3FMLA

P38 kinase crystal structure in complex with ro6224
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
349
structure length
342
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title P38 kinase crystal structure in complex with RO6224
rcsb
molecule keywords Mitogen-activated protein kinase 14
molecule tags Signaling protein, transferase
source organism Homo sapiens
total genus 108
structure length 342
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fmlA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fmlA01
1W0XC 3H3CA 3Q3BA 4IB1A 5HCZA 4HVDA 4M69B 3WZUA 3EFJA 4O0WA 2GSFA 4CG9A 4OTHA 3RK7A 4FNZA 4XNEA 3DKCA 4D9UA 5CAVA 5IUIA 2W1DA 1H4LA 4BTMA 3DOGA 2XK3A 4Q5EA 4U44A 4PMSA 2IPXA 3FLWA 4G3EA 1UA2A 3KA0A 3SXRA 5FRIA 3ORKA 3B2WA 2NPQA 2XYUA 5CY3A 5I9UA 4YJVA 1SVEA 4TWOA 4GYGA 5CASA 4LI5A 4ZSGA 5EQPA 5EKOA 4MVFA 4LM5A 2WTVA 3COMA 3HA6A 3RAHA 3AOXA 5AUYA 2B53A 4YHJA 4CQGA 2F2CB 3R7IA 3ZLSA 3HV7A 5FXSA 2A1AB 1HCKA 4QTDA 2O63A 4BCNA 3OTVA 4CFUA 2WTWA 4QP8A 2ZYBA 3VBVA 2B9JA 1KOBA 2GU8A 3ZDIA 4HYIA 3IW6A 4D0WA 2ONLA 2C4GA 2O2UA 2JKKA 4O21A 4PQNA 2HOGA 4QTBA 3I60A 3FYKX 4FL1A 1CSNA 2R0IA 5DIAA 3MVMA 4DGLC 2YCSA 2BRHA 3MFTA 2C1AA 3O7LB 4O6EA 1H0WA 4RJ6A 4YTHA 4OLIA 3UG2A 3WILA 4DLJA 3CSVA 3CXWA 1YXXA 4GG5A 3MVHA 5I9XA 4JAIA 1PHKA 4YP8A 4MQ1A 3F61A 4IDVA 5CU6A 4PDPA 3KXMA 4LUDA 2J51A 3TNPC 4PUZA 4APPA 4O7NA 2LGCA 4C58A 3ELJA 4RG0A 2XH5A 3RGFA 2GNHA 4U97A 4OAVB 3PUPA 4GKIA 4AT5A 4PX6A 1G5SA 5HNBA 3AC5A 3PIXA 1A06A 5D7VA 4CQEA 4BDIA 1B6CB 4FTMA 3V8TA 1FQ1B 4NK9A 2XIZA 3DCVA 4R6VA 2Y4PA 1JOWB 5FQDC 4QTCA 2V7AA 3ZRLA 1GOLA 1H07A 4WG4A 3BLRA 5CSHA 4RFYA 3DB6A 3HAVA 3HP2A 4EOQA 4AZVA 4FSTA 5DPVA 5E90A 4AXAA 5K9IA 2F57A 4DG2E 4HPUE 3QZGA 1B39A 3GU6A 2B55A 2BMCA 1XR1A 5A6OA 4IB0A 3TNHA 3CQWA 3LFDA 4EYMA 5IQBA 4KWPA 4A4LA 4NW5A 3TJCA 5KUPA 2WMVA 2BCJA 2WQEA 2UW9A 3Q6WA 5E8YA 4AU8A 4HCVA 4C4IA 4Y8DA 1OKVA 3UZPA 2PUIA 1T46A 3MH3A 3GU5A 2E9NA 4LGHA 3Q52A 5ITAA 4ZEGA 4F64A 4S32A 3QD2B 3AC2A 2W99B 3I81A 4UBAA 3ZH8A 4FOBA 3WZJA 4IM2A 3PXZA 3OY3A 5K4JA 3A8WA 1ERKA 3G5DA 2IVSA 2VNYA 1JSVA 2BALA 5EQEA 5J9LA 4GU6A 4CFVA 2ZM1A 2XNOA 4FUXA 3OWJA 4HCTA 4JX3A 3PXRA 4RWJA 5CT0A 3RHKA 1YXSA 2XIKA 3MDYA 1YOMA 1V0BA 5BQ0A 3DK6A 3MFUA 4WNPA 3QLFA 4ZZOA 3KQ7A 1PKGA 4ZAUA 5L2SA 3OHTA 4PRJA 4R3RA 5GJDA 5BVOA 1WBOA 4DEDA 1JKKA 4FIHA 1QPDA 3HA8A 3OW3A 2XEYA 1RQQA 2OKRA 3BLHA 4MXZA 2YFXA 2JFMA 3LXLA 4FK6A 4QMYA 4X2NA 5J9YA 4DLIA 4F1OA 3M11A 2VWXA 4U8ZA 2GPHA 3QKLA 3R1QA 4HNFA 5LOHA 2C68A 3PVGA 3NUYA 3IG7A 3RZFA 3UE4A 4EH2A 4U43A 3FLZA 3ZZWA 2C3JA 3D5VA 1OL6A 3NUNA 4L3LA 2HK5A 5AV4A 4CKJA 3ZO4A 4TKSA 4ANLA 4A4XA 4BWPA 5TF9A 4E8AA 2UW7A 4IMYA 3QZIA 3V3VA 3NAYA 2P55A 1OI9A 4RGJA 4OBPA 4F9CA 3W32A 3CR0A 4S34A 3PXFA 3MI9A 4UWCA 3BLQA 3TXOA 4HW7A 5IA2A 1NVSA 3SW7A 1H0VA 5ANEA 2FO0A 4QMTA 2VGOA 4S30A 3ENHA 3ZM4A 3HV4A 4AW1A 4O0VA 4KSQA 4WBBB 5FP5A 1PW2A 3FC2A 3E93A 5AADA 4TYHA 3E87A 4HVHA 3KRWA 5BMSA 4MWIA 2KULA 5HG8A 3ORLA 2X1NA 2J9MA 2YISA 3V04A 2Y0AA 3MWUA 3O8PA 2W4KA 3P23A 5H8EA 3UOLA 5DOSA 4GUBA 4A07A 3QTIA 3ZUVA 1NVQA 4AGCA 3PVBA 4NM7A 4EJNA 1DI8A 3GQLA 3MN3A 4GK4A 2R3MA 4WNKA 4C3FA 5E7RA 4TZRA 5IA3A 2V5QA 4QMSA 4TYEA 2G2FA 4GK2A 3HECA 3S4QA 4K2RA 4QYGA 3S95A 3AMBA 3Q5ZA 2KTYA 4IFGA 2P4IA 4WT6A 5LJJA 1P4FA 4FTTA 2IJMA 3C0GA 2QLUA 4JQEA 3H9OA 3IECA 2W4JA 3KC3A 4A9RA 3K2LA 3F9NA 3K5UA 2V62A 3EMGA 3D5XA 4MNFA 5GZ8A 4ASEA 3HP5A 2OW3A 1IA9A 4EHVA 3EFLA 4A9UA 2WTCA 4GVJA 3L8VA 2UZOA 3P79A 3D2KA 2A27A 1G3NA 3PJ2A 5DT3A 4B7TA 4EK6A 4FNXA 4LGDA 3CKXA 2CN5A 3PVUA 3LIJA 1JKLA 1VJYA 3TL8A 5IISA 2YM4A 4F9YA 4PDSA 4ASZA 4MF0A 4MD8E 4WRGA 3T9TA 4D58A 3DTCA 2HENA 4IAKA 4CT2A 3GEQA 4OR5A 3UJGA 4BN1A 5DE2A 5E1EA 3ZRMA 1Q8ZA 3FZRA 3LFCA 3OY1A 4F9WA 4XLVA 3CPBA 2JLDA 3F3UA 3ZCLA 4D5KA 2ONLC 2FSMX 3FI8A 4R1VA 5IQDA 5HE0A 3PIZA 4E93A 4V01A 1KV2A 2GFSA 4LG4A 4DGMA 3SC1A 3EQPA 2UVZA 2QOQA 3LCDA 3VQHA 4BBMA 3R7GA 3I1AA 3R6XA 4YC3A 4JDKA 2GDOA 4AOTA 1WBPA 4YC6A 3UQCA 4DFBA 4X3JA 1ZY4A 1H1QA 3DGKA 4KSPA 2IO6A 5KZIA 1YDTE 2Z8CA 4AW5A 4F63A 5KMIA 5L6PA 1H28A 5HLNA 3MVJA 3LM0A 3ZU7A 2XS0A 4FZAB 1PMVA 5AUVA 2WAJA 3GFWA 4ZTLA 2CGVA 2V55A 4H39A 4AA4A 3TKUA 4OTRA 3SXFA 5KCVA 3C5IA 3NRMA 1ZMWA 4LRKA 1H26A 3IGGA 2QHMA 4FIIA 4X21A 2ITTA 2X39A 3BZ3A 4JXFA 3VNTA 4EL9A 2X7GA 5HX6A 4H05A 1YHWA 2H9VA 3LAUA 3QTUA 4KIOA 1T45A 3G6HA 4U9AA 3TDVA 2VO7A 5DNRA 1WFCA 2W06A 3E3PA 2R5TA 2P33A 3DQXA 4EHGA 2W17A 3HYHA 2J0KA 5EK7A 2BROA 3D7TA 2GNGA 3IO7A 4L8MA 4RC2A 2PK9A 3R04A 3QCSA 3FDNA 3ZEPA 1NA7A 4TNBA 4L7FA 3R8LA 2PVJA 2CJMA 3E63A 4I5HA 4L46A 1OKZA 4EOSA 2I7QA 2UZBA 3R7VA 4M69A 2VTIA 4MXCA 4XP3A 4QNAA 1YW2A 2WMSA 3OBGA 2R3RA 3PE1A 3NNXA 4UV0A 4L9IA 2HIWA 4MBIA 4C38A 3Q4TA 3R9RA 3V01A 3PRFA 3MYGA 3F3VA 1VYWA 3QALE 4TW9A 3BRBA 4NUSA 3LFSA 5LCKA 3NNVA 4JJRA 2Y4IB 3KRXA 4NM0A 2BFYA 4FOCA 1STCE 4Z3VA 3UPZA 3FI4A 2WFYA 4YURA 2ZV7A 1UNGA 4FKJA 4BGGA 4YTCA 2FYSA 2W7XA 4R3PA 5BYYA 4XOYA 1LP4A 1YXUA 4I22A 3RP9A 2BKZA 5AR4A 4OTFA 3FLSA 2C6LA 5J7BA 2WTKC 3GB2A 5HE3A 3M2WA 5CYIA 5A46A 2C0TA 4I94A 5DR6A 2X6DA 