3FMYA

Structure of the c-terminal domain of the e. coli protein mqsa (ygit/b3021)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
66
structure length
65
Chain Sequence
AETVAPEFIVKVRKKLSLTQKEASEIFGGGVNAFSRYEKGNAPHPSTIKLLRVLDKHPELLNEIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator MQSA (ygiT/b3021)
total genus 21
structure length 65
sequence length 66
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 3fmyA00
2CROA 2LYRA 4MCTA 1S7EA 1Y7YA 2XI8A 4PU7A 3F51A 5K98B 1RZSA 3PXPA 2H8RA 2R63A 1ZUGA 1QP0A 1QP7A 4MCXA 2KZ8A 2GRLA 2L8NA 1LLIA 1PERL 2JVLA 4J1WA 1JFTA 1POUA 3OP9A 1GT0C 1DW9A 3ZKCA 2LCVA 2OFYA 1QQBA 3RZZA 1R63A 1JH9A 1WIZA 2BJCA 1ZS4A 2LYQA 2IVQA 3R1FA 1LCDA 4GQMA 4IA8A 3SCHA 2MEZA 3EUSA 1IC8A 3VK0A 1X57A 3ZHMA 2EF8A 3GN5A 1ZZBA 3QF3A 4X4DA 4I6TA 4X4EA 1O4XA 1ZVVA 2HSGA 2PUGA 1JFSA 2AXUA 4O8BA 1QQAA 1LCCA 3S8QA 4YARA 2D5VA 2FJRA 4Y42A 4J1XA 3OQOA 2KPJA 2LYLA 2PE5A 3IVPA 1UXCA 2IVBA 3HZIB 4FN3A 1SQ8A 1CQTA 3L1PA 1EFAA 1ZZ9A 2BNOA 4I6UA 4F8DA 1JWLA 2PUFA 1PRUA 3GBFA 4YG4A 2AXVA 2PIJA 1RPEL 3TRBA 1RIOA 3JXCL 3ZHIA 3DNVB 3KZ3A 1AU7A 4FBIA 2XCJA 3F52A 3G5GA 1R69A 1YSEA 4X4HA 1PRVA 4OB4A 1HF0A 3JXDL 2LYJA 4YG7B 1OCTC 2L49A 1LMB3 4X4GA 2GZUA 1BDIA 4Z5DA 1XWRA 2KEIA 1UXDA 1WH6A 3BS3A 4X4BA 2OR1L 4PU8A 1ZAYA 3KJXA 3FYAA 1NEQA 2IV1A 3UFDA 3QWGA 1OSLA 2O4AA 2XIUA 3H5TA 2IUOA 2CSFA 1ZZ7A 4IVZA 2PUDA 3GN5B 1RZRD 3MLFA 1CJGA 3O9XA 4YBAA 2WIUB 1NERA 2PUEA 3SCGA 2EBYA 3QQ6A 2R1JL 3JXBC 2PUAA 1BDHA 1QPZA 4Z5CA 1LQCA 3F6WA 3SCFA 4X4CA 4JQDA 1ZZCA 3FMYA 1ZPQA 1RZRA 2KEKA 3OQMA 2MQKA 4JCXA 2XSDC 1Y9QA 4PU3C 2AXZA 1X2LA 4PU4C 1DWKA 2O38A 3LFPA 4I6RA 3G7DA 2PPXA 2AWIA 1ZZ8A 4Z59A 1QP4A 2PUBA 2XJ3A 3KXAA 1VPWA 4IWRA 1WETA 2BNNA 3B7HA 3U3WA 2ICPA 4I8TA 2O49A 4JCYA 2A6CA 1L1MA 2GRMA 3CECA 3LISA 1B0NA 2AUWA 2IVGA 1E3OC 2AW6A 2EWTA 3FYMA 2BNMA 2KEJA 4GHJA 3BDNA 1ZZ6A 2IU7A 3BD1A 1ADRA 2HINA 1PRAA 4NDWA 2LYSA 5A7LA 4YG1A 2LYPA 2WUSR 4X4IA 2PUCA 1WH8A 2JCGA 4X4FA 2B5AA 1UTXA 3OQNA 3CROL 3QYXA 3OMTA 4Z5HA 3D1NI 2ICTA 4Z58A 3CLCA 1PNRA 2LYKA
