3FN3A

Dimeric structure of pd-l1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title A dimeric structure of PD-L1: functional units or evolutionary relics?
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn3A02
3KJ6H 5HJ3B 1WZKA 1K8IA 1EAPB 3OG4B 2Z9TA 3LKOB 2NW3B 3O3DA 1RJLB 1T0MA 3I3DA 1P9MC 3DVGA 1GCFA 4OM0L 1D5ZB 4NQUA 3MNVB 4MCZB 4Y4HA 1I3VA 1RIVH 4LPUA 3RPIA 3P77A 3WJJA 1X5AA 1QNZH 3P2TA 3MJ8A 3KLAA 2LVCA 1TQCC 3MV7E 2AJXL 3S36H 5C09B 3FO2A 2DTML 4WFHE 4X5XA 5AYQA 1LEIB 2JJTA 4GW4A 4RGND 2F53A 1RUML 1M71B 3BP6B 3OKMB 1BFTA 1HYSD 4Q2ZA 3U7WH 2J5LC 3WJLA 5J11B 4H1LB 4M7LH 4CVXB 1MJ8H 1D5IH 1NMBH 1PKOA 1X5JA 3C08L 4Z7WE 4KKLC 4XPFH 4P3DA 1Y0LA 3GB7A 2XZQL 1BECA 3U46A 3O4OC 4HBCL 3G5ZB 5T3ZL 2IPUK 3OKNB 4NBXB 5I74B 5IMLA 4J3WA 3VXTA 1AE6L 1R5VA 3QH3B 4DKEH 1J5OL 3ZSTA 5GGSA 1IC5H 2ADFH 1T2XA 5FIEA 3QDMA 5C6TH 5D2NA 4P2OB 5L88L 5I1CL 4X5LA 1OGAE 5KVMC 3BSZL 4X9GA 1FGNH 3VFRA 1AD0A 4Q74A 3BAEL 5FECB 2OTUB 2UWEF 5C70A 1KEMH 4B50A 3QEHA 5I66A 3GMOB 3UTTE 1P1ZA 5ALCH 4QHUA 5IB2A 1A6PA 1N4XH 5FUCE 4P5MA 4IIQA 1UENA 2R1YB 2Y23A 1GXEA 4QO1A 4N9OB 2HRPH 3O2DL 2YPKA 2R23A 4NM8H 3BQUD 4NWUL 5EU6B 2NYYD 4IHOA 5F9DC 1OAQL 1FHGA 3NGBC 4X6BA 5HHOA 4XB7A 1P2CA 3NH7H 3QHTC 5CZXC 2Z31B 3CVHA 4HWZA 3WS3B 3BP7A 5IW3A 3HNSL 1HIML 1ROWA 4OCXH 5C0CA 3VRJB 1GHFH 1D5MB 1WBXB 3MV8D 3E8UH 4JY4B 1ZHNB 4KRPD 2V9RA 3UTZA 4X6DA 3MYJB 1QLRB 1Z9LA 3C2AL 3HI1A 4JM4H 4Q6IB 3LS4L 1C5CH 4XNMB 3C60A 1QFOA 2QV2A 5CJXA 1FIGH 2MJWA 4NQVB 3VXUE 4CW1B 1NBYB 2VR5A 3BPCB 4B53A 3O6KL 1NCBL 4I5BB 2E8YA 5GGUA 4I9WE 5DTFA 5MHSE 2AJSH 1H3PH 2P8MA 4HS8H 1UM6L 1UA6L 5CBAA 4FFYL 3VD7A 3FT2B 5IGXH 4RGNC 1G7JB 2VLJD 3VXSD 1Z3GH 1HYSC 1T83A 3NCFB 4WI6A 5GS1A 5ITBH 3GSWA 4BJLA 2V9QA 4HSQA 3D3VA 3HMWH 4XCNB 4MX7B 3S35L 3U0WH 1HOCB 5T33H 4LASL 5E8NB 4XBEL 1ZHBB 1CK0H 4XCFL 3MRQA 4OCYH 3MR9B 4RSVA 1YC8A 3KPQB 3G6DL 5F6HJ 3PWLB 3QHZL 3T4AA 1DFBL 1I7TB 5L8LB 5F97E 4MAUL 4JZJC 3H9SA 4L4TD 4CL7A 5KSBE 4UQ3B 2BSED 2J8UE 4QXGH 1JNNL 1KPVA 1JZ3A 4GQ9L 4I4WB 3EO1A 4U1HA 3T4YB 3V4UH 2WLZA 3OB8A 3V6OC 1U3JA 2CO7B 1FLRH 1JYVA 1KIRB 3NCJH 3BDBA 1BJ1H 1U95A 3MYZA 1DVFD 4ZO6A 4LP4A 4P46A 4OSUL 4HDIA 2F8XC 5HGHA 5T1LD 3L5WB 2X4TB 3VFPB 3QUZB 2F8VA 3K8KA 1MCFA 4PJ8B 1S9XB 4JM2D 1MAML 1U6AH 1UM5H 2DBJA 3UJJL 4XC1L 2ITDA 4HIIB 3I6GB 2GK2A 3HUJF 3TBWB 4Y5YA 4YX2L 1P4IL 3RGVB 5FHAH 1AY1L 5IP4A 3BQUC 4OZHA 5SX4I 3FQTB 3MRJB 2OX5A 2BVOB 3QYCA 5SWQB 5I1EH 1P69B 3PQYE 5TF1L 3BD3A 3BYTA 3MXWL 4WWID 5D93B 1NGYB 2L0DA 3EDEA 2FIRT 4YDLC 5KSAA 3SPVA 5TQ2L 5FDWA 3S35X 1TJGL 4MNQB 4RMRA 1D6EA 2R2BA 4MVBD 1MHEA 3EOAA 2ENYA 2GUOB 5E7FA 3W39B 2VDOH 3DV6B 4LLYA 4KRPC 4JY6A 1IAOA 3FONB 2Q8AL 4YHPA 3OKKA 1BFVH 4RGMC 4E42B 4WO4B 1ED3A 2H8PA 4GO6B 3HUJB 4V1DE 4XGZA 1IM9B 4MJIE 3MRRB 4OLWH 3TN0B 1R5WA 4B0MM 1L0QA 5GGQL 3P9MB 2IFFL 1AGCA 5CEYB 1K8IB 4EQ2A 2J8OA 3O3DB 5E9DD 1T0MB 5C0AA 4TYUA 1JJUA 3VGDA 1QFWL 4Y4HB 3OF6D 4PJGE 3RPIB 3P77B 1PKQA 5F1SA 3RDTA 2DRUA 4K71B 2MSPA 4YXHH 3MJ9H 2I9TB 1WVZA 3FO2B 4UMGA 5I8EA 4P4KA 3INUH 1J8HA 3N1FC 4OD1H 5CILL 2DMCA 4GW4B 1MREH 2QL1A 4F8TA 2MCPH 3Q1SL 1KJ2A 4JB9L 4Q2ZB 3MLVL 2YPLD 5IW1A 1T22B 1DUZA 4PRBA 3PABA 1I9RL 4OTXL 5HHME 3BIAX 4P3DB 1Y0LB 4QKXB 1RIUH 3QJFA 3QULA 5D7LE 3L5XL 5FA4A 4JFQA 1TETH 3U46B 2D7NA 4PJEE 4OZFG 4GAFB 3KPNA 1R5VB 2QTEA 3UX9B 4Y16B 5GGSB 3BPNB 1DVFC 5B4MD 2NY3D 3QDMB 5D2NB 1H3UA 4NPYA 3MLZL 1A6UL 4OIIL 5C6TL 3WHE1 1MJUL 2WUCH 4FXGA 4JM2C 1K85A 3VFRB 3MFFB 3FO9A 1FGNL 3AS3A 5JO5A 4WFFD 1JNHB 1NGZA 3BGFC 3QEHB 5I6XC 5FXCH 4JO4L 1YY9D 3IAPA 5FYJD 1P1ZB 1KEML 4QHUB 4F33A 2XQBL 4IIQB 4K9EC 1CF8L 4LCYA 1KTRL 2QEJA 1S5HA 2YPKB 1VESA 1I3RA 4E5XA 2EH7H 4MVBC 3QQ4B 1LWRA 4FQPA 4Z0BL 4Z9KB 3UJIL 5I1JL 4HIEA 4X6BB 4DVBA 2HVJA 5HHOB 4LLUA 1MPAL 1NL0H 1P2CB 5E4EC 2QSCH 5ESQB 1FNAA 4CKVX 4MWFA 5I1AA 1LO5B 3CVHB 2AKRA 3MRHA 4HWZB 4P5KA 3R4DA 2PXYD 2EE2A 3BP7B 4NZUH 4PJDA 2EIBA 2LU3A 3QBTB 3CXDL 1F4WL 4OIAA 1EMTH 4FXKA 4WEBH 4MA7L 3T77A 3DBXA 2P44B 5JMRA 4CVWA 3UTZB 4X6DB 1VACA 3PG2A 1KYOJ 1GPOH 2V5TA 5IG7A 1AC6A 5CHNA 1D9KD 1U3HA 3TLRA 4K7FA 5I15H 3OR7B 3IJYA 3QEQE 5HY9A 5B38G 4JM4L 3MV7D 3B4NA 1UKTA 4L1HA 3S34H 1BQHA 3HE6B 2P8MB 3JTSA 3CFJA 4GKZA 4LRNL 4TULL 2ZUWA 1N6UA 3WS6A 5D70H 3VG0L 4I3GA 1KELH 1HWHB 5ESVB 4HIJB 5CLTA 4YZFE 2HWZL 1SVZA 1X3DA 3BH9A 5BS0D 3SOBL 