3FMLA

P38 kinase crystal structure in complex with ro6224
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
342
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title P38 kinase crystal structure in complex with RO6224
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 108
structure length 342
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmlA01
3R9HA 3F6XA 4MHAA 4RJ4A 4G16A 4JG6A 3VN9A 4DH3A 3OCGA 5HO7A 3K3IA 2YZAA 1V0PA 4XX9A 4A07A 3F7ZA 2J0LA 3TI1A 4AW0A 4FTIA 1YXVA 2RFSA 3EN4A 5L6WL 4EBWA 3LMHA 4H3QA 4TYEA 3U4UA 1KOAA 4G9CA 1BLXA 2O5KA 2XYNA 3M2WA 5J7BA 3HRCA 1O6YA 4ANNA 3RCJA 3PSCA 3FDNA 4IM0A 4IAYA 4AXAA 3DDPA 1U5RA 3NNWA 1SM2A 3QWKA 1MQBA 4GKIA 3DNDA 3RHXA 4FTRA 1XH8A 3PVWA 4I4EA 4PWNA 4EK8A 4UX9A 2AUHA 4D1XA 2BRMA 3BU3A 2PU8A 3ZO4A 3KK8A 4GYIA 4O1OA 3ZBXA 3WF7A 1Y6AA 4FSNA 4CD0A 1DAWA 5A4EA 3ACKA 3Q4CA 4DCEA 1WVYA 2R3HA 2XUUA 5HGIA 3W32A 3P7BA 2WQOA 3R1YA 3TTIA 5GIPE 4UWYA 4GFOA 4NJ3A 1S9IA 5BVEA 4XEYA 4QP2A 4UWCA 4C3FA 4DG0E 4IX5A 3NRMA 4U43A 3W16A 2RKUA 3I7BA 3FXZA 5AA9A 3QFVA 1YKRA 1ZYCA 4FG8A 4MBLA 5E8UA 2R3NA 2Y9QA 2EUFB 3NDMA 3FMDA 4G31A 3NGAA 2IZUA 2VAGA 3F2RA 2GFSA 3FMEA 4R5YA 4PDSA 4BVUA 5FP6A 3BE9A 3IK3A 4AS0A 5HBEA 2OJFE 5LCKA 1YWVA 4IWQA 4IX4A 2W7XA 4LL0A 1KE8A 2QCSA 3A8WA 4JOAA 2VTPA 4FODA 5F9EA 4BCPA 2H8HA 5AV0A 4BDFA 3A7IA 2V22A 3T9IA 3CTQA 4FSYA 2LAVA 3RVGA 4EBVA 3R30A 4IFGA 5DRDA 3EQBA 2ITTA 4FKPA 4R7IA 3TNWA 5LVLA 3JUHA 3GFEA 2XK7A 4L52A 5HOAA 3SW4A 4XHKB 4KSPA 4AW5A 4WBBB 4F08A 3R7VA 3CP9A 2RSVA 3DNEA 4U9AA 1XH6A 5I9ZA 3R8PA 4BI1A 5A4LA 4C62A 5J9LA 4RQVA 3RPRA 3PIXA 1PRYA 4RIXA 4C4GA 1QPJA 3RAKA 1OUYA 3OP5A 2QOQA 4M69B 3R02A 4D4RA 4X3FB 2DYLA 5IU2A 3HAMA 4E93A 3UIBA 4J8NA 4YO6A 1JBPE 1PY5A 3R28A 4QMNA 3QX4A 2RGPA 3FSKA 2Z7QA 4OTWA 4X2KA 4USDA 3ROYA 4I20A 2JDSA 4BTFA 4DEGA 5M44A 1ZY5A 2A0CX 3E8EA 3W33A 2VTQA 2ITQA 5HHWA 5IA1A 3UTOA 4DEEA 3SOAA 1UU7A 2JBPA 1PYEA 4CMTA 4O27B 3ZLSA 4IB0A 5EG3A 5DIAA 1J1BA 4AP7A 4PF4A 1BI8A 3UDBA 3E8NA 2WO6A 2IJMA 4RWJA 4TN6A 2PUPA 3GC0A 5IH5A 4IAAA 3W2SA 4D2WA 3OFMA 4EOKA 4O91A 4LI5A 2I0EA 2PZIA 3E92A 3BKBA 3U4WA 2XH5A 4JS8A 5LWNA 5IPJA 4FEXA 3GCUA 2R64A 4HCVA 3GFWA 3PRFA 4E6DA 2HAKA 4ORKA 4MNEB 2OJ9A 1OL7A 3DKCA 4E6CA 4FOCA 5EDPA 1BKXA 3F69A 4CZYB 3FQSA 3OOGA 3QAME 3QTIA 3KXZA 3Q4TA 5F20A 2BVAA 2ZV2A 1J7IA 3PJ3A 4KS7A 4RQKA 2WOTA 4RA5A 2J5FA 5B2LA 3ANRA 2GSFA 5AP2A 2I0HA 4CFXA 2C4GA 2YITA 4PMSA 4YJTA 4R7HA 4ZY4A 3ODYX 3V04A 3ALNA 1URWA 3I0QA 4EOLA 1BUHA 4ZXTA 2JLDA 2R0IA 2ZM1A 4FIHA 4QTEA 3NYNA 5CNOA 5IUIA 3NVMB 4LUDA 5CEIA 4ANQA 1F3MC 5M4IA 4BGGA 4JJRA 5I4NA 2AC3A 3UZPA 1PYXA 4C2WA 5L8LA 2UW8A 3GCPA 4KB8A 2VRXA 3TZ9A 5CANA 3N51A 3BU5A 1QPDA 3NNVA 5CXZA 5HX6A 4HVGA 4LV8A 5BUJA 3HEGA 3WOWA 2QKRA 4O0WA 4CV8A 4FT7A 2R7IA 4WNKA 5IQEA 3GXLA 3FLQA 4O6LA 4XCUA 2PUNA 2X6DA 4PDOA 4GK3A 1GZKA 3FZ1A 4B4LA 2R2PA 3D5UA 2P2HA 4RT7A 4XMOA 1J3HA 3EOCA 4FUXA 4E5AX 3CJGA 1IG1A 1OM1A 2QOLA 3LOKA 4CFFA 4RJ8A 3FI4A 5KMMA 3V8TA 2E9VA 1OBDA 3KXXA 5GINE 2UVYA 3P0MA 2CGVA 3GCQA 4BBMA 4L68A 3QLGA 4G3GA 4IAKA 2GS7A 4NEUA 2C5VA 3D15A 4RWLA 2B53A 5DEYA 2C6LA 3PUPA 3R0TA 2CGUA 4W4XA 2OJIA 3EQDA 3I60A 4XV3A 5IISA 5I9YA 3QRIA 3SDJA 4FL1A 4JBOA 4Y85A 3WZUA 3TUBA 4NM0A 4TWOA 5EYDA 2B0QA 4EWHA 2UZUE 3BE2A 4Q2AA 4DLIA 3TNIA 2XCHA 3ATSA 3MIYA 5LWMA 1UA2A 2XJ2A 2JFLA 3FQEA 2UZLA 4FKQA 5CASA 4O96A 4OTHA 3R83A 2JKQA 5EW8A 4BR3A 1PHKA 2Z7RA 2ETRA 3CKWA 3DK7A 3U9CA 2BIYA 3WF5A 4EOIA 1OIYA 2GNGA 2GS2A 3MGYA 2BDWA 3OWKA 5E90A 3V5WA 4R6VA 4DFXE 2G1TA 4KAOA 2H34A 4Y5HA 1H28A 4KBKA 3P1AA 3QD4A 4JBPA 3KB7A 2YM8A 5F95A 3NNXA 3E62A 3VNTA 3FLNC 2ITUA 3BEAA 2UZVA 1H0WA 2RG5A 4YUQA 4I24A 4A06A 3IDCA 4FTKA 2XKDA 4OBQA 3W1FA 2PL0A 4ZAUA 3I0OA 1GNGA 5AR4A 5BVWA 5IQGA 5L8KA 3AMYA 2R3PA 3MTLA 3QQKA 2OWBA 3FMHA 2W4KA 3LQ5A 4YZBA 4B7TA 5E4HA 1VYWA 5D12A 3C4EA 4AQCA 4C7TA 3R9RA 3NCZA 4TWPA 2R3RA 4BWXA 1GZNA 2Y4PA 2REIA 4MQ2A 3ZZEA 3UGCA 3LFEA 4LMUA 5D10A 5E8WA 1H1RA 4FEQA 1WBSA 4NUSA 4O22A 3OHTA 4HZSA 4JIKA 5B2KA 4A4LA 3COHA 1NA7A 3CLYA 5CEKA 4P7EA 1ZY4A 2NNWB 3PY3A 5AP7A 2Y8OA 4ENXA 4QMTA 5BPYA 2ITZA 3HMNA 2WTKC 3GEQA 4C35A 4EOSA 2OZAA 4BIEA 2ZB1A 2IW6A 4OLIA 4XH6A 4EH9A 5JK3A 2P3GX 4QO9A 3UJGA 3A4PA 3C5IA 5AIRA 3R21A 3UP2A 4DGOA 4ENYA 1H08A 3R71A 2YCRA 1XR1A 1WFCA 2BILB 3CR0A 4WBOA 5JGAA 2Y0AA 3GQIA 3ORTA 2C5OA 2VTOA 3R7GA 4JLCA 3FAAA 3TZMA 4B8MA 5AEPA 2BPMA 5TOZA 2EVAA 4ERKA 2FYSA 4CKIA 5CF5A 4DTBA 1KSWA 4P4CA 1G3NA 4YBKA 4UBAA 3VBQA 5KZ0A 3QQLA 3SAYA 4E5BA 4FIEA 4CT2A 4TY1A 5CAQA 3HGKA 2VTTA 4AUAA 4JT3A 4IADA 1LR4A 2WTVA 3DAKA 1FOTA 4O83A 2BZHB 1A48A 3U87A 4KNBA 3GCVA 2PVLA 1IAJA 3QYZA 3DBFA 3QGYA 4QTDA 3E88A 3QRUA 3SOCA 2QU5A 3IDPA 4DT8A 1YI3A 4ZJIA 3EFKA 3ORPA 3D0EA 4WUAA 3RGFA 5AV4A 2WZJA 2JITA 4EEVA 3EKNA 5CF8A 2UW4A 3DAJA 3D7TA 5D41A 2C5NA 4M14A 3V5PA 2VZ6A 5AV3A 1O9UA 3V5JA 4DE4A 3KKVA 5BX0A 5FDPA 1P4FA 3FZOA 4PRJA 2J4ZA 4P2KA 5HG8A 5A6OA 2ZDUA 3R7YA 3KCKA 4C4EA 2W9ZB 5E8ZA 4Y83A 5FBOA 2XKCA 3VBTA 5AR8A 1PJKA 2O64A 5M57A 2W1IA 2YIWA 4OTQA 4ZTHA 4DG3E 4EHGA 2HZNA 3F61A 4EKKA 4XBRA 