3FMZA

Crystal structure of retinol-binding protein 4 (rbp4) in complex with non-retinoid ligand
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
174
structure length
174
Chain Sequence
b'ERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLARQYRLIVHNGYC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Retinol-binding protein 4
publication title Identification and Characterization of a Non-retinoid Ligand for Retinol-binding Protein 4 Which Lowers Serum Retinol-binding Protein 4 Levels in Vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 3fmzA00
5HCDC 3CR6A 4YFRA 3ELXA 4IB6A 1CBRA 2AT0X 1SXXA 4ORXA 4YDAA 2R56A 1LICA 4QGWA 4YCHA 4EEJA 2E4JA 4GETA 1OBUA 1U18A 1MVGA 4IB8A 1A57A 4XMCA 3BX7A 2QO5A 3FW5A 4OS3A 4ZHGA 4ZFXA 1QWDA 2MJIA 2NNDA 2FS7A 1KT6A 3DTQA 4YKOA 4IAXA 2ALLX 3G7XA 2KTDA 3APUA 1Z24A 5EEDA 1ZNLA 1IKEA 1TOUA 1R0UA 4NNTA 5HCEC 4A60A 3BRNA 3O2YA 1JYJA 3WXQA 5F6ZA 2ACOA 4OS0A 2HMBA 5H8TA 4GKCA 1OEEA 2MO5A 3FR5A 4NP1A 4XMFA 1ERBA 3HWFA 1GXAA 4ZCBA 5BVQA 3FA7A 3TF6A 5EPQA 2RCTA 3BLGA 5HBSA 2FLJA 4QYNA 1ACDA 2R74A 2WSJA 1VYFA 2XSTA 2CZUA 3FIQA 3B2IA 2WR6A 3IFBA 1AQBA 4TNNA 4ALOA 5H9NA 4ORWA 5KIDA 1SXWA 1HBQA 1ICMA 2L67A 2Q2PA 3KZAA 2QM9A 4XMGA 1QQSA 1AB0A 3FW4A 5BVSA 2POAA 4ZHCA 2L9CA 3FA6A 4EXZA 1UREA 5H9KA 4GNYA 3NX1A 1D2UA 3JS1A 1D3SA 3FMZA 4TKBA 1LFOA 3K3LA 2L68A 3APXA 1AELA 1DZMA 2LB6A 5HCCC 4ZHFA 1RBPA 4ARHA 4BOEA 1O1VA 2WUTA 1GT1A 1EPBA 1QY2A 2K23A 1YP7A 2Q9SA 1ZRYA 5D48A 2RA6A 3BU1A 3BY0A 4UU3A 4BQUA 1O8VA 2RD7C 2Q4NA 1ADLA 2OFMX 3NQ9A 4YBPA 1GM6A 4EDEA 1PEEA 1JYDA 2LBAA 1EQDA 4ORRA 1LIDA 4LZUA 1ZNGA 4D6AA 3CWKA 2OFRX 3RZYA 4QGVA 4GNWA 1E06A 2A3FX 4AW8A 4QAEA 3FEPA 3DSZA 3B2LA 1HQPA 4UU2A 1FE3A 1X8OA 3VG2A 5L8IA 1SY1A 5F6BA 1UZ2X 3FEKA 1BRQA 3BS2A 1JBHA 1YUPA 4I3DA 1KT3A 1PMPA 3WVMA 2LBVA 1NP1A 4AZPA 1DZKA 1O1UA 1U0XA 3KQ0A 4A8ZA 1VYGA 3PECA 3UEUA 3WJBA 3TGCA 5EDCA 1JZUA 1DZPA 5DPQA 3HWGA 1IFCA 4QZUA 3U03A 1CBSA 3FA8A 2HLVA 2ANSA 3HWDA 5L8NA 1ICNA 1P6PA 5DG4A 1E00A 2AL0X 3B2HA 1DZJA 3L4RA 1A3YA 1DC9A 3WJGA 3P6DA 3GAQA 4YFQA 1HBPA 2R73A 1SY2A 3EBKA 1MDCA 3S26A 4ZR2A 3O19A 4ZH6A 2AKQA 1FELA 2AT3X 4IB7A 1B8EA 4GRJA 1YIVA 1QG5A 1DFVA 5AQ6A 3P6CA 4A1YA 2FR3A 1G5WA 2OZQA 4YGGA 3TGAA 4TKHA 5LJKA 3WJDA 1OEJA 3VG7A 5IO5A 2WEXA 3APVA 5F1EA 1MX8A 5F58A 1EALA 4ZHDA 5L8OA 1YWCA 2KT4B 4MVIA 3D95A 2YG2A 3FA9A 1NGLA 1I04A 2CM9A 4Y0RA 3FR4A 1CBIA 1YWBA 2QOSC 4MVLA 4NNSA 3WJCA 1RLBE 1IKJA 1SY0A 2LFOA 3VG3A 1TVQA 1EPAA 3F8AA 4O9SA 3RSWA 1I05A 4IMOA 1S2PA 4YCEA 2MM3A 4HPCA 5IO6A 1E02A 1IIUA 2L5PA 2FTBA 4YKMA 4A1HA 1GGLA 4LKPA 1DV9A 1EUOA 1A18A 1ALBA 1GT5A 2JU8A 2OVAA 3EBWA 4ODDA 1ZNDA 4AZMA 2AT6X 1B56A 3KFHA 4YFPA 5LJEA 1GKAA 1KT5A 3AKNA 3U9PC 3BX8A 3KFFA 3PPTA 1FDQA 5D4AA 1BJ7A 1QY0A 4YGZA 5FAZA 1I06A 2ACPX 5HTDA 1OEKA 3B2KA 4I3CA 4XMEA 2HNXA 3PEDA 4I3BA 1QFTA 1BRPA 3BSZE 4LZVA 1ERXA 2PY1A 3CBCA 1YWAA 2K62A 2O62A 4YDBA 2A0AA 3NADA 1OPAA 4AZOA 1PM1X 1KXOA 4NYRA 1HN2A 4CK4A 3T1DA 5EDBA 5D45A 1LPJA 3JSQA 1NP4A 2A13A 3NQ3A 1N0SA 1GX8A 1ZNEA 5EZ2A 4OS8A 3HWEA 3WJFA 1LIBA 1HMSA 4MVKA 5K06A 5KICA 2FR2A 2X46A 5HTEA 1BM5A 4I9RA 4TJZA 4XMHA 4HFOA 4YH0A 2QO6A 1XCAA 5LKFA 2IFBA 3FELA 2A2UA 3P6FA 1EXSA 1QY1A 2LKKA 4ZHHA 1S7DA 1OBQA 2GC9A 1MUPA 4RUUA 3VG5A 2OVEA 5IO7A 4IB9A 2RQ0A 3F9DA 3WBGA 3C78X 4R0BA 1CJ5A 4HPDA 1ML7A 5EEEA 4IBAA 2OVDA 5HZ5A 1EW3A 3CQRA 4IAWA 3U0DA 3WJEA 1T8VA 4WBKA 2CZTA 1X8PA 3EYCA 1AVGI 3VG4A 5HAEA 1ZNHA 4IMNA 3AKMA 4WFUA 3PH5A 5FFHA 5HZ6A 1X8NA 1XKIA 3NPOA 1KQXA 5HZQA 3QKGA 3SAOA 4YGHA 5B27A 4ES7A 3P6EA 2W2AA 3IA8A 2HZQA 4N7DA 1LIEA 4WFVA 1VPRA 1KT7A 2WQAE 3CMPA 3STNA 3PP6A 1SXUA 4OMXA 1PBOA 3UEWA 4TQ2A 5HZ8A 1EIIA 5F7GA 3UEXA 1TOWA 4ZGUA 1ZNKA 1FTPA 4ZJ0A 1QFVA 3STMX 2EU7X 1DF3A 2F73A 5LJHA 3P6GA 4DQ4A 3STKA 4QGXA 4XMDA 4AZNA 3HK1A 4I9SA 2AH7X 1MX7A 4LKTA 4AZQA 2W2BA 1G7NA 1GX9A 2FWVA 2JU7A 5H9LA 5LJGA 2ASNX 4ORUA 1BSQA 3BU9A 4NLJA 1YWDA 5B29A 3D97A 4QZTA 1X8UA 2HZRA 2WQ9A 1KQWA 3CBSA 3C76X 3Q6LA 1FENA 5JR8A 2WWPA 2CBRA 5HWZA 5LJCA 3EMMA 1X89A 2NP1A 4Y0SA 1IFBA 1T0VA 1E5PA 2Q2MA 3FENA 3ZQ3A 1OBPA 4N7CA 1JV4A 1SXYA 2JOZA 3KFIA 4AYHA 1B4MA 3O22A 3APWA 3PH6A 3NX2A 1LF7A 4Y0PA 4YBUA 1BSYA 1S44A 2AT8X 3TZSA 1KT4A 5D47A 2FRSA 1GT3A 4KIIA 5D8JA 5HA1A 4PSQA 4ALBA 3MVFA 1IW2A 5KHPA 1JJXA 3NR3A 3D96A 1T68X 2G78A 1BEBA 2CBSA 1YP6A 3I0AA 3B2JA 3P6HA 1U17A 4ORSA 5LJBA 3KFGA 1BWYA 1KZWA 1TW4A 4NYQA 5H9AA 1L6MA 2GJ5A 2QO4A 1A2DA 5LKEA 2GTFX 3NP1A 1I4UA 1CBQA 4K19A 2DM5A 1LKEA 5BVTA 3I17A 1JJJA 4GH7A 4HPAA 3ELZA 4ZH9A 2Q39A 1KGLA 5LJDA 4EFGA 1SY3A 1G85A 2HYSA 3CQNA 5HA0A 3C77X 4AZRA 1QABE 2P8GA 4NLIA 2JN3A 3FR2A 1OPBA 1FEMA 1X71A 2NNQA 2N93A 2FS6A 3ZUIA 3OJYC 4QYPA 1BBPA 4RUNA 1KOIA 4Y0QA 1LNMA 1SA8A 2AMMX 4HPBA 4TKJA 1LIFA 4ORYA 2X45A 2A2GA 1GKAB 2CM4A 3MBTA 1CRBA 1HMTA 2FT9A 4TLJA 3ZUOA 4DQ3A 4BVMA 3VG6A 4GE1A 1KZXA 1EIOA 4OMWA 1G74A 5C0NA 2AT5X 2G79A 2NNEA 1BSOA 1B0OA 1HMRA 1TXLA 4M7MA 2BLGA 3BDRA 3UEVA 5HZ9A 2W2FA 2XKLA 1H91A 2G7BA 5CE4A 4D6BA 1GT4A 2WEWA 1X8QA 5FENA 1BLRA 4M6SA 3TGBA 3FLLA 2RCQA 3EM0A 4YMYA 2JU3A
chains in the Genus database with same CATH superfamily
