA 2WMBA 1CKJA 2W5HA 3JYAA 1MRVA 1DAYA 3B2WA 3ZTXA 2ITOA 3HMIA 5HNBA 3T8OA 3UG1A 2DWBA 1SZMA 2WMVA 4ZXTA 3F3WA 5TE0A 3G2FA 4F0IA 4FZ7A 1W83A 2QOQA 4L67A 2LAVA 2X4FA 1G5SA 3VS6A 3GCVA 3F82A 4GT3A 5H9BA 3R7GA 3DBFA 4EH3A 4UEUA 2UZVA 2E9PA 2EB3A 3THBA 4BCOA 2XYUA 4KWPA 4X2FA 4BCGA 3AT4A 1OIYA 2W1EA 4R5SA 4RG0A 4RVTA 1H0WA 3PVGA 2C5YA 2B0QA 3L8PA 3QFVA 4FIIA 5HX8A 5ITAA 3R7UA 4K6ZA 2CKEA 4TRLA 3CQEA 3EN7A 5B0XA 5BVNA 2ITUA 3I6WA 5ANIA 4Z7GA 1ZYJA 4F1MA 1PMUA 2ZOQA 4PTEA 2V5QA 4PP7A 1IA8A 5AIKA 4TL0A 2VWUA 3AC2A 4J97A 4NSTA 5L4QA 4TY1A 5AAFA 5HVKA 3QC9A 4J98A 4I20A 1UWJA 2VUWA 3TM0A 4HYUA 5FDPA 2W5BA 3HRCA 1FVTA 2QURA 5EYCA 5CVFA 2R9SA 4F6WA 3I1AA 1UU7A 2WPAA 3KGAA 4OTQA 2UZEA 4QP9A 1OL2A 3VULA 2PUUA 4ZZOA 2WQEA 5KMOA 2XH5A 3FLYA 1GY3A 4AZEA 3MWUA 2VU3A 4QMNA 2YN8A 3S00A 3G5DA 2OH0E 2A2AA 4YBJA 4EQMA 4CMOA 4IJ9A 4RSSA 4YZ9A 5IISA 3GI3A 1M14A 2ZDUA 4G5JA 2PMOX 5CQWA 4JJRA 1YXSA 3QWKA 4LL5A 3RAHA 3F7ZA 3SKCA 3QA8A 3KY2A 1E1XA 4HJOA 5C03A 3PG3A 2WMUA 5LWMA 3OWLA 2BKKA 1NXKA 4W9WA 3QTWA 3MGYA 4YNEA 1ZMUA 3Q52A 2WQMA 4NJDA 1B38A 3VJNA 4EKLA 3IK3A 2X7FA 3EOCA 3VWAA 2VWIA 4D0WA 2QOLA 5H8EA 4DEEA 4RIWA 5AP3A 3DFAA 4F63A 5CSHA 3T9IA 1PXLA 3S4QA 4F65A 3C4ZA 4MBJA 1S9IA 1H1WA 5IUHA 3EFWA 3SA0A 4K2RA 4LGDA 3NUNA 2C1BA 3WIGA 2R3IA 4W8DA 2R3HA 1NT2A 4GW8A 2W1CA 5JK3A 3PVBA 1VJYA 4FT3A 1UNLA 3BU3A 2H8HA 3VS1A 2XNEA 2J4ZA 1JSVA 3MTLA 4A4LA 1Q8TA 3HV7A 4NCTA 4X3FA 4ZP5A 2C47A 4HVIA 3WZJA 3GCPA 4DYMA 3POZA 4CSVA 2YDKA 4LGGA 2VWZA 4DT8A 2CN8A 5EHOA 3FC2A 4CCUA 5AM7A 3R8VA 3ZRLA 1Z5MA 1OL7A 4QD6A 3ALOA 3ROCA 3A8WA 3FHIA 3PYYA 4O7ZA 5CI6A 2SRCA 3E7VA 5A6OA 2R3OA 5E8ZA 3KRJA 2BZIB 3VS7A 2VWYA 2WMRA 2R3KA 2ZAZA 3MN3A 1GZKA 4IDTA 4KBAA 4B99A 4ERKA 5LVMA 1AGWA 3M42A 4BKYA 3FI2A 4RC4A 4BGGA 4F9YA 4IE9A 3QUEA 3CKXA 4CFXA 4IZAA 4QP4A 5CT0A 5BUJA 5CVGA 4HCVA 2XNOA 5KUPA 3BE9A 1XHAA 5L2WA 3QGYA 1H1PA 3RAKA 1A06A 5A9UA 3U4WA 3COKA 4YO4A 3IGGA 4BRXA 3C0IA 4J7BA 4DEAA 2X39A 4YO6A 2RF9A 3ORIA 3UNKA 3WZUA 4RIXB 3OW3A 3GCSA 2R7BA 4FEQA 5M06A 4RJ5A 1SM2A 2ACXA 1ZYSA 4OTPA 4OBOA 3ZM9A 3TIZA 2B9JA 4DEHA 3QTRA 1NW1A 4CXAA 4GK3A 2C6LA 3TXOA 3UGCA 2BZJA 3PSCA 3EHAA 1G8AA 4TWCA 4FA2A 4UMUA 3AOXA 4OBQA 3TUCA 3FLZA 2YM3A 3ITZA 4QMUA 2IZSA 5FWKK 4PDYA 5LMAA 4FYNA 2EXMA 3P79A 3LPBA 2Y4PA 4L00A 4WRSA 4BDAA 5G6VA 3TZ7A 5JGAA 5H2UA 4PDOA 2B7AA 3BGPA 4GUBA 1CMKE 1H0VA 2QOOA 3MFUA 4F4PA 4DEBA 5LWNA 3VUTA 4BR3A 4HCTA 2WZJA 4MEDA 2QC6A 4RLKA 5J7BA 5E91A 2Y8OA 3G6HA 4P7EA 3FUPA 3DZOA 5HLWA 4RJ7A 3PE1A 3GFWA 5E4HA 4FTNA 1H27A 4F08A 1V1KA 4R3CA 4MYGA 5FM3A 4OT6A 4XH6A 4CQEA 4AACA 3SG9A 4UWBA 3GCUA 3L9LA 4DGGA 1KUTA 2JDSA 3ACKA 5JZNA 4M66A 3A8XA 3FDNA 2W17A 4O7WA 5B2KA 1YHWA 2XUUA 4AFJA 4L42A 4AZVA 4EC8A 1AQ1A 5JRQA 3LQ3A 2PVHA 3RCDA 3P7AA 3OEZA 5HORA 4G9RA 1H25A 2WTKC 3UO6A 2IVSA 3G9LX 3IW5A 3LFEA 3NVKI 2ZV7A 4FKUA 4R6VA 3F88A 2XB7A 2H96A 3EQHA 4BIBA 4B9DA 4O0UA 4Y46A 4U44A 2C68A 1YQJA 3BV2A 3JY9A 1Q62A 4HGTA 3VUKA 4KABA 3IDBA 5JSMA 2QNJA 3ATTA 5FXRA 4RZWA 3TG1A 5IQAA 5A46A 4O7SA 4U41A 1YW2A 5L6OA 4FEUA 3UVRA 2RL5A 3CIKA 4LRMA 5E8WA 4O86A 1H24A 1OKVA 4S31A 4A9TA 2ZM3A 4JS8A 4CFWA 2CKQA 3H30A 4DH8A 1OKYA 5C4LA 3PY0A 4QYEA 5AR5A 3SV0A 5AV0A 