chains in the Genus database with same CATH superfamily
5K98B 1QP7A 2KZ8A 4J1WA 1JFTA 5DTMA 4EZIA 3ZKCA 3RZZA 3ME5A 1ZS4A 2LYQA 3NROA 5DT2A 2FFHA 1JFSA 2D5VA 2LLVA 1QQAA 2XXAA 2FJRA 2KPJA 2IVBA 3HZIB 3L1PA 2BNOA 1JWLA 1RIOA 3F52A 3LQXA 4YG7B 1LMB3 4X4GA 2GZUA 1UXDA 3BS3A 4X4BA 4PU8A 1NEQA 4ER3A 2CSFA 4IVZA 3SR4A 3QOWA 2WIUB 2EBYA 3QQ6A 2V3CC 3R09A 3F6WA 1ZPQA 3VWSA 2MQKA 2PXDA 1Y9QA 3G7DA 3A9XA 5GAGi 5DRYA 3B7HA 1U2ZA 4I8TA 3LISA 1B0NA 2IVGA 4EQZA 1E3OC 2EWTA 4ER7A 2PXBA 3BDNA 2IU7A 3OKZA 2WUSR 1UTXA 3OMTA 4Z5HA 2ICTA 2LYKA 2CROA 2LYRA 2PXEA 2XI8A 1RZSA 3PXPA 2H8RA 1QP0A 4MCXA 1LLIA 1PERL 1DW9A 2LCVA 2OFYA 1QQBA 1WIZA 3GUUA 5JUWA 3R1FA 4GQMA 3A9YA 1IC8A 3TELA 3ZHMA 1ZZBA 3QF3A 1ZVVA 4I6TA 1O4XA 4YARA 3OQOA 2LNMA 2LYLA 3IVPA 1UXCA 4EKGA 1CQTA 2MXDA 4I6UA 1DULA 1RPEL 1MFQC 1R69A 4OB4A 1OCTC 2LYJA 1BDIA 4Z5DA 3FYAA 3UFDA 1OSLA 2M4HA 2XIUA 2IUOA 1ZZ7A 3NDBB 3MLFA 3GZDA 3JXBC 2J7WA 1BDHA 1ZZCA 2PXPA 1RZRA 2KEKA 1HQ1A 3OQMA 2XSDC 1X2LA 3LFPA 4I6RA 1QP4A 3KL4A 4ER6A 1VPWA 4IWRA 3OWQA 2O49A 4JCYA 1L1MA 3FYMA 2XXPA 1ADRA 2HINA 4NDWA 2LYSA 4YG1A 4X4FA 2B5AA 3CROL 2LLWA 3TEPA 4MCTA 1S7EA 3F51A 1ZUGA 1POUA 2J7UA 3OP9A 1GT0C 1R63A 4HRAA 4WVLA 2BJCA 1LCDA 3SCHA 1QZXA 2MEZA 3EUSA 1X57A 2EF8A 3GN5A 2HSGA 2PXFA 4O8BA 3S8QA 3M9LA 4FN3A 1SQ8A 1ZZ9A 2PUFA 1PRUA 3GBFA 3TRBA 3JXCL 3ZHIA 3DNVB 3KZ3A 3NZLA 1AU7A 2PXUA 3G5GA 3A9ZA 4X4HA 1HF0A 2PXQA 1XWRA 2OR1L 1ZAYA 3KJXA 2IV1A 2VEOA 2O4AA 3H5TA 2PXTA 3MEJA 3O9XA 1CJGA 1NERA 5DSXA 3SCGA 3TFLA 2R1JL 4EK9A 2PUAA 1QPZA 3SCFA 4JQDA 3G0TA 4JCXA 2AXZA 1DWKA 2O38A 4OBMA 2PPXA 2HCNA 2PUBA 2XJ3A 1WETA 2BNNA 3U3WA 2ICPA 3UWPA 2GRMA 3CECA 2HCSA 2AUWA 5DTQA 2BNMA 4GHJA 1ZZ6A 1PRAA 2PUCA 5A7LA 2LYPA 1WH8A 2JCGA 3OQNA 4DE8A 3NXHA 2JQEA 1Y7YA 4PU7A 2R63A 2GRLA 1QB2A 2L8NA 4Q2JA 2JVLA 1JH9A 2IVQA 4IA8A 3VK0A 4X4DA 4X4EA 2PUGA 2AXUA 2YBDA 1LCCA 4Y42A 4J1XA 2PE5A 1EFAA 4ER0A 4F8DA 4YG4A 3SX0A 3ZPXA 2AXVA 2PIJA 4FBIA 2XCJA 1YSEA 1PRVA 3JXDL 2PXVA 2L49A 3GZDC 2KEIA 5DRTA 1WH6A 3QWGA 2PUDA 2L1PA 3GN5B 1RZRD 4YBAA 3QOXA 2PUEA 2PXKA 2PXLA 4Z5CA 5GAHi 1LQCA 3PE5A 4X4CA 3FMYA 3DM5A 4PU3C 2XXQA 4PU4C 1NW3A 3GZCA 2AWIA 1ZZ8A 4Z59A 3KXAA 3QFIA 2A6CA 2ODRD 2AW6A 5DTRA 2KEJA 3BD1A 4EKIA 4DE9A 4X4IA 2HFZA 3QYXA 3CLCA 4ER5A 3D1NI 4Z58A 1PNRA