5FUOL 5GS1B 5FO8A 2D9CA 4XTRD 3GSWB 1J1XH 1XR8A 5DQDL 3IJSB 3DVNB 3CFIC 2W92A 5HDOA 4DQOH 2CK0H 3HC4H 1FJ1B 1IVLA 4LPWA 4RISH 1ZT4B 3MRQB 3P40A 4NUGH 5D1ZA 2HVKA 3UP1A 5JW4N 3VGHA 4O02L 2BCKA 2QHRH 4QHKI 1OGAD 5B4MC 1N0XL 2NY3C 1OWWA 2F58H 3RL2A 3WYRA 4GW1A 1W8NA 5DD1L 5FGSA 3ZYOA 3H9SB 8FABA 4P9HH 3VFMB 4YFLF 2HT3C 1KPVB 1OM3H 4OQTA 3EO1B 1G7LB 4U1HB 3GKWH 4PRHE 1U95B 1Y18B 4HS3A 3V4UL 4P46B 4HDIB 4GG8A 5HGHB 5DO2D 1CXFA 1YY9C 4PRPA 5F7NC 4KI5D 4WTZA 1NUDA 1A1NA 3V6BR 3NCMA 1FRGL 3GBLA 3PL6A 4JZNA 4TOYH 1ERNA 1FAIL 1FNGA 2DQDL 2VR4A 3W81A 1BBDH 3AAZA 2ITDB 4PGCA 1WF5A 1U6AL 3C5JA 5HDLA 5IVXF 4Y5YB 4HUVA 1JFQH 3PWJA 4OZHB 4MB5A 4Z18A 4S0TD 3VFWA 4BZ2H 4I8DA 4LGRB 1FBIL 4C83A 3QPQD 1L9MA 1RQ5A 2PXYC 5KSAB 3SPVB 5FDWB 4PGJA 4EUPH 1D6EB 2R2BB 1MHEB 3EOAB 3DGCR 4YHLH 4LEXL 4LLYB 1A9EB 2BRQA 2VDLH 4CU8A 3ULVL 5DQ9A 4JY6B 1PGRB 3FHQA 1IAOB 4UV4H 3BWUC 2FECI 2VDOL 4YHPB 3OKKB 1KV3A 1OF2A 2FX9H 2XY2A 5D7KD 2QQLH 4NSKB 1D9KC 4QRPD 1ED3B 2H8PB 3VXUD 5HPMA 1FFPA 3WD5L 1RY7B 1EFXB 4C56A 4CVZA 3H3PH 5MHSD 3RUGF 4J4PA 5IFJA 4G6JH 1ZV5A 1AGCB 2OS7A 5CP3A 3EOBA 5AYUH 5C0AB 1X5IA 4PJFE 4GH7B 3DXAA 2K7QA 3DURA 4XPGL 3FN0H 3WFZA 3NACL 4K7PX 1PKQB 3RDTB 1AHWA 5SX5H 2IG2L 1HCVA 4XTRC 1JV5B 3NZ8A 1S7QA 5I8EB 2AEWA 4YXHL 3MJ9L 3T08A 2AABL 1C08A 4KKBD 4L3EE 4ALAH 1MREL 5TE4H 4JRYE 1OT1A 2MCPL 3MLWL 4PGZA 4FTVD 5IW1B 4M7ZC 4PRBB 3QCVH 5E00B 3RUGB 3PABB 4LNVA 3SE9H 1QYGH 3TO4A 2OZ4L 2E6PA 1RJCA 4FQCH 3V0WH 3QJFB 1RMFH 3QULB 5FA4B 2A77L 4JFQB 1JWUA 4Q9QL 4XHJC 1I1FA 5FDYA 2DLEA 5C08A 3TEUA 3UZQA 3ALPA 1S7XA 1TETL 3KPNB 2BVPA 4I0KA 4Z0XA 1UVQA 5F6IC 4U1SA 1LO0L 4QOKE 4JKMA 1U42A 5DO2C 3LZFL 4NPYB 3EOYG 2E9WA 4LF3A 4KI5C 2QSQA 4JFYA 4UILH 3O6MH 4FXGB 2FEEI 4WI2A 4P59H 3FO9B 4ZYKA 3IFNH 4MCYA 2AEPL 2BSSB 2BX5A 1NGZB 3PQYD 1FGVL 3LB6D 4IRJA 5E2VL 1QVOA 2QSVA 2C3VB 4K2UL 4F33B 3ZKND 2UY7A 4TTGA 4L8BA 1CE1L 1F4AA 2IADB 4YBLB 3QPQC 2JB5L 4LCYB 1MAKA 4NN5C 2BHUA 4WW2A 4HWBA 3BI9X 1S5HB 3IDGA 1I3RB 4E5XB 2X1OA 1CXHA 1KN4H 1X5FA 5T3ZD 5BQ7A 4X6CF 3L3HB 3D85D 4DVBB 5IB4A 2HVJB 2EH7L 4YO0A 5I1AB 3BPLB 3DYMA 5I9QB 1JHLL 4XPAL 2DIBA 4V1DD 2AKRB 3MRHB 4P5KB 4PJHE 4ZG1A 3MA7A 1G9ML 3NA9H 4G43A 1BLNA 2I07A 5DJXA 4FXKB 3T77B 3DBXB 2P5EE 1PSKH 4QXUL 3BKCH 1Z9OA 4RGOL 3N0PB 1MCKA 1VACB 1V8HA 4X7SH 1A7OH 3IXAA 4X99B 4X8JA 5BO1L 2FLBT 3T2NH 3VFNA 5HY9B 4ZSOE 3RIFK 3QI9D 4WI3A 4IM8A 4AYFA 2FHBA 4J3OC 4TPRH 4H0IA 4HAGA 1H0DA 4Y88A 4X6CB 1W0VA 2VR9A 2AS5M 5LGJA 4ELKA 3P11L 3WSQH 3UPRA 3JTSB 3UYOD 1SMAA 4GKZB 1VGEH 3PWVA 2AVGA 4KKBC 4LU5H 5IJKC 1IQWL 3S4SA 1F58H 1EFQA 3BH9B 4JVPA 4DJMA 3T3MF 2BSTA 2LE9A 2X6MA 5FO8B 4Y5XC 2UVEA 1XR8B 2J6EA 4J3VA 4NKOA 4Y5VA 1J1XL 2IPKB 3W82A 4YDVA 3STBA 1IGTA 4Y2DA 1JYNA 1SJXA 2NX5E 5D1ZB 1OPGH 2HVKB 2IGFH 3ZHDA 5JTWA 4UTAL 3ULVE 1KGCD 4NUGL 3KGRA 5E94A 4TUKH 3JTTA 4N8VA 4BUHA 4GW1B 5DT1H 3ILPB 1Z9SA 2X4UB 3SE4A 1SHMA 8FABB 2R4SH 2YRPA 5IV2A 3KWWA 2OXGA 3CK0H 5A2JH 2QADB 5JOEA 3KPPA 1OM3L 4HS3B 3U0TB 4NM4H 5I71B 2PW1B 1ADQA 4GG8B 4ELME 3LB6C 4WI8A 1MSPA 1VERA 4JFZL 3SKJH 4PRPB 3TV3H 3HNVL 3ZKNC 2RFXA 3I84A 1A1NB 3S37L 4KJYA 4G80A 1FNGB 1YEIL 3NFNA 2VDMH 4PGCB 4CVUA 3GSRA 3C5JB 5TE6H 1C7TA 4MJ4A 4HUVB 5INCA 3N1MC 3GSOB 3Q6FA 1ZAGA 4PRDA 5L8KB 4C83B 2I25N 1WCBA 2ZJSH 3HR5B 2EDWA 3QDJD 3IDUA 3F12A 4POZD 4U05A 2JF1A 2OL3H 3DX9A 1I7UA 4FQQA 1P7KA 5IMMA 1NPUA 4ZFGL 5DQ9B 1A64A 3QEQD 1MUJA 3WFCL 1OF2B 2VDLL 4NHUA 3HKFA 5LGKA 5JOPD 4Y19E 1X9QA 5HPMB 1FFPB 5DI8B 1HHIA 3KPLA 3RZWA 1T1YA 3QI9C 1CLOL 5F6HI 2OR8A 1TNNA 4C56B 3MSPA 2XN9A 5DYOA 4CVZB 4DZ8A 3CZFA 2AV1A 1AO7E 1CVRA 3VH8A 2DBLH 3LPWA 4GUPA 5IFJB 2AJUL 5EPMA 3EOBB 3RVXC 2FJFA 1KTDA 4PP2B 4R4BA 3SCMD 4YC2C 5BV7B 3DXAB 3DURB 4PLOB 3HNTH 4XMPH 5GZOD 3S37X 1Q0YL 5FKAB 5IKCA 5B39A 3KXFA 3JSSA 2Y36H 1TJHH 1UZ6F 3NZ8B 3TVMD 3JUZA 1S7QB 3LEXA 3HAEH 2VH5L 3QFJA 5AUMA 3K1KC 1YEJL 1C08B 5C9JA 3LDBC 3E6FA 2FX8H 3ULSA 3U9PH 4ETQA 3T09A 2IMMA 1HH9A 3TBSA 1UXWB 4NJAL 5TE4L 4OJFH 1UJTA 5EH1A 4LVHB 3I85A 3D0VA 3TO4B 4FQXD 4NFBA 4NQDA 3SDCD 2ZKHL 1QYGL 1JWUB 5ESAA 4QRRA 1I1FB 5C08B 4W70A 1I85C 1S7XB 4M6OL 1T5XA 4HHAA 3G5YA 1MCLA 2GFBA 4Z0XB 4S1RL 4ZAKA 1UVQB 3RJQB 5DJAA 4U1SB 5J12C 3N1GC 4FFZH 2XXCB 5GGVH 4HXBH 2DQEH 4LF3B 1BMGA 5C0RH 1DN2A 4JFYB 4RDQF 1HKLH 1KTLA 4ONFL 5AWNH 4GW5B 4EIZC 2AP2A 5GGTL 4ZYKB 1C8PA 