3EN5A 4FTKA 3U87A 2UV2A 4Q5HA 4BZDA 2XK9A 4FTOA 2XIZA 2Y4IB 5D11A 4E5AX 3EQDA 1NVQA 3EL7A 2YM4A 5L8LA 2WD1A 5E90A 4GJ3A 3UVQA 5DMZA 3W55A 5HTCA 3LCDA 3PLSA 5KZ0A 1WBWA 4BI1A 3KK9A 3KMMA 4YC6A 4ZIMA 2B1PA 3WE8A 3W2CA 3GQIA 2P3GX 3NUXA 4Y73A 2E9UA 4CZYB 4NIFB 2F49A 3OVVA 3GEQA 5LCKA 1PY5A 2HENA 3ZO1A 4DAWA 3ORLA 3ZM4A 4EUUA 3Q5ZA 3NUAA 2JFLA 5B2MA 5CXZA 3AD6A 4U40A 3Q2JA 5FEQA 4G6OA 5GHVA 3ET7A 4FZAB 4TYEA 3O8PA 4GJ2A 3LCKA 4AX8A 4LM5A 4BDJA 3TTIA 5AUTA 3WOWA 5KHXA 3FEGA 4GRBA 3ZC6A 3FKLA 3AMBA 2C6MA 4MBLA 4O91A 4ZSLA 4BTJA 1FOTA 5FXQA 4AOIA 1UU8A 5KBRA 3KCKA 4FSWA 3HGKA 3HECA 5E1SA 4NTSA 3V04A 2R4BA 3W32A 4ZTMA 3CKWA 4QPAA 1PRYA 1ZMWA 4IDVA 5FEEA 3MFRA 2PVNA 3LFBA 5F4NA 2YM5A 3VBYA 4C3PA 2WXVA 4E8AA 4DA5A 2QOHA 3COHA 4X7QA 1KE8A 5JGDA 5A4TA 1OVEA 2BALA 1BI7A 2GSFA 2VWXA 5AX3A 4JR7A 3QYWA 2YIWA 2VTPA 3K3JA 5C8MA 5IUIA 2C5VA 3FI3A 4RIYB 4KS7A 3WF9A 2HWPA 5CU3A 2H9VA 4XJ0A 5BNJA 5EYKA 5C9CA 3ODZX 4V04A 3SOAA 5HBJA 3S1HA 3NNXA 2OGVA 3OMVA 3ZBFA 4QQTA 2KULA 4YZMA 3F69A 3MY5A 3IONA 4KB8A 2VX1A 4QMWA 5EDRA 3DDQA 2OK1A 4DEGA 4IVCA 3C0GA 5HLNA 3UIMA 4G34A 4R3RA 3Q9XA 3MH0A 3QHWA 4PWNA 3A4PA 5TT7A 5M57A 3KXHA 4YLJA 4NT4A 4DFYA 3WYXA 4YJRA 3ZSIA 3BYSA 1CKPA 4MD9E 4EBWA 3PXQA 3ORPA 5B2LA 5JEBA 5LXMA 3SX9A 2FGIA 3ENMA 4DGMA 5J7HA 2BZHB 3QRTA 5DOSA 3K5UA 4IAAA 3I79A 5A4EA 2IZRA 4IM3A 4BZNA 3R1QA 4OLIA 5IA4A 5M44A 3LJ2A 3C51A 3BHVA 5F95A 1OZ1A 4KKEA 4JRNA 4ZY6A 2BUJA 2XCKA 1FVRA 4EK4A 1OI9A 2OZAA 4TN6A 4EKKA 3R9NA 2B55A 2OW3A 2DUVA 3C50A 2OJFE 3K5VA 3AT2A 4W4WA 3MA6A 3H0YA 3QQFA 4JLCA 1JPAA 2QU5A 1LEWA 5CSWA 4CGAA 4XP3A 2A19B 4MWIA 3SXSA 4JQ8A 2W4JA 2CNVA 1OPLA 2HWOA 3SXFA 5DFPA 3HMPA 4P5QA 3SOCA 4FV5A 4AT3A 1XBCA 2OIBA 1CKIA 2YIQA 3EIDA 3H9RA 3QD2B 3LE6A 5EDQA 5HTIA 3REPA 3NYVA 5KMIA 2WEIA 4UXLA 3V6RA 3W10A 5BPYA 4O84A 3QX4A 4MX9A 5EW8A 2J90A 2W1IA 4FTIA 4LOOA 4XG7A 5KKRB 3JXWA 2WAJA 1X8BA 4LL0A 2C3JA 3NPCA 3Q32A 5IA2A 3D94A 4IVDA 2QO2A 3UMWA 4F70A 5CEKA 4GU9A 4ZTLA 5KNJA 3ALNA 3R6XA 4F9CA 1YDRE 3MA3A 1KV1A 2O8YA 4YJVA 4C37A 3C4WA 3UQFA 3N4VA 4I22A 5DT3A 4I6QA 3VF9A 1MUOA 5DHJA 3UC4A 1U46A 3W2QA 1OKZA 4X3FB 5M09A 2PZYA 4IVBA 2ITNA 4LOQA 2BHEA 5AV1A 3COMA 1PW2A 3ZFYA 3AQVA 3FKOA 3IGOA 4NFMA 4EL9A 3ORNA 5L2IA 3CGOA 3QC4A 4EH9A 5K4JA 3JUHA 3GFEA 5IH5A 5JT2A 4FEXA 1J7LA 2CHLA 4TYGA 3MW1A 2A27A 4USDA 3ID6C 2YEXA 3PZHA 4FIHA 4H3BA 3ZHPC 2ESMA 4FT7A 3MSSA 2JD5A 2C6TA 3I5NA 1W7HA 4O21A 2ETMA 2JKQA 2XK8A 3A62A 3Q3BA 4WD5A 2ITTA 2YCSA 2GNHA 4EK5A 1ZXEA 4OT5A 2XNGA 3KEXA 5IEYA 3HV6A 3VF8A 1ZWSA 3QTUA 4G6NA 2IZTA 2J0MB 2UZNA 5L8KA 3TJDA 3UMXA 5GNKA 3CBLA 3I0OA 4FG7A 2QONA 3QA0A 2PPQA 3FE3A 4I5CA 1P4FA 4KIKA 4KSQA 5J1VA 3ZZWA 4UALA 3NS9A 4ANBA 4EH6A 5CZIA 4BGHA 5IQIA 2J0LA 3OZ6A 5CEOA 1B39A 4J52A 5J9ZA 2X2KA 1ND4A 5IQHA 3DLZA 5EHYA 5IU2A 3DBQA 3SC1A 4WHZA 3UZRA 3BGQA 3R83A 3TKIA 3GC9A 4OBPA 4WIHA 2PMLX 4FL3A 3KRXA 4YC8A 4D2TA 1ZY4A 3Q4CA 4XV1A 4YURA 3RM7A 2BRNA 4WNPA 3MH3A 2B9IA 3MV5A 4GUEA 3DFCB 3IKAA 4FBXA 2JLDA 4GU6A 5EHLA 3MH1A 5ETIA 3LFFA 2PSQA 2XRUA 5LMKC 3MPAA 1K2PA 3QKMA 4G3GA 3NNVA 4CKIA 3BI6A 5E8SA 3QRJA 3BGZA 3NW7A 4U8ZA 3F2AA 4PMMA 3GVUA 3OUNB 5HIBA 3P5KA 5IQGA 1PHKA 3AC1A 4YBKA 2GNIA 1YHVA 2JKMA 