chains in the Genus database with same CATH topology
2CROA 2LYRA 4MCTA 1S7EA 1Y7YA 2XI8A 4PU7A 3F51A 5K98B 1RZSA 3PXPA 2H8RA 2R63A 1ZUGA 1QP0A 1QP7A 4MCXA 2KZ8A 2GRLA 2L8NA 1LLIA 1PERL 2JVLA 4J1WA 1JFTA 1POUA 3OP9A 1GT0C 1DW9A 3ZKCA 2LCVA 2OFYA 1QQBA 3RZZA 1R63A 1JH9A 1WIZA 2BJCA 1ZS4A 2LYQA 2IVQA 3R1FA 1LCDA 4GQMA 4IA8A 3SCHA 2MEZA 3EUSA 1IC8A 3VK0A 1X57A 3ZHMA 2EF8A 3GN5A 1ZZBA 3QF3A 4X4DA 4I6TA 4X4EA 1O4XA 1ZVVA 2HSGA 2PUGA 1JFSA 2AXUA 4O8BA 1QQAA 1LCCA 3S8QA 4YARA 2D5VA 2FJRA 4Y42A 4J1XA 3OQOA 2KPJA 2LYLA 2PE5A 3IVPA 1UXCA 2IVBA 3HZIB 4FN3A 1SQ8A 1CQTA 3L1PA 1EFAA 1ZZ9A 2BNOA 4I6UA 4F8DA 1JWLA 2PUFA 1PRUA 3GBFA 4YG4A 2AXVA 2PIJA 1RPEL 3TRBA 1RIOA 3JXCL 3ZHIA 3DNVB 3KZ3A 1AU7A 4FBIA 2XCJA 3F52A 3G5GA 1R69A 1YSEA 4X4HA 1PRVA 4OB4A 1HF0A 3JXDL 2LYJA 4YG7B 1OCTC 2L49A 1LMB3 4X4GA 2GZUA 1BDIA 4Z5DA 1XWRA 2KEIA 1UXDA 1WH6A 3BS3A 4X4BA 2OR1L 4PU8A 1ZAYA 3KJXA 3FYAA 1NEQA 2IV1A 3UFDA 3QWGA 1OSLA 2O4AA 2XIUA 3H5TA 2IUOA 2CSFA 1ZZ7A 4IVZA 2PUDA 3GN5B 1RZRD 3MLFA 1CJGA 3O9XA 4YBAA 2WIUB 1NERA 2PUEA 3SCGA 2EBYA 3QQ6A 2R1JL 3JXBC 2PUAA 1BDHA 1QPZA 4Z5CA 1LQCA 3F6WA 3SCFA 4X4CA 4JQDA 1ZZCA 3FMYA 1ZPQA 1RZRA 2KEKA 3OQMA 2MQKA 4JCXA 2XSDC 1Y9QA 4PU3C 2AXZA 1X2LA 4PU4C 1DWKA 2O38A 3LFPA 4I6RA 3G7DA 2PPXA 2AWIA 1ZZ8A 4Z59A 1QP4A 2PUBA 2XJ3A 3KXAA 1VPWA 4IWRA 1WETA 2BNNA 3B7HA 3U3WA 2ICPA 4I8TA 2O49A 4JCYA 2A6CA 1L1MA 2GRMA 3CECA 3LISA 1B0NA 2AUWA 2IVGA 1E3OC 2AW6A 2EWTA 3FYMA 2BNMA 2KEJA 4GHJA 3BDNA 1ZZ6A 2IU7A 3BD1A 1ADRA 2HINA 1PRAA 4NDWA 2LYSA 5A7LA 4YG1A 2LYPA 2WUSR 4X4IA 2PUCA 1WH8A 2JCGA 4X4FA 2B5AA 1UTXA 3OQNA 3CROL 3QYXA 3OMTA 4Z5HA 3D1NI 2ICTA 4Z58A 3CLCA 1PNRA 2LYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRO A;  2LYR A;  4MCT A;  1S7E A;  1Y7Y A;  2XI8 A;  4PU7 A;  3F51 A;  5K98 B;  1RZS A;  3PXP A;  2H8R