5CHKA 5HCDC 3CR6A 3LTWA 4YFRA 3ELXA 2RTBB 4IB6A 4KC7A 1CBRA 5AJCA 5FQ8E 2AT0X 1SXXA 4ORXA 4YDAA 2R56A 1LICA 3RDXA 4QGWA 4YCHA 4EEJA 2E4JA 4GETA 2MF6A 3AEHA 4U3QA 4BCSA 4MISA 3LV4A 4Y5DA 4OELA 1OBUA 1U18A 1MVGA 4IB8A 1A57A 4XMCA 2ZSCA 3BX7A 2QO5A 4GGRA 3FW5A 4OS3A 2MWHA 4ZFXA 4ZHGA 1QWDA 2MJIA 2NNDA 2FS7A 4MEEA 1KT6A 3DTQA 2IZHB 2X8SA 4YKOA 4IAXA 5HZ9A 1N9MA 2ALLX 2QCBA 3G7XA 2IZBA 4GD9A 4Z28A 4CPHB 2KTDA 3APUA 1Z24A 5EEDA 1ZNLA 2F09A 3T6LA 1VWNB 1IKEA 1TOUA 1R0UA 4NNTA 5HCEC 4A60A 2JGSA 1VWPB 3BRNA 1N7YA 1JYJA 3O2YA 3WXQA 2RTAA 5F6ZA 2ACOA 1VWOB 1LUQA 3RKGA 4OS0A 2HMBA 5H8TA 2UZ2A 4GKCA 4KC8A 4Z6JA 1OEEA 1SWPA 2BS5A 2MO5A 3FR5A 2OVSA 2Y32A 4U8UO 4QQ1A 4NP1A 4XMFA 1ERBA 3HWFA 2AVIA 5IRUA 2QMIA 1GXAA 4ZCBA 5BVQA 3FA7A 3TF6A 5EPQA 2RCTA 3RDUA 3BLGA 5HBSA 2FLJA 1K3BA 2KW1A 4QYNA 1ACDA 2R74A 2WSJA 2RTKA 1VYFA 2XSTA 2CZUA 3FIQA 3B2IA 3SLOA 2WR6A 2OYBO 3IFBA 1HXLA 1AQBA 4KT5A 4TNNA 4ALOA 3PQSA 2VFCA 4ORWA 1MM9A 1AVDA 2VFBA 5H9NA 4EQAC 5KIDA 1SXWA 1HBQA 2Y3EA 1ICMA 3EW1A 2L67A 2Q2PA 1SWDA 2RTDB 2GTLO 3KZAA 2QM9A 4XMGA 1QQSA 5CSEA 2KD2A 1AB0A 3FW4A 5BVSA 1PTSA 2POAA 4O4XA 4ZHCA 2L9CA 3FA6A 4EXZA 1UREA 2GH7A 1VWMB 4GNYA 5H9KA 3NX1A 1D2UA 3JS1A 1D3SA 4GGTA 2OY8A 3FMZA 4BX7A 4TKBA 1LFOA 3K3LA 2L68A 3APXA 3WZOA 5HZ5A 1AELA 1DZMA 2LB6A 5HCCC 1JMZA 4ZHFA 1RBPA 4CPFA 4ARHA 4BOEA 1O1VA 2WUTA 4MIRA 1GT1A 1EPBA 1QY2A 2K23A 1YP7A 2Q9SA 4U9CA 3SOTA 3ZZVA 4NV7A 1ZRYA 3CKGA 5D48A 1I78A 2RA6A 3BU1A 4Z2PA 1OSPO 3BY0A 4UU3A 3RE5A 4BQUA 4GDZA 1O8VA 4HWMA 2RD7C 1ADLA 2Q4NA 2OFMX 2Z4HA 3NQ9A 1GM6A 3WYQA 4YBPA 4EDEA 1PEEA 1JYDA 2LBAA 1EQDA 4ORRA 1LIDA 3FIDA 3NBXX 2I5VO 1ZNGA 1SWTA 4LZUA 4D6AA 3CWKA 3HOEA 5BYPA 2OFRX 3RZYA 1Y0GA 5K68A 3VGWA 4GNWA 1E06A 1VYOA 2A3FX 5AJBA 4AW8A 4QAEA 2C1SA 1VWRB 3NQKA 4JNJA 1SLEB 3FEPA 3DSZA 3P02A 2F01A 3OD9A 3B2LA 1SLFB 4I6SA 4O4UA 1HQPA 2G5LA 2IZKA 1Y55X 4NV8A 4UU2A 1FE3A 1X8OA 3VG2A 4U46A 1SY1A 5F6BA 1UZ2X 3MG5A 3FEKA 4KCAA 5L8IA 1BRQA 3BS2A 1JBHA 1YUPA 1SWFA 3S5XA 2IZAA 1DF8A 2JMBA 4I3DA 1KT3A 1PMPA 3WVMA 1W4TA 2LBVA 3S5VA 1NP1A 2FHLA 2RTOB 4AZPA 1DZKA 1O1UA 1SRIA 3LHNA 3RE6A 1U0XA 3KQ0A 4A8ZA 1PBYA 1VYGA 3PECA 3UEUA 2WPUA 3WJBA 3TGCA 5B5FA 5EDCA 1JZUA 2OFBA 1DZPA 4JGLA 4Y59A 5B3MO 3JQOA 5DPQA 3HWGA 1IFCA 2FKGA 3WZNA 4QZUA 1NQNA 3U03A 1CBSA 2M4LA 3D9WA 3FA8A 2HLVA 2ANSA 3HWDA 5L8NA 4BGFA 1ICNA 1P6PA 5DG4A 1E00A 2OL8O 2IZLB 4U8UM 2AL0X 3B2HA 4C5PA 1DZJA 1KL4A 3L4RA 1A3YA 3HTYA 5FQ7E 1DC9A 3S60A 3P6DA 3WJGA 4DNEA 3GAQA 4YFQA 1HBPA 3RDSA 2R73A 1SREA 2VDFA 2CAMA 1SY2A 3EBKA 1MDCA 4BX5A 3S26A 3T6FA 4ZR2A 3O19A 3RBYA 4ZH6A 2AKQA 1FELA 1GX3A 2AT3X 2GTLM 4IB7A 1B8EA 3KVNA 4GRJA 4O3WA 1YIVA 1QG5A 1DFVA 5AQ6A 3P6CA 4A1YA 2FR3A 2X32A 4QRLA 2RTFB 1G5WA 2OF8A 2OZQA 4YGGA 3SLTA 3TGAA 1LCVA 4TKHA 2RTGB 1RXHA 4O3XB 5LJKA 3WJDA 1OEJA 3VG7A 5IO5A 2WEXA 1VWIB 3VHIA 3APVA 5F1EA 1MX8A 5F58A 1EALA 1IJ8A 1MOYA 4MVEA 4ZHDA 5L8OA 1YWCA 3WYPA 1HY2A 2KT4B 3PDFA 4MVIA 2X4MA 1LDQA 2YG2A 3D95A 4L3RA 3FA9A 1NGLA 1I04A 2CM9A 2IZIA 3FR4A 1CBIA 1YWBA 2QOSC 4Y0RA 1VWGB 3VE1A 4MVLA 3FYFA 4NNSA 3WJCA 1FJ1E 1RLBE 1IKJA 2IZEB 1SY0A 2LFOA 3VG3A 5B10O 1SWKA 2AF5A 3EC5A 2C4IA 1JJUA 1TVQA 1EPAA 2RN4A 2RTEB 4BX6A 3F8AA 3GE2A 4O9SA 3RSWA 5IXGA 1E2TA 1I05A 1S2PA 4IMOA 4YCEA 5L3YA 2MM3A 4HPCA 5IO6A 1E02A 1IIUA 2L5PA 2FTBA 4YKMA 4FBOA 4A1HA 1GGLA 4LKPA 1DV9A 1EUOA 1SWHA 1A18A 3OBLA 4FGIB 1ALBA 1GT5A 2JU8A 2OVAA 3CKFA 3EBWA 4ODDA 3X00A 4DCBA 1ZNDA 4AZMA 4BJ8A 2AT6X 1B56A 4CDEA 3KFHA 4YFPA 4L1NA 5LJEA 2RTIB 1GKAA 1KT5A 2KTSA 2RTPB 1STRB 3AKNA 1EI5A 1LCWA 3ZW1A 3U9PC 3BX8A 3KFFA 3PPTA 1FDQA 2OL6O 5D4AA 5JD2A 1BJ7A 1VWCB 4GGZA 1QY0A 4YGZA 5FAZA 2RTHB 1I06A 2ACPX 5HTDA 1OEKA 4O3ZA 3B2KA 2RTLA 4I3CA 4CPIA 4XMEA 4JO6A 2HNXA 3PEDA 4I3BA 1QFTA 5IRWA 2OY5O 3QQ2A 2ZAGA 1BRPA 3BSZE 4LZVA 1AVEA 1ERXA 3PK2A 2PY1A 3CBCA 1YWAA 4FQBB 4IABA 2K62A 2O62A 4YDBA 2JW1A 2A0AA 3T2XA 3NADA 1RAVA 4PJ2A 3ZWEA 1OPAA 3VE2A 4AZOA 1PM1X 1KXOA 4NYRA 1HN2A 3P24A 4CK4A 3T1DA 1K24A 1RXKA 3MX7A 5EDBA 3RDMA 1Y9TA 1Y52X 5D45A 2RTJA 1LPJA 3VPJE 3JSQA 1NP4A 2RTMA 2A13A 2OF9A 1SRGA 1VWFB 1N0SA 3NQ3A 1GX8A 2LA7A 1ZNEA 5EZ2A 4ZGFA 1NQMA 3HWEA 4OS8A 4CPHA 3FDCA 3WJFA 1SWEA 1LIBA 1KL3A 1HMSA 4MVKA 5K06A 5KICA 2FR2A 2X46A 5HTEA 1BM5A 4I9RA 4TJZA 4XMHA 3ZW2A 4Z2OA 4HFOA 4YH0A 4BX7B 3U0DA 2QO6A 1XCAA 3RDOA 5LKFA 4I95A 2IFBA 2Y3FA 2A2UA 3FELA 3P6FA 1EXSA 4COTA 2UYWA 1NDJA 1QY1A 2LKKA 2BS6A 1MK5A 4JHQA 3HOLA 4ZHHA 1S7DA 1OBQA 1I9HA 1SWBA 2GC9A 1MUPA 4RUUA 1UYNX 3VG5A 2OVEA 5IO7A 4CDFA 4IB9A 2Z4IA 2RQ0A 2X56A 3F9DA 2QOMA 4OKAA 1NC9A 3WBGA 1VWHB 3C78X 4R0BA 1CJ5A 4HPDA 1ML7A 3Q34A 2DJFA 2G8CO 1WBIA 3MM0A 4GJVA 2OVDA 4IBAA 5EEEA 2OY7A 2RTRB 4ON1A 1RSTB 1EW3A 3CQRA 1SWAA 4IAWA 4INNA 3WJEA 1T8VA 3WZPA 2X34A 2RTCB 2CZTA 4WBKA 4YVBA 1X8PA 3EYCA 1AVGI 3VG4A 5HAEA 1ZNHA 4IMNA 1UYOX 3AKMA 4CV7A 4QGVA 3VU1A 4WFUA 3PH5A 5FFHA 5HZ6A 1X8NA 1XKIA 4ML7B 3NPOA 1KQXA 5HZQA 2FGSA 3WZQA 3QKGA 3SAOA 2X55A 4YGHA 5B27A 4ES7A 3P6EA 2IZCB 2OL7A 2W2AA 4Z2VA 3IA8A 2HZQA 4N7DA 1LIEA 4WFVA 1VPRA 1KT7A 2WQAE 3CMPA 2OFAA 1SMPI 2BC3A 1HXZA 1SXUA 2HKDA 1PBOA 3PP6A 4OMXA 5B5GA 3STNA 3UEWA 4TQ2A 5HZ8A 1RSUB 5F7GA 1EIIA 3UEXA 1TOWA 2A8GA 1ZNKA 1FTPA 4ZGUA 4ZJ0A 1QFVA 3STMX 2EU7X 4CSBA 4Z27A 1KFFA 1LCZA 1DF3A 2F73A 4CDCA 5LJHA 3P6GA 4DQ4A 3STKA 1SWGA 4QGXA 4XMDA 2A5BA 3SZJA 4AZNA 1STSB 1VWDB 2IZGB 3HK1A 4ID2A 4I9SA 2AH7X 1MX7A 2ZAIA 4LKTA 1SLDB 1JIWI 4AZQA 2W2BA 1G7NA 1GX9A 2FWVA 2JU7A 5H9LA 5LJGA 4WHIA 1SWQA 2ASNX 5FQ6E 4ORUA 1BSQA 3OE3A 5CYBA 3BU9A 4NLJA 3SZHA 1YWDA 5B29A 3D97A 3RDQA 4CDDA 4QZTA 4U8UN 1X8UA 2HZRA 2I5ZO 2WQ9A 1KQWA 3CBSA 3C76X 4GZVA 3Q6LA 1FENA 3PQUA 5JR8A 2WWPA 2CBRA 1VWBB 4GDAA 5HWZA 5LJCA 1LELA 3EMMA 1X89A 2NP1A 2FHNX 4Y0SA 1IFBA 1T0VA 1E5PA 1W6FA 2Q2MA 3WOVA 3ZI8A 3FENA 3HPEA 3ZQ3A 1OBPA 4N7CA 4LQZA 5F2BA 1JV4A 1SXYA 2JOZA 3KFIA 4AYHA 1N4JA 3O22A 3APWA 3PH6A 1B4MA 3NX2A 