4RIWB 3OWPA 2RG6A 4E20A 2PUNA 3R7IA 2WIHA 4BCJA 4JBOA 3C4XA 4AGUA 5A4LA 3LHJA 3H3CA 3IPHA 3V01A 2R3FA 4L52A 5DN3A 4TWNA 2VTMA 5FP5A 2FYSA 5CQUA 2R2PA 2FSMX 4ACHA 5C26A 3HLLA 2VTRA 4FKWA 5AAGA 4ENXA 3R30A 5M56A 3ZU7A 4QMPA 4EORA 2PMIA 3MPMA 5G1XA 3BQCA 3C4CA 2YABA 4IB0A 4FR4A 4Y95A 5AP1A 4C35A 2JBOA 4XLVA 4I0RA 3O2MA 2UW9A 5DH3A 4E4XA 3PA4A 3PIYA 5CENA 5AP4A 5IDNA 2PVRA 2V55A 1UNGA 2IVTA 5I0BA 4G2FA 4IWQA 2HIWA 3UNJA 2VTOA 5KX8A 3RZFA 3FMHA 4A07A 2H6DA 2XIRA 3W1FA 4AE6A 5EW9A 5L8JA 4DN5A 4C2VA 4N6YA 3DKOA 3A60A 5E8VA 3QCSA 5C27A 3NIEA 4FOCA 3QQJA 5CI7A 1YHSA 4D2WA 5CT7A 5E92A 3VHKA 3JVSA 3C7QA 5ANDA 3G0FA 3R01A 4IZYA 4G1WA 4YGAA 5EH0A 3FWQA 4ZMFA 4U79A 4QP3A 5HI2A 4S32A 4TWOA 4WA9A 4AGCA 4LV5A 2OU7A 2ZV8A 4G3FA 4F09A 3HUBA 3OS3A 3UOKA 4C4FA 2OZOA 4CT2A 1GZOA 4YNOA 2OFVA 4FODA 4J8MA 3D2KA 1UNHA 4FG9A 3GXLA 5EDPA 4D2PA 5DIAA 3A4OX 2XVDA 5L3AA 3UQCA 4U6RA 4H05A 1A48A 4FSMA 4QP6A 2XJ1A 4EEVA 4CLJA 3BLHA 2OXDA 2YM6A 2HZIA 4BIEA 3PA3A 4RGJA 4EH7A 2WU6A 1Q4LA 4BI2A 3KULB 4EWHA 3DLSA 3UQGA 4DE4A 1QL6A 3E3BX 1CDKA 4GEOA 3QTSA 4MTAA 4K8AA 4F0GA 3OBJA 2UUEA 4FE2A 1L3RE 5JQ5A 3D4QA 4YTHA 4FSNA 3EQFA 4N4SA 4MK0A 2OF4A 2X7OA 3Q4ZA 3DPKA 5IH6A 2C6EA 3RNIA 2C3IB 1M52A 2QO7A 3ZXZA 3CGFA 4WG3A 4C59A 4WBOA 2XKCA 3OEFX 5AUUA 1SNXA 2BDWA 3HEGA 3CLYA 3NYNA 4QNAA 1OGUA 2C6KA 2F57A 1REKA 2WQNA 4AXAA 5CSVA 5CU4A 4PPBA 1OB3A 1PYXA 2W99B 2Y9QA 3BYUA 3DB6A 3BZ3A 3LMHA 5J5SA 1XH5A 2UZWE 5HE3A 2J2IB 1XJDA 2Z8CA 4WG4A 2PVJA 2XKEA 4I92A 4B4LA 1GZ8A 3ZEPA 1RW8A 2Q0NA 2BRMA 1Q3WA 2YLEA 3F5GA 3TZ8A 4E4NA 4YUQA 1REJA 2WTWA 3BWJA 5H8BA 4I4EA 4RWIA 4FKTA 3BHHA 3G15A 2CKPA 2BR1A 3NLBA 3V5LA 3NDMA 4FICA 3UP2A 2RGPA 4M69A 3KXXA 4FNZA 4E5WA 5BUEA 4BYJA 4YR8A 3LW0A 2I0HA 4O81A 4FV8A 3TT0A 3SRVB 4HZRA 4D58A 4E6DA 2R5TA 5AR2A 3GC0A 2XKFA 5CF8A 3WE4A 3BWFA 2XNBA 5BYLA 4C8BA 3QLGA 1J91A 4MQ1A 4IADA 3VRZA 3BV3A 3RK7A 4X2JA 2UZTA 4I24A 4IAKA 5FM2A 2QLQA 4BKJA 1UU3A 4WG5A 3LOKA 2Z7SA 1PXIA 2VGOA 2C0IA 4G3DA 2A1AB 5J8IA 3DV3A 1Q99A 3FXWA 3H10A 4HPUE 4OGRA 2CNUA 2RIOA 3LCOA 4OTGA 4RC3A 2I40A 5DR2A 4O82A 2VZ6A 2EVAA 1O6KA 3PY3A 1MQ4A 2UW5A 3F5UA 3DT1A 3R1YA 4KNBA 4RBLA 4YZCA 3A7IA 5E1EA 5HKMA 3ZDUA 5J5TA 4ACGA 3F5XA 4BCKA 1T45A 4NW6A 3TEIA 5JFSA 2YDIA 2Y6OA 3MI9A 3EQPA 3PJ8A 3MFTA 4HVGA 4D1XA 4EOJA 2WMQA 4AWIA 4ANNA 2E9NA 3CS9A 4MCVA 4EOQA 3TDVA 4J96A 4PDSA 4BIDA 4A4OA 5CAOA 3RCJA 2QOBA 4NW5A 1ERKA 3QTZA 2X2MA 4QTBA 2C3LA 4M84A 4RC2A 3M2WA 2GMXA 3UIBA 2FB8A 3DK3A 4IMYA 4M7IA 3O71A 5M08A 4UWCA 4YJOA 3WF5A 2C3KA 1JOWB 3RWPA 4KINA 1CM8A 4QTCA 5FDXA 2BRBA 3HRFA 4FX3A 4EYJA 2AC5A 2JGZA 3F9NA 3GQLA 4DLJA 5K9IA 3PFQA 5IQCA 4FV6A 4IFCA 4JX7A 4TYJA 2AYPA 3ZUUA 5CALA 3O8UA 2XEYA 4AF3A 3T3VA 4FMQA 4MWHA 1PXNA 5IG1A 3N4TA 4UMQA 2JEDA 5KKRC 2AUHA 1PKDA 4IWDA 3IO7A 4EZ7A 4R7BA 4OUCA 4QNYA 4Y85A 4P5ZA 3SRVA 3TUBA 1Z9XA 3IS5A 2OG8A 2UZDA 4IX3A 3C0HA 4L68A 3NAXA 4NM3A 4U81A 4BCQA 4RX5A 1ATPE 4U5JA 4IAIA 3R2YA 3BBWA 5A14A 5CU6A 2GQGA 4R1YA 5FBOA 4DF3A 3OUKA 4JIAA 2IO6A 4NU1A 4DTKA 2NRYA 2XBAA 3Q4TA 4FK3A 2OXYA 2CN5A 4UZHA 2FSLX 2XS0A 5IPJA 3NAYA 2OIQA 2PUIA 1OPJA 4M3QA 5J9LA 3Q5IA 3TV4A 4FEVA 2BILB 5DI1A 4FKGA 3ZFXA 4XOYA 2CPKE 4AZWA 2C4GA 1UWHA 