1MFCL 3JVGA 3WEXA 4MCYB 1G9NH 2LABA 4J3XA 2DQJH 3L5JA 1ULVA 2MWCA 4IRJB 3DX8B 3A67L 5FYJU 1D5BA 1PY9A 2V2XA 5IQ9A 1G6RB 2PTTA 4L8BB 3DMMB 4ONGH 1RZFL 4NKIH 1U8KB 2FZ3A 1CGUA 3EYFB 4FQ2H 3AXLA 3OJDA 3I9GH 3BX7C 5DUML 3RX5A 4POZC 1FFQA 4LGSB 3VWJD 1R3KA 2X9WA 5IB4B 4YO0B 1FO0H 1A6AA 1IL1A 1M7IA 3MA7B 4G43B 1BLNB 2I07B 3QNZB 5DJXB 3HMXA 3NA9L 3UTQA 3BVNA 4XP6H 5C07E 4LVOC 3JWOH 1KCKA 1ORQA 3X3FH 3BKCL 3IXAB 4X8JB 1E28A 3SCMC 5EORH 4M7KH 2YN5A 3VFGL 5TGBA 4HCRL 1C5BL 4HK0A 4WVRA 3WUWB 1JRHI 5GZOC 2JTDA 4LSRH 2EICA 1OTTD 3VXMA 5LGJB 4L3ED 4ELKB 4Y0GA 3UPRB 1SJEA 1Q8MA 3F7YA 1LNUA 3PWVB 4R0LA 1WV7T 1XIWD 3GMRA 3JBG7 4K3GA 3OZ9L 3KPSE 3DNKA 3SKOA 3RX7A 4GSDH 3LKSB 5D1XB 2NNAA 3MV01 2E6JA 5IOPA 4OKVA 2BSTB 2G2RA 3MOBL 5DJDB 4FQXC 3QIUD 4O5LH 4Y5VB 3SDCC 3QAZB 3FQNA 4YDVB 4XHQA 4Y2DB 3OPZH 4BFGA 1EK3A 1Q72L 4QOKD 3TH3T 3U7YL 3RI5K 4WW1A 2FGZA 5E94B 4W6YB 7FABL 3JTTB 2YN3A 4S1DD 4N8VB 1JZ6A 1ZVSA 1VFBA 4HC1A 3TYGL 5IV2B 3QHFH 1J0KA 3CSBA 4TNWK 4GRWF 4EXPX 3CDCA 3RZCA 4X6EA 5IF0A 3KPPB 1YEFL 4ONHB 1CXIA 4L8SC 5JUEH 1KOAA 4QWWD 3MODH 3SE3A 2KZWA 5KN5A 2RFXB 4HUWA 4KJYB 3TV3L 4G80B 1P5UA 3NFNB 3OXRA 2I27N 3GSRB 5ANMA 1RZJL 2D7PA 4OAWB 2DICA 3HZKB 4FFVD 1L6ZA 3VWJC 2VSCA 5E8DH 5IVZA 4NRZA 3AY4C 4PTUA 4K8RH 1BQLH 1WCBB 4KUCD 2M8XA 1ZS8A 3QUXD 4GRWB 3B9KA 5IBLD 1TQBB 3SDDD 3V5KA 3VGEA 3F12B 2R69L 1QPXA 3B5HA 3DX9B 1GL4B 1I7UB 1P7KB 5IMMB 1FNSH 1U2HA 3TNMA 4O4YL 5J3HD 2KUTA 1RAMA 1MUJB 2BFVL 1UWEH 2CH8A 3B43A 4NHUB 4UOW0 4UINH 4J23A 4JVWA 5I1IH 1YQVH 3KYKL 4DZ8B 2VDRH 5MEPA 2XN9B 5IROA 1VKXA 3CZFB 3BHBA 5E1AA 3VH8B 5HYJA 1CR9L 1TTFA 4GUPB 2ARWA 3IDMA 1OTTC 5T1DL 1IGIL 1HINL 5EPMB 1WT5A 3MMEB 2FGWL 1KTDB 2FJFB 3QJHA 4R4BB 5H35A 1AXIB 2YMXL 2ADJA 1NKOA 4F7EA 3H9YA 1XIWC 1JGUL 1UM4L 2ICCA 3MOAH 5F9JB 3G9VA 5IKCB 2NY0B 5B39B 3KXFB 1XGPA 5BCAA 1ZE3C 2BNQA 1EEZB 3UEZA 2Y5TA 3LEXB 3QUMB 2QJDA 4M62L 5AUMB 3QIUC 1FAKT 4HG4K 1XF2A 5F7HA 1RUKL 1YZZA 3ULVD 2H3NA 3IU4H 3WFHA 5JHDE 2ZCKH 1HH9B 3NFSH 3TBSB 1KB5A 1Q0XH 5AZ2L 1YN6B 3SGDH 1MCRA 3O6LH 1A6WH 1A7RL 3D0VB 4S1DC 2K9UA 1KBGL 3D18B 3ULUH 4LSTL 3KAAA 4OFKA 4NQDB 4N5ED 4P4RA 5IK3B 4QRRB 4F15C 2GJ6E 5MI0B 5I1GH 5LKNA 4BKLA 4KTYA 4HHAB 1FNEA 1RJYA 1DLHA 2GFBB 2CQVA 2EEDA 5GRJH 4NNXA 4JFFA 3RX8A 4ZAKB 4LEOA 1CDBA 3SO3B 5DJAB 4M5YH 3HA0A 2JCCF 1QR4A 5HGGS 4F7CB 1IGCL 3O3AA 2FYYA 4QWWC 1MCSA 2E7CA 3P4NA 1EERB 1VSCA 2OP4H 4FFZL 4JN2B 3EDKA 1KTLB 2DQEL 3C5ZD 5D5MA 5E2UL 1Z5LA 4GMTL 1FG2A 1S3KL 3WEXB 1PAMA 1UKQA 3GMNA 5C7XH 5GRVK 4EBQL 2YSSA 1ZEAH 1WZLA 4FFVC 1G9NL 2IAMD 1D5BB 3OKOA 4J2XA 2V2XB 1AI1H 5IQ9B 3RGHA 3TJEL 4MB3A 1BZ9B 1AXTL 1NAMA 1RK1A 2PTTB 2FZ3B 2DJSA 3S6CA 3MBEA 3RIFF 2P24A 4C4KT 3QUXC 1JF6A 4ONGL 2D7TH 5D1QA 3OJDB 2VDQL 5IBLC 5F7EL 3CFDB 3MBXL 3SDDC 5JPNA 2FEDD 2W9EL 4D0CB 4WUUE 1QSFE 2VUYA 5J3HC 5AEAA 4Y19D 3C6LD 4OZGA 3T3PF 3IDYB 1A6AB 1IL1B 3K80A 1M7IB 1A6TA 4N0FA 5EWIL 1WIOA 1ZA6A 3UTQB 3MXVH 1I9JL 3MJGX 4FXLA 3BVNB 4FS0A 1ORQB 4AQOA 2EDDA 4OFVA 3SE8H 1MFNA 3K4DA 5MEQA 4HFUH 3AMLA 4HIHB 5TGBB 4HK0B 1QKZL 2EDTA 1EHXA 3SHSA 1F6FB 5J11C 3EO9H 1SEQH 4X7DC 3BW9B 3VXMB 3WKNA 4LSRL 1SJEB 3W0WB 4PJIA 3F7YB 1LNUB 4R0LB 3GMRB 5FM8A 3SKOB 3ULVC 4EUPG 4PJBA 1TJIL 2NNAB 3RY5A 1OAZH 1I1CA 4OKVB 1WFUA 3T2OA 2G2RB 3KHQA 3IYLW 4X9FA 5DXWA 4EEEA 3FQNB 4N5EC 4PGDA 1MLCA 1XFPA 3V0VA 2ITCA 1HWGB 3MRIA 3KJ4B 2EYTA 1G1CA 2R0ZH 3MLTA 4KJWC 1HEZA 1EVTC 4KTDH 4DOHE 1ZVSB 1VFBB 3EAKA 5ETUB 3QXDA 2NY7L 4HKZA 2R56H 3C5ZC 2KH2B 5F9AC 1QLEH 1NUGA 3FCTA 4PJ8D 4RMVA 3RZCB 2PYEA 2E7HA 1NC2A 4X6EB 5IF0B 5GISH 2X4QB 5AZEL 2NY6D 1EHLH 3ALWA 4L3AA 4QEGA 4Y4FD 2IAMC 5GHWH 2YUWA 1T20A 4NQSA 2YD9A 4LPCA 4JRXA 5KN5B 4HUWB 1KSRA 4K7PH 2BDNL 1DQJA 5E2JA 3MODL 3BZEA 2FLRT 4MYWB 3OXRB 4TQEH 1JYWA 5ANMB 5EB9A 4D0DA 5JDSA 2ED8A 4G5ZL 4MNQD 2FEDC 5IVZB 1P9MA 1UB5A 1KPUA 4JG1H 4NZTL 3MV9A 3I50H 3C6LC 4NCC2 2VKWA 1H8SA 3FQXA 3PV6B 3SKUD 3TESA 3LEYH 3H42H 4M93B 1CL7L 1N3NB 1CD1A 3ECBA 4H1LH 2FATH 3U4BL 4U33A 5C07D 3UMTA 4U1JA 4R96A 3V5KB 1XAUA 1IM9D 1WUNT 3CMOH 3WNLA 1MJ7L 5GS0L 4TUJB 2B0SH 1ACYL 1LK2B 3MLRL 4CGTA 4G8GB 4Z7UE 4LOUD 4MZ3A 1GC1L 1JZ8A 4PPTA 2V6HA 1LEKA 1VKXB 3FFCE 1ZHLA 4U1LA 5MEPB 4UINL 3QUKA 4WNQA 5E1AB 5HYJB 1E4JA 3BT2H 4M3JA 1EHAA 2WNGA 3LH2H 4PBWD 3KPSD 3QJHB 1U8LA 2ADJB 5CMAA 4JZOA 3EFDH 2BVQA 4M48L 4X7FC 3HPJA 4LSVH 1S7RA 