5C4LA 4YLLA 2WTWA 3EZRA 4QYGA 3GU7A 4TWCA 3JY0A 3SHEA 3MH0A 3VUKA 5K4JA 1XJDA 1M2QA 4I6BA 1FVVA 3R1SA 2C3IB 4PPCA 3GC9A 3EN7A 3N4VA 4YTCA 2B55A 3O0GA 3R73A 4Z9LA 5KMOA 3FZSA 3KEXA 2I0VA 2W1CA 4Y5QA 5HTCA 3TDVA 3QC9A 4PTCA 4NL0A 3Q2JA 4D2PA 4ZSAA 4ZY5A 3NUAA 4O7YA 3A7HA 4TYHB 2CSNA 2WTIA 4RBLA 4W4VA 2B9HA 1JSUA 2FGIA 4JDJA 3FJQE 4C34A 5LXMA 3FMLA 2ZMDA 5EI6A 1BL6A 4Y95A 3GU4A 5E7RA 3MB6A 3TDWA 2QLUA 4M7IA 4CQGA 3RPVA 4BCQA 3EQHA 2YERA 4G6NA 3VS5A 3TNPC 2XEZA 3E7OA 4LYNA 4BDBA 4ZTQA 3FL5A 2UZWE 4FV1A 2B54A 2E9PA 3Q52A 2VUWA 4G9RA 3BWFA 2WMQA 1H4LA 1QPEA 3Q9XA 5BQ0A 1AD5A 3MI9A 3MVLA 4KUJA 3NS9A 3FLSA 4DT9A 3RK7A 1QPCA 5JH6A 5KBRA 4O82A 4X0MA 4XNEA 4QP1A 4UN0C 1Q24A 3OWPA 1U4DA 3KRRA 3PYYA 2XP2A 3QL8A 4I21A 5FUTA 2JKKA 5AX9A 1KE7A 2H9VA 3QQJA 4BBFA 1WBVA 4BCOA 2RF9A 4F0FA 4AT3A 2FH9A 3PIYA 4WSYA 1FPUA 2OG8A 4F9CA 1GOLA 3KXHA 3N4UA 5FRIA 4RC2A 2XIYA 3BHVA 3P7AA 5DWRA 3RCDA 5D11A 4CXAA 4RWIA 2X2LA 4BKZA 3P86A 4BIDA 3VBXA 2W96B 3JS2A 3MVJA 1QCFA 3KMUA 5BVFA 3HZTA 2VTAA 2OIBA 2C6OA 4LOPA 4AN9A 1JAMA 4I6HA 3IGGA 4G6LA 2V62A 4V0GB 5DOSA 3BHTA 1A06A 1VJYA 3P78A 4GT4A 5HBHA 3PPJA 5HO8A 1PXKA 4AZTA 4CCUA 5AV2A 4D5HA 5H8EA 4BDEA 5M06A 3HV5A 3ORKA 4WD5A 1ZMUA 5CAUA 3RAWA 4D9TA 2C6IA 3ZU7A 4BY9E 2QOBA 3ZCLA 4AA5A 2BAQA 3ZO3A 3QD2B 3RINA 3RI1A 4DGLC 4IX3A 1OBGA 4Q5EA 1H25A 3TM0A 3GGFA 3UG2A 3FMJA 4RA4A 2Z7LA 1PMVA 4K9YA 4JBQA 1XWSA 3LQ8A 3F66A 2IZSA 3UIUA 3PPKA 3C4XA 3D4QA 3KK9A 3RALA 4FZDB 5JKGA 3GI3A 3CS9A 4QTCA 4IBMA 2Y4IB 5EM8A 5HTBA 4JG7A 4DF3A 2OZOA 3QTQA 2YAKA 3DU8A 3ZYAA 3O96A 5I3RA 2WMBA 3NR9A 4X2JA 2XBJA 2CKQA 4R1VA 2WNTA 5TT7A 1U54A 3PA4A 5FXRA 4CFVA 4TT7A 3F2AA 4BDKA 5A46A 5J5TA 4NWMA 4EORA 2WU7A 2C6KA 2VGOA 3RMFA 3HECA 3DKOA 3NYXA 5M4FA 4FIGA 3G9NA 4GEOA 4I93A 2OICA 4S31A 3V5QA 2YDKA 4A4XA 1TKIA 3QQUA 3MPAA 4FV9A 3U55A 2YACA 4F6WA 4FOBA 4J96A 4XLVA 4KWPA 1ZXEA 1GIIA 3KMWA 3PSDA 3M1SA 1M7NA 1NXKA 1YOMA 3BBWA 3QQHA 4GVJA 4IM2A 4HNFA 4KS8A 4NIFA 1CTPE 2RIOA 5I9XA 2XM9A 5L2QA 4L53A 3C50A 3EFWA 3W2CA 5HCXA 3O8UA 3RP9A 5JFXA 3UO4A 1Q3WA 5ANIA 4XG3A 4U40A 3NAXA 3TCPA 3UQGA 3FZPA 2HXQA 1ZLTA 5E92A 3UODA 4QD6A 3AG9A 4ZZMA 2QNJA 2WMXA 3QTRA 4HVHA 4G3DA 5FBNC 5JGDA 2B9FA 3F3TA 4AZFA 3OXTA 2VN9A 5EM5A 3MW1A 5KBQA 3UO6A 3MSSA 4XBUA 4E4XA 4LL5A 4M12A 3NX8A 3QTUA 3POZA 4F1TA 1UU8A 5I0BA 4S30A 2JIIA 4YJUA 2WQBA 3UMWA 5IQFA 4IFCA 1Q61A 3F3VA 4FEUA 2BHEA 5JFVA 2CKEA 1PKDA 5FXQA 3RZBA 3S00A 2CN8A 4K6ZA 2NPQA 4RFMA 3FHIA 4XV2A 3O2MA 5KZIA 3PA3A 4QYFA 1DAYA 4GH2A 4RIOA 4RJ7A 2JGZA 2OLCA 2CLQA 4ID7A 4DC2A 5FEEA 4KD1A 3BGPA 3H4JA 2C3KA 3O7LD 4U6RA 5DA3A 1R3CA 4PPBA 4Y46A 3CC6A 2X0GA 4G3EA 4QP8A 3GVUA 3JY9A 2X6EA 2Z7SA 4IWOA 5IG1A 2O0UA 2HK5A 4UWBA 2PMNX 3ULIA 4YMJA 4LV5A 1I44A 3HVCA 5HU9A 3EN6A 5J79A 2C5XA 2VO6A 4S34A 2XYUA 4YZCA 3ULZA 4F1OA 1LP4A 2PVJA 3CD3A 3ELJA 3AC5A 4D0WA 3PLSA 3POOA 2BAJA 4JR7A 4OW8A 5AAEA 4QMUA 3UIMA 5K4IA 3HRBA 4FNZA 2R3KA 3CPBA 5CEPA 5C8MA 2XK4A 3OY3A 4QMOA 3EH9A 2PMLX 4O2ZA 4BN1A 3KA0A 4TZRA 3BGQA 5AP1A 5HD4A 4DHFA 4PP9A 2DWBA 3KRXA 4NCTA 3VRYA 4MF0A 4FVPA 4XLIA 3WF9A 3ALOA 3PJ1A 4EOJA 4W8EA 3ZBFA 1DI9A 3WF6A 3BYUA 4AACA 1CKJA 3PJ2A 1OPKA 3DBEA 2X1NA 1OIUA 1RE8A 3RPSA 1WVWA 1M2RA 1OKWA 2CNUA 4I0TA 4MXXA 3ZSHA 2HZ0A 3ZUVA 3LM0A 3BHUA 4C61A 4LOOA 3IOKA 3OOMA 3QKLA 4F7NA 2ZM4A 4C3RA 2CCIA 1NY3A 2J51A 2ZJWA 1SNXA 3FLWA 3KN6A 3PP0A 2UUEA 3RNIA 3TKHA 5I5ZA 4K77A 4HYUA 4FV3A 5LCJA 2JKOA 3Q5ZA 4EYMA 5EH0A 3OMVA 3GBZA 1R1WA 2WB8A 3A4OX 4BIBA 4CFNA 3FUPA 3NW6A 1LEWA 5HEZA 4GU6A 4NSTA 4R3RA 4ANMA 3DPKA 4GFGA 3GCSA 5CSPA 3HUCA 4R8QA 2XNBA 3W2RA 1JVPP 5TR6A 4YNEA 3NVKI 3MA6A 4D58A 3MBLA 3RK5A 3ZXZA 1UU3A 4H58A 3L9LA 5EYMA 3L9PA 3LCDA 3PIZA 2YM5A 4TYGA 5CU6A 5JMSA 5CVHA 1CMKE 3ENMA 4IVAA 4LGGA 4N6ZA 2QC6A 1QL6A 4KSQA 2WHBA 1FGKA 4NFNA 4UMTA 4UY9A 4YTHA 4E5WA 4EC8A 5CALA 5IQIA 3AGLA 2XNOA 4FTAA 5L8JA 2HZ4A 4MBIA 1JOWB 4EC9A 5ICPA 4OGRA 3CBLA 5K5XA 3RPOA 4WNPA 4L01A 2YEXA 3W2QA 4O7WA 3A8XA 3V6SA 5M55A 5LJJA 5DNRA 4AGUA 4AWIA 2ONLA 3VQUA 4BFMA 4QMQA 1IAHA 3AT3A 1P4OA 3IW8A 3DJ7A 3TJDA 4XG4A 3Q4UA 2O3PA 2X2MA 2IW9A 4F9YA 3HV7A 1CKIA 3KRLA 1JKLA 3QKMA 2JDRA 2PHKA 3OEZA 1XH5A 3DZOA 4I0SA 2JD5A 4WUNA 5FEDA 3RK9A 4EHZA 3LXPA 3TXOA 4F63A 4Y73A 4E6AA 2X7GA 4O38A 2P2IA 2ZV7A 1VYZA 5K0KA 3UBDA 3ORNA 1JNKA 5ACKA 2IW8A 3MB7A 3R8ZA 5C26A 3QX2A 3B8RA 3QZGA 3EYHA 4FF8A 3EN9A 1G5SA 4L9IA 3QUEA 2XZSA 1W0XC 3EFLA 4FC0A 3U54A 4KBAA 5FTQA 2CHLA 2JIUA 4CFWA 5E8YA 2BFYA 4ZTSA 1Q99A 4V05A 3FL4A 4M15A 2XNGA 3MPMA 3AD5A 3JVRA 4IWPA 3CKXA 5EFQA 3W2PA 3SXSA 4OTDA 4L3JA 3LHJA 3O7LB 4WNMA 2JAMA 5CSHA 4AW1A 1Q41A 3FI3A 3LXLA 4U44A 3UO5A 2X81A 3TJCA 4WG3A 2WQEA 1KV1A 1GIJA 4ONAA 5T3QA 4GMYA 3JVSA 3VUTA 4GIHA 4GYGA 5CU4A 4F7LA 4M69A 2XNNA 4IX6A 4AG8A 4X3FA 5B2MA 4ZZOA 3I79A 3NCGA 3AMBA 3VS2A 2W1GA 3P7CA 1W83A 3ZM9A 2BZKB 2VTLA 3ZSIA 3CXWA 4FKIA 3SD0A 3D83A 4FG9A 3AMAA 4N6YA 4DH5A 2PTKA 4JX3A 2X4ZA 4IACA 4FE2A 4FV0A 4DH1A 3R1NA 4O7SA 1OPJA 3AD6A 3Q5IA 4O0VA 1PXOA 5G1XA 3FKNA 3T3UA 2WEVA 2BMCA 4BDAA 4IB5A 3WZDA 4FT9A 5CT7A 4FKGA 4FKLA 2YAAA 2OJGA 4RZVA 