5HG7A 3QRUA 3R00A 2CGXA 4JQ7A 5ACBC 1YOJA 1R0PA 1ZYLA 1UU9A 2BKZA 3TN8A 2HXQA 2WTKB 4HOKA 4FTRA 3CD8A 4MXZA 5C01A 3H9OA 4RIXA 5GINE 4IC8A 3PRIA 4DH3A 1SNUA 3PWYA 1H01A 3GOKA 4O1PA 3OCBA 3EZVA 2C30A 3NNWA 4FTJA 4D28A 2VTHA 2RSVA 2GQRA 2GQSA 2R0IA 3VNTA 2QOIA 2NNWB 2G1TA 2WGJA 1Z57A 4GH2A 1YOLA 5EM7A 3FLSA 3QZFA 3F66A 3DZQA 1HCLA 4GIHA 4B0GA 4Z16A 2QI8A 2I0VA 4R1VA 3OG7A 4FKPA 4CTCA 1P5EA 3R63A 4N0SA 4BBMA 3AD5A 4CCBA 2R3RA 1U54B 5HO7A 3FHRA 3QD3A 3NSZA 3TV6A 4PPAA 3OOMA 4PDPA 4Y83A 3ZLSA 5JZJA 5DG5A 3HV4A 4GV1A 3BX5A 2YCQA 3DBDA 2F7XE 3F5PA 5I9WA 2WMWA 3KKVA 5EM8A 2FH9A 4CTBA 2Y7JA 3ODYX 3DK6A 3OTUA 3RINA 2QOKA 3ZSGA 5EFQA 1L8TA 3W8QA 1OL1A 1MQBA 4KUJA 2F4JA 3AG9A 1I09A 4IIRA 5EI8A 5CU2A 4C36A 1W0XC 5HD7A 3UO4A 3C5UA 3KCFA 3QQGA 1XH7A 1GZNA 4IAZA 4JAJA 4R7HA 5EI2A 2YWPA 4ACDA 1KOAA 4O0XA 5EW3A 2OFUA 2WHBA 4D4YA 4K18A 4BCFA 1H8FA 4EK3A 3PVWA 5AUXA 4A9RA 4UBAA 3LQ8A 3EB0A 3UBDA 4M8TA 3CPBA 4C2WA 3ERKA 3PPKA 5ANGA 2CGVA 4FV2A 5E8XA 4YP8A 4AN3A 3FJQE 4ZLZA 3QLFA 4ZS4A 3KXMA 1I44A 4O0RA 4E73A 3I0QA 4O6EA 1WBTA 2JAVA 3HKOA 5M4FA 2X4ZA 1Q8UA 5T6KA 3TNIA 4J99A 2W4KA 4ZTHA 4DFZE 3R8PA 4FSUA 4YJNA 5I3OA 4QMOA 5CF5A 3PIZA 2X8DA 4MKCA 2G9XA 3QALE 4RZVA 3ZO3A 2C5OA 4PPCA 5HE1A 2YDJA 3D83A 5I3RA 3KULA 4DC2A 2XRWA 3CEKA 2BHHA 5BVWA 3T3UA 4D9UA 4DGLC 5CS6A 4C57A 4UN0C 1WMKA 5IMEA 2VGPA 4DCAA 3O51A 1OIRA 3L9NA 5TOZA 3FZSA 1APME 3DAJA 2O63A 3EN9A 5DLSA 3O23A 3ZC5A 4JRVA 3QZGA 3UOLA 4FUXA 4I1ZA 4O7LA 5AP7A 5LOHA 1WVYA 4IB3A 3GU7A 4H3QA 4GS6A 3QCQA 3ZMMA 4PY1A 4BCIA 4F9WA 1V0BA 2VWWA 1BUHA 3GBZA 4O2ZA 1UKIA 2HZ0A 3AMYA 4WNOA 5AUZA 4Q9ZA 1KE6A 2UW3A 3ANQA 1MP8A 4MHAA 4W4VA 4XRJA 3OCGA 4RQVA 3R8MA 2Z2WA 3HAVA 4EONA 3KXGA 4CD0A 2RKUA 3LFQA 4RIOA 5D7AA 4XRLA 4F7JA 4MVFA 3TL8A 3FZPA 5IQEA 4L7FA 4TNBA 4KAOA 3GU8A 5DR9A 1ZLTA 4IANA 2BTSA 1JNKA 4NJ3A 3DOGA 3EFJA 3E93A 4FSTA 4CKJA 3ZDIA 3P78A 4H39A 3CTQA 3HMOA 4BF2A 2BVAA 2Z7RA 4Q5EA 4YJPA 5T68A 3ZXTA 4Z3VA 4YJUA 1O6LA 2HZNA 3G33A 4XUFA 5K5NA 1WBPA 3KL8A 1KWPA 3EKKA 1Q41A 2QHNA 2ITWA 3ORXA 3Q6WA 2XNPA 4O0WA 1VYZA 4ZTRA 4XV9A 4L3PA 3LXKA 3MB6A 4V0GB 1KSWA 3VW8A 1YWNA 1YDTE 3HA6A 5HLPA 1LP4A 3BHYA 4J95A 5I5ZA 2GFCA 3OC1A 4PNIA 5GIOE 3Q53A 3ROYA 4YSJA 3LMGA 4XNEA 2CJMA 4EQCA 4RWKA
chains in the Genus database with same CATH superfamily
3K54A 3QQKA 5KMKA 3CXWA 4RJ6A 4GFOA 4LFIA 4AT5A 4I4FA 2F2CB 5FG8A 5C4KA 1CSNA 5I9YA 3VQHA 1G8KA 2GDOA 3EN6A 4S30A 4DFBA 3DAKA 5IA3A 4OTRA 1LPUA 2ZVAA 2IEWA 4XG6A 4BB4A 1WFCA 4AS0A 4OTFA 4APPA 2QODA 4NM0A 3C4FA 4ZSGA 3NVMB 3HAMA 4L45A 1M7NA 3NCGA 1PMNA 3OHTA 2W06A 2Q0BA 4PRJA 3WI6A 3NUSA 2PK9A 4ALVA 2J9MA 2YFXA 5AUYA 3QQLA 1XQZA 4ARKA 3EYHA 3PRFA 4U0IA 5IQBA 5DGZA 4PMSA 4J1RA 3NR9A 1QCFA 3LFAA 4LRJA 3EQIA 3TV7A 2XF0A 4ASXA 5HNIX 4ANOA 4BY9E 4A9UA 4DEDA 4FV1A 1ZOEA 2R3NA 5D12A 5EOLA 1PMEA 2ZB1A 2QCSA 3PPJA 1VYWA 2QO9A 4ZOGA 1H26A 3VS5A 4YMJA 1VR2A 4GCJA 1W98A 2WB8A 5I9UA 2X0PA 3FMNA 2BFXA 2FSTX 4L01A 3G51A 4GK2A 4GT4A 4DH7A 5JFWA 3CCNA 3VHEA 5JFVA 2QR8A 4LDTA 4ZJIA 3KFAA 4DDGA 4GVAA 3LQ5A 4R5YA 3MTFA 2JBPA 3NYXA 2ONLC 1R39A 4D9TA 2XIYA 4GMYA 3RKBA 5AV4A 5D41A 2ETKA 3FMEA 2UW4A 5HZNA 2NRUA 5LVLA 2DS1A 3AC5A 3U9CA 1ZARA 4EOSA 2VN9A 