1LF7A 4Y0PA 4YBUA 1BSYA 1S44A 2AT8X 3TZSA 4BX5B 1SWRA 1KT4A 2YMSA 5D47A 2GTLN 2FRSA 3RY1A 3ZW0A 5B11O 4NW4A 4EKVA 1GT3A 1VWQB 4KIIA 5D8JA 5HA1A 4BBOA 1SWOA 2A5CA 2X8FA 4PSQA 4ALBA 3MVFA 1JMXA 1IW2A 4GJSA 5KHPA 1JJXA 3NR3A 2BHVA 1N9YA 3D96A 1T68X 2G78A 1BEBA 5K67A 2CBSA 1Y53X 4O4SA 1YP6A 1SRJA 2BT9A 3B2JA 1SWSA 3AUMO 3I0AA 3P6HA 1U17A 4ORSA 5LJBA 2DJGA 3KFGA 1BWYA 1TW4A 1Y9LA 4NYQA 5H9AA 1SLGB 4O49A 5IRAA 4KH8A 1L6MA 1VWKB 2GJ5A 1JJJA 2QO4A 1A2DA 5LKEA 3V8UA 2GTFX 3NP1A 1SWJA 1I4UA 3F6ZB 1CBQA 4IRWA 4K19A 2DM5A 1LKEA 3SZIA 5BVTA 2PI3O 3I17A 3H3IA 3E3CA 4O3YA 4GH7A 1SWLA 4FBRA 4HPAA 3ELZA 4ZH9A 1VWAB 4QNIA 1SRHA 2Q39A 2X8TA 1JQPA 3D4RA 5B2AO 5LJDA 4EFGA 1KGLA 1SY3A 1G85A 2HYSA 3CQNA 2RTNB 5AEOA 5HA0A 3C77X 4BX6B 4AZRA 1QABE 2P8GA 4NLIA 2JN3A 3UAQA 1VWJB 3FR2A 4GU8A 2IZJA 1OPBA 1NBXA 1FEMA 1MEPA 1X71A 2NNQA 4O4OA 2N93A 2FS6A 4B55A 3ZUIA 1SWCA 1WUBA 3OJYC 3EW2A 1BBPA 1VWEB 4QYPA 4RUNA 1KOIA 3T2WA 3VHHA 4Y0QA 1HQQA 1LNMA 1SA8A 1SWNA 1W5RA 2AMMX 4I60A 4HPBA 3RY2A 4TKJA 1KZWA 1LIFA 1SWUA 4ORYA 3SLJA 4FBVA 4GK9A 2X45A 2A2GA 1GKAB 2CM4A 3MBTA 1CRBA 1HMTA 2FT9A 4TLJA 3ZUOA 1STPA 2IZFB 1N43A 4BVMA 4DQ3A 2C1QA 4GE1A 3VG6A 3ZW0B 3VHMA 3ZW1B 2IZDB 2FKJA 1KZXA 1EIOA 3N91A 4OMWA 1G74A 1RXJA 5C0NA 2AT5X 2G79A 1SRFA 2RTQB 1BSOA 1B0OA 1TXLA 1HMRA 2NNEA 2BSZA 2BLGA 3BDRA 4M7MA 3UEVA 2W2FA 2XKLA 1H91A 2G7BA 5CE4A 1LDOA 4OEMA 1KL5A 4D6BA 2MHDA 1VWLB 2OY1O 1GT4A 1X8QA 2WEWA 3RWXA 4CPEA 5FENA 1BLRA 4M6SA 4GUZA 3TGBA 3FLLA 2RCQA 3EM0A 4YMYA 2JU3A
chains in the Genus database with same CATH topology
5HCDC 3CR6A 4YFRA 3ELXA 4IB6A 5AJCA 4KC7A 1CBRA 5FQ8E 2AT0X 1SXXA 4ORXA 4YDAA 2R56A 1LICA 4QGWA 4YCHA 4EEJA 2E4JA 4GETA 4U3QA 4MISA 3LV4A 1OBUA 1U18A 1MVGA 4IB8A 1A57A 4XMCA 3BX7A 2QO5A 3FW5A 4OS3A 2MWHA 4ZFXA 4ZHGA 1QWDA 2MJIA 2NNDA 2FS7A 1KT6A 3DTQA 2X8SA 4YKOA 4IAXA 2ALLX 3G7XA 2KTDA 3APUA 1Z24A 5EEDA 1ZNLA 2F09A 1IKEA 1TOUA 1R0UA 4NNTA 5HCEC 4A60A 3BRNA 3O2YA 1JYJA 3WXQA 5F6ZA 2ACOA 3RKGA 4OS0A 2HMBA 5H8TA 4GKCA 4KC8A 1OEEA 2MO5A 2BS5A 3FR5A 2OVSA 4U8UO 4QQ1A 4NP1A 4XMFA 1ERBA 3HWFA 2QMIA 1GXAA 4ZCBA 5BVQA 3FA7A 3TF6A 5EPQA 2RCTA 3BLGA 5HBSA 2FLJA 2KW1A 4QYNA 1ACDA 2R74A 2WSJA 1VYFA 2XSTA 2CZUA 3FIQA 3B2IA 2WR6A 3IFBA 1AQBA 4KT5A 4TNNA 4ALOA 3PQSA 4ORWA 5H9NA 4EQAC 5KIDA 1SXWA 1HBQA 1ICMA 2L67A 2Q2PA 3KZAA 2GTLO 2QM9A 4XMGA 1QQSA 2KD2A 1AB0A 3FW4A 5BVSA 2POAA 4O4XA 4ZHCA 2L9CA 3FA6A 4EXZA 1UREA 5H9KA 4GNYA 3NX1A 1D2UA 3JS1A 1D3SA 3FMZA 4TKBA 1LFOA 3K3LA 2L68A 3APXA 1AELA 1DZMA 2LB6A 5HCCC 4ZHFA 1RBPA 4ARHA 4BOEA 1O1VA 2WUTA 4MIRA 1GT1A 1EPBA 1QY2A 2K23A 1YP7A 2Q9SA 4U9CA 3SOTA 3ZZVA 1ZRYA 5D48A 2RA6A 3BU1A 3BY0A 4UU3A 4BQUA 4GDZA 1O8VA 4HWMA 2RD7C 1ADLA 2Q4NA 2OFMX 2Z4HA 3NQ9A 1GM6A 4YBPA 4EDEA 1PEEA 1JYDA 2LBAA 1EQDA 4ORRA 1LIDA 3NBXX 4LZUA 1ZNGA 4D6AA 3CWKA 3HOEA 5BYPA 2OFRX 3RZYA 4QGVA 4GNWA 1E06A 2A3FX 5AJBA 4AW8A 4QAEA 3NQKA 3FEPA 3DSZA 3P02A 3OD9A 3B2LA 4I6SA 4O4UA 1HQPA 4UU2A 1FE3A 1X8OA 3VG2A 5L8IA 1SY1A 5F6BA 1UZ2X 4KCAA 3FEKA 1BRQA 3BS2A 1JBHA 1YUPA 3S5XA 2JMBA 4I3DA 1KT3A 1PMPA 3WVMA 2LBVA 3S5VA 1NP1A 4AZPA 1DZKA 1O1UA 3LHNA 1U0XA 3KQ0A 4A8ZA 1VYGA 3PECA 3UEUA 3WJBA 3TGCA 5EDCA 1JZUA 1DZPA 4JGLA 3JQOA 5DPQA 3HWGA 1IFCA 4QZUA 3U03A 1CBSA 2M4LA 3FA8A 2HLVA 2ANSA 3HWDA 5L8NA 1ICNA 1P6PA 5DG4A 1E00A 4U8UM 2AL0X 3B2HA 1DZJA 3L4RA 1A3YA 3HTYA 5FQ7E 1DC9A 3S60A 3P6DA 3WJGA 3GAQA 4YFQA 1HBPA 2R73A 1SY2A 3EBKA 1MDCA 3S26A 4ZR2A 3O19A 3RBYA 4ZH6A 2AKQA 1FELA 2AT3X 2GTLM 4IB7A 1B8EA 4GRJA 4O3WA 1YIVA 1QG5A 1DFVA 5AQ6A 3P6CA 4A1YA 2FR3A 4QRLA 1G5WA 2OZQA 4YGGA 3TGAA 4TKHA 4O3XB 5LJKA 3WJDA 1OEJA 3VG7A 5IO5A 2WEXA 3APVA 5F1EA 1MX8A 5F58A 1EALA 4MVEA 4ZHDA 5L8OA 1YWCA 2KT4B 4MVIA 3D95A 2YG2A 4L3RA 3FA9A 1NGLA 1I04A 2CM9A 4Y0RA 3FR4A 1CBIA 1YWBA 2QOSC 3VE1A 4MVLA 3FYFA 4NNSA 3WJCA 1RLBE 1IKJA 1SY0A 2LFOA 3VG3A 1TVQA 1EPAA 2RN4A 3F8AA 3GE2A 4O9SA 3RSWA 1I05A 4IMOA 1S2PA 4YCEA 2MM3A 4HPCA 5IO6A 1E02A 1IIUA 2L5PA 2FTBA 4YKMA 4FBOA 4A1HA 1GGLA 4LKPA 1DV9A 1EUOA 1A18A 3OBLA 4FGIB 1ALBA 1GT5A 2JU8A 2OVAA 3EBWA 4ODDA 1ZNDA 4AZMA 2AT6X 1B56A 3KFHA 4YFPA 4L1NA 5LJEA 1GKAA 1KT5A 2KTSA 3AKNA 1EI5A 3ZW1A 3U9PC 3BX8A 3KFFA 3PPTA 1FDQA 5D4AA 1BJ7A 1QY0A 4YGZA 5FAZA 1I06A 2ACPX 5HTDA 1OEKA 4O3ZA 3B2KA 4I3CA 4XMEA 2HNXA 3PEDA 4I3BA 1QFTA 2ZAGA 1BRPA 3BSZE 4LZVA 1ERXA 2PY1A 3CBCA 1YWAA 4FQBB 4IABA 2K62A 2O62A 4YDBA 2JW1A 2A0AA 3NADA 4PJ2A 3ZWEA 1OPAA 3VE2A 4AZOA 1PM1X 1KXOA 4NYRA 1HN2A 3P24A 4CK4A 3T1DA 3MX7A 5EDBA 1Y9TA 5D45A 1LPJA 3VPJE 3JSQA 1NP4A 2A13A 3NQ3A 1N0SA 1GX8A 2LA7A 1ZNEA 5EZ2A 4ZGFA 4OS8A 3HWEA 3WJFA 1LIBA 1HMSA 4MVKA 5K06A 5KICA 2FR2A 2X46A 5HTEA 1BM5A 4I9RA 4TJZA 4XMHA 3ZW2A 4HFOA 4YH0A 2QO6A 1XCAA 5LKFA 4I95A 2IFBA 3FELA 2A2UA 3P6FA 1EXSA 4COTA 1QY1A 2LKKA 2BS6A 3HOLA 4ZHHA 1S7DA 1OBQA 2GC9A 1MUPA 4RUUA 3VG5A 2OVEA 5IO7A 4IB9A 2Z4IA 2RQ0A 3F9DA 3WBGA 3C78X 4R0BA 1CJ5A 4HPDA 1ML7A 5EEEA 4IBAA 2OVDA 4ON1A 5HZ5A 4INNA 1EW3A 3CQRA 4IAWA 3U0DA 3WJEA 1T8VA 4WBKA 2CZTA 1X8PA 3EYCA 1AVGI 3VG4A 5HAEA 1ZNHA 4IMNA 3AKMA 4CV7A 3VU1A 4WFUA 3PH5A 5FFHA 5HZ6A 1X8NA 1XKIA 4ML7B 3NPOA 1KQXA 5HZQA 3QKGA 3SAOA 4YGHA 5B27A 4ES7A 3P6EA 2W2AA 3IA8A 2HZQA 4N7DA 1LIEA 4WFVA 1VPRA 1KT7A 2WQAE 3CMPA 1SMPI 3PP6A 3STNA 1SXUA 4OMXA 1PBOA 3UEWA 4TQ2A 5HZ8A 1EIIA 5F7GA 3UEXA 1TOWA 4ZGUA 1ZNKA 1FTPA 4ZJ0A 1QFVA 3STMX 2EU7X 4CSBA 1DF3A 2F73A 5LJHA 3P6GA 4DQ4A 3STKA 4QGXA 4XMDA 4AZNA 4ID2A 3HK1A 4I9SA 2AH7X 1MX7A 2ZAIA 4LKTA 1JIWI 4AZQA 2W2BA 1G7NA 1GX9A 2FWVA 2JU7A 5H9LA 5LJGA 