A;  2R63 A;  1ZUG A;  1QP0 A;  1QP7 A;  4MCX A;  2KZ8 A;  2GRL A;  2L8N A;  1LLI A;  1PER L;  2JVL A;  4J1W A;  1JFT A;  1POU A;  3OP9 A;  1GT0 C;  1DW9 A;  3ZKC A;  2LCV A;  2OFY A;  1QQB A;  3RZZ A;  1R63 A;  1JH9 A;  1WIZ A;  2BJC A;  1ZS4 A;  2LYQ A;  2IVQ A;  3R1F A;  1LCD A;  4GQM A;  4IA8 A;  3SCH A;  2MEZ A;  3EUS A;  1IC8 A;  3VK0 A;  1X57 A;  3ZHM A;  2EF8 A;  3GN5 A;  1ZZB A;  3QF3 A;  4X4D A;  4I6T A;  4X4E A;  1O4X A;  1ZVV A;  2HSG A;  2PUG A;  1JFS A;  2AXU A;  4O8B A;  1QQA A;  1LCC A;  3S8Q A;  4YAR A;  2D5V A;  2FJR A;  4Y42 A;  4J1X A;  3OQO A;  2KPJ A;  2LYL A;  2PE5 A;  3IVP A;  1UXC A;  2IVB A;  3HZI B;  4FN3 A;  1SQ8 A;  1CQT A;  3L1P A;  1EFA A;  1ZZ9 A;  2BNO A;  4I6U A;  4F8D A;  1JWL A;  2PUF A;  1PRU A;  3GBF A;  4YG4 A;  2AXV A;  2PIJ A;  1RPE L;  3TRB A;  1RIO A;  3JXC L;  3ZHI A;  3DNV B;  3KZ3 A;  1AU7 A;  4FBI A;  2XCJ A;  3F52 A;  3G5G A;  1R69 A;  1YSE A;  4X4H A;  1PRV A;  4OB4 A;  1HF0 A;  3JXD L;  2LYJ A;  4YG7 B;  1OCT C;  2L49 A;  1LMB 3;  4X4G A;  2GZU A;  1BDI A;  4Z5D A;  1XWR A;  2KEI A;  1UXD A;  1WH6 A;  3BS3 A;  4X4B A;  2OR1 L;  4PU8 A;  1ZAY A;  3KJX A;  3FYA A;  1NEQ A;  2IV1 A;  3UFD A;  3QWG A;  1OSL A;  2O4A A;  2XIU A;  3H5T A;  2IUO A;  2CSF A;  1ZZ7 A;  4IVZ A;  2PUD A;  3GN5 B;  1RZR D;  3MLF A;  1CJG A;  3O9X A;  4YBA A;  2WIU B;  1NER A;  2PUE A;  3SCG A;  2EBY A;  3QQ6 A;  2R1J L;  3JXB C;  2PUA A;  1BDH A;  1QPZ A;  4Z5C A;  1LQC A;  3F6W A;  3SCF A;  4X4C A;  4JQD A;  1ZZC A;  3FMY A;  1ZPQ A;  1RZR A;  2KEK A;  3OQM A;  2MQK A;  4JCX A;  2XSD C;  1Y9Q A;  4PU3 C;  2AXZ A;  1X2L A;  4PU4 C;  1DWK A;  2O38 A;  3LFP A;  4I6R A;  3G7D A;  2PPX A;  2AWI A;  1ZZ8 A;  4Z59 A;  1QP4 A;  2PUB A;  2XJ3 A;  3KXA A;  1VPW A;  4IWR A;  1WET A;  2BNN A;  3B7H A;  3U3W A;  2ICP A;  4I8T A;  2O49 A;  4JCY A;  2A6C A;  1L1M A;  2GRM A;  3CEC A;  3LIS A;  1B0N A;  2AUW A;  2IVG A;  1E3O C;  2AW6 A;  2EWT A;  3FYM A;  2BNM A;  2KEJ A;  4GHJ A;  3BDN A;  1ZZ6 A;  2IU7 A;  3BD1 A;  1ADR A;  2HIN A;  1PRA A;  4NDW A;  2LYS A;  5A7L A;  4YG1 A;  2LYP A;  2WUS R;  4X4I A;  2PUC A;  1WH8 A;  2JCG A;  4X4F A;  2B5A A;  1UTX A;  3OQN A;  3CRO L;  3QYX A;  3OMT A;  4Z5H A;  3D1N I;  2ICT A;  4Z58 A;  3CLC A;  1PNR A;  2LYK A; 