3FQEA 4UMQA 2GS7A 3NVKI 4Z7HA 4AZSA 4ERWA 2BDWA 3U6JA 3GVUA 3FKLA 3EQIA 5HORA 3K3JA 2XBJA 2ETKA 2W1FA 4C34A 2OJIA 2UW5A 4GFOA 2JDTA 3FMEA 3NW5A 1CKIA 4ZY4A 3PYYA 4N70A 4AZWA 1UNLA 4FZ7A 4H1JA 4PPBA 5FBNC 4I6BA 3BX5A 3OROA 3NS9A 3OXZA 5K3YA 2VWBA 4ZY6A 5CEIA 4XV1A 4YJPA 4HCUA 5LMAA 4BTFA 4F09A 1FINA 3EJ1A 5B2MA 3A8XA 1Y8GA 4XG2A 4CRSA 3MH1A 1VZOA 4EH9A 4QMQA 4ACCA 4AW2A 2E9UA 3KN6A 2ZDUA 1QCFA 4IB5A 4W4XA 4YSMA 5CNNA 5FWKK 3VUGA 4QQCA 3VBQA 3DY7A 3GCPA 3R02A 4Y46A 2QOFA 5JRSA 2PMLX 2XJ2A 4BVUA 4DTKA 3UOHA 4EBVA 3BPRA 4CV8A 3COHA 4DCAA 1OIYA 4RVTA 3GNIB 3NAXA 2HZIA 2ITXA 4D4YA 3KVWA 3IW7A 2C6MA 1M7QA 2NP8A 4KKEA 2F2UA 3HLLA 2IZUA 2C1BA 3UODA 4K18A 1R0EA 1YWNA 2SRCA 4GS6A 5ETAA 2C5YA 4NTSA 4EHZA 3FJQE 2ZOQA 4JLCA 4DF3A 2XP2A 4OTWA 3FMKA 4WUAA 4NFMA 4IZ5A 4M13A 2CGXA 2PUUA 2UUEA 3DT1A 2VX1A 3MGYA 3FMLA 3UVQA 1YWRA 4RBLA 3P7BA 4DG0E 1MQ4A 2R3LA 5K0KA 5J5SA 1U4DA 4GW8A 3MJ2A 5E8TA 3C0HA 3DZQA 4XX9A 5IH6A 4DFXE 3MFSA 3T3VA 3OT8A 3OC1A 4KBCA 4NFNA 5DRDA 3LMHA 2W5BA 3R01A 5CLPA 5GJGA 5JGAA 1A9UA 2XK9A 1GJOA 3FZTA 1TQMA 3HMOA 4O0YA 4ZZNA 5AR5A 4CG8A 3QA8A 4LYNA 2BTSA 4FKUA 4JBPA 3W8LA 5A4QA 3VUTA 2W05A 3II5A 5FEDA 4GUEA 2VO3A 3FMNA 5AUXA 4WSQA 4H58A 5AV1A 5KMOA 4FTJA 5M53A 3RHXA 2OXDA 3DXPA 1OUYA 2Y6MA 4EQCA 3PRIA 4BICA 4OW8A 4CMOA 5A54A 1K2PA 5IMXA 4UX9A 5DR2A 2PVHA 4RLKA 3BE2A 4O81A 3DJ6A 3Q9YA 4FYOA 1ZZLA 2G15A 4K77A 2PVKA 2JDSA 5EI2A 5GZAA 1R3CA 2C0OA 3F5UA 3LFNA 4F0FA 3PPZA 4O0SA 2PY3A 2VTHA 4Z16A 1ZRZA 4BY9E 2JBOA 3BELA 3FWQA 1IASA 3P5KA 4M3QA 4CGAA 3P7AA 3UO4A 2EUFB 2FSOX 3H9FA 3QTQA 5CF6A 4ZK5A 4LV5A 3QUEA 3SXSA 1G8SA 3V5TA 4JS8A 4UZDA 5IG1A 4JAJA 4X2JA 4HGLA 5K4IA 4DE4A 3R28A 4G9RA 4O0XA 4V0GB 3UQGA 4UN0C 4NW6A 2VO6A 3A7GA 2XB7A 3BYSA 1PXPA 3MTLA 3QA0A 4HOKA 5EHOA 3TV4A 4AN2A 5EDPA 5H9BA 3FHIA 2WZJA 4BCHA 2QONA 4FKQA 4D5HA 2B9IA 3OFMA 4BYJA 4D9TA 4EH6A 4CTCA 5LVNA 2XIYA 3D94A 3HUBA 4A9TA 4AACA 4KRDA 4IW0A 4M8TA 4BDJA 2BRMA 4FT5A 3I6WA 4ZLOA 5BX0A 3A7JA 1ZXEA 4M67A 2YM3A 4QP7A 3R8PA 1HOWA 4GVAA 2PTKA 1PMUA 3EQGA 4JDHA 2ZDTA 4CKRA 4EK3A 1V1KA 3JXWA 4XS2A 4IZAA 5M56A 4X0MA 4NT4A 3VO3A 3ZRKA 2QR7A 3GUBA 5HTIA 2GQRA 5DFPA 2B9FA 1G8AA 3CPCA 4UY9A 5G1XA 4BTJA 3OUNB 3QCXA 2C6DA 3PTGA 5KHXA 4FMQA 1WBTA 2YIRA 4FT7A 4F4PA 2J0JA 4NIFA 3BYMA 4FKTA 3RWQA 1XH5A 4ARKA 4RFMA 4U42A 5JSMA 2CGWA 4L00A 5FDPA 5J1VA 3SDJA 1PXNA 4FV4A 4I6HA 5HCXA 5AR7A 3N4TA 3TM0A 3GU8A 3I5ZA 2FSTX 4ZTRA 5J87A 4EUUA 3UTOA 2YWVA 2P3GX 2QOKA 4EOOA 5HD4A 5HU3A 3O23A 1WMKA 4JX7A 4W4YA 4D0XA 3CBLA 5CAUA 3KMUA 4XG4A 3DNDA 3GU7A 2JFLA 3RINA 2OF4A 3UNZA 4FKRA 2PVLA 4AT4A 3ULZA 4D55A 3EYGA 4RJ4A 3LQ5A 5CTPA 4G5PA 5EI6A 4QTAA 3V51A 2QI8A 4NCTA 3KF4A 3UQFA 4ONAA 4U80A 3IW5A 2CCIA 4W8DA 3WI6A 3P0MA 5TO8A 5CU4A 3FY0A 5BYLA 2E2BA 4MXYA 1Z9XA 5IKWA 2YLEA 4RIYA 4WOVA 4YMJA 2YM8A 2F9GA 2CGUA 2YAAA 4LV8A 4QP4A 5CU3A 4R5SA 3K54A 4QMXA 5AV2A 3OP5A 1KE6A 5D10A 3MIYA 2C69A 3ACJA 1LUFA 3ALNA 4P5QA 5FD2A 3ZUTA 5E1SA 4FV9A 3FAAA 1VEBA 2YAKA 3B2TA 3EN7A 2X2MA 2WKMA 3FPMA 5ANGA 1J1BA 1VR2A 4IAFA 4RA5A 3WOWA 5EYDA 4IFCA 2H34A 3AC3A 2X8DA 2VTTA 3NNUA 3I5NA 1OKYA 3LJ1A 2J0LA 3PPJA 4K8AA 5CSWA 2QOBA 2H96A 3VS5A 4ANMA 2P2IA 3GBZA 3PZEA 3QD3A 5I0BA 5GJFA 4V05A 3MA3A 4FSRA 5F95A 4DYMA 4QMUA 3ID6C 5FEQA 3LW0A 3MBLA 3PPKA 4BC6A 2W9FB 4D2PA 4I93A 2OICA 2OWBA 1OPLA 3HKOA 4QMOA 2ITNA 2O5KA 3ZLYA 4FA2A 4MXOA 3D5WA 1ZARA 2PZ5A 2R7BA 2PE2A 1WBWA 5L4QA 2Y7JA 5EDRA 3DZOA 3QF9A 1BI7A 3F3TA 4FKVA 4NJ3A 4NJDA 4UYNA 4LMUA 3TZ7A 3RM6A 2X9EA 2JAVA 3UP7A 4CYIA 2PYWA 2C47A 5H8GA 3NNWA 5DT0A 3R21A 2YDJA 3WE8A 1GY3A 1OIRA 4X6RA 4I5MA 3I6UA 2HYYA 2RFDA 3CEKA 2WQBA 1AD5A 4GJ3A 5AP0A 1LEZA 5EW3A 3DDPA 2PZRA 1MRYA 4FKPA 2IG7A 2GHMA 3D2IA 3PLSA 2UZVA 2WMXA 5EOLA 3QYWA 3O17A 3VULA 4W4WA 4DFYA 1OL7A 1OPKA 3BWJA 4HZRA 3R1NA 1PXJA 4IEBA 5HNGA 3AD4A 1XWSA 2WQNA 3ZO2A 1TQIA 4EORA 4FTCA 4K33A 2O64A 4QQTA 3A62A 5CWZA 2XJ0A 5IDPA 4U0IA 4FTQA 3VW6A 1OIUA 3PA3A 3RAKA 1R0PA 1JSUA 2QC6A 4FTOA 5C9CA 2NNWB 3NGAA 2O0UA 4ZTHA 4PDOA 4EC8A 5GHVA 4UMRA 4OBQA 3PY0A 3COIA 5A4TA 3GGFA 3W1FA 3GCSA 5AX9A 5HX8A 2A4LA 4TTHB 2QOIA 4FSUA 2RGPA 4I21A 3WE4A 3TV7A 3R0TA 4IZYA 3R1YA 4IJ9A 3QRUA 4RC3A 4AGUA 5IQEA 3ZO1A 1ZMUA 3AXWA 3QLGA 4ZTNA 4J53A 4O38A 1Y57A 4MTAA 3RM7A 1XBCA 3MY1A 3CQUA 4QT1A 4B6LA 4F7LA 5AA9A 5EM8A 4E6QA 3KY2A 1M17A 3VS7A 3KXGA 4RX7A 2VTNA 3C9WA 4Y5HA 2E9VA 2XK4A 4ZIMA 4AP7A 4EH8A 2B54A 1Q8TA 3OG7A 2DUVA 5IQFA 5EQYA 4IHPA 2B52A 4UMPA 4AE9A 4ZY5A 3FYJX 3ENMA 2CKEA 4YHTA 4PTGA 4B9DA 2EB2A 1LEWA 2PUNA 2XK7A 3UC3A 2R4BA 1J7LA 3HUCA 4J8NA 3UGCA 2ITQA 3AD5A 2WIHA 3VBWA 1GNGA 1YRPA 3F82A 3QQLA 2OF2A 4KBAA 1B38A 3VS0A 5H8BA 3HDNA 4RA4A 4CVAA 5M4FA 2WNTA 3REPA 2C5OA 2WQMA 2PMNX 4Y72A 4FTKA 4YGAA 3PLAE 2AUHA 4KIKB 3N9XA 4USDA 3O71A 2IW6A 3ORNA 3IGOA 3FPQA 3RPVA 2I1MA 3OEFX 4FX3A 2IWIA 2BTRA 3KK8A 4NZWB 4I24A 5HKMA 3P86A 4HGEA 5HIEA 3MPMA 2VWIA 4BIDA 4Y95A 4G6OA 1LR4A 1W8CA 1Q97A 1JKTA 2BIYA 2F7ZE 3KKVA 3NLBA 4FNYA 2UZTA 2HW7A 3F2AA 4X3FB 3W2SA 2PSQA 3QL8A 4FUYA 4J97A 1WVYA 3I7CA 4WHZA 4XH6A 5CVGA 4RWIA 4YZMA 3TTJA 4O0TA 3RALA 4BHNA 2JGZA 4GG7A 3OEZA 