4WHIA 2ASNX 5FQ6E 4ORUA 1BSQA 3OE3A 5CYBA 3BU9A 4NLJA 1YWDA 5B29A 3D97A 4QZTA 4U8UN 1X8UA 2HZRA 2WQ9A 1KQWA 3CBSA 3C76X 4GZVA 3Q6LA 1FENA 3PQUA 5JR8A 2WWPA 2CBRA 5HWZA 5LJCA 3EMMA 1X89A 2NP1A 4Y0SA 1IFBA 1T0VA 1E5PA 2Q2MA 3WOVA 3ZI8A 3FENA 3ZQ3A 1OBPA 4N7CA 4LQZA 1JV4A 1SXYA 2JOZA 3KFIA 4AYHA 1B4MA 3O22A 3APWA 3PH6A 3NX2A 1LF7A 4Y0PA 4YBUA 1BSYA 1S44A 2AT8X 3TZSA 1KT4A 2YMSA 5D47A 2GTLN 2FRSA 3ZW0A 4NW4A 1GT3A 4KIIA 5D8JA 5HA1A 2X8FA 4PSQA 4ALBA 3MVFA 1IW2A 5KHPA 1JJXA 3NR3A 2BHVA 3D96A 1T68X 2G78A 1BEBA 2CBSA 4O4SA 1YP6A 3I0AA 2BT9A 3B2JA 3P6HA 1U17A 4ORSA 5LJBA 3KFGA 1BWYA 1KZWA 1TW4A 1Y9LA 4NYQA 5H9AA 4O49A 4KH8A 1L6MA 2GJ5A 2QO4A 1A2DA 5LKEA 3V8UA 2GTFX 3NP1A 1I4UA 3F6ZB 1CBQA 4K19A 2DM5A 1LKEA 5BVTA 3I17A 3H3IA 3E3CA 4O3YA 4GH7A 1JJJA 4FBRA 4HPAA 3ELZA 4ZH9A 4QNIA 2Q39A 3D4RA 2X8TA 1KGLA 5LJDA 4EFGA 1SY3A 1G85A 2HYSA 3CQNA 5AEOA 5HA0A 3C77X 4AZRA 1QABE 2P8GA 4NLIA 2JN3A 3UAQA 3FR2A 4GU8A 1OPBA 1FEMA 4O4OA 1X71A 2NNQA 2N93A 2FS6A 3ZUIA 3OJYC 4QYPA 1BBPA 4RUNA 1KOIA 4Y0QA 1LNMA 1SA8A 2AMMX 4HPBA 4TKJA 1LIFA 4ORYA 4FBVA 4GK9A 2X45A 2A2GA 1GKAB 2CM4A 3MBTA 1CRBA 1HMTA 2FT9A 4TLJA 3ZUOA 4DQ3A 4BVMA 3VG6A 4GE1A 3ZW0B 3ZW1B 1KZXA 1EIOA 3N91A 4OMWA 1G74A 5C0NA 2AT5X 2G79A 2NNEA 1BSOA 1B0OA 1HMRA 1TXLA 4M7MA 2BLGA 3BDRA 3UEVA 5HZ9A 2W2FA 2XKLA 1H91A 2G7BA 5CE4A 4D6BA 2MHDA 1GT4A 1X8QA 2WEWA 3RWXA 5FENA 1BLRA 4M6SA 3TGBA 3FLLA 2RCQA 3EM0A 4YMYA 2JU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HCD C;  3CR6 A;  4YFR A;  3ELX A;  4IB6 A;  1CBR A;  2AT0 X;  1SXX A;  4ORX A;  4YDA A;  2R56 A;  1LIC A;  4QGW A;  4YCH A;  4EEJ A;  2E4J A;  4GET A;  1OBU A;  1U18 A;  1MVG A;  4IB8 A;  1A57 A;  4XMC A;  3BX7 A;  2QO5 A;  3FW5 A;  4OS3 A;  4ZHG A;  4ZFX A;  1QWD A;  2MJI A;  2NND A;  2FS7 A;  1KT6 A;  3DTQ A;  4YKO A;  4IAX A;  2ALL X;  3G7X A;  2KTD A;  3APU A;  1Z24 A;  5EED A;  1ZNL A;  1IKE A;  1TOU A;  1R0U A;  4NNT A;  5HCE C;  4A60 A;  3BRN A;  3O2Y A;  1JYJ A;  3WXQ A;  5F6Z A;  2ACO A;  4OS0 A;  2HMB A;  5H8T A;  4GKC A;  1OEE A;  2MO5 A;  3FR5 A;  4NP1 A;  4XMF A;  1ERB A;  3HWF A;  1GXA A;  4ZCB A;  5BVQ A;  3FA7 A;  3TF6 A;  5EPQ A;  2RCT A;  3BLG A;  5HBS A;  2FLJ A;  4QYN A;  1ACD A;  2R74 A;  2WSJ A;  1VYF A;  2XST A;  2CZU A;  3FIQ A;  3B2I A;  2WR6 A;  3IFB A;  1AQB A;  4TNN A;  4ALO A;  5H9N A;  4ORW A;  5KID A;  1SXW A;  1HBQ A;  1ICM A;  2L67 A;  2Q2P A;  3KZA A;  2QM9 A;  4XMG A;  1QQS A;  1AB0 A;  3FW4 A;  5BVS A;  2POA A;  4ZHC A;  2L9C A;  3FA6 A;  4EXZ A;  1URE A;  5H9K A;  4GNY A;  3NX1 A;  1D2U A;  3JS1 A;  1D3S A;  3FMZ A;  4TKB A;  1LFO A;  3K3L A;  2L68 A;  3APX A;  1AEL A;  1DZM A;  2LB6 A;  5HCC C;  4ZHF A;  1RBP A;  4ARH A;  4BOE A;  1O1V A;  2WUT A;  1GT1 A;  1EPB A;  1QY2 A;  2K23 A;  1YP7 A;  2Q9S A;  1ZRY A;  5D48 A;  2RA6 A;  3BU1 A;  3BY0 A;  4UU3 A;  4BQU A;  1O8V A;  2RD7 C;  2Q4N A;  1ADL A;  2OFM X;  3NQ9 A;  4YBP A;  1GM6 A;  4EDE A;  1PEE A;  1JYD A;  2LBA A;  1EQD A;  4ORR A;  1LID A;  4LZU A;  1ZNG A;  4D6A A;  3CWK A;  2OFR X;  3RZY A;  4QGV A;  4GNW A;  1E06 A;  2A3F X;  4AW8 A;  4QAE A;  3FEP A;  3DSZ A;  3B2L A;  1HQP A;  4UU2 A;  1FE3 A;  1X8O A;  3VG2 A;  5L8I A;  1SY1 A;  5F6B A;  1UZ2 X;  3FEK A;  1BRQ A;  3BS2 A;  1JBH A;  1YUP A;  4I3D A;  1KT3 A;  1PMP A;  3WVM A;  2LBV A;  1NP1 A;  4AZP A;  1DZK A;  1O1U A;  1U0X A;  3KQ0 A;  4A8Z A;  1VYG A;  3PEC A;  3UEU A;  3WJB A;  3TGC A;  5EDC A;  1JZU A;  1DZP A;  5DPQ A;  3HWG A;  1IFC A;  4QZU A;  3U03 A;  1CBS A;  3FA8 A;  2HLV A;  2ANS A;  3HWD A;  5L8N A;  1ICN A;  1P6P A;  5DG4 A;  1E00 A;  2AL0 X;  3B2H A;  1DZJ A;  3L4R A;  1A3Y A;  1DC9 A;  3WJG A;  3P6D A;  3GAQ A;  4YFQ A;  1HBP A;  2R73 A;  1SY2 A;  3EBK A;  1MDC A;  3S26 A;  4ZR2 A;  3O19 A;  4ZH6 A;  2AKQ A;  1FEL A;  2AT3 X;  4IB7 A;  1B8E A;  4GRJ A;  1YIV A;  1QG5 A;  1DFV A;  5AQ6 A;  3P6C A;  4A1Y A;  2FR3 A;  1G5W A;  2OZQ A;  4YGG A;  3TGA A;  4TKH A;  5LJK A;  3WJD A;  1OEJ A;  3VG7 A;  5IO5 A;  2WEX A;  3APV A;  5F1E A;  1MX8 A;  5F58 A;  1EAL A;  4ZHD A;  5L8O A;  1YWC A;  2KT4 B;  4MVI A;  3D95 A;  2YG2 A;  3FA9 A;  1NGL A;  1I04 A;  2CM9 A;  4Y0R A;  3FR4 A;  1CBI A;  1YWB A;  2QOS C;  4MVL A;  4NNS A;  3WJC A;  1RLB E;  1IKJ A;  1SY0 A;  2LFO A;  3VG3 A;  1TVQ A;  1EPA A;  3F8A A;  4O9S A;  3RSW A;  1I05 A;  4IMO A;  1S2P A;  4YCE A;  2MM3 A;  4HPC A;  5IO6 A;  1E02 A;  1IIU A;  2L5P A;  2FTB A;  4YKM A;  4A1H A;  1GGL A;  4LKP A;  1DV9 A;  1EUO A;  1A18 A;  1ALB A;  1GT5 A;  2JU8 A;  2OVA A;  3EBW A;  4ODD A;  1ZND A;  4AZM A;  2AT6 X;  1B56 A;  3KFH A;  4YFP A;  5LJE A;  1GKA A;  1KT5 A;  3AKN A;  3U9P C;  3BX8 A;  3KFF A;  3PPT A;  1FDQ A;  5D4A A;  1BJ7 A;  1QY0 A;  4YGZ A;  5FAZ A;  1I06 A;  2ACP X;  5HTD A;  1OEK A;  3B2K A;  4I3C A;  4XME A;  2HNX A;  3PED A;  4I3B A;  1QFT A;  1BRP A;  3BSZ E;  4LZV A;  1ERX A;  2PY1 A;  3CBC A;  1YWA A;  2K62 A;  2O62 A;  4YDB A;  2A0A A;  3NAD A;  1OPA A;  4AZO A;  1PM1 X;  1KXO A;  4NYR A;  1HN2 A;  4CK4 A;  3T1D A;  5EDB A;  5D45 A;  1LPJ A;  3JSQ A;  1NP4 A;  2A13 A;  3NQ3 A;  1N0S A;  1GX8 A;  1ZNE A;  5EZ2 A;  4OS8 A;  3HWE A;  3WJF A;  1LIB A;  1HMS A;  4MVK A;  5K06 A;  5KIC A;  2FR2 A;  2X46 A;  5HTE A;  1BM5 A;  4I9R A;  4TJZ A;  4XMH A;  4HFO A;  4YH0 A;  2QO6 A;  1XCA A;  5LKF A;  2IFB A;  3FEL A;  2A2U A;  3P6F A;  1EXS A;  1QY1 A;  2LKK A;  4ZHH A;  1S7D A;  1OBQ A;  2GC9 A;  1MUP A;  4RUU A;  3VG5 