#chains in the Genus database with same CATH topology
 5K98 B;  1QP7 A;  2KZ8 A;  4J1W A;  1JFT A;  5DTM A;  4EZI A;  3ZKC A;  3RZZ A;  3ME5 A;  1ZS4 A;  2LYQ A;  3NRO A;  5DT2 A;  2FFH A;  1JFS A;  2D5V A;  2LLV A;  1QQA A;  2XXA A;  2FJR A;  2KPJ A;  2IVB A;  3HZI B;  3L1P A;  2BNO A;  1JWL A;  1RIO A;  3F52 A;  3LQX A;  4YG7 B;  1LMB 3;  4X4G A;  2GZU A;  1UXD A;  3BS3 A;  4X4B A;  4PU8 A;  1NEQ A;  4ER3 A;  2CSF A;  4IVZ A;  3SR4 A;  3QOW A;  2WIU B;  2EBY A;  3QQ6 A;  2V3C C;  3R09 A;  3F6W A;  1ZPQ A;  3VWS A;  2MQK A;  2PXD A;  1Y9Q A;  3G7D A;  3A9X A;  5GAG i;  5DRY A;  3B7H A;  1U2Z A;  4I8T A;  3LIS A;  1B0N A;  2IVG A;  4EQZ A;  1E3O C;  2EWT A;  4ER7 A;  2PXB A;  3BDN A;  2IU7 A;  3OKZ A;  2WUS R;  1UTX A;  3OMT A;  4Z5H A;  2ICT A;  2LYK A;  2CRO A;  2LYR A;  2PXE A;  2XI8 A;  1RZS A;  3PXP A;  2H8R A;  1QP0 A;  4MCX A;  1LLI A;  1PER L;  1DW9 A;  2LCV A;  2OFY A;  1QQB A;  1WIZ A;  3GUU A;  5JUW A;  3R1F A;  4GQM A;  3A9Y A;  1IC8 A;  3TEL A;  3ZHM A;  1ZZB A;  3QF3 A;  1ZVV A;  4I6T A;  1O4X A;  4YAR A;  3OQO A;  2LNM A;  2LYL A;  3IVP A;  1UXC A;  4EKG A;  1CQT A;  2MXD A;  4I6U A;  1DUL A;  1RPE L;  1MFQ C;  1R69 A;  4OB4 A;  1OCT C;  2LYJ A;  1BDI A;  4Z5D A;  3FYA A;  3UFD A;  1OSL A;  2M4H A;  2XIU A;  2IUO A;  1ZZ7 A;  3NDB B;  3MLF A;  3GZD A;  3JXB C;  2J7W A;  1BDH A;  1ZZC A;  2PXP A;  1RZR A;  2KEK A;  1HQ1 A;  3OQM A;  2XSD C;  1X2L A;  3LFP A;  4I6R A;  1QP4 A;  3KL4 A;  4ER6 A;  1VPW A;  4IWR A;  3OWQ A;  2O49 A;  4JCY A;  1L1M A;  3FYM A;  2XXP A;  1ADR A;  2HIN A;  4NDW A;  2LYS A;  4YG1 A;  4X4F A;  2B5A A;  3CRO L;  2LLW A;  3TEP A;  4MCT A;  1S7E A;  3F51 A;  1ZUG A;  1POU A;  2J7U A;  3OP9 A;  1GT0 C;  1R63 A;  4HRA A;  4WVL A;  2BJC A;  1LCD A;  3SCH A;  