3QTRA 2PULA 2XZSA 3R8UA 4AA0A 3R8MA 2ZV8A 3B8RA 3IDPA 5HZNA 3GP0A 4IADA 3A99A 5F4NA 3ROCA 4UMUA 5EYKA 3QQJA 1ZOGA 2YM6A 1UU7A 5CF5A 1WBVA 2PE0A 2RFEA 1YXVA 3QD0A 2ZB1A 3VHEA 3GC7A 4KS7A 1Q41A 4R7BA 2CNQA 1SNXA 3WIGA 1GZNA 2G01A 3KRJA 4Q9SA 4BYIA 1RW8A 3UIUA 3UYSA 3DKGA 3ZM9A 4PDYA 3ZSGA 5DEWA 4BF2A 4IWDA 2CNUA 3PFQA 4QMLA 4ZXTA 3G33A 3VQUA 3ZXZA 3EN9A 4QYHA 4CCBA 4E6AA 5KHWA 5L3AA 2P0CA 3EQFA 3DU8A 2ERZE 4OTQA 3E8DA 4NCTC 4MNEA 4EEVA 1NW1A 1O6YA 1U54B 4J52A 4K6ZA 1ZYLA 4GT3A 4G3DA 1WBSA 4ANNA 4IXPA 5HG9A 4M84A 1IAJA 5HLWA 4B8MA 4C3RA 3HAMA 2UVYA 3QGYA 4FL2A 2EVAA 4B4LA 5AUTA 1P2AA 4FIFA 5C8KA 4BDBA 1MRUA 3ZSIA 3R83A 4ORKA 4M97A 4NEUA 4RQKA 2F4JA 2XYNA 3CTHA 4CLIA 5M57A 2B9HA 4QP1A 4QO9A 1Q24A 5AP1A 4E1ZA 2R3FA 1H08A 2VWYA 3FBVA 3UP2A 2XBAA 4S31A 3ORXA 3WZEA 2WO6A 2OJ9A 4F0IA 2QKRA 4PL3A 2YZAA 1Z57A 4CFNA 5JZJA 2JIVA 2WMAA 3AT3A 4RX5A 3FQSA 4NM5A 3RPRA 5GINE 2HAKA 2OJGA 4CMTA 5BVFA 3NCGA 3A2CA 3FY2A 5HE2A 4CTBA 2YJSA 3E62A 5DVRA 2YACA 2IVVA 4E73A 5KMNA 5KKRC 5M44A 4AWIA 3PA4A 4ZJIA 2QOOA 5JN2A 4LOOA 1Q4LA 3C0IA 2YIWA 3PWDA 3GCVA 3GU4A 4FL3A 3IK3A 4PP7A 4Y73A 5DBXA 3SKCA 4BZNA 3IQ7A 4YJRA 5JK3A 2R3JA 2VAGA 3FZOA 4IX6A 4L52A 4C4HA 5I9YA 1FBNA 4IQ6A 4U41A 4U3ZA 1X8BA 3DFAA 4RIWB 2PVRA 4CXAA 3NEWA 1MQBA 3ORMA 2YERA 1UU3A 2BZHB 2XNEA 4KBKA 4X2FA 4ZP5A 1KE9A 3ATSA 2R0UA 3U4UA 5DYJA 2YCRA 1YOLA 1ZWSA 3FE3A 2WU7A 1KSWA 4RIOA 4WKQA 4G17A 1WBNA 3TKHA 4QMZA 1TKIA 3CJGA 5AFVA 4J1RA 5E8UA 2JDVA 2Z02A 4O7RA 2Z7RA 5LMBA 4BKYA 2R3KA 1MUOA 4LOPA 5AP6A 1ZOEA 2I6LA 3R22A 1CKPA 3UBDA 1XH6A 3KF7A 2QU6A 3Q4CA 5CU2A 4JIKA 3R7EA 5KMLA 4X2KA 3RTPA 3CE3A 2PZPA 5FXRA 1O6LA 3P4KA 3R7YA 3ZFMA 5KE0A 4IM3A 4M15A 3SW4A 2WB8A 3A4OX 4AZEA 3EH9A 4FC0A 4GFGA 3WYYA 5CF4A 5C4KA 3DV3A 3F5GA 3FMDA 4FG8A 4WSYA 4QYEA 1P14A 2NO3A 2YWPA 3CY2A 4PNKA 4FV8A 4EJ7A 3MTFA 4KA3A 2W96B 4FODA 5C03A 2BRGA 4YJSA 4CFMA 1K9AA 2UV2A 2VX0A 4AFJA 3TUDA 3BIZA 5LMKC 2F49A 3G6GA 4KIPA 4AT3A 4FIJA 3KULB 1JKSA 4KABA 5D7AA 5F9EA 5CSXA 1BL7A 2Q0NA 5CEQA 3MIAA 4O1PA 5A3XA 4BR3A 5H3QA 5HIDA 2Z2WA 2IZTA 1YXTA 5IEVA 1E9HA 3QTZA 1PXKA 3TG1A 3U6HA 2C3IB 2JC6A 3WARA 4WRSA 2YDKA 3H0YA 3ORZA 4ZS4A 4OTIA 3D14A 5B2LA 5HBJA 1UV5A 3AC8A 2VTJA 4UB7A 1YI3A 4NTTA 1FVRA 2PVFA 5HHWA 1SYKA 3ROYA 2BAJA 2G9XA 3C5UA 4D4RA 3LM5A 3RAWA 5KO1A 4BFMA 5IH5A 5EM7A 3SX9A 4U5JA 3WF8A 2OZAB 4I6FA 2HZNA 1M7NA 3F3ZA 4PPCA 1XH9A 2WGJA 2XMYA 3MH0A 1OIQA 4J71A 4O96A 3UMWA 4CFWA 5F94A 4ENXA 3U55A 3EFWA 4BCIA 2WU6A 3HV5A 3PWYA 4YZBA 5CAQA 3H30A 2YM7A 3M1SA 4FF8A 5DN3A 5LVLA 3LCSA 3RNIA 2PVYA 1PXLA 4LQMA 3TZMA 3R2YA 2GNFA 3AGMA 5D1JA 4BCKA 5M55A 3PA5A 1BUHA 2UVXA 4ITHA 3PY3A 4J7BA 4EKLA 5BVKA 3U54A 4BDEA 1OMWA 2XKEA 3IOPA 1FGIA 3KMMA 5JQ5A 5HIBA 4G6NA 4JBVA 3C1XA 1ZOHA 4GK3A 4Y5QA 4RPVA 4RZWA 5FGKA 3CGFA 4LL5A 5AM6A 3FI2A 4AS0A 3AC4A 4B99A 4FTAA 3I79A 4L53A 1W83A 3LFFA 3HRFA 3BCEA 3MSSA 4TWPA 3IW4A 4ALWA 4P7EA 2C30A 3ERKA 1Y8YA 3FLQA 4F9AA 3WF5A 5FG8A 3W2PA 2YN8A 4FV3A 1KV1A 4I41A 3ZUUA 3C4CA 3QRKA 1H8FA 3HRBA 3BYUA 3MY5A 2WHBA 5DI1A 3KCKA 3MFRA 4KUJA 4AX8A 3UZRA 2C0IA 2XM8A 2R2PA 3TNIA 1K3AA 4K0YA 4TXCA 3OWKA 1AGWA 4G3GA 4XP2A 3Q04A 3IW8A 3RPYA 4AF3A 3F3WA 4DH8A 1BLXA 3EOCA 5L8LA 5CF8A 2XUUA 5LMKA 2Z7LA 2BZJA 5DGZA 2FGIA 5ACBC 5FXQA 2QU5A 1FVVA 2R7IA 4BDHA 2JD5A 4KNBA 4HGTA 3NIEA 4FGRA 2J5FA 4L3PA 3E88A 1AQ1A 3MVLA 1OM1A 1TQPA 3U9CA 3S0OA 1JWHA 4ENYA 4EOKA 3SG9A 4IZ7A 2VTSA 4APCA 4XRLA 4GT5A 4LMNA 2GQGA 5J95A 3PXKA 3FKNA 4FEXA 5IQGA 4QP3A 3E3BX 4DGNA 5E9EA 2RSVA 3CD8A 3IONA 5KMMA 4QYYA 4XP0A 4CYJA 3H9RA 3G15A 2C3LA 4IWPA 1M52A 4FTUA 5FTOA 4L43A 5M4IA 1ZYDA 2QLQA 1KOAA 4E6CA 3LVPA 3QRJA 5K5NA 3I0OA 3JUHA 5KMJA 5L2WA 1YDRE 2OH4A 2WEIA 3WF7A 5EDQA 1IRKA 5D41A 4EI4A 4Z55A 3KMWA 5CSPA 5HLPA 3QQHA 4L42A 4FT3A 4QPMA 2RIOA 2IW8A 2VN9A 4FZFB 4L6QA 2OH0E 5BNJA 4XV2A 4RJ3A 1SZMA 2A2AA 3LCTA 4L67A 4TPTA 4ACHA 1DAWA 2J0IA 3NW7A 4YJUA 3PJ1A 4BCOA 3TKIA 4ZTMA 2VV9A 4R7IA 4H3QA 2YABA 1Y6AA 3OCTA 1OPJA 3O7LD 4XG3A 4UZHA 4Q9ZA 5AR3A 3C4XA 5HD7A 3MPTA 2BIKB 4D28A 5LWNA 5BMMA 3O0GA 3NX8A 4X7QA 3FC1X 1DAYA 4X6QC 2XNBA 2ZMDA 3WIKA 2J90A 3MW1A 2GS2A 3QQFA 3MS9A 1CKJA 4OBOA 4DT9A 2VTQA 1Q8YA 4RLLA 3CC6A 3FL5A 3LXNA 5AR8A 1H01A 2W5HA 4ACDA 4OT6A 2X8EA 3PSDA 2V22A 4RWLA 3WF6A 3IDCA 3W2QA 1CDKA 4CNHA 3AG9A 3O2MA 4JIAA 3BWFA 3VJNA 3R7UA 1Z5MA 5HI2A 1RDQE 1HCLA 3DK3A 4I20A 4QMNA 4I3ZA 5M06A 1F5QA 1UKHA 2C6EA 4O2PA 4CFXA 2WOTA 4UMTA 4YR8A 5IU2A 5CNOA 3QGWA 3CTQA 5K0XA 1OBDA 4NKAA 2PMIA 3VC4A 3OW4A 3NZ0A 4C02A 2WMBA 2ACXA 4EBWA 4M66A 3QXOA 1OKWA 5LVMA 4F7JA 4G34A 3IS5A 4N6YA 2GHGA 3GT8A 1WZYA 2JKOA 1UKIA 3QTXA 4D4VA 2CSNA 4WNOA 4F1MA 2CDZA 4IX5A 4AAAA 3I7BA 4DN5A 1S9IA 1MRVA 3NUUA 4R5YA 5AUWA 4BKJA 4NYEA 4XG9A 1J7UA 2OXYA 3ET7A 4XV9A 4FE2A 3SV0A 4MX9A 3VRYA 3PSCA 3RI1A 3PG3A 3ZLWA 5DHJA 4EOPA 3ITZA 3OVVA 3KK9A 1J1CA 3DTWA 4JI9A 4E3CA 5A9UA 4CCUA 3OZ6A 2WTIA 3R71A 2G2IA 4XRJA 3U51A 2YDIA 4F6WA 3CP9A 4GU9A 1E1VA 2UW6A 2ZV9A 2DQ7X 3DKOA 2CKOA 3KXNA 3LMIA 2PWLA 5FTQA 1YHSA 3FV8A 1IA8A 4BDDA 3N51A 3QD4A 1V0PA 3VUDA 1A48A 4IBMA 3DPKA 5EHYA 3RKBA 2QCSA 3DNEA 4ZJVA 4Q2AA 