A;  2OVE A;  5IO7 A;  4IB9 A;  2RQ0 A;  3F9D A;  3WBG A;  3C78 X;  4R0B A;  1CJ5 A;  4HPD A;  1ML7 A;  5EEE A;  4IBA A;  2OVD A;  5HZ5 A;  1EW3 A;  3CQR A;  4IAW A;  3U0D A;  3WJE A;  1T8V A;  4WBK A;  2CZT A;  1X8P A;  3EYC A;  1AVG I;  3VG4 A;  5HAE A;  1ZNH A;  4IMN A;  3AKM A;  4WFU A;  3PH5 A;  5FFH A;  5HZ6 A;  1X8N A;  1XKI A;  3NPO A;  1KQX A;  5HZQ A;  3QKG A;  3SAO A;  4YGH A;  5B27 A;  4ES7 A;  3P6E A;  2W2A A;  3IA8 A;  2HZQ A;  4N7D A;  1LIE A;  4WFV A;  1VPR A;  1KT7 A;  2WQA E;  3CMP A;  3STN A;  3PP6 A;  1SXU A;  4OMX A;  1PBO A;  3UEW A;  4TQ2 A;  5HZ8 A;  1EII A;  5F7G A;  3UEX A;  1TOW A;  4ZGU A;  1ZNK A;  1FTP A;  4ZJ0 A;  1QFV A;  3STM X;  2EU7 X;  1DF3 A;  2F73 A;  5LJH A;  3P6G A;  4DQ4 A;  3STK A;  4QGX A;  4XMD A;  4AZN A;  3HK1 A;  4I9S A;  2AH7 X;  1MX7 A;  4LKT A;  4AZQ A;  2W2B A;  1G7N A;  1GX9 A;  2FWV A;  2JU7 A;  5H9L A;  5LJG A;  2ASN X;  4ORU A;  1BSQ A;  3BU9 A;  4NLJ A;  1YWD A;  5B29 A;  3D97 A;  4QZT A;  1X8U A;  2HZR A;  2WQ9 A;  1KQW A;  3CBS A;  3C76 X;  3Q6L A;  1FEN A;  5JR8 A;  2WWP A;  2CBR A;  5HWZ A;  5LJC A;  3EMM A;  1X89 A;  2NP1 A;  4Y0S A;  1IFB A;  1T0V A;  1E5P A;  2Q2M A;  3FEN A;  3ZQ3 A;  1OBP A;  4N7C A;  1JV4 A;  1SXY A;  2JOZ A;  3KFI A;  4AYH A;  1B4M A;  3O22 A;  3APW A;  3PH6 A;  3NX2 A;  1LF7 A;  4Y0P A;  4YBU A;  1BSY A;  1S44 A;  2AT8 X;  3TZS A;  1KT4 A;  5D47 A;  2FRS A;  1GT3 A;  4KII A;  5D8J A;  5HA1 A;  4PSQ A;  4ALB A;  3MVF A;  1IW2 A;  5KHP A;  1JJX A;  3NR3 A;  3D96 A;  1T68 X;  2G78 A;  1BEB A;  2CBS A;  1YP6 A;  3I0A A;  3B2J A;  3P6H A;  1U17 A;  4ORS A;  5LJB A;  3KFG A;  1BWY A;  1KZW A;  1TW4 A;  4NYQ A;  5H9A A;  1L6M A;  2GJ5 A;  2QO4 A;  1A2D A;  5LKE A;  2GTF X;  3NP1 A;  1I4U A;  1CBQ A;  4K19 A;  2DM5 A;  1LKE A;  5BVT A;  3I17 A;  1JJJ A;  4GH7 A;  4HPA A;  3ELZ A;  4ZH9 A;  2Q39 A;  1KGL A;  5LJD A;  4EFG A;  1SY3 A;  1G85 A;  2HYS A;  3CQN A;  5HA0 A;  3C77 X;  4AZR A;  1QAB E;  2P8G A;  4NLI A;  2JN3 A;  3FR2 A;  1OPB A;  1FEM A;  1X71 A;  2NNQ A;  2N93 A;  2FS6 A;  3ZUI A;  3OJY C;  4QYP A;  1BBP A;  4RUN A;  1KOI A;  4Y0Q A;  1LNM A;  1SA8 A;  2AMM X;  4HPB A;  4TKJ A;  1LIF A;  4ORY A;  2X45 A;  2A2G A;  1GKA B;  2CM4 A;  3MBT A;  1CRB A;  1HMT A;  2FT9 A;  4TLJ A;  3ZUO A;  4DQ3 A;  4BVM A;  3VG6 A;  4GE1 A;  1KZX A;  1EIO A;  4OMW A;  1G74 A;  5C0N A;  2AT5 X;  2G79 A;  2NNE A;  1BSO A;  1B0O A;  1HMR A;  1TXL A;  4M7M A;  2BLG A;  3BDR A;  3UEV A;  5HZ9 A;  2W2F A;  2XKL A;  1H91 A;  2G7B A;  5CE4 A;  4D6B A;  1GT4 A;  2WEW A;  1X8Q A;  5FEN A;  1BLR A;  4M6S A;  3TGB A;  3FLL A;  2RCQ A;  3EM0 A;  4YMY A;  2JU3 A; 
#chains in the Genus database with same CATH topology
 5CHK A;  5HCD C;  3CR6 A;  3LTW A;  4YFR A;  3ELX A;  2RTB B;  4IB6 A;  4KC7 A;  1CBR A;  5AJC A;  5FQ8 E;  2AT0 X;  1SXX A;  4ORX A;  4YDA A;  2R56 A;  1LIC A;  3RDX A;  4QGW A;  4YCH A;  4EEJ A;  2E4J A;  4GET A;  2MF6 A;  3AEH A;  4U3Q A;  4BCS A;  4MIS A;  3LV4 A;  4Y5D A;  4OEL A;  1OBU A;  1U18 A;  1MVG A;  4IB8 A;  1A57 A;  4XMC A;  2ZSC A;  3BX7 A;  2QO5 A;  4GGR A;  3FW5 A;  4OS3 A;  2MWH A;  4ZFX A;  4ZHG A;  1QWD A;  2MJI A;  2NND A;  2FS7 A;  4MEE A;  1KT6 A;  3DTQ A;  2IZH B;  2X8S A;  4YKO A;  4IAX A;  5HZ9 A;  1N9M A;  2ALL X;  2QCB A;  3G7X A;  2IZB A;  4GD9 A;  4Z28 A;  4CPH B;  2KTD A;  3APU A;  1Z24 A;  5EED A;  1ZNL A;  2F09 A;  3T6L A;  1VWN B;  1IKE A;  1TOU A;  1R0U A;  4NNT A;  5HCE C;  4A60 A;  2JGS A;  1VWP B;  3BRN A;  1N7Y A;  1JYJ A;  3O2Y A;  3WXQ A;  2RTA A;  5F6Z A;  2ACO A;  1VWO B;  1LUQ A;  3RKG A;  4OS0 A;  2HMB A;  5H8T A;  2UZ2 A;  4GKC A;  4KC8 A;  4Z6J A;  1OEE A;  1SWP A;  2BS5 A;  2MO5 A;  3FR5 A;  2OVS A;  2Y32 A;  4U8U O;  4QQ1 A;  4NP1 A;  4XMF A;  1ERB A;  3HWF A;  2AVI A;  5IRU A;  2QMI A;  1GXA A;  4ZCB A;  5BVQ A;  3FA7 A;  3TF6 A;  5EPQ A;  2RCT A;  3RDU A;  3BLG A;  5HBS A;  2FLJ A;  1K3B A;  2KW1 A;  4QYN A;  1ACD A;  2R74 A;  2WSJ A;  2RTK A;  1VYF A;  2XST A;  2CZU A;  3FIQ A;  3B2I A;  3SLO A;  2WR6 A;  2OYB O;  3IFB A;  1HXL A;  1AQB A;  4KT5 A;  4TNN A;  4ALO A;  3PQS A;  2VFC A;  4ORW A;  1MM9 A;  1AVD A;  2VFB A;  5H9N A;  4EQA C;  5KID A;  1SXW A;  1HBQ A;  2Y3E A;  1ICM A;  3EW1 A;  2L67 A;  2Q2P A;  1SWD A;  2RTD B;  2GTL O;  3KZA A;  2QM9 A;  4XMG A;  1QQS A;  5CSE A;  2KD2 A;  1AB0 A;  3FW4 A;  5BVS A;  1PTS A;  2POA A;  4O4X A;  4ZHC A;  2L9C A;  3FA6 A;  4EXZ A;  1URE A;  2GH7 A;  1VWM B;  4GNY A;  5H9K A;  3NX1 A;  1D2U A;  3JS1 A;  1D3S A;  4GGT A;  2OY8 A;  3FMZ A;  4BX7 A;  4TKB A;  1LFO A;  3K3L A;  2L68 A;  3APX A;  3WZO A;  5HZ5 A;  1AEL A;  1DZM A;  2LB6 A;  5HCC C;  1JMZ A;  4ZHF A;  1RBP A;  4CPF A;  4ARH A;  4BOE A;  1O1V A;  2WUT A;  4MIR A;  1GT1 A;  1EPB A;  1QY2 A;  2K23 A;  1YP7 A;  2Q9S A;  4U9C A;  3SOT A;  3ZZV A;  4NV7 A;  1ZRY A;  3CKG A;  5D48 A;  1I78 A;  2RA6 A;  3BU1 A;  4Z2P A;  1OSP O;  3BY0 A;  4UU3 A;  3RE5 A;  4BQU A;  4GDZ A;  1O8V A;  4HWM A;  2RD7 C;  1ADL A;  2Q4N A;  2OFM X;  2Z4H A;  3NQ9 A;  1GM6 A;  3WYQ A;  4YBP A;  4EDE A;  1PEE A;  1JYD A;  2LBA A;  1EQD A;  4ORR A;  1LID A;  3FID A;  3NBX X;  2I5V O;  1ZNG A;  1SWT A;  4LZU A;  4D6A A;  3CWK A;  3HOE A;  5BYP A;  2OFR X;  3RZY A;  1Y0G A;  5K68 A;  3VGW A;  4GNW A;  1E06 A;  1VYO A;  2A3F X;  5AJB A;  4AW8 A;  4QAE A;  2C1S A;  1VWR B;  3NQK A;  4JNJ A;  1SLE B;  3FEP A;  3DSZ A;  3P02 A;  2F01 A;  