3GB2A 3Q60A 4MXYA 2PE1A 4C37A 1Q62A 1YWNA 4G3CA 4RVLA 3HX4A 2GQSA 1OKZA 4RC3A 3I81A 3PRIA 2XIXA 3H30A 2C0IA 3H10A 2VTIA 2HW6A 2H6DA 1NVSA 4MVFA 5HCYA 5AUVA 4XP0A 5HLPA 3KXMA 3V51A 4AAAA 2VWYA 4MH7A 4BF2A 4BWKA 2X39A 2XBAA 4MNEA 1PXIA 1STCE 4PV0A 4TNBA 1E9HA 4K11A 3HMPA 2BTRA 5L6PA 4EOMA 1VEBA 4FUYA 3OG7A 4BCNA 4ASDA 2CMWA 3PZEA 3QQGA 3E8CA 4PNKA 2YIYA 3OTVA 4YZ9A 5K9IA 4C4HA 3F2NA 1ZAOA 3KC3A 5LMKA 1KUTA 3QA0A 2RFEA 3R04A 3CSVA 2R0UA 2C69A 2X8IA 1CSNA 4J52A 5EQPA 4H3BA 3CTHA 4WRGA 3ZO1A 1M2PA 2R3IA 5JEBA 4GRBA 3O8PA 4ERWA 3IDBA 3FC1X 3LJ1A 3VBVA 3LFDA 4JRVA 3DCVA 2VO3A 2YHVA 1R0PA 2UZDA 3OF0A 4BCMA 5J7HA 2G01A 5L2WA 3Q2MA 2YFXA 3ORZA 4XG6A 4FA2A 3G51A 2FA2A 2GMXA 2JDTA 3QA8A 3LKMA 1YDSE 4G2FA 4Q9SA 3ZMMA 3REPA 2OKRA 5E8VA 4AA0A 2OO8X 4M84A 3VJNA 4I6QA 4WSQA 4WT6A 3NMUF 1AQ1A 4C3PA 4FKSA 1BX6A 5CI6A 4CFUA 4BL1A 2GU8A 4F09A 2CKOA 1NVQA 4BDJA 4J7BA 3KN5A 3QF9A 1H1SA 3QHRA 2BIKB 3QBNA 5CZHA 2X8DA 3CQWA 1FMOE 3DQWA 3FKOA 3JXWA 2DQ7X 3EHAA 4F9BA 1S9JA 2BRBA 2G9XA 5CSXA 2C68A 2HY81 4RX7A 4NCTC 3ZEPA 2O8YA 2OIDA 3LM5A 4UALA 4CG9A 2XJ1A 1MRUA 3DTWA 4U81A 1YI6A 2KULA 3NW7A 1W8CA 2NO3A 5DN3A 2PZRA 1M17A 5BVOA 5C8KA 1YI4A 1EH4A 2HWPA 5FTOA 4CVAA 3LZBA 4I6FA 3K5UA 3E87A 4CYIA 3Q9WA 3CCNA 2CJMA 5CVGA 4E3CA 2WIHA 3SKCA 4CMUA 1GAGA 2C30A 3U6JA 4FV8A 4L7SA 1UKHA 4HYHA 5JSMA 5HE1A 2EWAA 3HMOA 2ERKA 3CIKA 3ZRKA 4FNXA 4JL9A 5L6OA 4FKVA 2V7AA 2WMTA 2VX1A 2XF0A 3D2KA 4HPTE 2UVZA 4LG4A 4MNFA 3ZDUA 3HP2A 4NM5A 4AGCA 1YQJA 5DH3A 3LFAA 4IB1A 3DXQA 5M09A 1VZOA 3RWQA 4FZFB 4EUTA 3LVPA 4EJ7A 2R3GA 3MVMA 4FT0A 4CKRA 4O2PA 4QQTA 3VBYA 4CEGA 3QWJA 4CQEA 4O7RA 5HE2A 5IQDA 3AT2A 5LVPA 2F9GA 1B6CB 2W1EA 4FVQA 2R7BA 4JAJA 2WIPA 2BDFA 3C9WA 3DBQA 3A60A 4IVCA 2HW7A 4EL9A 4LFIA 4UXQA 3D9VA 3PA5A 3RPYA 4LRJA 2RFDA 2VO7A 4C8BA 2FO0A 4IVDA 4QMZA 1IR3A 4EH2A 3PVUA 2BAKA 3ZC6A 5AADA 1BL7A 4RG0A 4FBXA 1UWHA 5DT0A 3B2TA 1XKKA 2CNQA 4DEAA 3QTSA 3WARA 4BWPA 3FHRA 3MDYA 1YXTA 1HCKA 2A19B 4Z16A 3SA0A 2PZPA 2WTCA 3MY0A 4JNWA 4EH3A 5EDQA 2ONLC 3PY0A 2R9SA 1L3RE 2WU6A 4TNDA 2OJJA 3TNHA 4EHVA 3PWDA 2OFUA 3IW6A 4CGAA 3KULB 2R3MA 3F82A 4GG7A 3MY1A 4J53A 3H0ZA 4KIKA 3RM7A 2HXLA 4RFYA 4QYEA 1XQZA 5DEWA 1Q8ZA 3EB0A 4HCUA 1ZMWA 4NTTA 4TRLA 5EW3A 5BUIA 4I3ZA 4DBXA 5BYZA 4FKJA 2QO2A 3BRBA 3G0EA 5J5SA 1Z5MA 5CXHA 1PMNA 3Q96A 4XG8A 4Q5HA 5DG5A 4GIIA 4BZNA 2VNWA 5DRBA 1IASA 3OT3A 3SG8A 4I5MA 4BBEA 2QR8A 1Q8YA 5CX9A 3UVRA 1SVHA 2WMUA 3R22A 4UB7A 4BI2A 3D14A 4C36A 4FIIA 5J9ZA 5B0XA 3PXRA 4XS2A 5A3XA 4I41A 4FL2A 3H0YA 1UV5A 4GK4A 4B99A 5J1VA 1KWPA 4KIOA 4EKLA 4YZDA 5A4QA 2IVVA 4YTIA 1MQ4A 4OT6A 5FM3A 2OH0E 3VW8A 3WILA 2WTDA 3TUCA 3DXNA 4F65A 1JSTA 4Z7GA 2XIRA 4A4OA 4XOYA 4X3FC 5FQDC 3SRVB 4FMQA 3WE8A 4B9DA 3OUKA 4QTAA 4GJ2A 4II5A 1XBAA 3A2CA 5FEQA 3JYAA 4CZUA 2Z2WA 5KMNA 4AE9A 2KTYA 3TIYA 4EQUA 3TEIA 4QP6A 5G6VA 3VO3A 3VS1A 4UMPA 3D7ZA 3PJCA 4YPDA 5HNGA 5BVKA 4C59A 3AC1A 3ETAA 5JGBA 1H0VA 1FMKA 2F2CB 2HWOA 2WMVA 4FSTA 4M67A 5CS6A 4K8AA 4GV1A 3ORXA 3LLAA 4NFMA 2PULA 3VS4A 3QUDA 3KL8A 2R4BA 5FLFA 4D0XA 3G6GA 3TZ8A 3MFSA 1XH9A 3IW4A 5AUYA 1XH4A 5KMKA 5KKRB 4J8MA 3BYSA 4FG7A 4TYHA 5HTIA 3D5WA 3E3PA 4DFNA 4KIKB 2PYWA 5HVYA 4BB4A 4YC6A 2ETKA 4TYIA 4ZSJA 1IA9A 4UYAA 1NW1A 2OF2A 5DR9A 3BZ3A 4QPMA 2W99B 3NNUA 4C57A 3ZZWA 4QP3A 2R3JA 3KF7A 4QMLA 4E26A 3HYHA 5EOLA 4W8DA 3S4QA 5CSVA 5C9CA 4FV4A 2QOOA 3E7VA 2C6EA 5CEOA 3HLLA 4U0IA 2JC6A 3MFTA 4YJRA 5LMKC 5KX8A 2XIZA 3DQXA 4IQ6A 3SV0A 2PVMA 4RJ5A 5I9VA 3Q9YA 1W82A 2V7OA 4ASEA 4CKJA 5AAFA 4GUEA 4HVSA 3R8LA 1ZARA 2ACXA 3E93A 1RJBA 1V0OA 4GK2A 4RSSA 5EDRA 3LJ2A 2YN8A 2E9NA 3P08A 1U5QA 4NM3A 4KKEA 3QGWA 4WOVA 2PVRA 5IA5A 5EKNA 4RGJA 4H05A 4F9AA 5AUZA 3VBWA 4QNYA 4EK5A 4USFA 4BYIA 5JQ5A 1YW2A 4HZRA 2QOIA 2OW3A 3ROCA 5FG8A 3VUIA 3Q53A 5AFVA 2XEYA 1P5EA 3W10A 2QURA 1H27A 3R6XA 4RLKA 5DGZA 4IXPA 4NH1A 5IA2A 3QHWA 3EL7A 3I5ZA 2DUVA 3NUPA 4V0GA 2FB8A 3HV4A 3BQRA 2JEDA 4PL4A 4ASZA 2V5QA 2XIKA 3I6WA 5IEYA 3W8LA 5AIKA 3UOKA 2ZMCA 2ZV9A 2ITVA 3NUNA 1Z9XA 3OCTA 3OD6X 3QALE 2G2FA 3HDNA 4M13A 5CTPA 4ZK5A 5HLNA 3ZH8A 1P2AA 3ET7A 4FL3A 3UPXA 4YP8A 4MKCA 5AUXA 5GZ8A 4GVAA 2W0JA 4FNWA 4L8MA 2ZDTA 4ASXA 4E4LA 5KHXA 3LMIA 1KE5A 3UG1A 4YSMA 4DH8A 4DFUA 5T6KA 2QO7A 4YC8A 5AR5A 3ZFMA 3G9LX 4IZ5A 3C1XA 3LLTA 5IUHA 4AT5A 5HG7A 5BYLA 4LRKA 5IZFA 3LCSA 2CPKE 3IPHA 3MS9A 4XRLA 2B9IA 1JPAA 1Q3DA 2XA4A 3HDMA 4YJNA 4PX6A 2YCQA 4EWQA 1I09A 2Z02A 5E9EA 3ORLA 5GNKA 5HE0A 3OXIA 4XG7A 4K0YA 1Q4LA 1ZOHA 2EXCX 1P14A 4DGGA 4J97A 2PPQA 2UZOA 4V01A 4RVTA 3F5XA 3PTGA 2HZIA 2UZEA 3DTCA 3L8SA 4W9XA 5T68A 3UOLA 3AC2A 4FX3A 2GHMA 3C4WA 2PE0A 5AWMA 5KUPA 4D55A 3FQHA 2ZYBA 4NW6A 2WTJA 3NEWA 3DK3A 4BHNA 4F1MA 3KY2A 5BMMA 3QCQA 4F4PA 3QC4A 4KRDA 5LMBA 5IEXA 4UMQA 3MJ1A 5JZJA 1XHAA 4AZWA 2SRCA 5HG5A 3P5KA 3T8OA 4F6SA 5KHWA 1ZYLA 2XJ0A 2BDJA 3L9MA 4IDVA 1ZZLA 2G2IA 4FTTA 4W9WA 1UNLA 3THBA 3EQCA 1LUFA 2IZTA 3O50A 1YRPA 4MK0A 2GNIA 3LFQA 3AXWA 1ZYJA 4FTMA 3MV5A 3SVVA 4DFYA 1PXMA 4WA9A 3VIDA 3CPCA 4MQ1A 4CMOA 5C27A 2V0DA 3S3IA 2YLFA 3F3UA 2ITNA 4YJOA 1NT2A 5KMLA 5JZNA 4C4IA 3DFAA 3L8PA 4FT3A 