4WIHA 1XH7A 2OIQA 3DBDA 3TIYA 2GTMA 5EKNA 3PG1A 2X7OA 3GQIA 2REIA 4UWBA 3LMGA 5DH3A 3KXXA 3A7FA 4JVGA 4F6UA 4TWCA 3NW6A 4DFLA 4F0GA 4MD9E 3EL8A 4MK0A 1JSTA 4C35A 3MESA 3DB8A 5CXZA 2RKUA 5ANDA 2GFCA 3LXPA 2GNLA 3NIZA 3VIDA 4O7TA 4AE6A 3V5LA 3POOA 4G3CA 5DR9A 3CJFA 3C51A 4CD0A 3TT0A 2Q83A 5JFXA 5AP3A 3R9OA 1KE7A 5EYMA 3T9IA 3SVVA 2X2KA 4I5CA 1DS5A 3FMMA 5IZFA 1GAGA 3C4ZA 3IPHA 4C62A 4GRBA 1IAHA 4XOZA 1UU8A 4WD5A 5LXMA 3UG1A 3A4PA 3LCOA 2AC3A 4UYAA 1JQHA 4TYJA 2IVUA 5TOZA 4FI1A 1DI9A 4WBOA 4QNYA 1FPUA 1MP8A 2WMUA 2R3PA 2X2LA 2QR8A 3SAYA 2X7FA 3CIKA 2YIYA 5TT7A 4FEQA 4EK5A 4DT8A 3TIZA 4EH7A 1R78A 4N0SA 4C57A 3A7IA 4EC9A 3G0FA 5EG3A 5HVJA 4AW0A 3EQCA 1Y91A 3QHRA 2OBJA 5EI8A 4GH2A 4FVPA 1QPEA 2WMWA 4OUCA 3VS1A 2IW9A 4M12A 5GNKA 4XG8A 1M2PA 1S9JA 3VWAA 4YU2A 2B7AA 1Q99A 3HMNA 5C8NA 1OGUA 4M7IA 2PL0A 2UZEA 5KBRA 2YZLA 2ZJWA 5G6VA 5HG7A 4E5AX 2PVMA 2VWVA 3IDBA 4PMPA 2XKCA 3TUBA 1L8TA 2QD9A 4IVAA 3QWKA 4YZ9A 4ANQA 3BV2A 5IEXA 4DH7A 3EIDA 2R3QA 2BVAA 2EXCX 3Q60A 4QD6A 4FTLA 5M08A 4BWXA 5B7VA 1ND4A 5C8MA 4ZSAA 1H1WA 4P2KA 1IR3A 3BGZA 2J7TA 3TWJA 5M4UA 4YNOA 4G16A 5DEYA 5EFQA 3T3UA 4CZUA 4O6LA 2BRBA 5CVFA 5L8JA 3Q2JA 3HZTA 5TE0A 1JNKA 3QWJA 4NL0A 3VUKA 4W9WA 3SG8A 4XV3A 3AT2A 3VVHA 3FHRA 4TYHB 3Q5IA 3M42A 2OIDA 2C5VA 1NVRA 2ZM3A 5L6OA 3TUCA 3DBEA 3Q4ZA 4JDJA 3DAKA 5HO7A 4JBOA 3MPAA 5IA4A 2OLCA 5JZNA 3PJCA 2R64A 4HYHA 4FIGA 4IM0A 4QMVA 1JAMA 4DITA 4R1YA 2Z60A 4WO5A 3EZVA 3RK5A 4H3PA 4ID7A 3VHKA 3NYNA 3PSBA 1Q3WA 4LRMA 4YO4A 4DFUA 3KGAA 1UWJA 2BAQA 5AIRA 5T6KA 3BI6A 5EW8A 5HTCA 2VRXA 4J96A 5LWMA 3NMUF 3S3IA 3A61A 3O96A 3EWHA 4XG7A 3UC4A 4DEIA 3Q9ZA 3OCGA 1U46A 3ZTXA 3ZOSA 2QURA 5AAFA 1NT2A 4ANSA 4ASXA 3HVCA 4YPSA 4PMMA 3W18A 1SMHA 3UO5A 2OGVA 3R9DA 2BHHA 4N57A 4D2VA 2UW0A 5AUUA 4KKHA 4FV0A 4B8LA 1FMOE 4TY1A 5BUIA 3OBJA 2HY0A 1SVGA 2HZ4A 1NY3A 4JG6A 4KINA 2UZLA 4XBUA 5H2UA 4E5WA 3BQRA 3TZ8A 4E4XA 5JH6A 1TVOA 1URWA 2DWBA 2R3NA 4O7VA 3QX2A 5KX8A 5ANOA 4JG7A 3D7ZA 4LGGA 3EFKA 4FKLA 5FM2A 4HVGA 4DEEA 5E8XA 3NYVA 2W1EA 1ATPE 3CD3A 3U8WA 2ITUA 4AGDA 4H36A 2OXXA 3C4WA 3JPVA 4D1ZA 1M2RA 4AN3A 4I0RA 4ACGA 4DEBA 4IAAA 2E9OA 1BI8A 1QL6A 4CLJA 1XKKA 1QMZA 4XJ0A 2ETMA 1KUTA 5M09A 4QRCA 1UVRA 3HMIA 5EHLA 4C8BA 3UOJA 2GCDA 4QMWA 5HO6A 4D2SA 1YDSE 4GYIA 3ZO3A 4CZTA 4GIHA 3Q53A 4ALVA 2R3HA 3UMXA 5AWMA 3RPOA 2YITA 3ZEWA 4C61A 4AFEA 3F7WA 2YIQA 4FICA 4JR7A 1M2QA 3OT3A 3BGPA 3QRTA 5LCJA 2FB8A 5E8VA 3EHAA 3FI3A 1PMNA 1P4OA 3VN9A 3C7QA 3ZDUA 4D1XA 4QQJA 2BDFA 2YCFA 3V6SA 3UYTA 1WCCA 4BCPA 5KZ0A 5JFSA 1YQJA 5CSVA 2VWUA 2XM9A 3NVMB 3Q9XA 2J2IB 4M68A 4X2GA 3DLSA 3W55A 4IAIA 1YI6A 5E8SA 4K1BA 1KE5A 3MY0A 3VAPA 4EONA 3ZYAA 2FH9A 4I4FA 3KXHA 1KE8A 3EYHA 3NUPA 2EU9A 4I5PA 5I9WA 3Q2MA 4IVDA 4U81A 3DBFA 3VS2A 4H3BA 5AUZA 2O8YA 4EQMA 2PZIA 3GC9A 4ZLZA 1Q3DA 5J7HA 3Q9WA 3E5AA 2YIXA 3VUHA 1ZLTA 5KBQA 1H27A 3BEAA 3W2CA 2X9FA 3G90X 2XCHA 3A7HA 3QZFA 1E1XA 2X8IA 4U7ZA 4TYIA 3D7TB 3KXZA 4KKGA 4FZDB 4DHFA 4IX4A 3ZLXA 4CZYB 4G5JA 2BR1A 4UXLA 4ZSLA 3E7VA 4L3JA 5C4LA 5L2QA 3HV6A 3KN5A 4F08A 5CENA 2WMQA 2OZOA 4E20A 4O86A 4YPDA 1SM2A 3KRRA 4BDAA 3FQHA 3H4JA 5JFWA 1Q8UA 4MBJA 4HVSA 1I44A 2XK6A 4MH7A 4FSZA 4O0UA 5IDNA 4YZCA 5JGBA 4PWNA 4G6LA 4E5BA 4YLLA 3QU0A 3S2PA 2VZ6A 1YOJA 2Y9QA 3ZZEA 4YTFA 4DGOA 3FKOA 4J99A 4YJOA 1PYEA 5FP6A 4IAZA 3SGCA 4JT3A 4RX9A 4AG8A 3NDMA 4FGBA 4YJTA 4BGQA 1YWVA 4GJ2A 3VF9A 3VUMA 5DWRA 5JRQA 3JVRA 3D15A 3LCKA 3E64A 4P90A 5DRBA 1Q8WA 5CU0A 3OWLA 3TCPA 4I0SA 1XBBA 1WVWA 2RG5A 2Q0BA 4BWKA 5T68A 4FKWA 5AP2A 4EYJA 2WPAA 4DH3A 5BYZA 3V8WA 2B1PA 3FUPA 4QP6A 5HESA 2WELA 4NSTA 4ZSJA 4IC7A 4EZ7A 1QPCA 3DJ7A 2BRNA 5CAPA 3U87A 5CEPA 4GV1A 2EB3A 3L1SA 2WXVA 4RVLA 2CCHA 4M0ZA 2EXEA 2PU8A 1BMKA 3I4BA 2ZV2A 3R00A 2CMWA 3GC8A 4IDTA 4C33A 2VUWA 2QODA 3E8CA 3HMPA 4F1TA 3ALOA 2W9ZB 1W82A 5EM6A 2PMOX 5HU9A 5CI7A 1ZAOA 3QFVA 2J0MB 3V8SA 4BDCA 4FSYA 5BPYA 5CEMA 3SA0A 4OAUC 3CY3A 4C2WA 1EH4A 5JGDA 1H24A 2RF9A 2QKWB 4JQ8A 3COKA 3LZBA 2VTLA 3QCYA 3OOMA 3PY1A 4IANA 4DINA 3F2RA 1GZOA 4KAOA 4K11A 1PXIA 3DKFA 4O7YA 3R2BA 4GL9A 3W2OA 4QPAA 2JAMA 2IZSA 5CZIA 4CFFA 5ETCA 2G2HA 3BYVA 3E8NA 4G1WA 4FVQA 4J8MA 2XF0A 4JNWA 4BGHA 2ITVA 3SOCA 3ZONA 2QG5A 2X0GA 3FZ1A 2CPKE 4BZOA 3G51A 3ORIA 3WF9A 3R9HA 4HYSA 4PL5A 2JDRA 4BI0A 5FM3A 2JIIA 4MBLA 4F9BA 4O7LA 4O7SA 5IQAA 4AZTA 2OSCA 4FT9A 1L3RE 2E9PA 4JL9A 4H1MA 1M14A 2EWAA 4JOAA 4OGRA 3PJ8A 3ZBXA 4A9YA 3OF0A 5IH4A 4A4OA 3H10A 1R1WA 3PZHA 4XLIA 4FVRA 2C6IA 3RJCA 5I5ZA 3PDTA 2X4ZA 1NXKA 2PHKA 3LFEA 4PV0A 4EH4A 2C6KA 4RSSA 3LQ8A 3FXXA 3O8TA 4V0GA 2B4SB 4BDKA 2W0JA 4A7CA 3DJ5A 4OTPA 4PF4A 4N6ZA 3F69A 3GFEA 2OK1A 3EN4A 1F3MC 2ETRA 4LRJA 4ZTQA 3BQCA 4MEDA 4C4GA 1CMKE 2V0DA 2WTJA 3NUXA 5AMNA 5HVYA 1REJA 2HWPA 2XRUA 4KS8A 3SHEA 3LXKA 3DXNA 4EZ5A 5JMSA 1OVEA 4CKIA 4PPAA 4CMUA 4PTEA 5L6WL 4LUEA 4C4FA 3F7ZA 5A14A 2NRYA 1OL2A 3HDMA 3ZHPC 5HBHA 3W10A 1APME 4E4LA 4HVIA 2UW8A 4C2VA 2W1GA 4XG6A 3FLYA 4CV9A 2C3KA 4O2ZA 2QHNA 5AP5A 4XMOA 2VTMA 3V6RA 4O1OA 3QX4A 4R7HA 4BHZA 1OUKA 5CALA 4EWHA 3RK9A 5DT4A 1GIJA 4FV6A 4HNIA 4TT7A 4U45A 3QZHA 4ZOGA 4C7TA 4E7WA 4EK8A 4AZFA 