3OD9 A;  3B2L A;  1SLF B;  4I6S A;  4O4U A;  1HQP A;  2G5L A;  2IZK A;  1Y55 X;  4NV8 A;  4UU2 A;  1FE3 A;  1X8O A;  3VG2 A;  4U46 A;  1SY1 A;  5F6B A;  1UZ2 X;  3MG5 A;  3FEK A;  4KCA A;  5L8I A;  1BRQ A;  3BS2 A;  1JBH A;  1YUP A;  1SWF A;  3S5X A;  2IZA A;  1DF8 A;  2JMB A;  4I3D A;  1KT3 A;  1PMP A;  3WVM A;  1W4T A;  2LBV A;  3S5V A;  1NP1 A;  2FHL A;  2RTO B;  4AZP A;  1DZK A;  1O1U A;  1SRI A;  3LHN A;  3RE6 A;  1U0X A;  3KQ0 A;  4A8Z A;  1PBY A;  1VYG A;  3PEC A;  3UEU A;  2WPU A;  3WJB A;  3TGC A;  5B5F A;  5EDC A;  1JZU A;  2OFB A;  1DZP A;  4JGL A;  4Y59 A;  5B3M O;  3JQO A;  5DPQ A;  3HWG A;  1IFC A;  2FKG A;  3WZN A;  4QZU A;  1NQN A;  3U03 A;  1CBS A;  2M4L A;  3D9W A;  3FA8 A;  2HLV A;  2ANS A;  3HWD A;  5L8N A;  4BGF A;  1ICN A;  1P6P A;  5DG4 A;  1E00 A;  2OL8 O;  2IZL B;  4U8U M;  2AL0 X;  3B2H A;  4C5P A;  1DZJ A;  1KL4 A;  3L4R A;  1A3Y A;  3HTY A;  5FQ7 E;  1DC9 A;  3S60 A;  3P6D A;  3WJG A;  4DNE A;  3GAQ A;  4YFQ A;  1HBP A;  3RDS A;  2R73 A;  1SRE A;  2VDF A;  2CAM A;  1SY2 A;  3EBK A;  1MDC A;  4BX5 A;  3S26 A;  3T6F A;  4ZR2 A;  3O19 A;  3RBY A;  4ZH6 A;  2AKQ A;  1FEL A;  1GX3 A;  2AT3 X;  2GTL M;  4IB7 A;  1B8E A;  3KVN A;  4GRJ A;  4O3W A;  1YIV A;  1QG5 A;  1DFV A;  5AQ6 A;  3P6C A;  4A1Y A;  2FR3 A;  2X32 A;  4QRL A;  2RTF B;  1G5W A;  2OF8 A;  2OZQ A;  4YGG A;  3SLT A;  3TGA A;  1LCV A;  4TKH A;  2RTG B;  1RXH A;  4O3X B;  5LJK A;  3WJD A;  1OEJ A;  3VG7 A;  5IO5 A;  2WEX A;  1VWI B;  3VHI A;  3APV A;  5F1E A;  1MX8 A;  5F58 A;  1EAL A;  1IJ8 A;  1MOY A;  4MVE A;  4ZHD A;  5L8O A;  1YWC A;  3WYP A;  1HY2 A;  2KT4 B;  3PDF A;  4MVI A;  2X4M A;  1LDQ A;  2YG2 A;  3D95 A;  4L3R A;  3FA9 A;  1NGL A;  1I04 A;  2CM9 A;  2IZI A;  3FR4 A;  1CBI A;  1YWB A;  2QOS C;  4Y0R A;  1VWG B;  3VE1 A;  4MVL A;  3FYF A;  4NNS A;  3WJC A;  1FJ1 E;  1RLB E;  1IKJ A;  2IZE B;  1SY0 A;  2LFO A;  3VG3 A;  5B10 O;  1SWK A;  2AF5 A;  3EC5 A;  2C4I A;  1JJU A;  1TVQ A;  1EPA A;  2RN4 A;  2RTE B;  4BX6 A;  3F8A A;  3GE2 A;  4O9S A;  3RSW A;  5IXG A;  1E2T A;  1I05 A;  1S2P A;  4IMO A;  4YCE A;  5L3Y A;  2MM3 A;  4HPC A;  5IO6 A;  1E02 A;  1IIU A;  2L5P A;  2FTB A;  4YKM A;  4FBO A;  4A1H A;  1GGL A;  4LKP A;  1DV9 A;  1EUO A;  1SWH A;  1A18 A;  3OBL A;  4FGI B;  1ALB A;  1GT5 A;  2JU8 A;  2OVA A;  3CKF A;  3EBW A;  4ODD A;  3X00 A;  4DCB A;  1ZND A;  4AZM A;  4BJ8 A;  2AT6 X;  1B56 A;  4CDE A;  3KFH A;  4YFP A;  4L1N A;  5LJE A;  2RTI B;  1GKA A;  1KT5 A;  2KTS A;  2RTP B;  1STR B;  3AKN A;  1EI5 A;  1LCW A;  3ZW1 A;  3U9P C;  3BX8 A;  3KFF A;  3PPT A;  1FDQ A;  2OL6 O;  5D4A A;  5JD2 A;  1BJ7 A;  1VWC B;  4GGZ A;  1QY0 A;  4YGZ A;  5FAZ A;  2RTH B;  1I06 A;  2ACP X;  5HTD A;  1OEK A;  4O3Z A;  3B2K A;  2RTL A;  4I3C A;  4CPI A;  4XME A;  4JO6 A;  2HNX A;  3PED A;  4I3B A;  1QFT A;  5IRW A;  2OY5 O;  3QQ2 A;  2ZAG A;  1BRP A;  3BSZ E;  4LZV A;  1AVE A;  1ERX A;  3PK2 A;  2PY1 A;  3CBC A;  1YWA A;  4FQB B;  4IAB A;  2K62 A;  2O62 A;  4YDB A;  2JW1 A;  2A0A A;  3T2X A;  3NAD A;  1RAV A;  4PJ2 A;  3ZWE A;  1OPA A;  3VE2 A;  4AZO A;  1PM1 X;  1KXO A;  4NYR A;  1HN2 A;  3P24 A;  4CK4 A;  3T1D A;  1K24 A;  1RXK A;  3MX7 A;  5EDB A;  3RDM A;  1Y9T A;  1Y52 X;  5D45 A;  2RTJ A;  1LPJ A;  3VPJ E;  3JSQ A;  1NP4 A;  2RTM A;  2A13 A;  2OF9 A;  1SRG A;  1VWF B;  1N0S A;  3NQ3 A;  1GX8 A;  2LA7 A;  1ZNE A;  5EZ2 A;  4ZGF A;  1NQM A;  3HWE A;  4OS8 A;  4CPH A;  3FDC A;  3WJF A;  1SWE A;  1LIB A;  1KL3 A;  1HMS A;  4MVK A;  5K06 A;  5KIC A;  2FR2 A;  2X46 A;  5HTE A;  1BM5 A;  4I9R A;  4TJZ A;  4XMH A;  3ZW2 A;  4Z2O A;  4HFO A;  4YH0 A;  4BX7 B;  3U0D A;  2QO6 A;  1XCA A;  3RDO A;  5LKF A;  4I95 A;  2IFB A;  2Y3F A;  2A2U A;  3FEL A;  3P6F A;  1EXS A;  4COT A;  2UYW A;  1NDJ A;  1QY1 A;  2LKK A;  2BS6 A;  1MK5 A;  4JHQ A;  3HOL A;  4ZHH A;  1S7D A;  1OBQ A;  1I9H A;  1SWB A;  2GC9 A;  1MUP A;  4RUU A;  1UYN X;  3VG5 A;  2OVE A;  5IO7 A;  4CDF A;  4IB9 A;  2Z4I A;  2RQ0 A;  2X56 A;  3F9D A;  2QOM A;  4OKA A;  1NC9 A;  3WBG A;  1VWH B;  3C78 X;  4R0B A;  1CJ5 A;  4HPD A;  1ML7 A;  3Q34 A;  2DJF A;  2G8C O;  1WBI A;  3MM0 A;  4GJV A;  2OVD A;  4IBA A;  5EEE A;  2OY7 A;  2RTR B;  4ON1 A;  1RST B;  1EW3 A;  3CQR A;  1SWA A;  4IAW A;  4INN A;  3WJE A;  1T8V A;  3WZP A;  2X34 A;  2RTC B;  2CZT A;  4WBK A;  4YVB A;  1X8P A;  3EYC A;  1AVG I;  3VG4 A;  5HAE A;  1ZNH A;  4IMN A;  1UYO X;  3AKM A;  4CV7 A;  4QGV A;  3VU1 A;  4WFU A;  3PH5 A;  5FFH A;  5HZ6 A;  1X8N A;  1XKI A;  4ML7 B;  3NPO A;  1KQX A;  5HZQ A;  2FGS A;  3WZQ A;  3QKG A;  3SAO A;  2X55 A;  4YGH A;  5B27 A;  4ES7 A;  3P6E A;  2IZC B;  2OL7 A;  2W2A A;  4Z2V A;  3IA8 A;  2HZQ A;  4N7D A;  1LIE A;  4WFV A;  1VPR A;  1KT7 A;  2WQA E;  3CMP A;  2OFA A;  1SMP I;  2BC3 A;  1HXZ A;  1SXU A;  2HKD A;  1PBO A;  3PP6 A;  4OMX A;  5B5G A;  3STN A;  3UEW A;  4TQ2 A;  5HZ8 A;  1RSU B;  5F7G A;  1EII A;  3UEX A;  1TOW A;  2A8G A;  1ZNK A;  1FTP A;  4ZGU A;  4ZJ0 A;  1QFV A;  3STM X;  2EU7 X;  4CSB A;  4Z27 A;  1KFF A;  1LCZ A;  1DF3 A;  2F73 A;  4CDC A;  5LJH A;  3P6G A;  4DQ4 A;  3STK A;  1SWG A;  4QGX A;  4XMD A;  2A5B A;  3SZJ A;  4AZN A;  1STS B;  1VWD B;  2IZG B;  3HK1 A;  4ID2 A;  4I9S A;  2AH7 X;  1MX7 A;  2ZAI A;  4LKT A;  1SLD B;  1JIW I;  4AZQ A;  2W2B A;  1G7N A;  1GX9 A;  2FWV A;  2JU7 A;  5H9L A;  5LJG A;  4WHI A;  1SWQ A;  2ASN X;  5FQ6 E;  4ORU A;  1BSQ A;  3OE3 A;  5CYB