4EHZA 3QCXA 4CV9A 3DNEA 4RVMA 4TYHA 4YC3A 5HEZA 3ZRKA 4ZAUA 3LJ0A 4QP8A 4E1ZA 2JIUA 4HPTE 3DKCA 1SMHA 4YZDA 1GOLA 3IOKA 3HNGA 4D2RA 3UZTA 2PZIA 1OL5A 1IG1A 1XR1A 3DKFA 4P2KA 4AE9A 5J9YA 4C7TA 4RJ8A 4IQ6A 2OJJA 2J50A 3Q6UA 1F3MC 2YIRA 5CY3A 2XNNA 4UMTA 4BBEA 2XK6A 3RHXA 2ETRA 5IQFA 2C0TA 3UTOA 3E64A 4CYJA 5AR3A 4R77A 4RVKA 3ETAA 3KMWA 5BMMA 4ZTQA 3BQRA 3VO3A 4K0YA 1BI8A 1T46A 3OWJA 5D7VA 3LXPA 2R3JA 3WARA 2VO3A 3U4UA 3ENHA 4DDIA 4DLIA 3NW6A 2W1DA 3KMUA 1PYEA 3UIXA 4EHEA 3CY3A 5LMKA 4EH8A 4G9CA 4Z55A 3ZOSA 2X6EA 1HCKA 3P08A 1J7IA 3Q04A 3PLAE 5GJDA 5AUVA 3FSKA 4BDCA 4U97A 3VS3A 2J51A 2OLCA 5EQEA 4BWXA 3EMGA 4FL1A 5J1WA 1TQMA 2JAMA 4ALUA 3CJFA 2OBJA 4DG0E 4F99A 4PL3A 4EUTA 1YWVA 3DQWA 5CSPA 4UXQA 4G6LA 3R9RA 3LAUA 5EYDA 3U6HA 4O0SA 4GFGA 3LKMA 4O7RA 3FAAA 3FMKA 4BYIA 4ZK5A 2XZSA 4CFNA 2O5KA 2OXXA 5HOAA 3UNZA 2VX3A 5DPVA 3EQBA 3RJCA 1PMVA 1Y6AA 3QTQA 4BCHA 2PE0A 3MY1A 3FL5A 3PWDA 4M0ZA 4X0MA 1YKRA 2ZMCA 4ASEA 5C8KA 3HRBA 4O6LA 2VO6A 4H1JA 3VBQA 4F7SA 3B2TA 5HE0A 3T9TA 2O0UA 4GYIA 4O4FA 2YHVA 2GU8A 3FPMA 2R3QA 2CLXA 2OJ9A 4FG8A 3K2LA 1YI6A 4NK9A 5EM5A 4V0GA 4DHFA 4I5HA 4DG3E 3F61A 3I5ZA 3I4BA 3QX2A 4FV9A 4IM0A 4QYFA 3RVGA 3NNUA 4UV0A 5KBQA 5KZIA 5E8TA 4U42A 4R78A 5DRBA 4ERWA 1OITA 5A3XA 2XK3A 1RDQE 4RMZA 4JMQA 4AXDA 1RE8A 3QKKA 1P14A 5AIRA 4JXFA 2AC3A 4XBUA 3HV5A 3FLWA 3FQSA 4M15A 4IB5A 4FIEA 2WQOA 4J71A 5H3QA 3A7FA 2DQ7X 4I6HA 4L44A 5HG9A 4U80A 4MF1A 3JS2A 4II5A 2EXCX 2WELA 5CASA 2PVMA 3GCQA 1H08A 1YI3A 1J1CA 3AC8A 3ZRMA 4EYMA 3RPSA 4AW1A 4C02A 5AV3A 4HGLA 3V5PA 3OBGA 4AP7A 1WCCA 5IA0A 1ST4A 1KOBA 4USFA 2HY81 5BYZA 5CAPA 3NUPA 4I6BA 2YWVA 5H8GA 3CTHA 4ZTSA 1VZOA 4QPMA 4WNKA 3TWJA 4BCNA 1PJKA 4MNEB 4DG2E 4FUYA 1JBPE 4HYIA 1ZZLA 1J1BA 1DAWA 5CEMA 2PVYA 4PF4A 3DB8A 3V5WA 3BYVA 3B8QA 3KA0A 4A4XA 5HNGA 4EZ5A 5KO1A 2XNMA 4AXFA 4M12A 4GFMA 1K3AA 3HYHA 2GPHA 4O27B 1XH9A 5HCXA 2IZUA 5FLFA 3R7VA 4NWMA 3HDNA 2XYNA 1NVRA 4G31A 4KD1A 4RA4A 3KVWA 3W2SA 3DNDA 4AFEA 3FKNA 1XH4A 4IC7A 1KE9A 3LLAA 4DHIB 4XLIA 2YZAA 1M2RA 3CC6A 2O2UA 3R7OA 4CV8A 3FI4A 3LCTA 2YERA 3CTJA 4KRDA 4O96A 1OIQA 4FKRA 4TYIA 5FBNC 3VIDA 4AN9A 4XP0A 3KN6A 3EFLA 3KVXA 2ITYA 3SAYA 4C4JA 4O38A 1W82A 2WMTA 2W5AA 1FMOE 3WF7A 2WIPA 3EKNA 2PZ5A 4WT6A 4OTWA 2B52A 3GP0A 1ZZ2A 3BLRA 3KB7A 4XCUA 3FQEA 2E9OA 3V3VA 4XG2A 4JDJA 4BDHA 3RPRA 4QTAA 4RX8A 1XBBA 3P4KA 3ZO4A 4AZTA 4MD7E 4JBVA 3KRWA 5DEWA 3MBLA 3IW7A 4YTFA 5LMBA 3FBVA 3MS9A 4NEUA 3PJ2A 4XOZA 3V5JA 4X2NA 3TYKA 4GSBA 2JDRA 4JG6A 4M69B 4XP2A 3E63A 4C38A 1WVXA 3D14A 3KU2A 5CSXA 1FPUA 3ZLWA 2QU6A 2QQ7A 2HY0A 1OMWA 4DEIA 1YOMA 4GKIA 2BRHA 3FXXA 1JAMA 4BTMA 3GU6A 5KE0A 5CF6A 3WZDA 1PXOA 2YAAA 3QQHA 5EI6A 4EOOA 5JQ8A 4QP7A 4BN1A 3DBCA 3EFKA 3PXRA 4C34A 3UPZA 5LARA 4UMRA 4C61A 1P2AA 2X8IA 3TDWA 4PL4A 4W4YA 3R7YA 4ZSAA 3ATSA 5CWZA 4JDKA 3UC3A 4FKOA 3LFSA 4D4VA 3OT8A 1ZY5A 2BMCA 3D7TB 4G16A 1BYGA 4JNWA 2VTQA 3JPVA 1WBSA 3O8TA 3V8SA 5C1QB 3UDBA 3UE4A 3F3TA 5BX0A 4FOBA 5I9VA 3O50A 4TWPA 1ZOGA 2CDZA 3P0MA 3I81A 4FTMA 5AP0A 4CFUA 4EBVA 4QRCA 4IX5A 4FZDB 4KS8A 2QOCA 2YISA 2CGWA 1R1WA 3E8CA 3MIAA 3R9OA 4A9SA 4TXCA 1H07A 4DBNA 3O7LD 4FF8A 3IW6A 2W1HA 2YLFA 5TKDA 4C58A 2X0OA 3ZO2A 4F7NA 4A9YA 3KF7A 3MYGA 