3DXQA 3O8UA 4IC8A 5HEZA 2VTRA 3OUKA 4N4SA 4WA9A 4IX3A 4S33A 1U5RA 5EYCA 3VS4A 3H0ZA 2ITZA 3AD6A 4TWNA 3SLSA 4AOJA 5J1WA 2WEVA 3BE9A 3WZDA 3ZSHA 4NU1A 2ERKA 2IZRA 2Y4IC 4HJOA 4RVKA 4IWOA 5AIKA 5DLSA 3QCQA 3U4WA 4YSJA 5IQIA 5FEEA 1WAKA 2YM5A 4FSNA 4JRVA 2BAKA 5ETIA 3D83A 3NYXA 4O27B 4TL0A 5CAOA 3D5UA 3G9NA 4TN6A 2XCKA 5IUHA 1H1RA 4F65A 1OZ1A 4O22A 4F7NA 4FIEA 2VTOA 3N4UA 3DS6A 2PUPA 4L68A 4O82A 4QPSA 5D11A 3PE2A 3WBLA 3ZS5A 2XJ1A 2HCKA 3EKKA 2I0VA 3LJ2A 3OCSA 2Z7QA 3G0EA 3MH2A 2X81A 4JR3A 4RJ5A 4ZSEA 5F20A 1PXMA 4EOJA 1OECA 3UVRA 3PVWA 4FSQA 4FTRA 4FSMA 2QOHA 2O65A 3KRLA 4OT5A 4XUFA 3ODZX 4NM3A 4YZDA 4YNEA 4AGWA 1R39A 2XKFA 5IA1A 3TI1A 1YVJA 3DDQA 3RZBA 5ANIA 3TTIA 4ZMFA 1CM8A 1SNUA 4U79A 4AOIA 4WNMA 3QC4A 4G31A 2GNIA 4L45A 4FV7A 2R3GA 3DFCB 3HNGA 3KEXA 3ZC5A 4FV5A 4AN9A 5I4NA 3O50A 2DYLA 4FKIA 4Y83A 2JKMA 2FVDA 1PYXA 2C5NA 1ZMVA 4BIEA 3AQVA 2GMXA 4BCJA 5EOBA 3BU3A 4ERKA 2GQSA 3TV6A 3TN8A 5IEYA 2HZ0A 3QKKA 2FUMA 4LOQA 2HWOA 3EB0A 3P78A 4M14A 4RIXB 4XCUA 4YHFA 5AR2A 4U6RA 3VS6A 2ZMCA 4D1SA 4I23A 3HRCA 2C6OA 5TKDA 3RCDA 4BDGA 1FGKA 5AP7A 3AMAA 5GIPE 5FLFA 2YEXA 3VRZA 3R30A 3FL4A 3QUDA 3GENA 3RAIA 3VF8A 5D9HA 4NIFB 4F6SA 1PJKA 1XBAA 4IH8A 1PMEA 1JLUE 4BI2A 1WVXA 5I3OA 5IPJA 4AUAA 5CZHA 3KVXA 2X4FA 3BHVA 3OTUA 5LARA 3DBCA 4C59A 4DH1A 3TJDA 4WUNA 3SQQA 5C01A 1Q5KA 4QP9A 4MF1A 4F70A 5FTGA 2R3IA 4RX8A 4DBNA 3KU2A 2PE1A 3RCJA 4DA5A 5CI6A 3EN5A 5JT2A 3V5WA 4Y85A 5CEKA 2JKQA 3TNWA 4QTEA 3QTWA 3D0EA 5CVHA 3ZXTA 2NRUA 5CEOA 2BKKA 1F0QA 1XHAA 2IN6A 3NYOA 3W33A 3ATTA 4Q5HA 3FSKA 3KL8A 4K9YA 4QMPA 4RIYB 5IQHA 4I1ZA 4DC2A 2WTDA 5ANKA 2CKQA 4HYUA 2OG8A 1OB3A 3FXWA 4O0RA 5GIOE 3MJ1A 3F5PA 5BUEA 4GKHA 4BRXA 3NPCA 3L9LA 4UWYA 5HE1A 4C4JA 4EKKA 2BZIB 4F7SA 2J5EA 5I9ZA 2OI4X 4FR4A 1UNHA 2BZKB 2PPQA 2H8HA 2HELA 2O3PA 3ANQA 5M07A 2JDOA 4EH3A 3SOAA 2WMRA 3THBA 3K5VA 5J79A 2H6DA 3JY0A 3R63A 3PP0A 2VNWA 2XVDA 4OTDA 4I92A 3F5XA 4C36A 3UZTA 1ZY5A 4BCMA 2XNNA 3ZC6A 2R9SA 3R9NA 4EOMA 4A9SA 2BPMA 2YA9A 4G9CA 1H1PA 4QMMA 4RVMA 2VWZA 5KKRB 3NSZA 3DLZA 2CLXA 2ZAZA 3EQBA 3OOGA 4NH1A 3G9LX 5AM7A 5E4HA 3R73A 2QOCA 2F7XE 3ZMMA 4U40A 3R1SA 1YHVA 2CLQA 2UW4A 2HXQA 5HGIA 4QP2A 2OJFE 5DG5A 3SRVB 4NWMA 3LLTA 4MHAA 5AEPA 3D9VA 4TRLA 3FMHA 4KD1A 5CS6A 4CT1A 4TNDA 4W8EA 4IJPA 5IUGA 2UZUE 5JQ8A 5KNJA 4ZMEA 5CXHA 2XNGA 4DGGA 2W1IA 3UNKA 4YBJA 3AC1A 4JRNA 2ITWA 4YJQA 5CQWA 3B8QA 5E91A 3UPXA 4RWKA 4E26A 3TDWA 5A6NA 3QKMA 2XEZA 2ITOA 2YLFA 4II5A 3N4VA 2WOUA 3GXLA 4ZS0A 4IVCA 2ZB0A 4YUQA 4DEAA 5B2KA 2A19B 4KIKA 4L44A 3FSFA 4FEUA 4O83A 1XH8A 3F6XA 3PP1A 4YLJA 2PZYA 2XIXA 4HGSA 3SD0A 4DTAA 5IF1A 1YKRA 4PTCA 4BKZA 5IA5A 3RNYA 2GTNA 3QQUA 3NUAA 4O7ZA 2BILB 2ZVAA 3EL7A 3FMJA 4E6DA 1BL6A 2AC5A 3IOKA 4PNIA 3E7OA 3RVGA 3L8PA 4EK4A 2DS1A 2WMTA 4Z7GA 1UWHA 5E8WA 1PY5A 1FMKA 4X3FA 1PXOA 3Q6UA 5HICA 2RG6A 1VYZA 3HGKA 4WG3A 3FEGA 4DBXA 1OITA 1P5EA 2QQ7A 4MQ2A 2LAVA 3BYOA 4DG3E 3QHWA 4QQ5A 4R3CA 4UALA 4F99A 5LVPA 2JEDA 2HXLA 3V5QA 4C4EA 1BX6A 2XIRA 4FZ6A 1QPJA 1XJDA 1BYGA 1OBGA 4DFNA 2FSLX 1FOTA 2I40A 3GI3A 4OTGA 3QQGA 4FSWA 4IWQA 3LKMA 2ITPA 4KRCA 2VWWA 1O9UA 3LFBA 4I0TA 5AJQA 5FDXA 4D2TA 4C0TA 2OIBA 2ESMA 2IVTA 3CKWA 4GEOA 4BCFA 2UZNA 5BVNA 1PF8A 4JBQA 4KIQA 3TNQB 2QO2A 2W5AA 3L8SA 4GCJA 4DEHA 5JFVA 4QOXA 4XEYA 2I0YA 4ZTSA 4IAYA 1PKDA 2OO8X 2VX3A 3HMMA 5T3QA 4ZLYA 2VGPA 4R78A 2BUJA 3OD6X 4MYGA 4ITIA 4UXQA 2VTAA 3Q96A 5M4CA 5IQCA 5JEBA 3BV3A 3K3IA 3BU6A 3GCUA 3MA6A 3QAME 1RJBA 1U54A 5HNIX 4FNWA 3LHJA 4BDFA 3WYXA 1IEPA 3ZBFA 4KB8A 4RZVA 2XNPA 3BGQA 2QO7A 5J9ZA 3F88A 2BDJA 4JG8A 4FK3A 4ZJJA 5CANA 1ZYSA 2CKPA 5BVDA 2A0CX 3C13A 3CS9A 5HCYA 3V5JA 5KMKA 4G3FA 4WG5A 5ICPA 4DH5A 5LVOA 3P7CA 4DCEA 3WZKA 4GIIA 4YO6A 5I3RA 2W1HA 2GHLA 2UZDA 3EQRA 2BHEA 3NR9A 4YC8A 5AA8A 3L9PA 5ETFA 3VUIA 2HY81 4D2WA 2YHVA 1PRYA 4UEUA 3QBNA 2UW3A 1URCA 4M0YA 3AMYA 3S00A 5M51A 2WQOA 1CTPE 4IACA 4ACMA 4IVBA 4D2RA 2ITYA 3I0QA 4BIBA 4JDIA 4FKSA 3BU5A 2RL5A 2C6TA 4P4CA 3GCQA 2I0EA 3ZFXA 4J98A 2XA4A 3ULIA 4E4NA 2JIUA 3JR1A 1SVHA 5A4LA 5L2IA 3GOKA 3IKAA 4IIRA 3MB7A 2QO9A 4BBFA 4W9XA 4CEGA 4V04A 4EH5A 1RE8A 4RIWA 3JY9A 4Z9LA 4FYNA 3RBWA 1XQZA 3C50A 3ETAA 1W98A 2UZWE 4EUTA 5FBOA 3LQ3A 3E92A 4DFZE 3KREA 5DMZA 4XBRA 3HX4A 2WD1A 5ACKA 3P1AA 4MNEB 4P5ZA 3UIMA 2WIPA 3PXYA 5HOAA 5AAGA 5HO8A 3VBTA 3RPSA 4ANBA 2XK8A 5B0XA 3LFAA 4USFA 5GZ9A 3QTSA 3PJ3A 2F7EE 4BCQA 5IMEA 3HV3A 1Y6BA 1J7IA 3DAJA 4FV2A 3ZFYA 2WTKB 2C5XA 3CTJA 3KB7A 4LL0A 4DAWA 2VO0A 5FUTA 4PY1A 4QYFA 3GC0A 4FKOA 4YLKA 4S2ZA 5C26A 5J5TA 3UIXA 2Y8OA 3QUPA 2GS6A 1W7HA 5HG5A 3W8QA 5HTBA 4LFIA 2J6MA 3AT4A 4NKSA 4YTIA 3QC9A 3OXIA 5CT7A 4ITJA 3LPBA 2FA2A 1Q62A 3ORPA 3FLNC 3OXTA 5HBEA 3OS3A 4EZ3A 4O7WA 4TYGA 3CGOA 3KULA 1YI4A 2XKDA 5HQ0A 5L8KA 5BVWA 5EW9A 4FTIA 3LLAA 4BZDA 3U6IA 4RQVA 4B0GA 3NWWA 2QNJA 3ACKA 3FZPA 3ORTA 2OJJA 2RFSA 2OFUA 3MV5A 2VTPA 5AV0A 4C3PA 3BBWA 4ZZMA 5E92A 4L01A 3NCZA 3DA6A 1BKXA 4CRLA 4RIXA 3G2FA 2QG7A 4DEGA 2GNJA 5F1ZA 3L9MA 3Q4UA 5C1QB 3AGLA 4EQUA 1REKA 1JBPE 3POZA 2CHLA 2VD5A 3DK7A 4JQ7A 5L2TA 3OWPA 3ANRA 1I09A 2JITA 4O84A 4HZSA 4R77A 3JS2A 4MXXA 4RT7A 3KFAA 