A;  3BU9 A;  4NLJ A;  3SZH A;  1YWD A;  5B29 A;  3D97 A;  3RDQ A;  4CDD A;  4QZT A;  4U8U N;  1X8U A;  2HZR A;  2I5Z O;  2WQ9 A;  1KQW A;  3CBS A;  3C76 X;  4GZV A;  3Q6L A;  1FEN A;  3PQU A;  5JR8 A;  2WWP A;  2CBR A;  1VWB B;  4GDA A;  5HWZ A;  5LJC A;  1LEL A;  3EMM A;  1X89 A;  2NP1 A;  2FHN X;  4Y0S A;  1IFB A;  1T0V A;  1E5P A;  1W6F A;  2Q2M A;  3WOV A;  3ZI8 A;  3FEN A;  3HPE A;  3ZQ3 A;  1OBP A;  4N7C A;  4LQZ A;  5F2B A;  1JV4 A;  1SXY A;  2JOZ A;  3KFI A;  4AYH A;  1N4J A;  3O22 A;  3APW A;  3PH6 A;  1B4M A;  3NX2 A;  1LF7 A;  4Y0P A;  4YBU A;  1BSY A;  1S44 A;  2AT8 X;  3TZS A;  4BX5 B;  1SWR A;  1KT4 A;  2YMS A;  5D47 A;  2GTL N;  2FRS A;  3RY1 A;  3ZW0 A;  5B11 O;  4NW4 A;  4EKV A;  1GT3 A;  1VWQ B;  4KII A;  5D8J A;  5HA1 A;  4BBO A;  1SWO A;  2A5C A;  2X8F A;  4PSQ A;  4ALB A;  3MVF A;  1JMX A;  1IW2 A;  4GJS A;  5KHP A;  1JJX A;  3NR3 A;  2BHV A;  1N9Y A;  3D96 A;  1T68 X;  2G78 A;  1BEB A;  5K67 A;  2CBS A;  1Y53 X;  4O4S A;  1YP6 A;  1SRJ A;  2BT9 A;  3B2J A;  1SWS A;  3AUM O;  3I0A A;  3P6H A;  1U17 A;  4ORS A;  5LJB A;  2DJG A;  3KFG A;  1BWY A;  1TW4 A;  1Y9L A;  4NYQ A;  5H9A A;  1SLG B;  4O49 A;  5IRA A;  4KH8 A;  1L6M A;  1VWK B;  2GJ5 A;  1JJJ A;  2QO4 A;  1A2D A;  5LKE A;  3V8U A;  2GTF X;  3NP1 A;  1SWJ A;  1I4U A;  3F6Z B;  1CBQ A;  4IRW A;  4K19 A;  2DM5 A;  1LKE A;  3SZI A;  5BVT A;  2PI3 O;  3I17 A;  3H3I A;  3E3C A;  4O3Y A;  4GH7 A;  1SWL A;  4FBR A;  4HPA A;  3ELZ A;  4ZH9 A;  1VWA B;  4QNI A;  1SRH A;  2Q39 A;  2X8T A;  1JQP A;  3D4R A;  5B2A O;  5LJD A;  4EFG A;  1KGL A;  1SY3 A;  1G85 A;  2HYS A;  3CQN A;  2RTN B;  5AEO A;  5HA0 A;  3C77 X;  4BX6 B;  4AZR A;  1QAB E;  2P8G A;  4NLI A;  2JN3 A;  3UAQ A;  1VWJ B;  3FR2 A;  4GU8 A;  2IZJ A;  1OPB A;  1NBX A;  1FEM A;  1MEP A;  1X71 A;  2NNQ A;  4O4O A;  2N93 A;  2FS6 A;  4B55 A;  3ZUI A;  1SWC A;  1WUB A;  3OJY C;  3EW2 A;  1BBP A;  1VWE B;  4QYP A;  4RUN A;  1KOI A;  3T2W A;  3VHH A;  4Y0Q A;  1HQQ A;  1LNM A;  1SA8 A;  1SWN A;  1W5R A;  2AMM X;  4I60 A;  4HPB A;  3RY2 A;  4TKJ A;  1KZW A;  1LIF A;  1SWU A;  4ORY A;  3SLJ A;  4FBV A;  4GK9 A;  2X45 A;  2A2G A;  1GKA B;  2CM4 A;  3MBT A;  1CRB A;  1HMT A;  2FT9 A;  4TLJ A;  3ZUO A;  1STP A;  2IZF B;  1N43 A;  4BVM A;  4DQ3 A;  2C1Q A;  4GE1 A;  3VG6 A;  3ZW0 B;  3VHM A;  3ZW1 B;  2IZD B;  2FKJ A;  1KZX A;  1EIO A;  3N91 A;  4OMW A;  1G74 A;  1RXJ A;  5C0N A;  2AT5 X;  2G79 A;  1SRF A;  2RTQ B;  1BSO A;  1B0O A;  1TXL A;  1HMR A;  2NNE A;  2BSZ A;  2BLG A;  3BDR A;  4M7M A;  3UEV A;  2W2F A;  2XKL A;  1H91 A;  2G7B A;  5CE4 A;  1LDO A;  4OEM A;  1KL5 A;  4D6B A;  2MHD A;  1VWL B;  2OY1 O;  1GT4 A;  1X8Q A;  2WEW A;  3RWX A;  4CPE A;  5FEN A;  1BLR A;  4M6S A;  4GUZ A;  3TGB A;  3FLL A;  2RCQ A;  3EM0 A;  4YMY A;  2JU3 A; 
#chains in the Genus database with same CATH homology
 5HCD C;  3CR6 A;  4YFR A;  3ELX A;  4IB6 A;  5AJC A;  4KC7 A;  1CBR A;  5FQ8 E;  2AT0 X;  1SXX A;  4ORX A;  4YDA A;  2R56 A;  1LIC A;  4QGW A;  4YCH A;  4EEJ A;  2E4J A;  4GET A;  4U3Q A;  4MIS A;  3LV4 A;  1OBU A;  1U18 A;  1MVG A;  4IB8 A;  1A57 A;  4XMC A;  3BX7 A;  2QO5 A;  3FW5 A;  4OS3 A;  2MWH A;  4ZFX A;  4ZHG A;  1QWD A;  2MJI A;  2NND A;  2FS7 A;  1KT6 A;  3DTQ A;  2X8S A;  4YKO A;  4IAX A;  2ALL X;  3G7X A;  2KTD A;  3APU A;  1Z24 A;  5EED A;  1ZNL A;  2F09 A;  1IKE A;  1TOU A;  1R0U A;  4NNT A;  5HCE C;  4A60 A;  3BRN A;  3O2Y A;  1JYJ A;  3WXQ A;  5F6Z A;  2ACO A;  3RKG A;  4OS0 A;  2HMB A;  5H8T A;  4GKC A;  4KC8 A;  1OEE A;  2MO5 A;  2BS5 A;  3FR5 A;  2OVS A;  4U8U O;  4QQ1 A;  4NP1 A;  4XMF A;  1ERB A;  3HWF A;  2QMI A;  1GXA A;  4ZCB A;  5BVQ A;  3FA7 A;  3TF6 A;  5EPQ A;  2RCT A;  3BLG A;  5HBS A;  2FLJ A;  2KW1 A;  4QYN A;  1ACD A;  2R74 A;  2WSJ A;  1VYF A;  2XST A;  2CZU A;  3FIQ A;  3B2I A;  2WR6 A;  3IFB A;  1AQB A;  4KT5 A;  4TNN A;  4ALO A;  3PQS A;  4ORW A;  5H9N A;  4EQA C;  5KID A;  1SXW A;  1HBQ A;  1ICM A;  2L67 A;  2Q2P A;  3KZA A;  2GTL O;  2QM9 A;  4XMG A;  1QQS A;  2KD2 A;  1AB0 A;  3FW4 A;  5BVS A;  2POA A;  4O4X A;  4ZHC A;  2L9C A;  3FA6 A;  4EXZ A;  1URE A;  5H9K A;  4GNY A;  3NX1 A;  1D2U A;  3JS1 A;  1D3S A;  3FMZ A;  4TKB A;  1LFO A;  3K3L A;  2L68 A;  3APX A;  1AEL A;  1DZM A;  2LB6 A;  5HCC C;  4ZHF A;  1RBP A;  4ARH A;  4BOE A;  1O1V A;  2WUT A;  4MIR A;  1GT1 A;  1EPB A;  1QY2 A;  2K23 A;  1YP7 A;  2Q9S A;  4U9C A;  3SOT A;  3ZZV A;  1ZRY A;  5D48 A;  2RA6 A;  3BU1 A;  3BY0 A;  4UU3 A;  4BQU A;  4GDZ A;  1O8V A;  4HWM A;  2RD7 C;  1ADL A;  2Q4N A;  2OFM X;  2Z4H A;  3NQ9 A;  1GM6 A;  4YBP A;  4EDE A;  1PEE A;  1JYD A;  2LBA A;  1EQD A;  4ORR A;  1LID A;  3NBX X;  4LZU A;  1ZNG A;  4D6A A;  3CWK A;  3HOE A;  5BYP A;  2OFR X;  3RZY A;  4QGV A;  4GNW A;  1E06 A;  2A3F X;  5AJB A;  4AW8 A;  4QAE A;  3NQK A;  3FEP A;  3DSZ A;  3P02 A;  3OD9 A;  3B2L A;  4I6S A;  4O4U A;  1HQP A;  4UU2 A;  1FE3 A;  1X8O A;  3VG2 A;  5L8I A;  1SY1 A;  5F6B A;  1UZ2 X;  4KCA A;  3FEK A;  1BRQ A;  3BS2 A;  1JBH A;  1YUP A;  3S5X A;  2JMB A;  4I3D A;  1KT3 A;  1PMP A;  3WVM A;  2LBV A;  3S5V A;  1NP1 A;  4AZP A;  1DZK A;  1O1U A;  3LHN A;  1U0X A;  3KQ0 A;  4A8Z A;  1VYG A;  3PEC A;  3UEU A;  3WJB A;  3TGC A;  5EDC A;  1JZU A;  1DZP A;  4JGL A;  3JQO A;  5DPQ A;  3HWG A;  1IFC A;  4QZU A;  3U03 A;  1CBS A;  2M4L A;  3FA8 A;  2HLV A;  2ANS A;  3HWD A;  5L8N A;  1ICN A;  1P6P A;  5DG4 A;  1E00 A;  