5HZNA 2BROA 2GDOA 1OECA 4MXZA 4QRCA 2GQGA 3OBGA 3QD3A 4YC3A 5J87A 4MD7E 2PVKA 5DE2A 5KCVA 1SVGA 4E6QA 3ZFXA 3DDQA 3TL8A 4B8LA 5I9UA 3ZEWA 4OTRA 2HENA 1T45A 1WBNA 4GL9A 1ZMVA 5EHYA 3R7EA 3L8XA 2XNMA 2P0CA 4DEBA 1PXNA 5E8TA 2J0KA 2ESMA 2PY3A 3RM6A 2XK6A 3SX9A 1B39A 5DR6A 3ZSGA 2J7TA 2R3QA 2VWBA 3CGOA 1JKKA 3D5XA 3TV6A 1R78A 4F7JA 3OW3A 3DLSA 4OTIA 5IKWA 1SVEA 4BHZA 4RRVA 2XCKA 3E8DA 4E8AA 4FGBA 1Y57A 4FKWA 1PXPA 2I7QA 4QMSA 4P5ZA 3AT4A 5HORA 1BI7A 5L2TA 4AN2A 3NYVA 1PXJA 2HIWA 3MH3A 4M8TA 3UOJA 4FT5A 3QZHA 4FTLA 4R3PA 4DEDA 2X4FA 3SG9A 4EK6A 3MY5A 1Y6BA 3QXOA 4RX8A 3TN8A 3LFSA 4HYIA 4OTGA 1W98A 2BZIB 2W4OA 3EQPA 2CLXA 3ZLXA 2UW0A 4YJQA 2O65A 1H07A 3QZIA 4BKJA 4OBPA 3VAPA 2RL5A 5F94A 3P4KA 3V01A 1OKVA 1WBPA 4H3PA 4ZLZA 5CYIA 5ANOA 3NZ0A 4RIWB 5GJDA 4JQEA 4MTAA 2PVNA 4FSRA 4JDIA 4L6QA 4DH7A 1UNGA 2PUUA 4I4FA 4UZDA 3RZFA 4H1JA 3Q04A 4Y72A 4BDGA 3QD0A 2XRUA 4D2SA 4DA5A 4MXAA 5A54A 5IH4A 1YXSA 4FV6A 2OBJA 4PTEA 5CLPA 4QP4A 1J7LA 5H9BA 4EOOA 5IQHA 3DGKA 2C0TA 3O17A 2W5AA 4I22A 5IF1A 3DB8A 5L2SA 2QI8A 4AGWA 4R77A 4YHTA 4LRMA 3LCTA 4O7ZA 1K2PA 4FSZA 2VWZA 4EH4A 4NJDA 4M66A 4R7BA 2B4SB 5HVJA 4N70A 2FVDA 2UW5A 3R01A 4EONA 4G34A 4ZJJA 4UMRA 4EK3A 5AUUA 4EZ7A 3HA8A 2PK9A 4N4SA 4F0IA 4HGLA 1DS5A 1T46A 4MD8E 4RWKA 5GZ9A 3DS6A 3FZRA 3QCYA 4BI0A 4PP7A 5IDNA 3F3WA 4YJVA 3ZRLA 2CCHA 4X2FA 3ZHPC 4UXLA 2B7AA 3PE2A 4HPUE 2IN6A 1OZ1A 2YIRA 1YHVA 3U6HA 4O6EA 5AR3A 3ZFYA 3IW5A 2PMOX 3HA6A 3HKOA 3Q9ZA 4D28A 3E3BX 3OY1A 4ZSEA 4F64A 4IDTA 2R5TA 3AC3A 5AR7A 5HNBA 4RPVA 2ZM3A 4FIFA 3R9NA 1URCA 3UMXA 2XMYA 3R7UA 3C0GA 1OI9A 2HCKA 2PVYA 2YM4A 5CF6A 3LPBA 4NKSA 2GS6A 4IAZA 3RHKA 1WBTA 5D7AA 4XRJA 4GJ3A 3U51A 4YNOA 4A9RA 1M14A 4MCVA 4MYGA 3H9OA 4HW7A 4MEDA 3LFCA 3TZ7A 2PUIA 2OF4A 1AGWA 3R8UA 4DITA 2YWPA 3PXQA 4YZMA 3UP7A 3KF4A 4U7ZA 2QD9A 5FP5A 5BVNA 3C0HA 3PDTA 4AX8A 3MFRA 2FUMA 4WNOA 5EM7A 3ZLWA 1YXXA 2VTJA 3FE3A 1TQMA 3LW0A 3NW5A 5KE0A 3WZKA 4APPA 1H1PA 5B7VA 1H26A 4GS6A 2JDVA 5JRQA 3I7CA 3VRZA 2WELA 3UC4A 1W84A 4X3JA 5AP4A 3KQ7A 3EKKA 4EZ5A 4ITJA 5EI8A 3LMGA 5F4NA 4UEUA 2B9JA 4BGQA 4IIRA 4NT4A 3U8WA 3G33A 4G5JA 3FEGA 2Y4IC 2W1ZA 3BYMA 4DYMA 4PUZA 2UW9A 4E7WA 3ZOSA 4NYEA 3NSZA 4GCJA 2WMAA 4ANLA 3FI8A 3MH1A 4JIAA 2F7EE 1U59A 2VTSA 1YOLA 2F57A 2YZLA 1WAKA 2XS0A 1Y8GA 1ZWSA 2QG5A 3H3CA 3OXZA 5C01A 3NWWA 4BDCA 4D2RA 2C47A 5L2IA 2XNEA 4NTSA 3EQGA 2XRWA 2BUJA 4YHJA 4BCKA 3ODZX 1GY3A 3ZTXA 3PVGA 4X7QA 4QQCA 4DG2E 2YLEA 5HVKA 3FYKX 2YDJA 3BIZA 3C4CA 3T3VA 4C0TA 5BVDA 2UZNA 4LOQA 2VNYA 4EI4A 2EU9A 1FQ1B 4ITHA 3QTWA 3EQIA 3GQLA 4H1MA 4G1WA 4HGEA 4HJOA 4MWHA 3VUMA 5M08A 4H39A 2V55A 4O7LA 3GENA 1SYKA 1JWHA 3VF9A 2J6MA 2X2KA 5EM6A 1FVTA 3MTFA 4CSVA 4FTUA 5H3QA 5CQWA 4RX5A 4ANOA 3A7FA 3FZTA 4KKGA 3ZRMA 4D9UA 3NUUA 3A7GA 3FSFA 3R1QA 4X2GA 4FYOA 3KRWA 4IZAA 4AN3A 4KKHA 2GNLA 2PVFA 2RG6A 2BR1A 4F70A 5JT2A 3F3ZA 3CY3A 4XJ0A 4AFJA 4HGSA 3VHKA 5EQEA 3KGAA 4AW2A 4Q9ZA 2P33A 3IONA 4JQ7A 1TVOA 4GFMA 3FLZA 4LGDA 1YHWA 3C4FA 2UZBA 5AP3A 3V5TA 5FTGA 2VTNA 2CDZA 3COIA 3IECA 2I1MA 1ZRZA 2Z60A 3PP1A 4DTAA 4S2ZA 3PXKA 3UIXA 5IDPA 3R8VA 3UZRA 2E2BA 4ALUA 4IZ7A 2GHGA 3JR1A 3E5AA 4FV2A 5DYJA 1F0QA 5HD7A 3PFQA 2W5BA 3UYTA 4RC4A 5IUGA 4L42A 3BGZA 4G6OA 3ANQA 4FTJA 2W1DA 4BYJA 5CAPA 2X7OA 2IZRA 5E91A 4QQJA 3VS3A 3KCFA 4EH6A 1Y8YA 2BKKA 4XOZA 1G8SA 2EB3A 1FBNA 4YHFA 3SW7A 5HNIX 4JI9A 5DMZA 2VWVA 4AT4A 4JG8A 4JXFA 4BCHA 2PZ5A 3ACJA 4EH5A 1GJOA 2QO9A 3WZEA 4YU2A 1PXLA 1YDRE 5C4KA 2I6LA 4QNAA 4IW0A 1MRVA 5GJFA 4BCIA 4MX9A 4CFMA 3EYGA 3PXFA 5EQYA 4ACMA 3QCXA 4XG2A 5AP5A 2VWXA 4FV7A 4NU1A 3ID6C 1F5QA 5DHJA 5E1EA 4BCGA 3C7QA 2P55A 2WFYA 2C3JA 2OGVA 4DN5A 5GIOE 3LJ0A 3EQRA 4MXOA 3VS6A 3U9NA 4FTNA 4PL3A 4WG4A 4C2VA 3CTJA 1G8AA 2YDIA 4IH8A 1OL1A 5ANKA 3SQQA 4E4MA 3UZTA 3HAVA 2GNJA 4BICA 1U46A 4HGTA 3H9FA 2XNPA 3GC8A 3PXZA 3TTJA 4BDIA 4IZYA 1H1QA 1MRYA 2XK3A 3FMNA 4O0UA 4U5JA 4RVKA 4W4YA 3RKBA 4YTFA 4EH8A 4J99A 4O86A 5EKOA 5JQ8A 3PG1A 4JRNA 5AMNA 4M0ZA 5HG9A 5BMSA 2JKMA 4I94A 2X7FA 4IE9A 4OTFA 5CAOA 1KV2A 4FVRA 1E1VA 4I5PA 4APCA 4XUFA 4ACDA 2C1AA 2O2UA 5DPVA 3VC4A 2CGXA 1ZYDA 4QTBA 3QLFA 3ZDIA 5C1QB 2WEIA 5AV1A 4O0YA 2WQNA 5EI2A 4ZTLA 4USEA 5LOHA 4KRCA 4JQ8A 2R3FA 4U45A 3O51A 3QCSA 4DFZE 2YCFA 3EQFA 5EW9A 4J98A 3VHEA 2VWUA 4OT5A 3TV4A 2QVSE 2XVDA 5M4UA 2OXDA 3H9RA 3NPCA 3LCKA 5CZIA 3DJ5A 3OZ6A 4FKRA 3FMKA 2J0MB 3A62A 3EMGA 3P79A 4K1BA 1R39A 1UKIA 4KBCA 3CD8A 3WI6A 4AF3A 4ZLYA 2J0JA 3F5GA 4ANSA 4YPSA 4ANBA 1WBWA 4CLJA 4ZTMA 4X21A 3S1HA 4YO4A 4FSWA 4XV1A 4D1ZA 4E73A 2PMIA 3TKUA 3F5PA 3GU5A 4NW5A 3TNQB 2W17A 3COMA 2QOHA 1JKTA 2NP8A 2WPAA 4CNHA 4ZY6A 4ZSLA 3GNIB 1FGIA 1SMHA 5TE0A 3ZS5A 4CRSA 3KXNA 4IM3A 2C1BA 3F7WA 3KULA 4FV5A 2EXMA 4NZWB 5LARA 3OTUA 5EHOA 4EOPA 2ETMA 2VV9A 1Q8WA 3LFFA 4K18A 4XG9A 4GW8A 3V8SA 3EJ1A 5D7VA 5L4QA 4AGDA 3MPTA 3D2IA 3UQFA 1H1WA 3UE4A 4DTKA 3OROA 5HQ0A 5HIBA 4O84A 1PMEA 3IG7A 4R5SA 4TXCA 2WTKB 2GTMA 1R0EA 5HI2A 4ZS0A 1RW8A 5CEQA 4OAVB 3RJCA 4CCBA 5HO6A 3PJ8A 3BLRA 3FMMA 5A4TA 4J71A 1Z57A 2R3LA 4LMNA 3B8QA 2ITPA 1OIQA 3A61A 3OS3A 4PY1A 2PZYA 3M11A 4F0GA 1YVJA 5CY3A 