2OZAA 1GIIA 2AYPA 2QOLA 3QQKA 4GFMA 3L9NA 4W4VA 4YZNA 1H1SA 2I0HA 1ZZ2A 2YJRA 4PMTA 4RFZA 4GMYA 3DAEA 4RC4A 4RJ8A 3OMVA 3TZ9A 5J8IA 4EWQA 4FBXA 4BTKA 2JBPA 3C4EA 3A60A 1XH4A 4HPTE 3EQDA 4A06A 2G1TA 1GZ8A 3UO6A 3OCBA 1JVPP 4USEA 5EM5A 4U3YA 2X6EA 1XO2B 4X3FC 1H25A 5CX9A 4EHEA 3S1HA 3JVSA 2CNVA 1J3HA 5EH0A 3R8ZA 3BBTB 2ZM4A 3KCFA 1W84A 4D4SA 5AAEA 1H00A 3UDBA 3BHTA 4EOIA 5HVKA 3EKNA 4AA5A 3LJ0A 4BBEA 2W1CA 1OL1A 1ZYJA 3V5PA 1KWPA 3BHUA 2PVNA 2Y6OA 4YJNA 4FG9A 4GT4A 3BHYA 4I4EA 2J4ZA 2QVSE 3GOPA 4R8QA 3RWPA 3EN6A 5A4EA 3VW8A 3PXQA 4ANOA 4DTBA 5LQFA 3BHHA 3F66A 3FXZA 4RMZA 3F2NA 3HEGA 4O91A 1IG1A 2EXMA 3LFQA 1FVTA 3HL7A 3Q32A 4ALUA 2YCQA 4MWHA 4PP9A 3QXPA 5TR6A 3CCNA 3DBQA 3UOKA 4FV1A 4PL4A 3RMFA 5ANJA 5I9VA 2OFVA 2OU7A 1O6KA 3VBYA 3R8VA 1UU9A 3VBXA 3CQEA 4BI1A 3DQWA 5A4CA 4RJ7A 3P08A 3R7OA 2Z7SA 2V7OA 2W1ZA 3UNJA 3QYZA 5D12A 5AX3A 5K5XA 2XRWA 2R3OA 3EZRA 3O51A 4ASDA 5DA3A 3PIYA 3U9NA 4FTNA 3SRVA 4XHKB 4E4MA 4FEWA 3L8XA 1V0OA 5AP4A 1J91A 3W2RA 1DM2A 3T8OA 3JYAA 2RFNA 2XNMA 2HW6A 3UIBA 4AQCA 1U5QA 4G2FA 4FKGA 1LPUA 3CLYA 3ODYX 5E8ZA 3TEIA 3VJOA 3TACA 5BUJA 4BB4A 3QRIA 3EQHA 4BCGA 1JPAA 5AV3A 3LE6A 1GIHA 5CQUA 4J95A 3C4FA 5JKGA 2VU3A 4IB3A 3LOKA 2CN8A 4EOLA 1ZYCA 2BFXA 4MCVA 4FT0A 4C37A 1Q61A 4BL1A 3BEGA 4GSBA 5IA0A 5C27A 1OL5A 3NUSA 4FG7A 4CSVA 3P9JA 3BKBA 4I6QA 2W4OA 4IE9A 5BVEA 4L7SA 4MXAA 2J50A 4YBKA 2B0QA 4FEVA 1GZKA 3VS3A 2P2HA 3UVPA 4MAOA 1U59A 3MB6A 4MD7E 4MKCA 3FZSA 4XYFA 3E8EA 3W16A 4RRVA 3D4QA
chains in the Genus database with same CATH superfamily
1W0XC 3H3CA 3Q3BA 4IB1A 5HCZA 4HVDA 4M69B 3WZUA 3EFJA 4O0WA 2GSFA 4CG9A 4OTHA 3RK7A 4FNZA 4XNEA 3DKCA 4D9UA 5CAVA 5IUIA 2W1DA 1H4LA 4BTMA 3DOGA 2XK3A 4Q5EA 4U44A 4PMSA 2IPXA 3FLWA 4G3EA 1UA2A 3KA0A 3SXRA 5FRIA 3ORKA 3B2WA 2NPQA 2XYUA 5CY3A 5I9UA 4YJVA 1SVEA 4TWOA 4GYGA 5CASA 4LI5A 4ZSGA 5EQPA 5EKOA 4MVFA 4LM5A 2WTVA 3COMA 3HA6A 3RAHA 3AOXA 5AUYA 2B53A 4YHJA 4CQGA 2F2CB 3R7IA 3ZLSA 3HV7A 5FXSA 2A1AB 1HCKA 4QTDA 2O63A 4BCNA 3OTVA 4CFUA 2WTWA 4QP8A 2ZYBA 3VBVA 4QDVA 2B9JA 1KOBA 2GU8A 3ZDIA 4HYIA 3IW6A 4D0WA 2ONLA 2C4GA 3W0NA 2O2UA 2JKKA 4O21A 4PQNA 2HOGA 4QTBA 3I60A 3FYKX 4FL1A 1CSNA 2R0IA 5DIAA 3MVMA 4DGLC 2YCSA 2BRHA 3MFTA 2C1AA 3O7LB 4O6EA 1H0WA 4RJ6A 4YTHA 4OLIA 3UG2A 3WILA 4DLJA 3CSVA 3CXWA 1YXXA 4GG5A 3MVHA 5I9XA 4JAIA 1PHKA 4YP8A 4MQ1A 3F61A 4IDVA 5CU6A 4PDPA 3KXMA 4LUDA 2J51A 3TNPC 4PUZA 4APPA 4O7NA 2LGCA 4C58A 3ELJA 4RG0A 2XH5A 3RGFA 2GNHA 4U97A 4OAVB 3PUPA 4GKIA 4AT5A 4PX6A 1G5SA 5HNBA 3AC5A 3PIXA 1A06A 5D7VA 4CQEA 4BDIA 1B6CB 4FTMA 3V8TA 1FQ1B 4NK9A 2XIZA 3DCVA 4R6VA 2Y4PA 1JOWB 5FQDC 4QTCA 2V7AA 3ZRLA 1GOLA 1H07A 4WG4A 3BLRA 5CSHA 4RFYA 3DB6A 3HAVA 3HP2A 4EOQA 4AZVA 4FSTA 5DPVA 5E90A 4AXAA 5K9IA 2F57A 4DG2E 4HPUE 3QZGA 1B39A 3GU6A 2B55A 2BMCA 1XR1A 5A6OA 4IB0A 3TNHA 3CQWA 3LFDA 4EYMA 5IQBA 4KWPA 4A4LA 4NW5A 3TJCA 5KUPA 2WMVA 2BCJA 2WQEA 2UW9A 3Q6WA 5E8YA 4AU8A 4HCVA 3KIOC 4C4IA 4Y8DA 1OKVA 3UZPA 2PUIA 1T46A 3MH3A 3GU5A 2E9NA 4LGHA 3Q52A 5ITAA 4ZEGA 4F64A 4S32A 3QD2B 3AC2A 2W99B 3I81A 4UBAA 3ZH8A 4FOBA 3WZJA 4IM2A 3PXZA 3OY3A 5K4JA 4O4CA 3A8WA 1ERKA 3G5DA 2IVSA 2VNYA 1JSVA 2BALA 5EQEA 5J9LA 4GU6A 4CFVA 2ZM1A 2XNOA 4FUXA 3OWJA 4HCTA 4JX3A 3PXRA 4RWJA 5CT0A 3RHKA 1YXSA 2XIKA 3MDYA 4DDIA 1YOMA 1V0BA 5BQ0A 3DK6A 3MFUA 4WNPA 3QLFA 4ZZOA 3KQ7A 1PKGA 4ZAUA 5L2SA 4MUQA 3OHTA 4PRJA 4R3RA 5GJDA 5BVOA 1WBOA 4DEDA 1JKKA 4FIHA 1QPDA 3HA8A 3OW3A 2XEYA 1RQQA 2OKRA 3BLHA 4MXZA 2YFXA 2JFMA 3LXLA 4FK6A 4QMYA 4X2NA 5J9YA 4DLIA 4F1OA 3M11A 2VWXA 4U8ZA 2GPHA 3QKLA 3R1QA 4HNFA 5LOHA 2C68A 3PVGA 3NUYA 3IG7A 3RZFA 3UE4A 4EH2A 4U43A 3FLZA 3ZZWA 2C3JA 3D5VA 1OL6A 3NUNA 4L3LA 2HK5A 5AV4A 4CKJA 3ZO4A 4TKSA 4ANLA 4A4XA 4BWPA 5TF9A 4E8AA 2UW7A 4IMYA 3QZIA 3V3VA 3NAYA 2P55A 1OI9A 4RGJA 4OBPA 4F9CA 3W32A 3CR0A 4S34A 3PXFA 2IEWA 3MI9A 4UWCA 3BLQA 3TXOA 4HW7A 5IA2A 1NVSA 3SW7A 1H0VA 5ANEA 2FO0A 4QMTA 2VGOA 4S30A 3ENHA 3ZM4A 3HV4A 4AW1A 4O0VA 4KSQA 4WBBB 5FP5A 1PW2A 3FC2A 3E93A 2X0PA 5AADA 4TYHA 3E87A 4HVHA 3KRWA 5BMSA 4MWIA 2KULA 5HG8A 3ORLA 2X1NA 2J9MA 2YISA 3V04A 2Y0AA 3MWUA 3O8PA 2W4KA 3P23A 5H8EA 3UOLA 5DOSA 4GUBA 4A07A 3QTIA 3ZUVA 1NVQA 4AGCA 3PVBA 4NM7A 4EJNA 1DI8A 3GQLA 3MN3A 4GK4A 2R3MA 4WNKA 4C3FA 5E7RA 4TZRA 5IA3A 2V5QA 4QMSA 4TYEA 2G2FA 4GK2A 3HECA 3S4QA 4K2RA 4QYGA 3S95A 3AMBA 3Q5ZA 2KTYA 4IFGA 2P4IA 4WT6A 5LJJA 1P4FA 4FTTA 2IJMA 3C0GA 2QLUA 4JQEA 3H9OA 3IECA 2W4JA 3KC3A 4A9RA 3K2LA 3F9NA 3K5UA 2V62A 3EMGA 3D5XA 4MNFA 5GZ8A 3W0MA 4ASEA 3HP5A 2OW3A 1IA9A 4EHVA 3EFLA 4A9UA 2WTCA 4GVJA 3L8VA 2UZOA 3P79A 3D2KA 2A27A 1G3NA 3PJ2A 5DT3A 4B7TA 4EK6A 4FNXA 4LGDA 3CKXA 2CN5A 3PVUA 3LIJA 1JKLA 1VJYA 3TL8A 5IISA 2YM4A 4F9YA 4PDSA 4ASZA 4MF0A 4MD8E 4WRGA 3T9TA 4D58A 3DTCA 2HENA 4IAKA 4CT2A 3GEQA 4OR5A 3UJGA 4BN1A 5DE2A 5E1EA 3ZRMA 1Q8ZA 3FZRA 3LFCA 3OY1A 4F9WA 4XLVA 3CPBA 2JLDA 3F3UA 3ZCLA 4D5KA 2ONLC 2FSMX 3FI8A 4R1VA 5IQDA 4QDEA 5HE0A 3PIZA 4E93A 4V01A 1KV2A 2GFSA 4LG4A 4DGMA 3SC1A 3EQPA 2UVZA 2QOQA 3LCDA 3VQHA 4BBMA 3R7GA 3I1AA 3R6XA 4YC3A 4JDKA 2GDOA 4AOTA 1WBPA 4YC6A 3UQCA 4DFBA 4X3JA 1ZY4A 1H1QA 