5FKPB 4PJ7E 1RUAL 4FQJL 1XGPB 1G6RL 1G9MC 2AK1L 3QCUH 3PXJA 3OXSA 4MSWA 5KVDL 1MIMH 4JY5H 1GIGH 2BK8A 1PZ5A 2VJXA 3U82B 1I9IH 3FB8A 2GSIA 1F8TL 2CKNA 4A6YL 3U6RA 2H3NB 3DI2B 3WFHB 1WITA 4BH8A 1KB5B 3IU4L 3LSOA 3SEPA 1T7XA 5EZIL 1YUHA 1NH6A 4WHYH 3F5WA 4XPTH 1MCIA 1MVFA 2AGJH 3O6LL 4S0SD 3CU1A 25C8L 1G0XA 4G9DA 2VRAA 2ID5A 3QRFM 4PJ8C 4BKLB 2CO6B 3HS0A 1FNEB 1DLHB 2WZPD 4DW2H 4Z7VA 4NNXB 4JFFB 5F9OH 4LEOB 2NY6C 4PJ5E 1YECH 5ABDE 4G8FB 2GTWA 2NZIA 2CDEA 3VG9C 4Y4FC 3O3BA 3O3AB 5TPWH 2FYYB 2VLRD 3P4NB 2WP3O 4OZGF 5IEKA 4KKCD 1BJMA 1FG2B 5HI3D 2JJUA 4Y1AB 2PUQT 2QKIA 4PV9B 3ZTJH 1OGTA 3GMNB 2OTWA 4OLZL 1FZKA 4PY7A 3OKOB 4J3SA 5KAQG 5E70A 1NAMB 4K3HA 4DTGL 2AXFA 4OM1H 3MBEB 5I18L 2P24B 4QRSA 5D1QB 2V2WA 5EBMB 3ZHLA 4YPJA 2AXJA 1E0OB 2D7TL 1MFBL 3UAJD 4ODSL 5I0ZA 5IB1B 1MRDH 4OZGB 4JO3H 5CEZH 3MZGB 4X4YA 5F8RC 4XMKH 1XT5A 4PJBF 1E4XI 4LOUC 1MWAL 4N0FB 1JNLH 4Z7QF 3ARZA 4MA3B 3EW3B 3O11A 1A3RH 4JFOA 3KVQA 1ZA6B 1MFDL 2R0LL 5EOTA 4XP5H 1KB9J 5JLZA 4KZEL 4LLAA 4NO2A 5F7KC 3MXVL 3O4LB 2G60H 1MNUH 3GSNA 3K2MC 3HE6D 4K23H 5C71A 5IB3A 4ZPTA 1F6LL 1QFUL 2DQFB 3KYMA 5HHVL 5HD8D 2R4RH 3RI5F 3LOWA 2VZOA 5FYKL 3WO4C 4Q58C 3QRGL 3IU3A 4O58H 4G9FD 4JZJA 1VFAA 3LQAH 1YPZA 5L2JA 4TNWF 1SEQL 3O81A 2WK2A 3V6OA 4JPWH 5JHDD 5I1DA 3FOLA 4PJBB 1KCLA 1KN2H 2ORBH 3BRGC 2DL2A 2Q1EA 4Y16C 2WQRA 3N1PC 2QQNH 3BPNC 2DWDA 3ORJA 2GJ6D 2YBRA 2BJMH 4NBYB 2GITA 4PGDB 2ITCB 3KNBA 3BMVA 1U58A 3DTXA 3MRIB 2EYTB 2DB8A 3BQUA 4JCMA 1JZ5A 4EDXA 3R8QA 4XMLH 1HEZB 3ES6A 3NIGE 3P30L 2PKDA 2R0ZL 2HKHL 3W5NA 3WHXA 3QXDB 4HKZB 1NSNL 1U8IA 2ED7A 2YD1A 4X9HA 2XZCL 1IGJA 1TIUA 3FCTB 4KKCC 4X0KA 5IHUH 4ORGA 4HZLA 5HI3C 1NC2B 3PGDA 5EZOH 3MV8A 3V52H 3WKMH 2AJZA 3QXWA 5GISL 1RUPL 1T20B 3HAEG 4NQSB 3NTCL 2A6DA 4JQXC 2VXVL 4JRXB 1DQJB 1KJVA 3ARFD 1T04A 4U6VL 1FC2D 1KXQE 4HXAH 3FO0L 1YNLH 3ZTNL 5DEFA 4D0DB 5JDSB 1QSFD 1U8PA 3QUML 4P2RD 3UAJC 4HH8A 1DSFH 2V5MA 1X5YA 1DQLH 1UB5B 1KPUB 1V7NH 3GSQA 4PB0H 1P84J 3IETA 3GGWA 4DFHA 1HILB 2VLJA 1OP5K 3FQXB 5DLML 3VXSA 4ZFOA 1RURH 3ECBB 1CD1B 3GHEL 3VRLF 4DKFL 4U1JB 4R96B 4XT1C 1EFXD 5SWSE 2F5BH 3ULUE 3Q3GA 5GRUL 3LPGA 3NFPA 2EO9A 3X14A 5T1MA 2LU7A 3HE6C 1LO3H 4H0GA 3CMOL 3FQWA 3O0RH 3D39D 4FZEL 5HD8C 1LEKB 2DIJA 4AG4L 5JQHC 3QUKB 4WNQB 1BPVA 4EIGB 2YD4A 2WP3T 4KHXH 2DQUH 4OF6A 3W2DH 4ZTPL 5F71A 4JPKH 2ZUSA 3O4OB 1E6OL 1U8LB 1ZT1A 5CMAB 3B9AA 1IAII 3O2VH 5FF6A 4JZOB 1IC7L 5IR1A 3HPJB 1DVFA 1EA9C 2Q7NA 4OV5A 5T1LA 2A6JA 3SO5A 5BVPH 4S2SB 3GSUA 3OXSB 4M5ZL 4MSWB 4JM2A 1PZ5B 1OCWH 3FB8B 4JY5L 3U6RB 4G8IA 5JHLH 4UZGA 1ZHKA 1NBQA 4BH8B 2J88H 3LSOB 3RWGA 5I1KH 1YUHB 2XRAH 5LXGH 5I0DA 3N06B 3F5WB 4N1HB 4PRIE 2DF3A 3CVHH 3MNWA 2HTKD 1T21A 1X7QA 4G9DB 1E4WH 3VDAA 5FGCE 2A74A 1IGMH 1BEYH 2LV4A 1X6NA 1B4JL 3HS0B 2ARJA 4HGMA 1K6QL 2YD2A 4S1QH 1YNTB 1MCOH 3NGBB 3BD4A 5CJ8A 1JI1A 2AI0H 4ODUA 2GTWB 1ZLSH 2CDEB 3V2AR 3WXWH 5GZND 2C3XA 1NJ9A 1XZ0B 1YECL 1JYXA 3MLUH 4PD4K 4EI6A 3U83A 4ZFFA 1GAFH 5I17A 5IEKB 4Q6YA 4GBXD 2QKIB 3E3QE 3H0TA 1HHKB 5A3ID 1OGTB 1RZ8A 4XNUH 4Z8FH 2VQUA 1NLDH 2OTWB 1WSST 5IIEA 2B1AH 3IKKA 4HAFA 1FZKB 4PY7B 4GOSA 2CPCA 3BEVB 5E9DA 3ZDZE 4XWGL 4XXDA 3ZDXF 2AXFB 2WBWB 4YHOH 3VCLA 3D69B 3QT2A 5D2LE 4FFWD 3OF6A 4JQVC 35C8H 3TGXA 1J9CT 2V2WB 5FCUL 5FV1L 1DDHA 3AUVA 1HYRC 1WFNA 2DQTH 3WNKA 1IMHC 2FX7H 2PTUA 4PUBH 4GMSH 1XF1A 4RGNB 2EDQA 1NGQH 2YUXA 4L5FH 1PG7X 3GRWA 3FHAA 3AU1A 5DZLA 4X4YB 4RWHA 5A1AA 3A6BH 4GRMA 1JE6A 2YPLA 4JJHA 5JIPA 2ZCLL 4JFOB 2V5YA 2VDPH 5E6ZA 5MENE 4OZIA 1A3RL 4NO2B 1BD2D 1CFVL 2E9BA 2BY2A 1RZJC 3ARDD 4MQ7B 1PG7W 4N1CA 5IB3B 4ZPTB 2ZOLA 4ZNEA 3ARED 4GXVH 1MNUL 3KYMB 1HQ4A 2EYRB 4LAQL 1OSPL 1FL5B 4K23L 2EEAA 4RAUA 4LBEA 1QO3A 3BIKA 1BOGB 3ZDYF 4PYGA 1HNGA 4E41B 1RFDH 3IU3B 4JZJB 4DWHA 1VFAB 5HYSG 4K3EH 4BFIB 1YPZB 1FL3A 3GBNL 4GAGL 5L2JB 3DROA 4O58L 3SQOH 2DQCH 4BA8A 3GJEA 2Q7YA 1EO8H 1JTOA 4N68A 5I1DB 5DJ2A 4XAKE 5DMKA 1JHTA 5C09E 4OLVL 5K59E 1CE6A 2W9LA 3P0VH 2YBRB 2A9NL 2GITB 4XP9L 2HTKC 4KQ4H 4XAWH 1A22B 2OBGA 4OCLC 1BBJA 1U58B 2CUHA 3DTXB 3ISWA 4G7VL 4JG0H 4JFED 5B8CB 3F62A 3BQUB 3ES6B 1A5FL 2VQ1B 3IRPX 4NQXA 2WINA 5GZNC 1V3MA 5HHQB 3PDGA 2PXYA 4YDLB 4WHDA 1RUQL 4M9OA 4X0KB 1V5JA 4YBLC 1OAXL 4HZLB 4GBXC 4OFIA 1OP3H 3MV8B 4UT6L 5IHUL 3PWPE 3BKML 1FE8H 2AJZB 2FJGA 4KRPB 2UUDK 1A7PH 1SY6A 2V2TA 5GGRA 4RGMB 2A6DB 4LK4A 5EU5A 