3BV2A 5FDXA 2WOUA 3Q32A 4BDHA 4ZP5A 4AOJA 2J50A 1J91A 2I40A 3PG3A 3VVHA 4B6LA 3LCOA 4O21A 4FK3A 4DINA 4MF1A 1ZOGA 3MJ2A 1PF8A 3PZHA 2NRYA 5H2UA 5M56A 1M52A 3F9NA 3SRVA 3V6RA 4TYJA 3K2LA 3DKFA 4WRSA 5CT0A 3OWLA 3VW6A 2H96A 3NLBA 5EYCA 3DZQA 3VF8A 3CGFA 4PTGA 2BCJA 4GU9A 4D2TA 3S95A 5EYKA 3FPQA 4RIXB 5ETFA 2WMRA 2YCSA 2Z8CA 3IOPA 3KVXA 2WMSA 4FI1A 3BWJA 2HOGA 4U3ZA 5AUTA 3I4BA 3KREA 3LE6A 1IA8A 1OL2A 2UZTA 5E8XA 5JN2A 3PE1A 3VJOA 3OC1A 3DT1A 3OBJA 3HMIA 4TW9A 4F9WA 2RFNA 2J5EA 5CI7A 5CSWA 2NRUA 4L7FA 2YJSA 3GP0A 1H00A 4PMPA 3UVPA 4TWNA 3ATTA 2CKPA 1REJA 2QKWB 2XM8A 2PWLA 5GJGA 3ZLYA 3P23A 3IS5A 4D4VA 2ITXA 1LEZA 2QG7A 3DB6A 5H8BA 4O7NA 1XBCA 2JDOA 5H8GA 4QMXA 3ZUTA 5ANEA 4R1YA 4M0YA 4MWIA 5J9YA 3EZVA 4IAFA 3BQCA 3FBVA 4IC7A 3G90X 4FEVA 1UVRA 3R63A 3QTXA 4C02A 4KINA 1ND4A 3SXRA 4GUBA 4U42A 4NKAA 2GQRA 4F6UA 2GNHA 3ZONA 2CGWA 3EL8A 3VUGA 4QMWA 4Y8DA 3G2FA 5DVRA 4EK4A 3IO7A 3FC2A 2FSLX 2C0OA 3K3JA 4AZSA 4GT3A 4YBJA 3FPMA 4D4SA 2Y6MA 3K54A 3NUXA 3FV8A 4AE6A 4AU8A 3O23A 4BGHA 4FKTA 3T9TA 4ZMFA 2HELA 2FSMX 3UYSA 3L8VA 4QMPA 2OI4X 5ANDA 4ZEGA 5IA4A 5GHVA 5LVMA 4ZMEA 2OK1A 4BTJA 3O8TA 5CQUA 3RAIA 5AM6A 4QMYA 3TT0A 4D2VA 5IEVA 2WKMA 4O0TA 4U97A 4WG5A 4YLJA 4OAUC 4JVGA 5ETAA 4FIJA 3SGCA 4A9SA 2I0YA 3SC1A 3VS0A 4A9YA 3V3VA 3OCBA 4BKYA 3UOHA 4DGNA 4G17A 1FINA 3R7OA 4QOXA 3L1SA 2YISA 4JX7A 4O1PA 3HV6A 1ERKA 3BI6A 3C51A 4GT5A 2R3OA 2QHNA 3FI2A 1V0BA 4RVMA 3WBLA 2Q83A 3TKIA 3FYJX 2QQ7A 5I3OA 2IPXA 4E4NA 4TL0A 4ITIA 4D4YA 3FXXA 1WZYA 4MD9E 4BCFA 2O63A 5CEMA 3KU2A 4N57A 4FKUA 4XV9A 4J1RA 1KE6A 3O71A 3TUDA 3TWJA 3ZUUA 3PSBA 1UU9A 3OEFX 3IQ7A 2DS1A 2YIXA 3WYYA 2BHHA 4IVBA 3GU6A 4S33A 5FM2A 3JPVA 1OB3A 3S2PA 1O6LA 4QP7A 4KA3A 4I0RA 2VX3A 2ITOA 1M7QA 4ZIMA 3UQCA 4FICA 4O0SA 4QT1A 1OUKA 3PY1A 3RNYA 4OBOA 3BLHA 3HL7A 1ZOEA 2WAJA 4FTQA 5ACBC 2A2AA 3FY2A 4HYSA 3ZXTA 4FSUA 2W1HA 3VS7A 3E64A 3QXPA 3A99A 4AOIA 4IAIA 3AQVA 3UNJA 4RJ6A 1HOWA 4RLLA 2EB2A 1SNUA 5HLWA 3EN5A 3WE4A 3QTZA 2GPHA 4RJ3A 1CKPA 2EXEA 3RBWA 2C6DA 1XO2B 5FXSA 4CTBA 4EQMA 2ITYA 3BCEA 3DOGA 4IC8A 4I1ZA 1DI8A 2W5HA 5HBJA 4U8ZA 4AA4A 2BFXA 2W9FB 5A9UA 4ALVA 5CNNA 5FD2A 3LIJA 2BRNA 4YSJA 2VWWA 4P90A 1SZMA 4KIQA 2F2UA 2XK9A 4GSBA 3QRJA 4KIPA 5A4CA 1W7HA 5HIEA 2UW3A 4GKHA 5IQCA 5M51A 3G0FA 2LGCA 3DK6A 3R8MA 5IA3A 3M42A 3R9OA 5GZAA 3DBDA 3LXNA 1OL6A 2ERZE 5AP0A 2QLQA 4YJSA 3R9DA 4QPAA 3QZFA 3QYWA 5J8IA 4DFBA 4Z55A 3LAUA 4FNYA 4HNIA 4BZOA 4DLJA 5AUWA 1ZZ2A 5CU3A 3ZM4A 4ZJVA 4O7VA 2A4LA 4WIHA 4FZ6A 4DEHA 5DR2A 4PMMA 3Q6WA 4L43A 2WGJA 5C03A 4BDDA 3CE3A 5M53A 4FZAB 5TF9A 1QMZA 3Q4ZA 4D5KA 2OZAB 4TTHB 3BX5A 3OT8A 3C4ZA 3EIDA 5KMIA 2OIQA 2G15A 2J0IA 2G2HA 1PKGA 5BYYA 2BRGA 4QYHA 3FKLA 3EWHA 1OIRA 5M4CA 3C5UA 4RFZA 4A7CA 3OVVA 1MUOA 4AZVA 4PDPA 1Q8UA 3R00A 2JAVA 4AOTA 4ZSGA 5AAGA 5TO8A 5AM7A 3TIZA 2W1FA 3LFNA 4GG5A 2XKFA 2ZAZA 4L3PA 4N0SA 2C6MA 4ZZNA 3UNZA 1FVRA 3SLSA 3AC8A 3MIAA 3OW4A 4IEBA 1YDTE 2XKEA 2FSTX 2YA9A 3MVHA 5ETIA 1NVRA 5J1WA 3FY0A 4RMZA 3QQFA 5DT3A 4M68A 4FGRA 1JQHA 2WD1A 2XB7A 5IQAA 4RX9A 4HVDA 4U80A 1VR2A 3PWYA 4J95A 4M3QA 3VUHA 3BELA 5AR2A 3QUPA 4A9UA 4EJNA 4RIWA 3D7TB 2YM3A 5D9HA 4EOQA 4IJ9A 2W05A 2VTRA 4A9TA 1OITA 4PPAA 4EUUA 3G6HA 3NIZA 2VGPA 5M07A 4DBNA 5KKRC 2JBOA 2YIQA 4G3FA 4X2NA 5HICA 3I1AA 4ACCA 5L3AA 2YWVA 1WBOA 3F88A 5CENA 4NM7A 3NAYA 3V5LA 4QMVA 5I9WA 1UNHA 2BALA 2YM7A 1UWJA 3DY7A 3KMMA 4LGHA 1V1KA 3II5A 3NYOA 4MAOA 3ZC5A 5BNJA 3QKKA 3MH2A 4QMMA 4FSQA 4LM5A 5ANJA 4H36A 5LQFA 2QOCA 2XK8A 4F99A 1GZOA 5BUEA 4R78A 4IWDA 2IVSA 5AP6A 2Y6OA 4YURA 4D1SA 5CAVA 1CM8A 5HIDA 4TKSA 5HESA 1KE9A 3AGMA 4ZLOA 1OKYA 3BEGA 3R2YA 5JRSA 1OMWA 2YABA 5KO1A 1O6KA 4K2RA 5CU0A 5LMAA 2AYPA 3CQEA 4EYJA 4L00A 4YJPA 4B0GA 3AD4A 2BZJA 2FSOX 3IGOA 4X6RA 4F7SA 3RAHA 4C38A 5A6NA 3PXYA 4FZ7A 4C4JA 4R3CA 2X9EA 4CT1A 4CYJA 1OL5A 4PNIA 1MP8A 3V8WA 1LPUA 4CLIA 3ITZA 4V04A 2J2IB 3GUBA 3I6UA 2OSCA 4HCTA 4I23A 5A14A 2B52A 3AOXA 3CEKA 3DV3A 3NIEA 4CZTA 2OFVA 4KABA 4XYFA 4PDYA 4U79A 5CF4A 5F1ZA 5KMJA 1YHSA 3BHYA 2E9UA 1B38A 4X6QC 4YZNA 3Q3BA 4ZTRA 2ITWA 4UYNA 3QRTA 5IQBA 4CV9A 1REKA 2QOKA 3WIKA 3W8QA 4BRXA 3BU6A 4O7TA 3UPZA 2GCDA 3KFAA 2VX0A 4FYNA 3ERKA 2QONA 1YXUA 4XP2A 2F7ZE 4L46A 3U6IA 1RQQA 3DBCA 2OU7A 3HUBA 1DM2A 2PVHA 4I5CA 4S32A 4EQCA 2CNVA 4CRLA 1IRKA 3DA6A 5TKDA 3DAEA 2X8EA 3FWQA 1H24A 4IMYA 5EHLA 4LUEA 5DT4A 4BZDA 4TPTA 4IHPA 3OCSA 3C0IA 1Q8TA 4RIYA 1OPLA 5HCZA 4Z3VA 4EZ3A 2QR7A 3AC4A 2BKZA 1PMUA 3BBTB 5AX3A 3GT8A 3BYVA 4C33A 3UVQA 4JDHA 2UW6A 3BV3A 2X9FA 3VULA 2GFCA 5K0XA 2QOFA 3GOKA 4FK6A 4MBJA 5D1JA 3E63A 2W06A 1GZ8A 4L45A 3KXGA 3VQHA 3MESA 3MWUA 1L8TA 5E1SA 2YM6A 3B2WA 3GC7A 3OWJA 4UZHA 4UMUA 5K3YA 4JBVA 3A7JA 2B1PA 4CTCA 2JFMA 5ETCA 3DXPA 2ZVAA 5IA0A 5IH6A 3GU8A 1WMKA 2JIVA 1IEPA 2ZB0A 3NUYA 2C5YA 3ORIA 2WMWA 1HCLA 4P5QA 4FR4A 5IMEA 4EHEA 2PSQA 1H8FA 1KOBA 3BLQA 4XP3A 3ENHA 3WF8A 2F49A 1X8BA 2IWIA 2VWIA 1U54B 4QQ5A 5IMXA 5HU3A 4I92A 2CN5A 2PE2A 3BYOA 5CU2A 4WKQA 4YR8A 2IG7A 3MFUA 4M97A 4O0RA 1J7UA 1K3AA 3CQUA 4JR3A 4OUCA 5FGKA 1OGUA 2C3LA 3HV3A 2A27A 5EOBA 2QODA 3WIGA 5J95A 2OH4A 