3DGKA 4KSPA 2IO6A 5KZIA 1YDTE 2Z8CA 4AW5A 4F63A 5KMIA 5L6PA 1H28A 5HLNA 3MVJA 3LM0A 3ZU7A 2XS0A 4FZAB 1PMVA 5AUVA 2WAJA 3GFWA 4ZTLA 2CGVA 2V55A 4H39A 4AA4A 3TKUA 4OTRA 3SXFA 5KCVA 3C5IA 3NRMA 1ZMWA 4LRKA 1H26A 3IGGA 2QHMA 4FIIA 4X21A 2ITTA 2X39A 3BZ3A 4JXFA 3VNTA 4EL9A 2X7GA 5HX6A 2NYAA 1YHWA 2H9VA 3LAUA 3QTUA 4H05A 4KIOA 1T45A 3G6HA 4U9AA 3TDVA 2VO7A 5DNRA 1WFCA 2W06A 3E3PA 2R5TA 2P33A 3DQXA 4EHGA 2W17A 3HYHA 2J0KA 5EK7A 2BROA 3D7TA 2GNGA 3IO7A 4L8MA 4RC2A 2PK9A 3R04A 3QCSA 3FDNA 3ZEPA 1NA7A 4TNBA 4L7FA 3R8LA 2PVJA 2CJMA 3E63A 4I5HA 4L46A 1OKZA 4EOSA 2I7QA 2UZBA 3R7VA 4M69A 2VTIA 4MXCA 4XP3A 4QNAA 1YW2A 2WMSA 3OBGA 2R3RA 3PE1A 3NNXA 4UV0A 4L9IA 2HIWA 4MBIA 4C38A 3Q4TA 3R9RA 3V01A 3PRFA 3MYGA 3F3VA 1VYWA 3QALE 4TW9A 3BRBA 4NUSA 1G8JA 3LFSA 5LCKA 3NNVA 4JJRA 2Y4IB 3KRXA 4NM0A 2BFYA 4FOCA 1STCE 4Z3VA 3UPZA 3FI4A 2WFYA 4YURA 2ZV7A 1UNGA 4FKJA 4BGGA 4YTCA 2FYSA 2W7XA 4R3PA 5BYYA 4XOYA 1LP4A 1YXUA 4I22A 3RP9A 2BKZA 5AR4A 4OTFA 3FLSA 2C6LA 5J7BA 2WTKC 3GB2A 5HE3A 3M2WA 5CYIA 5A46A 2C0TA 4I94A 5DR6A 2X6DA 3FQEA 4UMQA 2GS7A 3NVKI 4Z7HA 4AZSA 4ERWA 2BDWA 3U6JA 3GVUA 3FKLA 3EQIA 5HORA 4LDTA 3K3JA 2XBJA 2ETKA 2W1FA 4C34A 2OJIA 2UW5A 4GFOA 2JDTA 3FMEA 3NW5A 1CKIA 4ZY4A 3PYYA 4N70A 4AZWA 1UNLA 4FZ7A 4H1JA 4PPBA 5FBNC 4I6BA 4O4BB 3BX5A 3OROA 3NS9A 3OXZA 5K3YA 2VWBA 4ZY6A 5CEIA 4XV1A 4YJPA 4HCUA 5LMAA 4BTFA 4F09A 1FINA 3EJ1A 5B2MA 3A8XA 1Y8GA 4XG2A 4CRSA 3MH1A 1VZOA 4EH9A 4QMQA 4ACCA 4AW2A 2E9UA 3KN6A 2ZDUA 1QCFA 4IB5A 4W4XA 4YSMA 5CNNA 5FWKK 3VUGA 4QQCA 3VBQA 3DY7A 3GCPA 3R02A 4Y46A 2QOFA 5JRSA 2PMLX 2XJ2A 4BVUA 4DTKA 3UOHA 4EBVA 3BPRA 4CV8A 3COHA 4DCAA 1OIYA 4RVTA 2XALA 3GNIB 3NAXA 2HZIA 2ITXA 3W0SA 4D4YA 3KVWA 3IW7A 2C6MA 1M7QA 2NP8A 4KKEA 2F2UA 3HLLA 2IZUA 2C1BA 3UODA 3PUFC 4K18A 1R0EA 1YWNA 2SRCA 4GS6A 5ETAA 2C5YA 4NTSA 4EHZA 3FJQE 2ZOQA 4JLCA 4DF3A 2XP2A 4OTWA 3FMKA 4WUAA 4NFMA 4IZ5A 4M13A 2CGXA 2PUUA 2UUEA 3DT1A 2VX1A 3MGYA 3FMLA 3UVQA 1YWRA 4RBLA 3P7BA 4DG0E 1MQ4A 2R3LA 5K0KA 5J5SA 1U4DA 4GW8A 3MJ2A 5E8TA 3C0HA 3DZQA 4XX9A 5IH6A 4DFXE 3MFSA 3T3VA 3OT8A 3OC1A 4KBCA 4NFNA 5DRDA 3LMHA 2W5BA 3R01A 5CLPA 5GJGA 5JGAA 1A9UA 2XK9A 1GJOA 3FZTA 1TQMA 3HMOA 4O0YA 4ZZNA 5AR5A 4CG8A 3QA8A 4LYNA 2BTSA 4FKUA 4JBPA 3W8LA 4AXDA 5A4QA 3VUTA 2W05A 3II5A 5FEDA 4GUEA 2VO3A 3FMNA 5AUXA 4WSQA 4H58A 5AV1A 5KMOA 4FTJA 5M53A 3RHXA 2OXDA 3DXPA 1OUYA 2Y6MA 2XAOA 4EQCA 3PRIA 4BICA 4OW8A 4CMOA 5A54A 1K2PA 5IMXA 4UX9A 5DR2A 2PVHA 4RLKA 3BE2A 4O81A 3DJ6A 3Q9YA 4FYOA 1ZZLA 2G15A 4K77A 2PVKA 2JDSA 5EI2A 5GZAA 1R3CA 2C0OA 3F5UA 3LFNA 4F0FA 3PPZA 4O0SA 2PY3A 2VTHA 4Z16A 1ZRZA 4BY9E 2JBOA 3BELA 3FWQA 1IASA 3P5KA 4M3QA 4CGAA 3P7AA 3UO4A 2EUFB 2FSOX 3H9FA 3QTQA 5CF6A 4ZK5A 4LV5A 3QUEA 3SXSA 1G8SA 3V5TA 4JS8A 4UZDA 5IG1A 4JAJA 4X2JA 4HGLA 5K4IA 4DE4A 3R28A 4G9RA 4O0XA 4V0GB 3UQGA 4UN0C 4NW6A 2VO6A 3A7GA 2XB7A 3BYSA 1PXPA 3MTLA 3QA0A 4HOKA 5EHOA 3TV4A 4AN2A 5EDPA 5H9BA 3FHIA 2WZJA 4BCHA 2QONA 4FKQA 4D5HA 2B9IA 3OFMA 4BYJA 4D9TA 4EH6A 4CTCA 5LVNA 2XIYA 3D94A 3HUBA 4A9TA 4AACA 4KRDA 4IW0A 4M8TA 4BDJA 2BRMA 4FT5A 3I6WA 4ZLOA 5BX0A 3A7JA 1ZXEA 4M67A 2YM3A 4QP7A 3R8PA 3ML1A 1HOWA 4GVAA 2PTKA 4JMQA 1PMUA 3EQGA 4JDHA 2ZDTA 4CKRA 4EK3A 1V1KA 3JXWA 4XS2A 4IZAA 5M56A 4X0MA 4NT4A 3VO3A 3ZRKA 2QR7A 3GUBA 5HTIA 4O4DA 2GQRA 5DFPA 2B9FA 1G8AA 3CPCA 4UY9A 5G1XA 4BTJA 3OUNB 3QCXA 2C6DA 3PTGA 5KHXA 4FMQA 1WBTA 2YIRA 4FT7A 4F4PA 2J0JA 4NIFA 3BYMA 4FKTA 3RWQA 1XH5A 4ARKA 4RFMA 4U42A 5JSMA 2CGWA 4L00A 5FDPA 5J1VA 3SDJA 1PXNA 4FV4A 4I6HA 5HCXA 5AR7A 3N4TA 3TM0A 3GU8A 3I5ZA 2FSTX 4ZTRA 5J87A 4EUUA 3UTOA 2YWVA 2P3GX 2QOKA 4EOOA 5HD4A 5HU3A 3O23A 1WMKA 4JX7A 4W4YA 4D0XA 3CBLA 5CAUA 3KMUA 4XG4A 3DNDA 3GU7A 2JFLA 3RINA 2OF4A 3UNZA 4FKRA 2PVLA 4AT4A 3ULZA 4D55A 3EYGA 4RJ4A 3LQ5A 5CTPA 4G5PA 5EI6A 4QTAA 3V51A 2QI8A 4NCTA 3KF4A 3UQFA 4ONAA 4U80A 3IW5A 2CCIA 4W8DA 3WI6A 3P0MA 5TO8A 5CU4A 3FY0A 5BYLA 2E2BA 4MXYA 1Z9XA 5IKWA 2YLEA 4RIYA 4WOVA 4YMJA 2YM8A 2F9GA 2CGUA 2YAAA 4LV8A 4QP4A 5CU3A 4R5SA 3K54A 4QMXA 5AV2A 3OP5A 1KE6A 5D10A 3MIYA 2C69A 3ACJA 1LUFA 3ALNA 4P5QA 5FD2A 3ZUTA 5E1SA 4FV9A 3FAAA 1VEBA 2YAKA 3B2TA 3EN7A 2X2MA 2WKMA 3FPMA 5ANGA 1J1BA 1VR2A 4IAFA 4RA5A 3WOWA 5EYDA 4IFCA 2H34A 3AC3A 2X8DA 2VTTA 3NNUA 3I5NA 1OKYA 3LJ1A 2J0LA 3PPJA 4K8AA 5CSWA 2QOBA 2H96A 3VS5A 4ANMA 2P2IA 3GBZA 3PZEA 3QD3A 5I0BA 5GJFA 4V05A 3MA3A 4FSRA 5F95A 4DYMA 4QMUA 3ID6C 5FEQA 3LW0A 3MBLA 3PPKA 4BC6A 2W9FB 4D2PA 4AXEA 4I93A 2OICA 2OWBA 1OPLA 3HKOA 4QMOA 2ITNA 2O5KA 3ZLYA 4FA2A 4MXOA 3D5WA 1ZARA 2PZ5A 2R7BA 2PE2A 1WBWA 5L4QA 2Y7JA 5EDRA 3DZOA 3QF9A 1BI7A 3F3TA 4FKVA 4NJ3A 4NJDA 4UYNA 4LMUA 3TZ7A 3RM6A 2X9EA 2JAVA 3UP7A 4CYIA 2PYWA 2C47A 5H8GA 3NNWA 5DT0A 3R21A 2YDJA 3WE8A 1GY3A 1OIRA 4X6RA 4I5MA 3I6UA 2HYYA 2RFDA 3CEKA 4O4EA 2WQBA 1AD5A 4GJ3A 5AP0A 1LEZA 5EW3A 3DDPA 2PZRA 1MRYA 4FKPA 2IG7A 2GHMA 3D2IA 3PLSA 2UZVA 1W2CA 2WMXA 5EOLA 3QYWA 3O17A 3VULA 4W4WA 4DFYA 1OL7A 1OPKA 3BWJA 4HZRA 3R1NA 1PXJA 4IEBA 5HNGA 3AD4A 1XWSA 2WQNA 3ZO2A 1TQIA 4EORA 4FTCA 4K33A 2O64A 4QQTA 3A62A 5CWZA 2XJ0A 5IDPA 4U0IA 4FTQA 3VW6A 1OIUA 3PA3A 3RAKA 