2VZTA 4JO1L 1D9KA 3RWCA 1T04B 3MV7A 4FFWC 4ZD3H 3D9AH 3MLSH 3UJTL 5DEFB 2A83A 1NKRA 3ZZ1A 3TIEA 1U8PB 1IJ9A 1VFUA 4O2CA 2MQ3A 2AXHA 3GSQB 5C6WH 4U1NA 2VLJB 3VXSB 1KJ2H 3FRPG 1VPOH 1CIUA 4JHWL 4KUZL 5BS0A 3REWA 4CUCA 4LSSH 5F8QC 3ZL4H 2O5XH 2DQIH 4A2LA 4DN4H 2C7UA 3BD5A 1LO4H 3Q3GB 1MCWW 4OT1H 1T1WA 1TLKA 3NFPB 4JM2F 1FVCA 1WK0A 3X14B 4ODHL 3FQWB 2VNCA 3AREC 1G9NC 5E4IA 5LQBL 4X7TA 3VFOA 2RQ8A 5DSCA 2GQHA 1CDJA 4P9ML 1OGAA 2CK2A 3LD8C 1DBKL 4L4TB 4APQD 3GMMA 5KANG 4NNPL 4KHXL 1B2WH 1OLZA 5M7QA 3X3GL 5FF6B 2BNRE 3UYRL 5IR1B 1FYTE 1DVFB 2PYFA 1I3GH 3TBVA 4DKAA 3O2VL 4D9LH 1B0GB 5T1LB 1JMXA 2A6JB 4M3KB 1MFEH 5DRWA 3LKPA 4DUVA 1A3LH 1MI5D 2X4PA 4JM2B 1INDH 5J13C 2BOBA 1ZLUK 3MPCA 3GI9H 4G8IB 4H88H 3BGFB 5I6XB 1DJSA 4OD2A 3RY6C 1ZHKB 5GS0D 4EKXA 1N6QH 3RVUD 3RWGB 1NCCL 1NGXA 2ATPA 3WFBL 5L2KB 1DLFL 3S5LA 3ARWA 3X12A 2J88L 3RVWD 5CEZE 5E99H 3KLSA 3MNWB 1N2RA 1T21B 2F15A 4OGYL 1X7QB 1S5IL 2EYSB 5E0QA 3F7QA 3C5SA 3OGCA 4M1DL 5H37H 3WFDH 4J8RB 4LDLB 2ARJB 4PJCE 4MAYD 4YDJA 4ODUB 4XBPA 5BZWA 4AT6B 1OT2A 5E4EB 3T0AA 5SWZD 1KCRL 1ZLSL 4PRAA 3X17A 1JPFB 5K9KA 4NQEE 4QRPA 4EI6B 5CZVH 3VXUA 4ZFFB 5I17B 1F2XK 1W8OA 1QD0A 3WN5B 3DMMD 3DX7B 2C4XA 1IT9H 2CMRL 1YJDL 1ZLVH 3MRMB 1MF2H 1S9YA 2FR4B 1RZ8B 3HC3L 2YD3A 5IIEB 1K4DB 4OZIF 5IBTH 4QY8A 5FYLL 4NCDA 43C9A 3D0LB 5E9DB 1K3ZA 4CMMA 4XXDB 3SGDI 5DFTA 3VCLB 4R26H 2DM7A 2EIEA 2CGRL 2B8OT 2DQGH 2EC8A 3UO1L 5CSBA 35C8L 2LFGA 1DDHB 2VC2H 1PLGL 4DK6A 3QNYA 5DA4A 3EO0A 2XKSA 3L3IA 5IJKA 4OF8A 4DN3L 2FX7L 3AU1B 4TRPH 1FORL 3O8XD 4GRMB 1NGQL 4L5FL 3TPKA 1NAKL 4FTVA 4U6YA 3VDCA 2H9GA 2HA1A 5L7XL 4Y5XA 3P3YA 3LRSA 5KSBA 4OZIB 2X70B 3ZE2E 1U8OA 2VDPL 5DJ8A 1AFVH 4APQC 1FC1A 3TWCH 2F54A 5F88A 4LMQI 4ZQKA 2ZOLB 3SBWC 3WIHL 4LCCC 1EIBA 3V7AE 5LG1A 4RAUB 5KANI 4LBEB 1QO3B 4IMKC 3BIKB 1L7IL 4KMLB 2D7MA 3UTOA 2NY3B 3IFOA 5D1XD 2P8PA 4Q9CA 2DOCA 2DLTA 1HE7A 2VDKH 4JDZA 4MNHA 3U0PA 3DROB 4HF5L 5DF0A 4LVHC 3GJEB 2DLFH 2Q7YB 1TVDA 4MLIA 1AKJA 1J1OL 2JE8A 4H1LG 4Y7MA 5DJ2B 3I2CH 4WHTA 3PQYA 5DS8A 5GS0C 3PWUA 1JHTB 4TVPH 3VFTA 3RVUC 1MRFL 1CE6B 2X4OB 1GC1C 5CSZB 5IM7A 1AGFB 5CJOL 2YRLA 5D7SL 1CFBA 3RVWC 2F53E 3P0VL 3K0WA 3QZWG 1AGEA 2HTLD 1BBJB 3RU8L 4YAQA 4MD5A 3NPSC 1CGSH 4Z78A 4LQ1A 1D7FA 5GPRA 4DAGH 1WBZA 3BKYH 1DZBA 4JG0L 4QRQA 4NQTA 3D85A 3ARYA 3VXOA 3AMKA 5FEBA 4NQXB 2WINB 2G9HA 4AEHL 5HDQH 3O2WH 4V1DA 5FYKD 2PXYB 3CVIL 3VJ6A 4ODWA 3DMMC 3MLXL 4S10A 1CDGA 1KEGL 4Z7WF 1KLGA 1IC4L 3BWAA 1C7SA 4X4ZA 3MV11 3SGEI 1S9KC 4HKXA 4HH9B 2CJUL 1D9KB 1KCVL 1DBJH 3WLBB 3QI9A 3WFEH 3MA9H 3MV7B 5F7MC 4NZRH 4JFDE 2VLLA 3VGFA 4HMCA 1NBVL 5LWYH 2YOCA 2A83B 2JELH 5L9DH 1UB6A 1I7RA 2CR3A 3MLSL 4MD4B 1LO2L 1NCAL 1YEGL 4AIZA 4RFEA 3I6LE 3O2DA 5CSGA 4WHYG 4O2CB 4M6NL 3QG7H 3BDYL 4N0YH 4L9DA 4MNGA 4U1NB 1RZIB 5F93C 4KDTC 5MEND 2EO1A 2VDNH 3O8XC 2R8SL 3OSKA 4Z7WB 2FO4B 3H2WA 3REWB 4UBDD 1YA5A 4GQPH 1WEJH 3KDMA 2EDNA 3VA2C 4XP1H 4XVTL 4HIXH 1KXTB 5HHOE 2C7UB 4JE4B 4LSSL 1T1WB 1FVCB 1LO4L 4WFEE 2YC1A 3ZTJG 5CWSB 4KTEL 5C0CE 4M7ZB 2ESVD 5DSCB 5IFHL 4MD0A 1QFHA 32C2A 1MEXL 2MPAH 2OM5A 1OGAB 1FPTH 5D1XC 3IB4A 3VXRE 1PJ9A 2W9DH 2JJVA 1OAUL 1S7SB 5HTSA 5JW3H 1WAAE 5MP6H 4X6DE 5T5FH 4YHML 1M7XA 5KVEL 3GMMB 3LIZH 1REIA 2W0PA 4HWEL 3S3SA 1I85A 1F11A 2CIIA 2R2HB 4ERSH 3GJFA 5F6IB 2PYFB 4LKXB 3TBVB 1A7BA 5FGBC 2BRRH 5FYLE 1JPSL 2CIKA 3AC0A 3VRIB 4N0CD 4JO2L 4NFCA 3LV3B 2Y07H 1T80A 5DRWB 3LKPB 4XVSL 2VQTA 4LCIH 1CU4L 3B2UD 1ZT7A 2I24N 2ZCHH 1S7TB 4J3TA 2BOBB 1BAFH 2HTLC 1INDL 4OD3L 4Z6AT 4R4FH 1F6AA 1NGXB 5C0IA 5HVWA 3D3VE 2VXQL 3S5LB 4Z76A 1TZIA 4NN5B 1IEHA 3E3QC 3BZDA 3OGCB 5E99L 5HYIA 3OB0H 3DSFH 2HH0L 3QDJA 2AJYL 1SYSA 5DD5L 4UU9A 3P4MA 3W9EA 1QA9A 5KTEL 4YDJB 2WQ8A 3OKEA 4JDTL 4XBPB 5BZWB 2DM2A 4BH7A 1A47A 3H9SE 3QEQA 1F4XH 4MZ2A 4RRPA 3UCRA 4NQCD 3ZKQD 5K9KB 4QRPB 3VXUB 2PCPB 1MHHB 4TVSa 5ICXA 2MQCA 5K9JL 1F90H 1S9YB 3ZYZA 5KSBF 1LK3L 3GNML 4DGYL 2J8UF 5ALBH 5DUPH 43C9B 1BVKA 2V17H 1CT8A 3GHBH 3SCMA 3WL9A 4CMMB 5ACMA 5JIKA 5B38B 1A6VL 1KC5L 4YJZL 1R3IL 1OARH 2H1PH 1JN6A 3R1GH 3VDBA 4AMKL 2D3VA 4WHCA 1MHPH 4OZHE 1QSZA 4UBDC 1TZHA 4LIQL 2J6EH 3QNYB 3TYFA 4YFEA 4M7JL 4HWUA 5F7FA 3VGGA 3OJ2C 1RJZA 3GMQA 4PG2C 3LMJH 5ADOH 1FNLA 1UACH 1UQSB 2MKWA 3V7AG 4AH2B 2EDXA 3SDXA 1NCUA 4FTVB 4U6YB 1MIEL 2H9GB 4BZ1H 5C1MB 3V5HA 4Y5XB 1JVKA 2OCFD 5KSBB 4XCCL 1VA9A 