3IKAA 1WVXA 4O0XA 2UV2A 3W2OA 2IVUA 3KVWA 4OR5A 3RTPA 4AFEA 3FLYA 3P9JA 3KRJA 4DEIA 2ZV8A 4NK9A 5E8SA 1BMKA 4ACHA 4HVIA 4NIFB 2VO0A 2VTMA 3G5DA 4CG8A 2WQMA 3OUNB 3PVBA 2A1AB 3N4TA 4IB3A 3UC3A 3D94A 4RIYB 5EK7A 1WCCA 4PMTA 2F7XE 4DCAA 4YLKA 4FTCA 4W4WA 3MN3A 3VWAA 2OXXA 4WO5A 4JDKA 3L9NA 5AJQA 4I5HA 5AA8A 1BYGA 1Q97A 3HP5A 4OTPA 5HX8A 4LQMA 1Y91A 1XBBA 2BTSA 2VD5A 3VUDA 4AZEA 5LVOA 2QU6A 4L44A 4QYYA 2Q0NA 4HOKA 2J9MA 1CDKA 2C6TA 3I5NA 3WZJA 4BCJA 2YJRA 2GNFA 4QP9A 3DFCB 1YOJA 3R2BA 4L3LA 5ANGA 3EFJA 3IW7A 3PPZA 3WYXA 2HY0A 5LVNA 3HNGA 3CY2A 3QU0A 2P4IA 4U3YA 5HE3A 5HKMA 3BPRA 3D5VA 3MYGA 2W4JA 4G5PA 1A9UA 3TG1A 1JKSA 2GTNA 2Y7JA 3GOPA 3W18A 1JLUE 3UNKA 1RDQE 3RWPA 2BRHA 2IVTA 1YWRA 5FWKK 1APME 2F4JA 1ZYSA 2IO6A 1Q5KA 2Q0BA 2UVXA 4ZOGA 4K33A 2QHMA 3COKA 3R7IA 4L67A 3F5UA 3LXKA 3ZO2A 3DJ6A 4ALWA 4PQNA 4E20A 5JFWA 5DI1A 4U41A 1TQIA 4IJPA 2J90A 3FXWA 4DGMA 2UW7A 1GIHA 3ORMA 3TACA 3S0OA 5C8NA 4RZWA 3LFBA 4FSMA 4BC6A 2VU3A 4ZTNA 3MA3A 5CVFA 4BTKA 4Z7HA 3G15A 3TV7A 4DFLA 2E9OA 3PLAE 2GHLA 4FTOA 2HYYA 5JFSA 3NUSA 1TQPA 5DLSA 3K5VA 1XH7A 1PW2A 4ZS4A 5DBXA 3N9XA 4MXCA 1ATPE 4C58A 5ITAA 4BTMA 3DLZA 3DKGA 2OXYA 4EH7A 5KNJA 2ZOQA 4O81A 2WXVA 4JAIA 3HMMA 4WHZA 3HRFA 1E1XA 4QPSA 1H01A 3CJFA 4E1ZA 4YGAA 4C4FA 4UV0A 5DFPA 4ARKA 3SXFA 3W55A 4FEWA 4DAWA 2VTHA 1OVEA 3Q6UA 4ACGA 5CWZA 1K9AA 3QRKA 4PL5A 4IANA 3BHHA 3LQ3A 4FKOA 1JSVA 1J1CA 2AC5A 3C13A 5K5NA
chains in the Genus database with same CATH superfamily
3R9HA 3F6XA 4MHAA 4RJ4A 4G16A 4JG6A 3VN9A 4DH3A 4DHJA 3OCGA 5HO7A 3K3IA 2YZAA 1V0PA 4XX9A 4A07A 3F7ZA 2J0LA 3TI1A 4AW0A 4FTIA 1YXVA 2RFSA 3EN4A 5L6WL 4EBWA 3LMHA 4H3QA 4TYEA 3U4UA 1KOAA 4G9CA 1BLXA 2O5KA 2XYNA 3M2WA 5J7BA 3HRCA 1O6YA 4ANNA 3RCJA 3PSCA 3FDNA 4IM0A 4IAYA 4AXAA 3DDPA 1U5RA 3NNWA 1SM2A 3QWKA 1MQBA 4GKIA 4BJJA 3DNDA 3RHXA 4FTRA 1XH8A 3PVWA 4I4EA 4PWNA 4EK8A 4UX9A 2AUHA 4D1XA 2BRMA 3BU3A 2PU8A 3ZO4A 3KK8A 4GYIA 4O1OA 3ZBXA 3WF7A 1Y6AA 4FSNA 4CD0A 1DAWA 5A4EA 3ACKA 3Q4CA 4DCEA 1WVYA 2R3HA 2XUUA 5HGIA 3W32A 3P7BA 2WQOA 3R1YA 3TTIA 5GIPE 4UWYA 4GFOA 4NJ3A 1S9IA 5BVEA 4XEYA 4QP2A 4UWCA 4C3FA 4DG0E 4IX5A 3NRMA 4U43A 3W16A 2RKUA 3I7BA 3FXZA 5AA9A 3QFVA 1YKRA 1ZYCA 4FG8A 4MBLA 5E8UA 2R3NA 4QEBA 2Y9QA 2EUFB 3NDMA 3FMDA 4G31A 3NGAA 2IZUA 2VAGA 3F2RA 2GFSA 3FMEA 4R5YA 4PDSA 4BVUA 5FP6A 3BE9A 3IK3A 4AS0A 5HBEA 2OJFE 5LCKA 1YWVA 4IWQA 4IX4A 2XAOA 2W7XA 4LL0A 1KE8A 2QCSA 3A8WA 4JOAA 2VTPA 4FODA 5F9EA 4BCPA 2H8HA 5AV0A 4BDFA 3A7IA 2V22A 3T9IA 3CTQA 4FSYA 2LAVA 3RVGA 4EBVA 3R30A 4IFGA 5DRDA 3EQBA 2ITTA 4FKPA 4R7IA 3TNWA 5LVLA 3JUHA 3GFEA 2XK7A 4L52A 5HOAA 3SW4A 4XHKB 4KSPA 4AW5A 4WBBB 4F08A 3R7VA 3CP9A 2RSVA 3DNEA 4AAYA 4U9AA 1XH6A 5I9ZA 3R8PA 4BI1A 5A4LA 4C62A 5J9LA 4RQVA 3RPRA 3PIXA 1PRYA 4RIXA 4C4GA 1QPJA 3RAKA 1OUYA 3OP5A 2QOQA 4M69B 3R02A 4D4RA 4X3FB 2DYLA 5IU2A 3HAMA 4E93A 3UIBA 4J8NA 4YO6A 1JBPE 1PY5A 3R28A 4QMNA 3QX4A 2RGPA 3FSKA 2Z7QA 4OTWA 4X2KA 4USDA 3ROYA 4I20A 2JDSA 4BTFA 4DEGA 5M44A 1ZY5A 2A0CX 3E8EA 3W33A 2VTQA 2ITQA 5HHWA 5IA1A 3UTOA 4DEEA 3SOAA 1UU7A 2JBPA 1PYEA 4CMTA 4O27B 3ZLSA 4IB0A 5EG3A 5DIAA 1J1BA 4AP7A 4PF4A 1BI8A 3UDBA 3E8NA 2WO6A 2IJMA 4RWJA 4TN6A 2PUPA 3GC0A 5IH5A 4IAAA 3W2SA 4D2WA 3OFMA 4EOKA 4O91A 4LI5A 2I0EA 2PZIA 3E92A 3BKBA 3U4WA 2XH5A 4JS8A 5LWNA 5IPJA 4FEXA 3GCUA 2R64A 4HCVA 3GFWA 3PRFA 4E6DA 2HAKA 4ORKA 4MNEB 2OJ9A 1OL7A 3DKCA 4E6CA 4FOCA 5EDPA 1BKXA 3F69A 4CZYB 3FQSA 3OOGA 3QAME 3QTIA 3KXZA 3Q4TA 5F20A 2BVAA 2ZV2A 1J7IA 3PJ3A 4KS7A 4RQKA 2WOTA 4RA5A 2J5FA 5B2LA 4MUQA 3ANRA 2GSFA 5AP2A 2I0HA 4CFXA 2C4GA 2YITA 4PMSA 4YJTA 4R7HA 4ZY4A 3ODYX 3V04A 3ALNA 1URWA 3I0QA 4EOLA 1BUHA 4ZXTA 2JLDA 2R0IA 2ZM1A 4FIHA 4QTEA 3NYNA 5CNOA 5IUIA 3NVMB 4LUDA 5CEIA 4ANQA 1F3MC 5M4IA 4BGGA 4JJRA 5I4NA 2AC3A 3UZPA 1PYXA 4C2WA 5L8LA 2UW8A 3GCPA 4KB8A 2VRXA 3TZ9A 5CANA 3N51A 3BU5A 1QPDA 3NNVA 5CXZA 5HX6A 4HVGA 4LV8A 5BUJA 3HEGA 3WOWA 2QKRA 4O0WA 4CV8A 4FT7A 2R7IA 4WNKA 5IQEA 3GXLA 3FLQA 4O6LA 4XCUA 2PUNA 2X6DA 4PDOA 4GK3A 1GZKA 3FZ1A 4B4LA 2R2PA 3D5UA 2P2HA 4RT7A 4XMOA 1J3HA 3EOCA 4FUXA 4E5AX 3CJGA 1IG1A 1OM1A 2QOLA 3LOKA 4CFFA 4RJ8A 3FI4A 5KMMA 3V8TA 2E9VA 1OBDA 3KXXA 5GINE 2UVYA 3P0MA 2CGVA 3GCQA 4BBMA 4L68A 3QLGA 4G3GA 4IAKA 2GS7A 4NEUA 2C5VA 3D15A 4RWLA 2B53A 5DEYA 2C6LA 3PUPA 3R0TA 2CGUA 4W4XA 2OJIA 3EQDA 3I60A 4XV3A 5IISA 5I9YA 3QRIA 3SDJA 4FL1A 4JBOA 4Y85A 3WZUA 3TUBA 4NM0A 4TWOA 5EYDA 2B0QA 4EWHA 2UZUE 3BE2A 4Q2AA 4DLIA 3TNIA 2XCHA 3ATSA 3MIYA 5LWMA 1UA2A 2XJ2A 2JFLA 3FQEA 2UZLA 4FKQA 5CASA 4O96A 4OTHA 3R83A 2JKQA 5EW8A 3W0SA 4BR3A 1PHKA 2Z7RA 2ETRA 3CKWA 3DK7A 3U9CA 2BIYA 3WF5A 4EOIA 1OIYA 2GNGA 2GS2A 3MGYA 2BDWA 3OWKA 5E90A 3V5WA 4R6VA 4DFXE 2G1TA 4KAOA 2H34A 4Y5HA 1H28A 4KBKA 3P1AA 3QD4A 4JBPA 3KB7A 2YM8A 5F95A 3NNXA 3E62A 3VNTA 3FLNC 2ITUA 3BEAA 2UZVA 1H0WA 2RG5A 4YUQA 4I24A 4A06A 3IDCA 4FTKA 2XKDA 4OBQA 3W1FA 2PL0A 4ZAUA 3I0OA 1GNGA 5AR4A 5BVWA 5IQGA 5L8KA 3AMYA 2R3PA 3MTLA 3QQKA 2OWBA 3FMHA 2W4KA 3LQ5A 4YZBA 4B7TA 5E4HA 1VYWA 5D12A 3C4EA 4AQCA 4C7TA 3R9RA 3NCZA 4TWPA 2R3RA 4BWXA 1GZNA 2Y4PA 2REIA 4MQ2A 