3D2IA 5AUWA 4FTTA 5DRDA 5AP6A 3PUPA 4OTIA 3F3VA 4L7SA 1WBOA 4GK4A 4ZZMA 5A6NA 5IUGA 4GKHA 1YRPA 3N9XA 4JL9A 4JVGA 2I0YA 2EWAA 4V01A 1JSUA 5FRIA 3WILA 5BVDA 4AA4A 3OXZA 3TNHA 4QQJA 1R3CA 4YJSA 5CEIA 4C3FA 3WIKA 5I4NA 3NMUF 2EUFB 3PXKA 5HHWA 4ZZNA 2VTJA 3G90X 4D1SA 1O6YA 3NGAA 3I7CA 2WO6A 1H28A 2REIA 3UIUA 2XM9A 1W8CA 3D5UA 4RWLA 2G2FA 4IM2A 4MF0A 1JQHA 4RJ3A 3VS0A 2BAJA 4QO9A 3CSVA 4QMLA 4NM5A 4ZMEA 1JWHA 4ZJJA 3C9WA 2BAKA 2ZYBA 5GJFA 1U5QA 1FINA 4L46A 4W4XA 3DXNA 3SW4A 4ANQA 3BE2A 1R78A 2YCRA 3BHTA 3GGFA 4KIPA 2V0DA 2IVVA 2X1NA 3K3IA 2VNWA 2JIVA 1IEPA 2C5NA 3DS6A 2G01A 3TNPC 4FYOA 3NX8A 1E1VA 4NZWB 4BBFA 4AOJA 4U45A 4MD8E 4C3RA 3FMJA 4L43A 4LUDA 3TTJA 3TZ9A 4FTCA 4JI9A 4K33A 4E6CA 3JR1A 4CKRA 2W1ZA 1WZYA 4CMUA 4J8NA 4YU2A 3VUHA 4D5HA 3AT3A 2I6LA 2QOFA 4ITHA 3F2NA 3LCSA 2JDVA 3OY1A 2OZAB 3QTIA 5HIDA 2RFDA 3FZ1A 4CT1A 5JGBA 5LVOA 4XX9A 4LQMA 2F9GA 4FK6A 1KE5A 1WBNA 4YLKA 3FMDA 3QQUA 2QHMA 2UZOA 5M55A 1U59A 4O2PA 1M2QA 5HVYA 1JKLA 2HXLA 3A7JA 4ASZA 2WTDA 2J6MA 3DKGA 3WF8A 4CZTA 3E8DA 1JKSA 3PSDA 2C6IA 5CLPA 2ONLA 3F3ZA 3BIZA 3SDJA 4EOMA 2R3LA 1RJBA 3NCZA 2CMWA 2ZB0A 3MVHA 2B4SB 1LR4A 2X7GA 4GVJA 4IFGA 4WO5A 4C4EA 4WNMA 2YAKA 3N4UA 5ANEA 5DVRA 1TKIA 3W16A 3W0RA 3QWJA 1UVRA 3GUBA 4Q9SA 1BKXA 2XK4A 4ZLYA 1R0EA 4I41A 3GB2A 2CCIA 4N6ZA 2P2IA 2PZRA 4P90A 5DT4A 5BMSA 2P55A 4HGSA 1EH4A 4FL2A 4JT3A 2VD5A 4GG5A 3P86A 3UG2A 4PX6A 3VBXA 2P33A 2PWLA 5CAUA 4AAAA 4AGDA 3R28A 3RAIA 3Q2MA 4L6QA 1M7QA 1PXPA 4FZ6A 5FGKA 3TCPA 3KRRA 5HCZA 4AQCA 4ORKA 3AMAA 4C4HA 3KK8A 5J79A 2WOUA 1P4OA 3TZMA 1UKHA 3KXZA 4QOXA 4I5PA 4WUNA 5HU3A 2OF2A 1FBNA 5FTGA 4CNHA 3RBWA 3S2PA 5ANJA 1OBGA 3L8SA 3UZPA 2I0EA 2R0UA 3E92A 2OJIA 4N70A 5CZHA 4CFFA 2EB2A 5A4CA 3NFGB 4DT9A 5AWMA 3RP9A 3PXZA 3ACJA 4I94A 3EJ1A 3OXTA 3FZTA 3R71A 3FXZA 3W18A 4FV0A 4K1BA 2V62A 4ENYA 2F2UA 5IDPA 3SQQA 4QQCA 4BDDA 4BL1A 4AXCA 2X9EA 1W2FA 2JITA 1U4DA 4FGRA 5JKGA 2A0CX 4RIYA 3PA5A 3FPQA 3RI1A 5DYJA 3AD4A 4BDEA 3GC7A 3KQ7A 1Q8YA 3FMMA 5ANOA 4BDBA 1FGIA 2G15A 3QHRA 5E8YA 1TFFA 4B6LA 2Q83A 3VBWA 5AV2A 4FSZA 3Q9ZA 4O83A 5E7RA 3R8ZA 2V7OA 3DJ7A 3VUMA 3HX4A 4RX7A 1Y6BA 5E8UA 4N57A 1JSTA 3ZUVA 2QD9A 2HZ4A 2C5XA 4JX3A 1SVHA 3MVJA 4IEBA 4TW9A 3O7LB 4IX6A 3Q96A 5J87A 3U9NA 4FVPA 2GNLA 2YJRA 1JKKA 2IWIA 1NY3A 3UP7A 2C6DA 2VTTA 5L2TA 1BX6A 4RLLA 4QTDA 4FI1A 3VBVA 3L9MA 1VLRA 4MXYA 3QKLA 4AZFA 5EQPA 5HD4A 3D15A 3CQUA 4I6FA 3ULZA 2R3PA 5HE2A 3F7WA 1DI9A 3L1SA 3A99A 2I7QA 2W96B 2BTRA 2FA2A 2XJ2A 4H3PA 5J95A 2ZJWA 3RPOA 3FSFA 2VNYA 4CFVA 3R21A 4ZSEA 2WU7A 2J0KA 2UW0A 4FTAA 4NFNA 5HBEA 5ACKA 2UW8A 2PE1A 3VQUA 1U54A 5KCVA 3DDPA 5IA5A 3PXFA 3BEAA 3B8RA 2QVSE 2W1GA 3SG8A 4KRCA 2ZV9A 2X8EA 4RX9A 4UYNA 3L8XA 2QG7A 3A7HA 3BBTB 4UWYA 2XIKA 4DITA 5IMXA 3BYMA 2XBJA 5CEQA 1J3HA 1URWA 1OPKA 4IVAA 4O7NA 2VAGA 3LFCA 5HQ0A 4XBRA 3QXOA 4TTHB 4YSMA 4D5KA 3P7BA 1H00A 4M68A 4QYGA 4DTBA 1YI4A 1OGYA 2F7ZE 1M2PA 4B8LA 5M53A 3CR0A 1H4LA 5BVFA 4O0VA 5HG8A 4AN2A 3CP9A 4FVQA 3VRYA 3PTGA 4M0YA 5TO8A 2GTNA 2PTKA 2X81A 3ORMA 4FKSA 4FKJA 1RQQA 4M13A 4F9AA 4CRLA 2BZKB 1OL6A 1ZYCA 2GS6A 5CANA 2C6OA 4I93A 3S95A 4E3CA 2VO0A 3D5XA 3FZRA 1Y8GA 3TJCA 3U55A 5B7VA 2DYLA 3F3UA 3RWQA 4EH4A 2LGCA 2UVYA 