2J8UB 4FQXA 4OFYD 1U8OB 3SDCA 5ITFA 3ZT5A 1TZGH 2PW2A 2BNRD 1IAKB 4WI5A 3OAUL 1FYTD 5FUZH 3NZHH 3PDDA 5TQ0L 2FD6H 4LLMA 2J2ZA 4IOFD 4Y89A 1ADQH 3IFOB 4UDUA 2P8PB 3EYSH 4JDZB 1YEEH 3IS0X 2W1NA 3B2UC 1A3QA 2CRZA 2OI9B 5KVGH 3WE6A 2C4FT 1BVZA 4CJ0A 4WHTB 4L8SA 3PQYB 1BZ7A 5DS8B 4O2FA 4FABH 4N5UA 3UZEA 3VFTB 1RZKH 5DRXB 4YE4H 1EPFA 2Z8RA 5IM7B 4L3CA 1J8HE 4Y8AA 1ZGLA 4PJGF 3WHE0 4NRYA 2E27L 4HK3J 1TCRA 4YAQB 2P1YA 4MD5B 4QHNA 4Z78B 4PJAE 3CDGB 1CGXA 3H3KA 1TENA 4KQ3L 3VWJA 3T1FA 1ZA3A 4QRQB 3D85B 4M1GH 3RWFA 2OMBA 3C8HA 4KMQA 2X1QA 3AY4A 2G9HB 1A4JB 3ARRA 3QCTL 4WFGE 4WY7L 1INEH 2XWJA 4JGJA 4V1DB 4RWYH 4AY0A 1HXYA 3P9LA 3CX5K 1OTUD 1U8HA 3VJ6B 1BVLA 2XG4A 3O2WL 1A7NL 1SYVA 3ZKMD 4X5WA 5C2BH 4MQSB 3BWAB 1WZ1H 2Z4QB 4KI1A 5BW7C 2VXTL 3KPMA 4PJEF 4YUEL 4UNVA 4OLUL 2HFGL 4PJGB 2XA3A 2APVA 3NAAH 4JGMA 3QI9B 3L7FA 4QCIA 4KJQD 15C8H 3F7VA 1UB6B 1I7RB 5EC2A 5J56B 2FL5A 4AIZB 4RFEB 4OF5A 5JZ7D 5L9DL 3SN6N 3DLQR 4YC2B 4MNGB 2EDJA 1XIWA 3QIBB 4N0YL 4M6MH 2RAMA 4G8GD 3KDMB 5D7LB 3LKNA 5I1LA 5ICYB 1UKSA 3QIUA 1KCUH 3BKJL 3HTLX 1V3KA 4PJEB 3EYOA 3LDBB 4HIXL 5GS3A 4FOMA 1XGYH 4PJDE 2YC1B 2R39A 4GKNA 1KENL 1Q9OB 1WFOA 4MD0B 4IOFC 32C2B 1QUNA 1QSEE 4JPVL 3RQ3A 1T03H 3T2PA 3DIFA 3K2UL 1VGKA 3HLAA 4AL8L 4YNYA 1F4YH 1FPTL 5CJ5A 1DL7L 5LBSL 4OB5H 1F11B 4H25A 2CIIB 3TNNA 1RSFA 4LSUL 4MJ6A 4UDTB 1RU9H 5GGVY 2DM4A 2BC4A 5J9PA 4U0RC 5J89A 4NGHH 1FSKC 5BRZA 5CD5D 5J12B 2H2SD 5GSRA 5TDNA 5F7UA 1FL6B 1H3VA 3F65A 1MCHA 2BRRL 4D8PA 4K3JL 1OD7A 3D25A 4ETYA 1ZT7B 1MY5A 3DRTA 2HLAA 2R1XA 2Y07L 4CU7A 4FHBD 2ZCHL 4LIQE 4XP4L 4X4XA 1R24B 2JK5A 1BAFL 1N6VA 1F6AB 1M05A 3P0YH 3QUYD 1X5ZA 5C0IB 3GDBA 3X11A 1CTNA 1JGVL 5TDOA 1PG7H 4PJHA 4KHTL 4YWGL 2CXGA 4Z76B 1TZIB 4YZFF 3VMOA 5C0JA 3D48R 3QUXA 2H26A 1OTUC 1MCPH 4U3HA 5CS7A 3KR3L 3ZKMC 3SDDA 1AGBA 3HMXH 1SYSB 4UU9B 4F80A 3P4MB 4Y1AD 3NABH 3W9EB 4FP8H 3OKEB 3BIBX 3MACL 4NO0A 2M1KA 4BH7B 2OLDA 4DKDC 3QEQB 2P7TA 4ZSOA 4CN1A 4JR9L 4JFDD 2C4FU 2VXSH 5D71L 1RJLA 4PRNA 3Q0HA 3HPLB 4KJQC 1KFAL 1KXVC 3I6LD 3T3ME 4NFDA 3IDJB 4GXUN 4UV7L 4OCSL 4UIKL 2IQ9H 2QQKH 4LARH 3KLDA 5JZ7C 1IGYA 1BVKB 3L3DA 3PGFL 2PN5A 1CT8B 3SCMB 3WL9B 4OCRH 3AB0C 2UZIL 2KPNA 5HVFB 1M71A 1JN6B 5DFVD 4Q9RH 3BP6A 3OKMA 1MQKH 3L1OH 3QFDA 2F74A 5CINH 5DC0A 1TZHB 3R1GL 1JI2A 3N85H 4TVPE 3TVMB 4YEFA 3TYFB 1MHPL 1I3UA 2BVYA 1RJZB 2Z92B 4CAGA 3O4LD 4P3CL 4TSAH 3V4VH 5C0CD 1NCWH 1AQKH 4H8WH 3OKNA 1B3JA 4AEIH 1UACL 4MDIB 3VXRD 4I3SL 3V4PH 1GGCL 3V5HB 4Y2OA 3CFCH 3W11D 1EH9A 4FQXB 3SDCB 4HC1H 5ITFB 4MXQC 3PHQB 4PRHB 4H0HB 3BPOB 2PW2B 4F58H 1LMKA 2OQJB 3BUTA 5FYLD 4LLMB 4IRSB 5CD5C 2GHWB 4JKPH 4UDUB 2H2SC 4FQLH 1XF3A 1DQQB 3IGAA 1CIDA 4HJJH 1JPTL 3GMOA 5BZDA 4ZOAA 1NUFA 2VZSA 3C5ZA 1PX4A 1MCQA 1ND0A 4LVEA 3DXAE 4Z5RA 4UB0L 3FB7A 3QXVA 1UXSA 3MJ9A 3RA7L 4WUKH 4L8SB 5KVGL 4LSQH 4RBPH 1BZ7B 4O2FB 2IAMA 3QUYC 1N0LA 4WWKD 5D6CB 1W0YT 4PJFF 4CN6A 1FIEA 4L3CB 2IPUG 5DHVA 1ZGLB 1ZTXH 4KAQL 1CBVL 4WIQA 4HPOL 2OZ4A 1TCRB 3OG6B 4KDVA 5DJYA 4QHNB 5DK2A 2OJEB 3WS3A 1IGFH 1SM3H 4M02A 2UWEA 4MQTB 3T1FB 1ZA3B 5L6YL 3RWFB 1WBXA 3HZMA 5AG8A 1RVFL 1ZHNA 4Y19A 3C6LA 3R0MA 2NY5H 2XWJB 2R0KL 4R97B 5FYKU 5C08E 3RPKA 1HXYB 1QLRA 3P9LB 3UTSE 3ZLQC 1U8HB 4HW6A 1BVLB 4XNMA 1SYVB 4X5WB 5DWUH 2FBJH 1GGIL 7CGTA 2O5YL 1CLYH 3U9UA 5C2BL 3BPCA 4ZOCA 3SDYH 3KPMB 3LHPL 3L7FB 4I48B 4QCIB 2ILLA 3GO1L 4YFLI 5LCVH 5IESH 1G7JA 4ZS6D 5INDA 1QHOA 3DYOA 3NMEA 2XPGA 1A7QH 5EC2B 2OJZH 3L5IA 2EE9A 2FL5B 3NVQA 4P2QE 4L3EB 1O5DT 3EYUH 3HI6H 1YMHA 4KMTL 4XCNA 4MX7A 1XIWB 2X44D 4ZUSA 1HOCA 4EOWL 5H37G 1MCEA 3KPRE 2A2QT 1ZHBA 1B88A 3HG1D 1KB5H 4M6ML 5I1LB 1G7IA 4JHZA 3REVB 4MA8H 3W11C 5F96H 3QIUB 1YJDC 1SBSL 3HFML 1I7TA 4FQIL 3ZE0E 3EYOB 4WCYL 2AQ3A 2P5WD 3RTQD 4FNLH 1ZWIA 3QO0B 3DETD 4UQ3A 2X9XA 1KJMB 4GKNB 4QOKB 3AVEA 2GTZA 3VW3L 1BQHG 1KIRA 6FABH 1NCDH 3MLYL 2JB6A 3DIFB 3CFEA 1FFNB 1CICD 2WUBL 1VGKB 3HLAB 4PJ9D 4PJHF 3L5WA 4YNYB 4KUCF 4U31A 4R3SB 1GJIA 2W60A 3UXFA 4F15B 1FN4A 2FECL 4H25B 4PJ8A 5IVNA 4IRZH 3TNNB 4MJ6B 2UZXB 2BC4B 1UCBH 5J9PB 3V0AC 1T3FB 5LGHL 5GSRB 4Y4FA 3OHXA 4NGHL 5TDNB 3FQTA 4WWKC 3LRGA 1EGJL 2VMFA 3BESR 2NCMA 4Q0XH 4D8PB 2B5IB 3D25B 5IFAH 1NAMH 5KVFL 3DRTB 2R1XB 3CU7A 3CH1A 2W59A 1NGYA 2YZ8A 4X4XB 4RFOH 2JK5B 1OQXA 4IBLT 4MNQA 1M05B 4JFHD 3TCLA 5J6HB 4LNRB 2GUOA 3X11B 5TDOB 5IMOA 1UYWL 4X80L 