1QZX A;  2MEZ A;  3EUS A;  1X57 A;  2EF8 A;  3GN5 A;  2HSG A;  2PXF A;  4O8B A;  3S8Q A;  3M9L A;  4FN3 A;  1SQ8 A;  1ZZ9 A;  2PUF A;  1PRU A;  3GBF A;  3TRB A;  3JXC L;  3ZHI A;  3DNV B;  3KZ3 A;  3NZL A;  1AU7 A;  2PXU A;  3G5G A;  3A9Z A;  4X4H A;  1HF0 A;  2PXQ A;  1XWR A;  2OR1 L;  1ZAY A;  3KJX A;  2IV1 A;  2VEO A;  2O4A A;  3H5T A;  2PXT A;  3MEJ A;  3O9X A;  1CJG A;  1NER A;  5DSX A;  3SCG A;  3TFL A;  2R1J L;  4EK9 A;  2PUA A;  1QPZ A;  3SCF A;  4JQD A;  3G0T A;  4JCX A;  2AXZ A;  1DWK A;  2O38 A;  4OBM A;  2PPX A;  2HCN A;  2PUB A;  2XJ3 A;  1WET A;  2BNN A;  3U3W A;  2ICP A;  3UWP A;  2GRM A;  3CEC A;  2HCS A;  2AUW A;  5DTQ A;  2BNM A;  4GHJ A;  1ZZ6 A;  1PRA A;  2PUC A;  5A7L A;  2LYP A;  1WH8 A;  2JCG A;  3OQN A;  4DE8 A;  3NXH A;  2JQE A;  1Y7Y A;  4PU7 A;  2R63 A;  2GRL A;  1QB2 A;  2L8N A;  4Q2J A;  2JVL A;  1JH9 A;  2IVQ A;  4IA8 A;  3VK0 A;  4X4D A;  4X4E A;  2PUG A;  2AXU A;  2YBD A;  1LCC A;  4Y42 A;  4J1X A;  2PE5 A;  1EFA A;  4ER0 A;  4F8D A;  4YG4 A;  3SX0 A;  3ZPX A;  2AXV A;  2PIJ A;  4FBI A;  2XCJ A;  1YSE A;  1PRV A;  3JXD L;  2PXV A;  2L49 A;  3GZD C;  2KEI A;  5DRT A;  1WH6 A;  3QWG A;  2PUD A;  2L1P A;  3GN5 B;  1RZR D;  4YBA A;  3QOX A;  2PUE A;  2PXK A;  2PXL A;  4Z5C A;  5GAH i;  1LQC A;  3PE5 A;  4X4C A;  3FMY A;  3DM5 A;  4PU3 C;  2XXQ A;  4PU4 C;  1NW3 A;  3GZC A;  2AWI A;  1ZZ8 A;  4Z59 A;  3KXA A;  3QFI A;  2A6C A;  2ODR D;  2AW6 A;  5DTR A;  2KEJ A;  3BD1 A;  4EKI A;  4DE9 A;  4X4I A;  2HFZ A;  3QYX A;  3CLC A;  4ER5 A;  3D1N I;  4Z58 A;  1PNR A; 
#chains in the Genus database with same CATH homology
 2CRO A;  2LYR A;  4MCT A;  1S7E A;  1Y7Y A;  2XI8 A;  4PU7 A;  3F51 A;  5K98 B;  1RZS A;  3PXP A;  2H8R A;  2R63 A;  1ZUG A;  1QP0 A;  1QP7 A;  4MCX A;  2KZ8 A;  2GRL A;  2L8N A;  1LLI A;  1PER L;  2JVL A;  4J1W A;  1JFT A;  1POU A;  3OP9 A;  1GT0 C;  1DW9 A;  3ZKC A;  2LCV A;  2OFY A;  1QQB A;  3RZZ A;  1R63 A;  1JH9 A;  1WIZ A;  2BJC A;  1ZS4 A;  2LYQ A;  2IVQ A;  3R1F A;  1LCD A;  4GQM