3ZZEA 3UGCA 3LFEA 4LMUA 5D10A 5E8WA 3W0RA 1H1RA 4FEQA 1WBSA 4NUSA 4O22A 3OHTA 4HZSA 4JIKA 5B2KA 4A4LA 3COHA 1NA7A 3CLYA 5CEKA 4P7EA 1ZY4A 2NNWB 3PY3A 5AP7A 2Y8OA 4ENXA 4QMTA 5BPYA 2ITZA 3HMNA 2WTKC 3GEQA 4C35A 4EOSA 2OZAA 4BIEA 2ZB1A 2IW6A 4OLIA 4XH6A 4EH9A 5JK3A 2P3GX 4QO9A 3UJGA 3A4PA 3C5IA 5AIRA 3R21A 3UP2A 4DGOA 4ENYA 1H08A 3R71A 2YCRA 1XR1A 1WFCA 2BILB 3CR0A 4WBOA 5JGAA 2Y0AA 3GQIA 3ORTA 2C5OA 2VTOA 3R7GA 4JLCA 3FAAA 3TZMA 4B8MA 5AEPA 2BPMA 5TOZA 2EVAA 4ERKA 2FYSA 4CKIA 5CF5A 4DTBA 1KSWA 4P4CA 1G3NA 4YBKA 4UBAA 3VBQA 5KZ0A 3QQLA 3SAYA 4E5BA 4O4FA 4FIEA 4CT2A 4TY1A 5CAQA 3HGKA 2VTTA 4AUAA 4JT3A 4AXEA 4IADA 1LR4A 2WTVA 3DAKA 1FOTA 4O83A 2BZHB 1A48A 3U87A 4KNBA 3GCVA 2PVLA 1IAJA 3QYZA 3DBFA 3QGYA 4QTDA 3E88A 3QRUA 3SOCA 2QU5A 3IDPA 4DT8A 1YI3A 4ZJIA 3EFKA 3ORPA 3D0EA 4WUAA 3RGFA 5AV4A 2WZJA 2JITA 4EEVA 3EKNA 5CF8A 2UW4A 3DAJA 3D7TA 5D41A 2C5NA 4M14A 3V5PA 2VZ6A 5AV3A 1O9UA 3V5JA 1ST4A 4DE4A 3KKVA 5BX0A 5FDPA 1P4FA 3NFGB 3FZOA 4PRJA 2J4ZA 4P2KA 5HG8A 5A6OA 2ZDUA 3R7YA 3KCKA 4C4EA 2W9ZB 5E8ZA 4Y83A 5FBOA 2XKCA 3VBTA 5AR8A 1PJKA 2O64A 5M57A 2W1IA 2YIWA 4OTQA 4ZTHA 4DG3E 4EHGA 2HZNA 2NYAA 3F61A 4EKKA 4XBRA 5C4LA 4YLLA 2WTWA 3EZRA 4QYGA 3GU7A 4TWCA 3JY0A 3SHEA 3MH0A 3VUKA 5K4JA 1XJDA 1M2QA 4I6BA 1FVVA 3R1SA 2C3IB 4PPCA 3GC9A 3EN7A 3N4VA 4YTCA 2B55A 3O0GA 3R73A 4Z9LA 5KMOA 3FZSA 3KEXA 2I0VA 2W1CA 4Y5QA 5HTCA 3TDVA 3QC9A 4PTCA 4NL0A 3Q2JA 4D2PA 4ZSAA 4ZY5A 3NUAA 4O7YA 3A7HA 1W2FA 4TYHB 2CSNA 2WTIA 4RBLA 4W4VA 2B9HA 2IF8A 1JSUA 2FGIA 4JDJA 3FJQE 4C34A 5LXMA 3FMLA 2ZMDA 5EI6A 1BL6A 4Y95A 3GU4A 5E7RA 3MB6A 3TDWA 2QLUA 3W0MA 4M7IA 4CQGA 3RPVA 3ML1A 4BCQA 3EQHA 2YERA 4G6NA 3VS5A 3TNPC 2XEZA 3E7OA 4LYNA 4BDBA 4ZTQA 3FL5A 2UZWE 4FV1A 2B54A 2E9PA 3Q52A 2VUWA 4G9RA 3BWFA 2WMQA 1H4LA 1QPEA 3Q9XA 5BQ0A 1AD5A 3MI9A 3MVLA 4KUJA 3NS9A 3FLSA 4DT9A 3RK7A 1QPCA 5JH6A 5KBRA 4O82A 4X0MA 4XNEA 4QP1A 4UN0C 1Q24A 3OWPA 1U4DA 3KRRA 3PYYA 2XP2A 3QL8A 4I21A 5FUTA 2JKKA 5AX9A 1KE7A 2H9VA 3QQJA 4BBFA 1WBVA 4BCOA 2RF9A 4F0FA 4AT3A 2FH9A 3PIYA 4WSYA 1FPUA 2OG8A 4F9CA 1GOLA 3KXHA 3N4UA 5FRIA 4RC2A 2XIYA 3BHVA 3P7AA 5DWRA 3RCDA 5D11A 4CXAA 4RWIA 2X2LA 4BKZA 3P86A 4BIDA 3VBXA 2W96B 3JS2A 3MVJA 1QCFA 3KMUA 5BVFA 3HZTA 2VTAA 2OIBA 2C6OA 4LOPA 4AN9A 1JAMA 4I6HA 3IGGA 4G6LA 2V62A 4V0GB 5DOSA 3BHTA 1A06A 1VJYA 3P78A 4GT4A 5HBHA 3PPJA 5HO8A 1PXKA 4AZTA 4CCUA 5AV2A 4D5HA 5H8EA 4BDEA 5M06A 3HV5A 3ORKA 4WD5A 1ZMUA 5CAUA 3RAWA 4D9TA 2C6IA 3ZU7A 4BY9E 2QOBA 3ZCLA 4AA5A 2BAQA 3ZO3A 3QD2B 3RINA 3RI1A 4DGLC 4IX3A 1OBGA 4Q5EA 1H25A 3TM0A 3GGFA 3UG2A 3FMJA 4RA4A 2Z7LA 1PMVA 4K9YA 4JBQA 1XWSA 3LQ8A 3F66A 2IZSA 3UIUA 3PPKA 3C4XA 3D4QA 3KK9A 3RALA 4FZDB 5JKGA 3GI3A 3CS9A 4QTCA 4IBMA 2Y4IB 5EM8A 5HTBA 4JG7A 4DF3A 2OZOA 3QTQA 2YAKA 3DU8A 3ZYAA 3O96A 5I3RA 2WMBA 3NR9A 4X2JA 2XBJA 2CKQA 4R1VA 2WNTA 5TT7A 1U54A 3PA4A 5FXRA 4CFVA 4TT7A 3F2AA 4BDKA 5A46A 5J5TA 4NWMA 4EORA 2WU7A 2C6KA 2VGOA 3RMFA 3O5AA 3HECA 3DKOA 3NYXA 5M4FA 4FIGA 3G9NA 4GEOA 1TFFA 3W0PA 4I93A 2OICA 4S31A 3V5QA 2YDKA 4A4XA 1TKIA 3QQUA 3MPAA 4FV9A 3U55A 2YACA 4F6WA 4FOBA 4J96A 4XLVA 4KWPA 1ZXEA 1GIIA 3KMWA 3PSDA 3M1SA 1M7NA 1NXKA 1YOMA 3BBWA 3QQHA 4GVJA 4IM2A 4HNFA 4KS8A 4NIFA 1CTPE 2RIOA 5I9XA 2XM9A 5L2QA 4L53A 3C50A 3EFWA 3W2CA 1G8JA 5HCXA 3O8UA 3RP9A 5JFXA 3UO4A 1Q3WA 5ANIA 4XG3A 4U40A 3NAXA 3TCPA 3UQGA 3FZPA 2HXQA 1ZLTA 5E92A 3UODA 4QD6A 3AG9A 4ZZMA 2QNJA 2WMXA 3QTRA 4HVHA 4G3DA 5FBNC 5JGDA 2B9FA 3F3TA 4AZFA 3OXTA 2VN9A 5EM5A 3MW1A 5KBQA 3UO6A 3MSSA 4XBUA 4E4XA 4LL5A 4M12A 3NX8A 3QTUA 3POZA 4F1TA 3BLAA 1UU8A 5I0BA 4S30A 2JIIA 4YJUA 2WQBA 3UMWA 5IQFA 4IFCA 1Q61A 3F3VA 4FEUA 2BHEA 5JFVA 2CKEA 1PKDA 5FXQA 3RZBA 3S00A 2CN8A 4K6ZA 4DHZA 2NPQA 4RFMA 3FHIA 4XV2A 3O2MA 5KZIA 3PA3A 4QYFA 1DAYA 4GH2A 4RIOA 4RJ7A 2JGZA 2AEGA 2OLCA 3UDSA 2CLQA 4ID7A 4DC2A 5FEEA 4KD1A 3BGPA 3H4JA 2C3KA 3O7LD 4U6RA 5DA3A 1R3CA 4PPBA 4Y46A 3CC6A 2X0GA 4G3EA 4QP8A 3GVUA 3JY9A 2X6EA 2Z7SA 4IWOA 5IG1A 2O0UA 2HK5A 4UWBA 2PMNX 3ULIA 4YMJA 4LV5A 1I44A 3HVCA 5HU9A 3EN6A 5J79A 2C5XA 2VO6A 4S34A 2XYUA 4YZCA 3ULZA 4F1OA 1LP4A 2PVJA 3CD3A 3ELJA 3AC5A 4D0WA 3PLSA 3POOA 2BAJA 4JR7A 4OW8A 5AAEA 4QMUA 3UIMA 5K4IA 3HRBA 4FNZA 2R3KA 3CPBA 5CEPA 5C8MA 2XK4A 3OY3A 4QMOA 3EH9A 2PMLX 4O2ZA 4BN1A 3KA0A 4TZRA 3BGQA 5AP1A 5HD4A 4DHFA 4PP9A 2DWBA 3KRXA 4NCTA 3VRYA 4MF0A 4FVPA 4XLIA 3WF9A 3ALOA 3PJ1A 4EOJA 4W8EA 3ZBFA 1DI9A 3WF6A 3BYUA 4AACA 1CKJA 3PJ2A 1OPKA 3P5JC 3DBEA 2X1NA 1OIUA 1RE8A 3RPSA 1WVWA 1M2RA 1OKWA 2CNUA 4I0TA 4MXXA 3ZSHA 2HZ0A 3ZUVA 3LM0A 3BHUA 4C61A 4LOOA 3IOKA 3OOMA 3QKLA 4F7NA 2ZM4A 4C3RA 2CCIA 1NY3A 2J51A 2ZJWA 1SNXA 3FLWA 3KN6A 3PP0A 2UUEA 3RNIA 3TKHA 5I5ZA 4K77A 4HYUA 4FV3A 5LCJA 2JKOA 3Q5ZA 4EYMA 5EH0A 3OMVA 3GBZA 1R1WA 2WB8A 3A4OX 4BIBA 4CFNA 3FUPA 3NW6A 1LEWA 5HEZA 4GU6A 4NSTA 4R3RA 4ANMA 3DPKA 4GFGA 3GCSA 5CSPA 3HUCA 4R8QA 2XNBA 3W2RA 1JVPP 5TR6A 4YNEA 3NVKI 3MA6A 4D58A 3MBLA 3RK5A 3ZXZA 1UU3A 4H58A 3L9LA 5EYMA 3L9PA 3LCDA 3PIZA 2YM5A 4TYGA 5CU6A 5JMSA 5CVHA 1CMKE 3ENMA 4IVAA 4LGGA 4N6ZA 2QC6A 1QL6A 4KSQA 2WHBA 1FGKA 4NFNA 4UMTA 