3HRZA 4PJHB 3W39A 3GK8L 5CKGA 4LQFH 1FQ9C 5C0JB 3QUXB 4M61A 1CLCA 4JVUA 4J12A 3EOTL 5I1HL 3LEVL 2Z8SA 2P5EB 5C07A 3SDDB 4KRMB 3HUJA 1IM9A 3BZ4A 3MRRA 1NBZA 5H2BA 1G84A 4WTZG 5DD6A 2P7TB 4ZSOB 1GGUA 5CEYA 3UPCA 4PRNB 3ULVF 4L4VD 2ZPKH 4JJ5A 4UQ2B 1U8JA 4ZS6C 4WJ5A 2EIZA 2UV3A 4KK8D 1QBML 2WAHA 4S11A 4XVJL 4LSPL 2I9TA 1IGYB 3L3DB 4ODBD 3RWIA 2DWEA 3KPSA 5ADPH 2WWKT 1NGPL 3T04D 5BMFH 2Q6WB 1LDPL 3VI4E 4Z7NE 2BXYA 4ELMF 4URTB 3QFDB 2F74B 4YXLH 4ZUUA 1FZOB 4KRLB 1T22A 1MQKL 5E2TL 1FDLL 1LHZA 3CDYA 4UT7H 4ZNCD 1JP5A 1RULH 3RTQC 3L5HA 1J05A 1C1EH 2AEQH 3DETC 3LAFA 1QSED 2EDOA 4Y16A 3MCLH 4AEIL 4F7MB 1GGBL 1CICC 1Q38A 4E41D 4PJ9C 4ZS7H 4DUWA 3ARBD 4H26A 4LRIC 1R0AH 1T2QL 5FAAA 1J0YA 4P2YA 2GCYA 3DGGB 4MB4A 3GIZH 5D7IE 4ELMB 2XN9E 3MFFA 4ESKA 1XGRA 2A1WH 3PXHA 4GXUM 1H8OA 2APFA 4YDIH 5DD3L 1JNHA 1XF3B 3IGAB 4WDIA 2VLRA 5BZDB 4HPYH 5JA9A 3LN5A 4OLXH 2JKXA 3B2VL 3C5ZB 2XKNA 4WV1C 1FH5L 1ND0B 4Z5RB 2O26U 1A6ZA 3FB7B 2HKFH 1LQSR 3ARTA 1UXSB 2I5YH 1JRHH 1JTTA 1UWXK 4YBHA 4D9RE 1FYHB 3KG5A 2IAMB 3CLEL 2DQHH 3QQ4A 4JQXA 4LSQL 3FO1B 5EZLA 2J4WL 3QFJE 5I8OH 3UDWC 5DHVB 4AK1A 4X7CC 2BY1A 2R0WL 2GSGA 2XTJD 1JGLL 1A0QH 5ESQA 3PJSA 1JHKH 1LO5A 5D8JL 3X13A 5DJYB 3WNOA 1IBGL 2XQYG 1SJVA 5DK2B 1D6VH 1VEMA 4NC1E 2UWEB 4TSCH 3HZMB 3N9GL 3RVTD 5ICZB 4Y19B 3C6LB 5I8KH 2VTFA 1BFOA 4BM7A 1AO7B 2VLKE 2G75B 1RIHH 3OR7A 2N1KA 4HMDA 2MOVA 3DUUA 1IKNC 4HK3N 4KK8C 5CLWA 5GGTA 3U9UB 2FBJL 4IDLA 4ZUTA 1OTSD 4R8WL 2C3GA 2OR9L 3HE6A 3DV4B 5C8JA 3K4AA 2OK0L 4JHAH 5B3JE 4DZBA 1N64L 2BERA 4NWTH 2Q8BH 4D3CH 3G5VB 5ESVA 5INDB 4HIJA 2XPGB 4G9FA 2XA8H 4GKSA 4P5TB 1QTYT 5CCKH 2XY1A 4RDQG 1YMHB 3VMNA 2KBGA 4D0BA 5JHDA 3F7RA 3IJSA 3PIQA 4LHQB 4U7KA 3DVNA 4ZUSB 4WEUD 1FJ1A 4MQXD 1ZT4A 3VFSA 3V5DA 4GT7A 4L9LC 1YQ2A 1F3RB 1AH1A 2DN7A 1G7IB 4CBPA 3QDAA 4NKMA 2GJ6A 2XZAH 3ARBC 2IPTH 1BGXL 1ZWIB 5TE7L 3V8OA 3OTTA 2BHYA 2XIDA 3VFMA 1JF1B 4KKAD 1G7LA 5GSVB 5A2IH 1AQDA 2GTZB 4FQ1L 1AJ7L 1PDKA 4H5SA 1VENA 2JB6B 12E8L 2JIXD 1Y18A 1EUUA 3CFEB 6CGTA 4NP4L 6FABL 4HCRA 3WDJA 5HHPA 5ILTH 2W60B 1FN4B 3GKZA 3S4SG 4NUJB 4P99A 1TPXC 3ARGD 4N0UE 2NY6B 2R2EA 3SDAB 2A9ML 1JZ7A 2HJKB 4M43H 4YXKH 1CZ8H 3VG9B 5B8CC 4Y4FB 3OHXB 3U1SH 2LTQB 1YEHH 2NYYC 1CL7I 3MGTA 5J1SC 3WIIH 3RVVD 5L2KD 3R06A 2XTJC 3CH1B 4LKCB 5EU7C 5KJRH 2VL5A 2D03H 2A38A 4W81A 1JGDA 5DZNA 1TMCB 4G3YL 1QSFA 4N8VG 1MRCH 4P2RA 3TCLB 1L7TH 1W72L 5IMOB 4KVNH 3RVTC 3HRZB 3PHOB 3IDIA 3UTSD 1A9EA 2WM0A 4JQVA 5DRZA 4KKNA 4M61B 3CLFH 4NSKA 3CZJA 4LQFL 2X1XR 4TNVK 5C07B 1DQDH 2XICA 1DBBL 4O9HH 3OJVC 2RR3A 1EFXA 1FCGA 5IVXA 3BZ4B 3CSPA 1NBZB 5H2BB 2UVFA 3P4LA 1ONQA 2Q87A 1OTSC 3BJ91 5DD6B 3GSNH 2RCSL 5F7YC 3D39A 3KJ6L 5E2WH 5E5UB 5JXAH 1G7PA 4WENB 4JJ5B 1U8JB 4WJ5B 2EIZB 4P2QD 4IMLB 1A9BA 2RBLA 5FO9B 3WNNA 1RIVL 2BXZA 4HBQA 1QNZL 4BK5A 1JV5A 2HYMA 3RWIB 2DWEB 3KPSB 3JV6A 4OFPA 3KPRD 4DGVH 4Q9BA 2CDGA 1T4KA 1GH7A 4PS4H 2CLVA 3S36L 1ZSDA 1EJOH 5ANME 1WGOA 3HZVA 1H8NA 4MGXA 4HKJB 4MQXC 1T6WA 3WO4B 1IILE 4ZUUB 4U1IB 3PGCA 1X6LA 5E00A 3RUGA 5DC4B 3U7WL 4CNIB 4M7LL 2LAGB 4IDJH 4KK6D 1MJ8L 1D5IL 1NMBL 4XNYH 1J05B 4UT7L 4XPFL 1RULL 5M94B 3JV0A 3OAYH 5IMKA 3VH8G 4KKAC 1DQMH 3UC0H 1X4YA 3QDGE 4AEEA 1XR9A 1NLBH 4HLJA 4DKEL 1E6JH 2XYCA 1TCMA 5DK0A 4H26B 3B8SA 1IC5L 2ADFL 2GCYB 5FFLA 2AAVA 3L7EA 3EYVA 3ARGC 5B39G 1XGRB 4ODTH 1SVCP 3MCKA 3RAJH 4MHHI 2BSSA 2A1WL 3RWHA 4WDIB 5E8PB 2VLRB 4YDIL 1BWMA 4R90H 4U1MB 2C3VA 3LN5B 1NANH 2XKNB 3RVVC 5ALCL 2IADA 4GBXA 1A6ZB 5KW9H 1JPST 4Q7DA 1N4XL 5GJTH 1HXMA 3S36X 2W0FA 2BNQE 1DUYB 2HRPL 5EZLB 3L3HA 4NM8L 3T0WA 2GSGB 5DD0H 5C0BE 2F9BT 3PJSB 4LLWB 4KPHH 2VAJA 3X13B 2Y7QA 3NH7L 3MRNB 2VN4A 3WN5C 2B2XH 4NNYA 1U2CA 1D6VL 1CI5A 2H2PD 4OCXL 3OAZH 2BVTA 1GHFL 1R6VA 2KDGA 1BFOB 2BNUA 3E8UL 4PGBB 1K8DB 4X99A 4D9QE 3L3JA 2Y4SA 4HG4J 5F72S 2JLLA 3F58H 1I7ZA 1NMCC 1C5CL 3DUUB 3L3OA 4M4PA 1BD2A 1T66D 4ZUTB 1X44A 1G9EA 5KSVA 4WFHD 1FIGL 4X6CA 5GGSY 5HHXH 2NY1B 3AREA 5C8JB 5D5ME 2IJ0C 4XNZC 3MJ6A 4DZBB 2Y06H 4LPTA 2AJSL 3N1QC 1H3PL 4HS8L 4XPBH 4X4MA 3GBMH 4R4ND 5IGXL 3BXNA 5J6GA 2Q8BL 4PGEA 4G9FB 4R6UA 4GKSB 1Z3GL 3SGKC 4W68A 3WV0A 4J1UB 1YEKH 5DHXB 2ZUTA 1F3DH 4KK6C 4D0BB 5JHDB 1R3JB 3PIQB 5ITBL 2IPKA 4G6MH 5EOCH 1GZPA 5JMOC 5IEHB 3HMWL 4UTBH 5E24E 2O61A 4PB9H 4PFEA 3U0WL 4I2XA 3V5DB 3VFSB 5T33L 1CK0L 2QSTA 4KH2A 2X41A 1ZVYA 4OCYL 4NKMB 