1R0PA 1JSUA 2QC6A 4FTOA 5C9CA 2NNWB 3NGAA 2O0UA 4ZTHA 4PDOA 4EC8A 5GHVA 4UMRA 4OBQA 3PY0A 3COIA 5A4TA 3GGFA 3W1FA 3GCSA 5AX9A 5HX8A 2A4LA 4TTHB 2QOIA 4FSUA 2RGPA 4I21A 2AEGA 3WE4A 3TV7A 3R0TA 4IZYA 5BV3A 3R1YA 4IJ9A 3QRUA 4RC3A 4AGUA 5IQEA 3ZO1A 1ZMUA 3AXWA 3QLGA 4ZTNA 4J53A 4O38A 1Y57A 4MTAA 3RM7A 1XBCA 3MY1A 3CQUA 4QT1A 4B6LA 4F7LA 5AA9A 5EM8A 4E6QA 3KY2A 1M17A 3VS7A 3KXGA 4RX7A 2VTNA 3C9WA 4Y5HA 2E9VA 2XK4A 4ZIMA 4AP7A 4EH8A 2B54A 1Q8TA 3OG7A 2DUVA 5IQFA 5EQYA 4IHPA 2B52A 4UMPA 4AE9A 4ZY5A 3FYJX 3ENMA 2CKEA 4YHTA 4PTGA 4B9DA 2EB2A 1LEWA 2PUNA 2XK7A 3UC3A 2R4BA 1J7LA 3HUCA 4J8NA 3UGCA 2ITQA 3AD5A 2WIHA 3VBWA 1GNGA 1YRPA 3F82A 3QQLA 2OF2A 4KBAA 1B38A 3VS0A 5H8BA 3HDNA 4RA4A 4CVAA 5M4FA 2WNTA 3REPA 2C5OA 3NFFB 2WQMA 2PMNX 4Y72A 4FTKA 4YGAA 3PLAE 2AUHA 4KIKB 3N9XA 4USDA 3O71A 2IW6A 3ORNA 3IGOA 3FPQA 3RPVA 2I1MA 3OEFX 4FX3A 2IWIA 2BTRA 3KK8A 4NZWB 4I24A 5HKMA 3P86A 4HGEA 5HIEA 3MPMA 2VWIA 4BIDA 4Y95A 4G6OA 1LR4A 1W8CA 1Q97A 1JKTA 2BIYA 2F7ZE 3KKVA 3NLBA 4FNYA 2UZTA 2HW7A 3F2AA 4X3FB 3W2SA 2PSQA 3QL8A 4FUYA 4J97A 1WVYA 3I7CA 4WHZA 4XH6A 5CVGA 4RWIA 4YZMA 3TTJA 4O0TA 3RALA 4BHNA 2JGZA 4GG7A 3OEZA 3QTRA 2PULA 2XZSA 3R8UA 4AA0A 3R8MA 2ZV8A 3B8RA 3IDPA 5HZNA 3GP0A 4IADA 3A99A 5F4NA 3ROCA 4UMUA 5EYKA 3QQJA 1ZOGA 2YM6A 1UU7A 5CF5A 1WBVA 2PE0A 2RFEA 1YXVA 3QD0A 2ZB1A 3VHEA 2AQXA 3GC7A 4KS7A 3BLAA 1Q41A 4R7BA 2CNQA 1SNXA 3WIGA 1GZNA 2G01A 3KRJA 4Q9SA 4BYIA 1RW8A 3UIUA 3UYSA 3DKGA 3ZM9A 4PDYA 3ZSGA 5DEWA 4BF2A 4IWDA 2CNUA 4DHIB 3PFQA 4QMLA 4ZXTA 3G33A 3VQUA 3ZXZA 3EN9A 4QYHA 4CCBA 4E6AA 5KHWA 5L3AA 1VLRA 2P0CA 3EQFA 3DU8A 2ERZE 4OTQA 3E8DA 4NCTC 4MNEA 4EEVA 1NW1A 1O6YA 1U54B 4J52A 4K6ZA 1ZYLA 4GT3A 4G3DA 1WBSA 4ANNA 4IXPA 5HG9A 4M84A 1IAJA 5HLWA 4B8MA 4C3RA 3HAMA 2UVYA 3QGYA 4FL2A 2EVAA 4B4LA 5AUTA 1P2AA 4FIFA 5C8KA 4BDBA 1MRUA 3ZSIA 3R83A 4ORKA 4M97A 4NEUA 4RQKA 2F4JA 2A98A 2XYNA 3CTHA 4CLIA 2B9HA 4QP1A 5M57A 4QO9A 1Q24A 5AP1A 4E1ZA 2R3FA 1ST4A 1H08A 2VWYA 3FBVA 3UP2A 2XBAA 4S31A 3ORXA 3WZEA 2WO6A 2OJ9A 4F0IA 2QKRA 4PL3A 2YZAA 1Z57A 4CFNA 5JZJA 2JIVA 2WMAA 3AT3A 4RX5A 3FQSA 4NM5A 3RPRA 5GINE 2HAKA 2OJGA 4CMTA 5BVFA 3NCGA 2X0OA 3A2CA 3FY2A 5HE2A 4CTBA 2YJSA 3E62A 5DVRA 2YACA 2IVVA 4E73A 5KMNA 5KKRC 5M44A 4AWIA 3PA4A 4ZJIA 2QOOA 3W0RA 5JN2A 4LOOA 1Q4LA 3C0IA 2YIWA 3PWDA 3GCVA 3GU4A 4FL3A 3IK3A 4PP7A 4Y73A 5DBXA 3SKCA 4BZNA 3IQ7A 4YJRA 5JK3A 2R3JA 2VAGA 3FZOA 4IX6A 4L52A 4C4HA 5I9YA 1FBNA 4IQ6A 4U41A 4U3ZA 1X8BA 3DFAA 4RIWB 2PVRA 4CXAA 3NEWA 1MQBA 3ORMA 2YERA 1UU3A 2BZHB 2XNEA 4KBKA 4X2FA 4ZP5A 3W0PA 1KE9A 3ATSA 2R0UA 4BJJB 3U4UA 5DYJA 2YCRA 1YOLA 1ZWSA 3FE3A 2WU7A 1KSWA 4RIOA 4WKQA 4G17A 1WBNA 3TKHA 4QMZA 1TKIA 3CJGA 5AFVA 4J1RA 5E8UA 2JDVA 2Z02A 4O7RA 1W2DA 2Z7RA 5LMBA 4BKYA 2R3KA 1MUOA 4LOPA 5AP6A 1ZOEA 2I6LA 3R22A 1CKPA 3UBDA 1XH6A 3KF7A 2QU6A 3Q4CA 5CU2A 4JIKA 3R7EA 5KMLA 4X2KA 3RTPA 3CE3A 1XMMA 2PZPA 5FXRA 1O6LA 3P4KA 3R7YA 3ZFMA 5KE0A 4IM3A 4M15A 3SW4A 2WB8A 3A4OX 4AZEA 3EH9A 4FC0A 4GFGA 3WYYA 5CF4A 5C4KA 3DV3A 3F5GA 3FMDA 4FG8A 4WSYA 4QYEA 1P14A 2NO3A 2YWPA 3CY2A 4PNKA 4FV8A 4EJ7A 3MTFA 4KA3A 2W96B 4FODA 5C03A 2BRGA 4YJSA 4CFMA 1K9AA 2UV2A 2VX0A 4AFJA 3TUDA 3BIZA 5LMKC 2F49A 3G6GA 4KIPA 4AT3A 4FIJA 3KULB 1JKSA 4KABA 5D7AA 5F9EA 5CSXA 1BL7A 2Q0NA 5CEQA 3MIAA 4O1PA 5A3XA 4BR3A 5H3QA 5HIDA 2Z2WA 2IZTA 1YXTA 5IEVA 1E9HA 3QTZA 1PXKA 3TG1A 3U6HA 2C3IB 2JC6A 3WARA 4WRSA 2YDKA 3H0YA 3ORZA 4ZS4A 4OTIA 3D14A 5B2LA 5HBJA 1UV5A 3AC8A 2VTJA 4UB7A 1YI3A 4NTTA 1FVRA 2PVFA 5HHWA 1SYKA 3ROYA 2BAJA 2G9XA 3C5UA 4D4RA 3LM5A 3RAWA 5KO1A 4BFMA 5IH5A 5EM7A 3SX9A 4U5JA 3WF8A 2OZAB 4I6FA 2HZNA 1M7NA 3F3ZA 4PPCA 1XH9A 2WGJA 2XMYA 3MH0A 1OIQA 4J71A 4O96A 3UMWA 4CFWA 5F94A 4ENXA 3U55A 3EFWA 4BCIA 2WU6A 3HV5A 3PWYA 4YZBA 1W2FA 5CAQA 3H30A 2YM7A 3M1SA 4FF8A 5DN3A 5LVLA 3LCSA 3RNIA 2PVYA 1PXLA 4LQMA 3TZMA 3R2YA 2GNFA 3AGMA 5D1JA 4BCKA 5M55A 3PA5A 1BUHA 2UVXA 4ITHA 3PY3A 4J7BA 4EKLA 5BVKA 3U54A 4BDEA 1OMWA 2XKEA 3IOPA 1FGIA 3KMMA 5JQ5A 5HIBA 4G6NA 4JBVA 3C1XA 1ZOHA 4GK3A 4Y5QA 4RPVA 4RZWA 5FGKA 3CGFA 4LL5A 5AM6A 3FI2A 4AS0A 3AC4A 4B99A 4FTAA 3I79A 4L53A 1W83A 3LFFA 3HRFA 3BCEA 3MSSA 4TWPA 3IW4A 4ALWA 4P7EA 2C30A 3ERKA 1Y8YA 3FLQA 4F9AA 3WF5A 3O5AA 5FG8A 3W2PA 2YN8A 4FV3A 1KV1A 4I41A 3ZUUA 3C4CA 3QRKA 1H8FA 3HRBA 3BYUA 3MY5A 2WHBA 5DI1A 3KCKA 3MFRA 4KUJA 4AX8A 3UZRA 2C0IA 2XM8A 2R2PA 3TNIA 1K3AA 4K0YA 4TXCA 3OWKA 1AGWA 4G3GA 4XP2A 3Q04A 3IW8A 3RPYA 4AF3A 3F3WA 4DH8A 1BLXA 3EOCA 5L8LA 5CF8A 2XUUA 5LMKA 2Z7LA 2BZJA 5DGZA 2FGIA 5ACBC 5FXQA 2QU5A 1FVVA 2R7IA 4BDHA 2JD5A 4KNBA 4HGTA 3NIEA 4FGRA 2J5FA 4L3PA 3E88A 2XARA 1AQ1A 3MVLA 1OM1A 1TQPA 3U9CA 3S0OA 1JWHA 4ENYA 4EOKA 3SG9A 4IZ7A 2VTSA 4APCA 4XRLA 4GT5A 4LMNA 2GQGA 5J95A 3PXKA 3FKNA 4FEXA 5IQGA 4QP3A 3PFYA 3E3BX 4DGNA 5E9EA 2RSVA 3CD8A 3IONA 5KMMA 4QYYA 4XP0A 4CYJA 3H9RA 3G15A 2C3LA 4IWPA 1M52A 4FTUA 5FTOA 4L43A 5M4IA 1ZYDA 2QLQA 1KOAA 4E6CA 3LVPA 3QRJA 5K5NA 3I0OA 3JUHA 5KMJA 5L2WA 1YDRE 2OH4A 2WEIA 3WF7A 5EDQA 1IRKA 5D41A 4EI4A 4Z55A 3KMWA 5CSPA 5HLPA 3QQHA 4L42A 4FT3A 4QPMA 2RIOA 2IW8A 2VN9A 4FZFB 4L6QA 2OH0E 5BNJA