4UY9A 4YTHA 4E5WA 4EC8A 5CALA 5IQIA 3AGLA 2XNOA 4FTAA 5L8JA 2HZ4A 4MBIA 1JOWB 4EC9A 5ICPA 4OGRA 3CBLA 5K5XA 3RPOA 4WNPA 4L01A 2YEXA 3W2QA 4O7WA 3A8XA 3V6SA 5M55A 5LJJA 5DNRA 4AGUA 4AWIA 2ONLA 3VQUA 4BFMA 4QMQA 1IAHA 3AT3A 1P4OA 3IW8A 3DJ7A 3TJDA 4XG4A 3Q4UA 1W2DA 2O3PA 2X2MA 2IW9A 4F9YA 3HV7A 1CKIA 3KRLA 1JKLA 3QKMA 2JDRA 2PHKA 3OEZA 1XH5A 3DZOA 4I0SA 2JD5A 4WUNA 5FEDA 3RK9A 4EHZA 3LXPA 3TXOA 4F63A 4Y73A 4E6AA 2X7GA 4O38A 2P2IA 2ZV7A 1VYZA 5K0KA 3UBDA 3ORNA 1JNKA 5ACKA 2IW8A 3MB7A 3R8ZA 5C26A 3QX2A 3B8RA 3QZGA 3EYHA 4FF8A 3EN9A 1G5SA 4L9IA 3QUEA 2XZSA 1W0XC 3EFLA 4FC0A 3U54A 4KBAA 5FTQA 2CHLA 2JIUA 4CFWA 5E8YA 2BFYA 4ZTSA 1Q99A 4V05A 3FL4A 4M15A 2XNGA 3MPMA 3AD5A 3JVRA 4IWPA 3CKXA 5EFQA 3W2PA 3SXSA 4OTDA 4L3JA 3TMOA 3LHJA 3O7LB 4WNMA 2JAMA 5CSHA 4AW1A 1Q41A 3FI3A 3LXLA 2X0PA 4U44A 2X81A 3UO5A 3TJCA 4WG3A 2WQEA 1KV1A 1GIJA 4ONAA 5T3QA 4GMYA 3JVSA 3VUTA 4GIHA 4GYGA 5CU4A 4F7LA 4M69A 2XNNA 4IX6A 4AG8A 4X3FA 5B2MA 4ZZOA 3I79A 3NCGA 3AMBA 3VS2A 2W1GA 3P7CA 1W83A 3ZM9A 2BZKB 2VTLA 3ZSIA 3CXWA 4FKIA 3SD0A 3D83A 4FG9A 3AMAA 4N6YA 4DH5A 2PTKA 4JX3A 2X4ZA 4IACA 4FE2A 4FV0A 4DH1A 3R1NA 4O7SA 1OPJA 3AD6A 3Q5IA 4O0VA 1PXOA 5G1XA 3FKNA 3T3UA 2WEVA 2BMCA 4BDAA 4IB5A 3WZDA 4FT9A 5CT7A 4FKGA 4FKLA 2YAAA 2OJGA 4RZVA 3GB2A 3Q60A 4MXYA 2PE1A 4C37A 1Q62A 1YWNA 4G3CA 4RVLA 3HX4A 2GQSA 1OKZA 4RC3A 3I81A 3PRIA 2XIXA 3H30A 2C0IA 3H10A 2VTIA 2HW6A 2H6DA 1NVSA 4MVFA 5HCYA 5AUVA 4XP0A 5HLPA 3KXMA 3V51A 4AAAA 2VWYA 4MH7A 4BF2A 4BWKA 4O4BB 4JMQA 2X39A 2XBAA 4MNEA 1PXIA 3TYKA 1STCE 4PV0A 4TNBA 1E9HA 4K11A 3VONA 3HMPA 2BTRA 5L6PA 4EOMA 1VEBA 4FUYA 3OG7A 4BCNA 4ASDA 2CMWA 3W0NA 3PZEA 3QQGA 3E8CA 4PNKA 2YIYA 3OTVA 4YZ9A 5K9IA 4C4HA 3F2NA 1ZAOA 3KC3A 5LMKA 1KUTA 3QA0A 2RFEA 3R04A 3CSVA 2R0UA 2C69A 2X8IA 1CSNA 4J52A 5EQPA 4H3BA 3CTHA 4WRGA 3ZO1A 1M2PA 2R3IA 5JEBA 4GRBA 3O8PA 4ERWA 3IDBA 3FC1X 3LJ1A 3VBVA 3LFDA 4JRVA 3DCVA 2VO3A 2YHVA 1R0PA 2UZDA 3OF0A 4BCMA 5J7HA 2G01A 5L2WA 3Q2MA 2YFXA 3ORZA 4XG6A 4FA2A 3G51A 2FA2A 2GMXA 2JDTA 3QA8A 3LKMA 1YDSE 4G2FA 4Q9SA 3ZMMA 3REPA 2OKRA 5E8VA 4AA0A 2OO8X 4M84A 3VJNA 4I6QA 4WSQA 4WT6A 3NMUF 1AQ1A 4C3PA 4FKSA 1BX6A 5CI6A 4CFUA 4BL1A 2GU8A 4F09A 2CKOA 1NVQA 4BDJA 4J7BA 3KN5A 3QF9A 1H1SA 3QHRA 2BIKB 3QBNA 5CZHA 2X8DA 3CQWA 1FMOE 3DQWA 3FKOA 3JXWA 2DQ7X 1TZDA 3EHAA 1S9JA 4F9BA 2BRBA 2G9XA 5CSXA 2C68A 2HY81 4RX7A 4NCTC 3ZEPA 2O8YA 2OIDA 3LM5A 4UALA 4CG9A 2XJ1A 1MRUA 3DTWA 4U81A 1YI6A 2KULA 3NW7A 1W8CA 2NO3A 5DN3A 2PZRA 1M17A 5BVOA 5C8KA 1YI4A 1EH4A 2HWPA 5FTOA 4CVAA 3LZBA 4I6FA 3K5UA 3E87A 4CYIA 3Q9WA 3CCNA 2CJMA 5CVGA 4E3CA 2WIHA 3SKCA 4CMUA 1GAGA 2C30A 3U6JA 4FV8A 4L7SA 1UKHA 4HYHA 5JSMA 5HE1A 2EWAA 3HMOA 2ERKA 3CIKA 3ZRKA 4FNXA 4JL9A 5L6OA 4FKVA 2V7AA 2WMTA 2VX1A 2XF0A 3D2KA 4HPTE 2UVZA 4LG4A 4MNFA 3ZDUA 3HP2A 4NM5A 4AGCA 1YQJA 5DH3A 3LFAA 4IB1A 3DXQA 5M09A 1VZOA 3RWQA 4FZFB 4EUTA 3LVPA 4EJ7A 2R3GA 3MVMA 4FT0A 4CKRA 4O2PA 4QQTA 3VBYA 4CEGA 3QWJA 4CQEA 4O7RA 5HE2A 5IQDA 3AT2A 5LVPA 2F9GA 1B6CB 2W1EA 4FVQA 2R7BA 4JAJA 2WIPA 2BDFA 3C9WA 3DBQA 3A60A 4FRFA 4IVCA 2HW7A 4EL9A 4LFIA 4UXQA 3D9VA 3PA5A 3RPYA 4LRJA 2RFDA 2VO7A 4C8BA 2FO0A 4IVDA 4QMZA 1IR3A 4EH2A 3PVUA 2BAKA 3ZC6A 5AADA 1BL7A 4RG0A 4FBXA 1UWHA 5DT0A 3B2TA 1XKKA 2CNQA 4DEAA 3QTSA 3WARA 4BWPA 3FHRA 3MDYA 1YXTA 1HCKA 2A19B 4Z16A 3SA0A 2PZPA 2WTCA 3MY0A 4JNWA 4EH3A 5EDQA 2ONLC 3PY0A 2R9SA 1L3RE 2WU6A 4TNDA 2OJJA 3TNHA 4EHVA 3PWDA 2OFUA 3IW6A 4CGAA 3KULB 2R3MA 3F82A 4GG7A 3MY1A 4J53A 3H0ZA 4KIKA 3RM7A 2HXLA 4RFYA 4QYEA 1XQZA 5DEWA 1Q8ZA 3EB0A 4QDEA 4HCUA 1ZMWA 4NTTA 4TRLA 5EW3A 5BUIA 4I3ZA 2AQXA 5BYZA 4FKJA 4I6LA 4DBXA 2QO2A 3BRBA 3G0EA 5J5SA 1Z5MA 5CXHA 1PMNA 3Q96A 4XG8A 4Q5HA 5DG5A 4GIIA 4BZNA 2VNWA 5DRBA 1IASA 3OT3A 3SG8A 4I5MA 4BBEA 2QR8A 1Q8YA 5CX9A 3UVRA 1SVHA 2WMUA 3R22A 4O4EA 4UB7A 3D14A 4O4DA 4FIIA 4BI2A 5B0XA 5J9ZA 3PXRA 4XS2A 5A3XA 4I41A 4FL2A 3H0YA 1UV5A 4GK4A 4B99A 5J1VA 1KWPA 4KIOA 4EKLA 4YZDA 5A4QA 2IVVA 4YTIA 1MQ4A 4OT6A 5FM3A 2OH0E 3VW8A 3WILA 2WTDA 3TUCA 3DXNA 4F65A 1JSTA 4Z7GA 2XIRA 4A4OA 4XOYA 4X3FC 5FQDC 3SRVB 4FMQA 3WE8A 4B9DA 3OUKA 4QTAA 4GJ2A 4II5A 1XBAA 3A2CA 5FEQA 3JYAA 4CZUA 2Z2WA 5KMNA 4AE9A 2KTYA 3TIYA 4EQUA 3TEIA 4QDVA 4QP6A 5G6VA 3VO3A 3VS1A 4UMPA 3D7ZA 3PJCA 4YPDA 5HNGA 5BVKA 4C59A 3AC1A 3ETAA 5JGBA 1H0VA 1FMKA 2F2CB 2HWOA 2WMVA 4FSTA 4M67A 5CS6A 4K8AA 4GV1A 3ORXA 3LLAA 4NFMA 2PULA 3VS4A 3QUDA 2X0QA 2R4BA 3KL8A 5FLFA 4D0XA 3G6GA 3TZ8A 3MFSA 1XH9A 3IW4A 5AUYA 1XH4A 5KMKA 5KKRB 4J8MA 3BYSA 4FG7A 4TYHA 5HTIA 3D5WA 3E3PA 4DFNA 4KIKB 2PYWA 5HVYA 4BB4A 4YC6A 2ETKA 4TYIA 4ZSJA 1IA9A 4UYAA 1NW1A 2OF2A 5DR9A 3BZ3A 4QPMA 2W99B 3NNUA 4C57A 3ZZWA 4QP3A 2R3JA 3KF7A 4QMLA 4E26A 3HYHA 5EOLA 4W8DA 3S4QA 5CSVA 5C9CA 4FV4A 2QOOA 3E7VA 2C6EA 5CEOA 3HLLA 4U0IA 2JC6A 3MFTA 4YJRA 5LMKC 5KX8A 2XIZA 3DQXA 4IQ6A 3SV0A 2PVMA 4RJ5A 5I9VA 3Q9YA 1W82A 2V7OA 4ASEA 4CKJA 5AAFA 4GUEA 4HVSA 3R8LA 1ZARA 2ACXA 3E93A 1RJBA 1V0OA 4GK2A 4RSSA 5EDRA 3UDZA 3LJ2A 2YN8A 2E9NA 3P08A 1U5QA 4NM3A 4KKEA 3QGWA 4WOVA 2PVRA 5IA5A 5EKNA 4RGJA 4H05A 4F9AA 5AUZA 3VBWA 4QNYA