4U8U M;  2AL0 X;  3B2H A;  1DZJ A;  3L4R A;  1A3Y A;  3HTY A;  5FQ7 E;  1DC9 A;  3S60 A;  3P6D A;  3WJG A;  3GAQ A;  4YFQ A;  1HBP A;  2R73 A;  1SY2 A;  3EBK A;  1MDC A;  3S26 A;  4ZR2 A;  3O19 A;  3RBY A;  4ZH6 A;  2AKQ A;  1FEL A;  2AT3 X;  2GTL M;  4IB7 A;  1B8E A;  4GRJ A;  4O3W A;  1YIV A;  1QG5 A;  1DFV A;  5AQ6 A;  3P6C A;  4A1Y A;  2FR3 A;  4QRL A;  1G5W A;  2OZQ A;  4YGG A;  3TGA A;  4TKH A;  4O3X B;  5LJK A;  3WJD A;  1OEJ A;  3VG7 A;  5IO5 A;  2WEX A;  3APV A;  5F1E A;  1MX8 A;  5F58 A;  1EAL A;  4MVE A;  4ZHD A;  5L8O A;  1YWC A;  2KT4 B;  4MVI A;  3D95 A;  2YG2 A;  4L3R A;  3FA9 A;  1NGL A;  1I04 A;  2CM9 A;  4Y0R A;  3FR4 A;  1CBI A;  1YWB A;  2QOS C;  3VE1 A;  4MVL A;  3FYF A;  4NNS A;  3WJC A;  1RLB E;  1IKJ A;  1SY0 A;  2LFO A;  3VG3 A;  1TVQ A;  1EPA A;  2RN4 A;  3F8A A;  3GE2 A;  4O9S A;  3RSW A;  1I05 A;  4IMO A;  1S2P A;  4YCE A;  2MM3 A;  4HPC A;  5IO6 A;  1E02 A;  1IIU A;  2L5P A;  2FTB A;  4YKM A;  4FBO A;  4A1H A;  1GGL A;  4LKP A;  1DV9 A;  1EUO A;  1A18 A;  3OBL A;  4FGI B;  1ALB A;  1GT5 A;  2JU8 A;  2OVA A;  3EBW A;  4ODD A;  1ZND A;  4AZM A;  2AT6 X;  1B56 A;  3KFH A;  4YFP A;  4L1N A;  5LJE A;  1GKA A;  1KT5 A;  2KTS A;  3AKN A;  1EI5 A;  3ZW1 A;  3U9P C;  3BX8 A;  3KFF A;  3PPT A;  1FDQ A;  5D4A A;  1BJ7 A;  1QY0 A;  4YGZ A;  5FAZ A;  1I06 A;  2ACP X;  5HTD A;  1OEK A;  4O3Z A;  3B2K A;  4I3C A;  4XME A;  2HNX A;  3PED A;  4I3B A;  1QFT A;  2ZAG A;  1BRP A;  3BSZ E;  4LZV A;  1ERX A;  2PY1 A;  3CBC A;  1YWA A;  4FQB B;  4IAB A;  2K62 A;  2O62 A;  4YDB A;  2JW1 A;  2A0A A;  3NAD A;  4PJ2 A;  3ZWE A;  1OPA A;  3VE2 A;  4AZO A;  1PM1 X;  1KXO A;  4NYR A;  1HN2 A;  3P24 A;  4CK4 A;  3T1D A;  3MX7 A;  5EDB A;  1Y9T A;  5D45 A;  1LPJ A;  3VPJ E;  3JSQ A;  1NP4 A;  2A13 A;  3NQ3 A;  1N0S A;  1GX8 A;  2LA7 A;  1ZNE A;  5EZ2 A;  4ZGF A;  4OS8 A;  3HWE A;  3WJF A;  1LIB A;  1HMS A;  4MVK A;  5K06 A;  5KIC A;  2FR2 A;  2X46 A;  5HTE A;  1BM5 A;  4I9R A;  4TJZ A;  4XMH A;  3ZW2 A;  4HFO A;  4YH0 A;  2QO6 A;  1XCA A;  5LKF A;  4I95 A;  2IFB A;  3FEL A;  2A2U A;  3P6F A;  1EXS A;  4COT A;  1QY1 A;  2LKK A;  2BS6 A;  3HOL A;  4ZHH A;  1S7D A;  1OBQ A;  2GC9 A;  1MUP A;  4RUU A;  3VG5 A;  2OVE A;  5IO7 A;  4IB9 A;  2Z4I A;  2RQ0 A;  3F9D A;  3WBG A;  3C78 X;  4R0B A;  1CJ5 A;  4HPD A;  1ML7 A;  5EEE A;  4IBA A;  2OVD A;  4ON1 A;  5HZ5 A;  4INN A;  1EW3 A;  3CQR A;  4IAW A;  3U0D A;  3WJE A;  1T8V A;  4WBK A;  2CZT A;  1X8P A;  3EYC A;  1AVG I;  3VG4 A;  5HAE A;  1ZNH A;  4IMN A;  3AKM A;  4CV7 A;  3VU1 A;  4WFU A;  3PH5 A;  5FFH A;  5HZ6 A;  1X8N A;  1XKI A;  4ML7 B;  3NPO A;  1KQX A;  5HZQ A;  3QKG A;  3SAO A;  4YGH A;  5B27 A;  4ES7 A;  3P6E A;  2W2A A;  3IA8 A;  2HZQ A;  4N7D A;  1LIE A;  4WFV A;  1VPR A;  1KT7 A;  2WQA E;  3CMP A;  1SMP I;  3PP6 A;  3STN A;  1SXU A;  4OMX A;  1PBO A;  3UEW A;  4TQ2 A;  5HZ8 A;  1EII A;  5F7G A;  3UEX A;  1TOW A;  4ZGU A;  1ZNK A;  1FTP A;  4ZJ0 A;  1QFV A;  3STM X;  2EU7 X;  4CSB A;  1DF3 A;  2F73 A;  5LJH A;  3P6G A;  4DQ4 A;  3STK A;  4QGX A;  4XMD A;  4AZN A;  4ID2 A;  3HK1 A;  4I9S A;  2AH7 X;  1MX7 A;  2ZAI A;  4LKT A;  1JIW I;  4AZQ A;  2W2B A;  1G7N A;  1GX9 A;  2FWV A;  2JU7 A;  5H9L A;  5LJG A;  4WHI A;  2ASN X;  5FQ6 E;  4ORU A;  1BSQ A;  3OE3 A;  5CYB A;  3BU9 A;  4NLJ A;  1YWD A;  5B29 A;  3D97 A;  4QZT A;  4U8U N;  1X8U A;  2HZR A;  2WQ9 A;  1KQW A;  3CBS A;  3C76 X;  4GZV A;  3Q6L A;  1FEN A;  3PQU A;  5JR8 A;  2WWP A;  2CBR A;  5HWZ A;  5LJC A;  3EMM A;  1X89 A;  2NP1 A;  4Y0S A;  1IFB A;  1T0V A;  1E5P A;  2Q2M A;  3WOV A;  3ZI8 A;  3FEN A;  3ZQ3 A;  1OBP A;  4N7C A;  4LQZ A;  1JV4 A;  1SXY A;  2JOZ A;  3KFI A;  4AYH A;  1B4M A;  3O22 A;  3APW A;  3PH6 A;  3NX2 A;  1LF7 A;  4Y0P A;  4YBU A;  1BSY A;  1S44 A;  2AT8 X;  3TZS A;  1KT4 A;  2YMS A;  5D47 A;  2GTL N;  2FRS A;  3ZW0 A;  4NW4 A;  1GT3 A;  4KII A;  5D8J A;  5HA1 A;  2X8F A;  4PSQ A;  4ALB A;  3MVF A;  1IW2 A;  5KHP A;  1JJX A;  3NR3 A;  2BHV A;  3D96 A;  1T68 X;  2G78 A;  1BEB A;  2CBS A;  4O4S A;  1YP6 A;  3I0A A;  2BT9 A;  3B2J A;  3P6H A;  1U17 A;  4ORS A;  5LJB A;  3KFG A;  1BWY A;  1KZW A;  1TW4 A;  1Y9L A;  4NYQ A;  5H9A A;  4O49 A;  4KH8 A;  1L6M A;  2GJ5 A;  2QO4 A;  1A2D A;  5LKE A;  3V8U A;  2GTF X;  3NP1 A;  1I4U A;  3F6Z B;  1CBQ A;  4K19 A;  2DM5 A;  1LKE A;  5BVT A;  3I17 A;  3H3I A;  3E3C A;  4O3Y A;  4GH7 A;  1JJJ A;  4FBR A;  4HPA A;  3ELZ A;  4ZH9 A;  4QNI A;  2Q39 A;  3D4R A;  2X8T A;  1KGL A;  5LJD A;  4EFG A;  1SY3 A;  1G85 A;  2HYS A;  3CQN A;  5AEO A;  5HA0 A;  3C77 X;  4AZR A;  1QAB E;  2P8G A;  4NLI A;  2JN3 A;  3UAQ A;  3FR2 A;  4GU8 A;  1OPB A;  1FEM A;  4O4O A;  1X71 A;  2NNQ A;  2N93 A;  2FS6 A;  3ZUI A;  3OJY C;  4QYP A;  1BBP A;  4RUN A;  1KOI A;  4Y0Q A;  1LNM A;  1SA8 A;  2AMM X;  4HPB A;  4TKJ A;  1LIF A;  4ORY A;  4FBV A;  4GK9 A;  2X45 A;  2A2G A;  1GKA B;  2CM4 A;  3MBT A;  1CRB A;  1HMT A;  2FT9 A;  4TLJ A;  3ZUO A;  4DQ3 A;  4BVM A;  3VG6 A;  4GE1 A;  3ZW0 B;  3ZW1 B;  1KZX A;  1EIO A;  3N91 A;  4OMW A;  1G74 A;  5C0N A;  2AT5 X;  2G79 A;  2NNE A;  1BSO A;  1B0O A;  1HMR A;  1TXL A;  4M7M A;  2BLG A;  3BDR A;  3UEV A;  5HZ9 A;  2W2F A;  2XKL A;  1H91 A;  2G7B A;  5CE4 A;  4D6B A;  2MHD A;  1GT4 A;  1X8Q A;  2WEW A;  3RWX A;  5FEN A;  1BLR A;  4M6S A;  3TGB A;  3FLL A;  2RCQ A;  3EM0 A;  4YMY A;  2JU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...