2YM8A 4LUEA 4G17A 3SW7A 2J5FA 5HO6A 2WMSA 3RPVA 3PXYA 4FV4A 5HO8A 4KIQA 1JLUE 4EWQA 4C62A 1TQPA 4E93A 3WZKA 4FZFB 4WBBB 2EU9A 2I1MA 1WVWA 2JFMA 3A2CA 3JVRA 3LZBA 2G2IA 4ID7A 4MNEA 4AT4A 4TT7A 4XMOA 2HOGA 1DI8A 4RWJA 4PV0A 5IH4A 4QYHA 3OP5A 3F2RA 2Y4IC 3VW6A 2PYWA 2J0JA 3F6XA 4X3JA 4DH1A 4JAIA 3MVLA 3SVVA 3MESA 4HW7A 3G6GA 2GCDA 2W0JA 3I6UA 3DJ5A 3LM0A 3BEGA 2Z7QA 4QP2A 4IW0A 3W2OA 2YM7A 4S34A 4YJTA 2C69A 5JMSA 1JVPP 5LQFA 2PVKA 4LMUA 4CG8A 4BCMA 2UVXA 3L8VA 5CXHA 4D2SA 2YITA 1NA7A 5JN2A 4FGBA 5DA3A 5AMNA 4NH1A 4HVSA 1Q3DA 3GU4A 2UZUE 4U7ZA 4C33A 3OROA 3FMLA 1IAJA 4BDFA 3ZBXA 5GZ8A 4DFUA 3O17A 4M14A 4UZDA 2OWBA 5KHWA 4JOAA 4CEGA 4QT1A 3MJ2A 4YPDA 2BAQA 4BTFA 2UW6A 2GNJA 2QR7A 4R7IA 4W8EA 4BFMA 4IZ5A 4X2KA 4K9YA 3E62A 4EK6A 4L9IA 3G9NA 2HK5A 1QPCA 3VUIA 1AD5A 3A61A 3DU8A 4RQKA 1Q8WA 4LMNA 5K5XA 1URCA 3PZEA 2BIKB 4QMYA 2A4LA 3IW8A 4FKQA 4PMTA 5K0XA 4Q2AA 4BJJB 3VS4A 4RVLA 3R8LA 5HU9A 4E7WA 5M4UA 3Q9WA 1GAGA 3L9PA 3LIJA 1ZMVA 5CF4A 4MXAA 4BVUA 4NL0A 5AFVA 4WUAA 5T3QA 3BPRA 3EYGA 3QRIA 4FKIA 5DBXA 2HCKA 4JIKA 1FQ1B 5D10A 3RMFA 3ZYAA 4BICA 3QCYA 4V05A 3SLSA 3R22A 3CQWA 4BZOA 4OTHA 4GL9A 4MXCA 3HVCA 2NPQA 3LMIA 4HNIA 3NUUA 3TIYA 1YXUA 2B9HA 5M51A 5L2SA 2F7EE 2JDTA 3R02A 3NZ0A 2PHKA 4H36A 2HYYA 4YJQA 3OWKA 2IG7A 4OAUC 2Y0AA 4YHFA 1Y57A 2IW6A 2ZMDA 3SXRA 4R3PA 4O22A 1OBDA 2BRGA 4FKLA 4L3LA 4EI4A 3SGCA 4B8MA 4IHPA 3V5TA 1SYKA 2FUMA 2IPXA 4YTIA 3AGMA 4EHVA 4FV7A 4BI0A 4IX4A 3EQGA 3HL7A 4L3JA 4L53A 4QMMA 3C1XA 5ICPA 5IEVA 4BCPA 1G8SA 4ITJA 4FC0A 4GYGA 2X9FA 4AW0A 4OW8A 3E3PA 1OIUA 2WMAA 4DTAA 2Z02A 4DINA 1BLXA 2GTMA 3V51A 4F6UA 2Z7LA 3MFSA 4KSPA 5JFXA 4IZ7A 3DA6A 3PJ1A 4O0YA 4TZRA 1ZAOA 4O0TA 5FEDA 5CYIA 1GIJA 4ZSJA 2V22A 2UZBA 4YLLA 5AR4A 4O7YA 2E9VA 1IASA 3LJ1A 2GNGA 4IAFA 4NKSA 2OKRA 3PE2A 4DFLA 3E88A 5FTQA 1DM2A 1QPEA 3A7GA 2BPMA 5BYYA 1XO2B 2WMXA 3RHKA 4DBXA 3BYOA 1O9UA 1Q61A 2OI4X 2OJGA 3C4EA 1QPJA 3FLQA 3H4JA 3PPZA 5CU0A 1FMKA 1B6CB 1ZRZA 3W0SA 1BMKA 3QUPA 5HIEA 4BWKA 2PU8A 2NYAA 3DAEA 4IJPA 2HAKA 4Y8DA 3ZS5A 4PP9A 1GNGA 4IWPA 3DY7A 2BFYA 3QUDA 4EH2A 2IN6A 4TYHB 4ANLA 5GZAA 2XCHA 5M4CA 3UOHA 3ZSHA 5IF1A 4RPVA 4YZBA 2PZPA 2XKDA 3RK5A 5LVPA 5C8NA 2YJSA 3ELJA 3RTPA 5CNNA 1TQIA 2RG5A 5D9HA 3QTXA 1ZYDA 5EKNA 4E26A 4OTDA 5AP2A 5ETCA 3V5QA 2CNQA 4FNYA 3QD4A 5IZFA 1YDSE 4O1OA 1F5QA 1OECA 2VWBA 3EL8A 4I5MA 4DCEA 4FT9A 3H0ZA 2FVDA 5F1ZA 3FQHA 3MVMA 1OM1A 4UB7A 4QQ5A 3VVHA 5HICA 3WBLA 4E5BA 2W4OA 2ITZA 4PNKA 2GHMA 1Y91A 4X6RA 2WTJA 2W1FA 2OICA 2W05A 4QMTA 3U8WA 3DBEA 4YHTA 5L6PA 5CAVA 4I23A 3NFFB 2QLUA 2XIXA 3WF6A 4EH5A 4JDIA 3W2PA 3OT3A 2OSCA 2P0CA 4KBKA 3D5VA 3V6SA 3QXPA 3CJGA 2VTIA 5HCYA 5BVEA 3E8EA 3IW4A 5AM6A 4D55A 1Q97A 4KIOA 4GT5A 5DE2A 4L8MA 3QZHA 3GU5A 2IJMA 3FI8A 2WQBA 4HVHA 3QRKA 4WSQA 3RGFA 5KMNA 5FD2A 3ZZEA 1Y8YA 1UA2A 5BUIA 3BU6A 2HELA 3LVPA 4FVRA 5EK7A 3S3IA 1JKTA 2WTVA 3KIOC 1PXKA 4EJNA 2WFYA 3SHEA 4YPSA 3RAWA 3UDTA 4XHKB 4F1TA 5GIPE 4RFZA 5DWRA 5HG5A 4FTLA 1H1SA 3ZONA 3FC1X 3VJOA 5AAEA 4CMTA 4U3ZA 4Y5HA 5AR8A 4UX9A 5HGIA 4O7VA 5EM6A 1G8JA 4IBMA 1LEZA 1A9UA 4F64A 2FO0A 3BCEA 4EOLA 2Z60A 1G3NA 4AG8A 5EQYA 4IXPA 2X6DA 1WAKA 2J5EA 4BGQA 3MB7A 4UYAA 3BHUA 4K77A 1XH8A 3PP0A 5ETAA 