A;  4IA8 A;  3SCH A;  2MEZ A;  3EUS A;  1IC8 A;  3VK0 A;  1X57 A;  3ZHM A;  2EF8 A;  3GN5 A;  1ZZB A;  3QF3 A;  4X4D A;  4I6T A;  4X4E A;  1O4X A;  1ZVV A;  2HSG A;  2PUG A;  1JFS A;  2AXU A;  4O8B A;  1QQA A;  1LCC A;  3S8Q A;  4YAR A;  2D5V A;  2FJR A;  4Y42 A;  4J1X A;  3OQO A;  2KPJ A;  2LYL A;  2PE5 A;  3IVP A;  1UXC A;  2IVB A;  3HZI B;  4FN3 A;  1SQ8 A;  1CQT A;  3L1P A;  1EFA A;  1ZZ9 A;  2BNO A;  4I6U A;  4F8D A;  1JWL A;  2PUF A;  1PRU A;  3GBF A;  4YG4 A;  2AXV A;  2PIJ A;  1RPE L;  3TRB A;  1RIO A;  3JXC L;  3ZHI A;  3DNV B;  3KZ3 A;  1AU7 A;  4FBI A;  2XCJ A;  3F52 A;  3G5G A;  1R69 A;  1YSE A;  4X4H A;  1PRV A;  4OB4 A;  1HF0 A;  3JXD L;  2LYJ A;  4YG7 B;  1OCT C;  2L49 A;  1LMB 3;  4X4G A;  2GZU A;  1BDI A;  4Z5D A;  1XWR A;  2KEI A;  1UXD A;  1WH6 A;  3BS3 A;  4X4B A;  2OR1 L;  4PU8 A;  1ZAY A;  3KJX A;  3FYA A;  1NEQ A;  2IV1 A;  3UFD A;  3QWG A;  1OSL A;  2O4A A;  2XIU A;  3H5T A;  2IUO A;  2CSF A;  1ZZ7 A;  4IVZ A;  2PUD A;  3GN5 B;  1RZR D;  3MLF A;  1CJG A;  3O9X A;  4YBA A;  2WIU B;  1NER A;  2PUE A;  3SCG A;  2EBY A;  3QQ6 A;  2R1J L;  3JXB C;  2PUA A;  1BDH A;  1QPZ A;  4Z5C A;  1LQC A;  3F6W A;  3SCF A;  4X4C A;  4JQD A;  1ZZC A;  3FMY A;  1ZPQ A;  1RZR A;  2KEK A;  3OQM A;  2MQK A;  4JCX A;  2XSD C;  1Y9Q A;  4PU3 C;  2AXZ A;  1X2L A;  4PU4 C;  1DWK A;  2O38 A;  3LFP A;  4I6R A;  3G7D A;  2PPX A;  2AWI A;  1ZZ8 A;  4Z59 A;  1QP4 A;  2PUB A;  2XJ3 A;  3KXA A;  1VPW A;  4IWR A;  1WET A;  2BNN A;  3B7H A;  3U3W A;  2ICP A;  4I8T A;  2O49 A;  4JCY A;  2A6C A;  1L1M A;  2GRM A;  3CEC A;  3LIS A;  1B0N A;  2AUW A;  2IVG A;  1E3O C;  2AW6 A;  2EWT A;  3FYM A;  2BNM A;  2KEJ A;  4GHJ A;  3BDN A;  1ZZ6 A;  2IU7 A;  3BD1 A;  1ADR A;  2HIN A;  1PRA A;  4NDW A;  2LYS A;  5A7L A;  4YG1 A;  2LYP A;  2WUS R;  4X4I A;  2PUC A;  1WH8 A;  2JCG A;  4X4F A;  2B5A A;  1UTX A;  3OQN A;  3CRO L;  3QYX A;  3OMT A;  4Z5H A;  3D1N I;  2ICT A;  4Z58 A;  3CLC A;  1PNR A;  2LYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...