5ETFA 4KBCA 5K3YA 5KMLA 1V0PA 1DS5A 2PVFA 2V7AA 4CRSA 4F7LA 1H1RA 4A06A 1QMZA 3BELA 2WKMA 3CPCA 3HMMA 3LM5A 4MNFA 2G2HA 5AR7A 5IEXA 5A54A 2FSOX 1KE7A 5JRSA 3NRMA 4BTKA 3R1SA 3DTWA 5JH6A 4O4DA 4PTCA 3DXQA 2B53A 5GJGA 4CQGA 3ZFMA 3EWHA 1IR3A 4NCTC 5AX9A 3PJCA 2O3PA 3PP1A 4DGOA 3ANRA 5M07A 4HYSA 3MH2A 4KA3A 4XV2A 2ERKA 4QMXA 3TACA 4USEA 4X21A 3BU5A 4Y5QA 5HTBA 4ZY4A 1VEBA 2GHLA 2P2HA 4FIJA 3DTCA 4CVAA 5M4IA 4FKVA 1STCE 4FEWA 1YVJA 2WTIA 1IRKA 3Q4UA 4H58A 4ITIA 3KXNA 3KF4A 4W9XA 4YZNA 4XG8A 4AA5A 4AU8A 2J0IA 2RFEA 4HCUA 4QP1A 3UJGA 3O96A 4FT5A 3OTVA 3VUDA 4G3CA 4IAYA 3W8LA 2OO8X 3M1SA 4FTQA 3CY2A 3DQXA 4MAOA 1PXJA 2BIYA 4JQEA 3MY0A 3P9JA 3U6IA 3FY0A 2EXEA 2GS2A 3Q9YA 4RFYA 2PY3A 3AXWA 5E9EA 5DR6A 3ZUTA 3QF9A 4ACMA 4NYEA 4GIIA 5LCJA 1IAHA 2BROA 2KTYA 3CD3A 3R04A 5L6WL 4DHZA 4CG9A 5EG3A 4ZJVA 2B9FA 5AA8A 4CYIA 3EQRA 3BL9A 3OD6X 3R2BA 3UODA 1GIHA 4X2GA 3UDZA 4NKAA 3GT8A 3Q60A 2O65A 2WOTA 4D2VA 2GS7A 4QPSA 4DH5A 1CTPE 2E2BA 4OAVB 4FSRA 4RA5A 2BDJA 1XWSA 4LYNA 3VBTA 3MPTA 4ASDA 3AGLA 3OW4A 4EK8A 4M67A 5L2QA 3IDCA 1E9HA 3OCTA 4E6AA 2CSNA 3GOPA 3LLTA 3PIXA 5FP6A 5KMJA 4CZUA 3ORKA 3UYSA 4H1MA 3D7TA 5AEPA 2YCFA 1FVVA 4PTGA 3AKKA 2X0GA 2R3GA 3TI1A 4F9BA 1YXXA 4XEYA 3BKBA 3HDMA 3OCSA 4NUSA 3AKJA 2W9FB 3C13A 5CVHA 1XBAA 2YIXA 2ZV2A 3FYKX 4TNDA 3MJ1A 3RPYA 4NIFA 2QG5A 2UW7A 1YXTA 3D9VA 4QMVA 4X6QC 4ZS0A 3RK9A 3RZBA 3VN9A 4U3YA 4WOVA 4AW5A 2PVLA 4EC9A 1V0OA 2VV9A 1OKWA 3KN5A 4EJ7A 4QMSA 5AADA 2C1AA 5CEPA 3G0EA 4WKQA 2P4IA 4B7TA 5I9XA 4CLIA 2R3MA 4LG4A 3RM6A 4CFMA 4O7TA 2NO3A 2XEZA 4NM7A 3NUYA 3HA8A 4WSYA 2GHGA 1H1QA 4FV3A 5BQ0A 2PULA 1XMLA 4MQ2A 4BKZA 2JDOA 4Z9LA 3TKUA 4EHGA 3DCVA 3RNYA 3FZOA 2VTNA 3UVPA 3PFYA 2VTLA 4ZY5A 2PL0A 3NIZA 5ANKA 4PMPA 2WEVA 3ORZA 4EOIA 2RFSA 4IACA 3ULIA 3U51A 4FIGA 2O64A 4LV7A 4EOKA 5HESA 3P7CA 4XS2A 3E5AA 4RJ4A 3E87A 4APCA 3TNWA 4BDIA 1F0QA 5EKOA 4JR3A 4UY9A 4Z7HA 4ANMA 2ZM4A 3COIA 5F9EA 3P1AA 3U6JA 4C0TA 3BLQA 5HBHA 1MRUA 3EN4A 4KIKB 3D5WA 4BHZA 5D1JA 4S2ZA 5F20A 3PVUA 2YACA 4EOPA 1PXMA 2X2LA 4O4CA 3PDTA 2JC6A 4E4LA 3FYJX 4HZSA 4YTCA 1W2DA 3TKHA 4FT0A 2H34A 4PUZA 2XP2A 2HW6A 4P4CA 4EQUA 2ZDTA 4AAYA 5KMMA 3EH9A 4D0XA 3FL4A 3GENA 3VC4A 4QYYA 3NEWA 5LJJA 4NTTA 4S33A 4LRKA 3IDPA 5FUTA 4Y72A 2VRXA 2IW8A 1QPDA 2IW9A 3NYOA 5TF9A 4DFXE 3W0QA 2R7IA 5A4QA 2PMNX 3N51A 5K4IA 4A7CA 3VONA 5DT0A 4TPTA 5CAQA 2HW7A 3R9DA 2ERZE 3ZLYA 4AA0A 3UO5A 1OUYA 3DGKA 2J7TA 3IQ7A 3MDYA 3S0OA 3R0TA 3NW5A 5GZ9A 2UZLA 3RALA 2VTSA 4E4MA 2QKWB 2ITPA 3QYZA 2W9ZB 4MH7A 2ITQA 4D4SA 3LFNA 3OXIA 4XG9A 3DJ6A 4IB1A 4DGNA 4I21A 4RRVA 4OR5A 2XMYA 3QL8A 4FNXA 5AP5A 2Y6MA 4AXEA 4FSQA 4QTEA 2PUPA 3CE3A 3QBNA 4LV8A 1Q24A 4RT7A 4JBPA 2RFNA 2XK7A 2CCHA 2ITXA 3OF0A 3VS2A 2JKOA 3SD0A 2VX0A 3OOGA 4K11A 2XJ0A 3IECA 3FV8A 3R1NA 1BL7A 1Q5KA 3JY0A 5DEYA 5CTPA 4HVDA 3TUDA 4BDKA 2R64A 4FTUA 5HX6A 3DXPA 2GFSA 4MBIA 2C0OA 3QGWA 4JG7A 4D4RA 4ZLOA 1S9JA 1FGKA 1WBVA 2GNFA 1KV2A 3OY3A 3FLNC 2W7XA 3BRBA 4EZ3A 4BC6A 3LXNA 2VTAA 3E7OA 4PL5A 3H9FA 3AC3A 4QMQA 3D7ZA 4GG7A 4BWPA 3QZIA 3KRLA 4JBQA 4U9AA 1NVSA 2NP8A 4F1OA 3HUCA 3ZCLA 2IVUA 4MXOA 2BDFA 2JIIA 4J53A 1ZOHA 3MIYA 3ZH8A 3QAME 1Q8ZA 4ZEGA 3P23A 4ONAA 1U5RA 4RFMA 4G5PA 4MXXA 4PQNA