4K9EH 2GJ6B 2EH8H 3BFOA 4LLQA 3ILPA 2X4UA 2VXUH 2H41A 3AS2A 1OD9A 4OF7A 4JFEA 4P48A 3T2QA 3RY6A 1AQDB 4QXGL 1OL0A 1QRNE 4H5SB 5HVGB 3UTTD 5KAQF 3U0TA 2O5ZH 2PW1A 1FLRL 3NCJL 1KLUA 5J8OA 3IDXH 1K9TA 3DO3A 5HHPB 2MTPA 4F7PA 1UJ3C 2BMKA 1B0WA 2NY4D 4YGVA 5IQ7H 1A8JH 1T7ZA 2R2EB 4DUXA 4JFXA 1UM5L 1TTGA 5FA3A 3RJDA 3BO8B 3BN9D 3T0EE 4U6XA 3GSOA 4OGXH 4PJIE 3MGTB 3TF7C 1Z0MA 4LCWE 5FHAL 4KZDH 3U1SL 3ARFB 3R06B 3RIAF 5I1EL 3QEUA 2VL5B 4I13B 5ACLA 3SKMA 2ICWI 1JGDB 3HR5A 1QSFB 4YHZH 4P2RB 4LPVA 3IDNA 2H2PC 2WWMD 2ZOKA 3IDIB 1J11A 2VLKD 1L7TL 3GRWH 4EI5D 5DRZB 5HGDB 5TDPB 5F3BA 2NXZD 3CLFL 3DUHA 5DI8A 1BFVL 1CS6A 1T7VA 5I2IA 1AD9B 5IVXB 1ZLWH 5CUSH 2VLME 4I9WD 1T66C 1ONQB 1OSZB 5TFSH 3VXPA 4OLWL 3RKDD 2ERJB 1VFMA 5HI5D 4XNXH 3MJ7B 3D39B 2XT1B 4PP2A 4AM0A 2PYEE 4U1GC 4UT9H 1G7PB 3VU2A 3H9ZA 3SJVE 1NC4D 1ZKAA 4R4NC 4LCUA 1A9BB 1T0NA 5FKAA 2OSLA 3V6FA 4APQA 3BISA 1FNFA 4JRXE 4X9BA 2X7LA 3JV6B 3SBWA 1CFSA 3LCYA 3VD4A 4LCCA 2CDGB 1T4KB 2CLVB 2EEBA 1ZSDB 1LE5A 1IEAA 3A6CH 4IMKA 3HZVB 3INUL 4OD1L 4PJXE 5FO7B 4TTDD 5DHYA 1UXWA 3PGCB 3MV9E 1MI5A 3S97C 5T1KD 4N0RA 1WTLA 5DMIH 4TSBH 4LGPB 4RAHA 5IMKB 1RIUL 2OL3B 1EBAA 3EDFA 4DOHB 2V5RA 1KCSH 5CD3A 2DI8A 4RX4D 1XR9B 5FUCC 1OWRM 5DK0B 5IJVA 1DTUA 1OW0C 3MCG1 1YNKH 1E4XH 3Q6GH 2NY4C 3QA3A 4O2EA 3L7EB 3EYVB 3H7BB 4Z95H 4GW5A 2WUCL 4L29A 3MCKB 3QWQB 1CLZH 1SY6H 3BN9C 5SWZA 3DX8A 3RWHB 3BE1H 1U91A 1N5YH 4Z7UF 1HSAA 3HI5H 3M1BB 1G6RA 5IT2H 3DMMA 3MTRA 1GVIA 1U8KA 1UGNA 4NC1C 4GBXB 3FAWA 3FMGH 3D5OF 3EYFA 1HXMB 3QXTA 3SKNA 2PF6A 4CJ1A 3HAEB 2W0FB 4A6YA 3TBYA 4P23D 4E9LA 3LS5H 1N59A 2WWMC 3OKLA 1OP5H 3GI8H 1F4HA 5IBUB 4EI5C 4CMHC 2W65A 4PJ7F 4M8VA 1NL0L 2Y7QB 5DD0L 2NXZC 4MJID 2QSCL 4XPHH 3IKCA 2H32A 3QNZA 4AIXA 1MVUA 4MXWH 4P57A 1V7MH 5HGBA 1W0WA 4NNYB 5C92A 4NZUL 4QNPE 1OAKH 4ZO7A 1EEUA 4WEBL 1EMTL 4U2YA 4Z7UB 3RKDC 4PY8J 1F02I 2BNUB 5C86A 5HI5C 4KDTA 4NHCH 4NZJA 3O8XA 3L3JB 2E6QA 2EE3A 4Z7VE 1F3DJ 4GAYA 1I7ZB 1GPOL 5I15L 4KXZH 3L3OB 3WUWA 5EOCJ 1BD2B 5KSVB 1PVHA 3ARDB 4I3RH 2DI9A 4CDGC 3S34L 3AREB 4OCWH 1P7HL 4N90E 1I1AB 3QIBD 1SJHA 5JPMA 1S9WA 3LD8B 3LKSA 5D1XA 2FJHA 5D70L 1CD0A 4TTDC 5J6GB 3BXNB 4PGEB 5HHMD 1KELL 4HWNA 4HX1B 4B41A 5D7LD 5FOBB 1FVEB 5DJDA 4JQIH 3I02A 2XXMB 4M4RA 1GZPB 2O61B 5FGBA 4I18B 1HH6A 4I2XB 3QDGD 4DQOL 1U8MA 2CK0L 1CXLA 3HC4L 4NN6C 4RISL 2ZUXA 1MWAA 3BYYA 3DVIA 1V05A 2YK1H 4LLQB 3DWTA 4RGNE 5J13B 3EKCA 2QHRL 5TJWK 2F58L 2EH8L 2HG5A 1NFDE 4JFEB 3EFFA 3UBXA 1WLHA 3D2UD 1DBMH 1KT2B 2OI9C 4JN1H 4P9HL 1QACA 3BP5A 5FHBH 1OAYH 4ONHA 3TA3D 3GKWL 1GOFA 4IEFB 1KLUB 2B1HH 2WBJD 4F7PB 2CD0A 2BMKB 1LGVA 4TNVF 1VFOA 1KULA 2E3VA 1JBJA 3JWNC 4YGVB 1ITBB 2BNQD 4JFXB 4TOYL 5M95B 4MJ5B 4OAWA 1BBDL 5FA3B 3HZKA 1UH4A 1YPZE 4U6XB 3D1MC 4P23C 2HMID 5C0BD 1NMAH 2YKLH 4YQXH 5E8OA 1JFQL 1IAIH 3QEUB 4BZ2L 5D72H 3SKMB 4JKKA 2MQ0A 5JW4M 5JR1H 4HQQH 3CXHK 3IDNB 2ZOKB 2NPLX 3S8WA 4D9QD 3L95B 3TT1H 2J3SA 4YHLL 5F3BB 5MENA 4D94A 4UV4L 2FX9L 2QQLL 5HXMA 5DR5H 5I2IB 1T89C 4X7EC 3HZYA 1I75A 2C5DC 4OLYH 5DVMA 4PG2A 3VXPB 1J0IA 3H3PL 2EDLA 3EJZD 4JDVB 2CKBH 3MMEA 4G6JL 4AM0B 3NIGF 4XX1E 2ESVA 4OM0H 3QIBC 5AYUL 2W07A 4N1EA 4LCUB 5F9JA 1T0NB 2OSLB 3V6FB 3FN0L 4APQB 2XI9A 1EEZA 2X7LB 4JRWA 2AJXH 1A4KB 1CFSB 3QUMA 5DK3A 5E95B 4LCCB 2DTMH 1LE5B 1IEAB 2L7JA 3W5MA 2VOTA 3EGSB 1RUMH 4HZAA 3F6LA 5HYSB 5DHYB 4ALAL 4E0RA 5EIIB 4HLZH 1YN6A 3OR6B 1MI5B 3E6HA 3QCVL 3D18A 3C08H 3SE9L 5IK3A 4AZ8A 2ICWA 4PRHD 2NW2A 2XZQH 1QRND 3B5GA 4FQCL 3V0WL 1RMFL 1ZANH 2Q86A 3IF1A 4HBCH 5T3ZH 1G1YA 4X83A 3LQMA 5CD3B 4IRSD 4JANA 3TA3C 4NO5A 5D7JB 3CMGA 4TN9A 5IJVB 2WBJC 5HHNA 4F7CA 5L88H 5I1CH 3NPSB 2CSPA 4JN2A 3U79A 3LQZA 3QA3B 1GRWA 3BSZH 4O2EB 2IH3B 4YGAB 1E4XL 1CGVA 2UUDH 4UILL 3T0ED 3O6ML 3ULUF 4L29B 1MCDA 4MAYB 3G5XA 3BAEH 4P59L 4LCWD 2Y5EA 5SWZB 3IFNL 5JXED 1Y6NR 2DD8H 1U91B 2HMIC 4NQCA 5EO1A 1HSAB 1BZ9A 4HS6B 1LD9A 4JLRA 1XMWA 2NTFB 3SKNB 5BW7A 3DO7A 4A6YB 1JWMA 3TBYB 3CFDA 3O2DH 3ZHKA 4HKBA 4BK4A 1NCNA 2VZ3A 4NWUH 2JCCA 1N59B 3OKLB 4D0CA 1M7DA 1OAQH 1KN4L 4FZ8H 3RFZC 4OF3A 5CGTA 2W65B 3NIDE 2Z35A 5SWSB 1J7VR 2EKJA 3IKCB 2VLMD 2H32B 1MVUB 4P57B 5HGBB 5EBLB 1W0WB 4YDKH 3HNSH 1HIMH 2CRMA 2QR0A 2E7MA 4EZMA 3VI3E 2CUIA 3EJZC 1E27B 1PSKL 3SJVD 3O8XB 3C2AH 5DMYA 3BDXA 3LS4H 4GAYB 4HIHA 4X7SL 1A7OL 5FGRA 1LEGA 4F2MA 3T2NL 1HSBA 4OFYA 2EC9U 2GW5A 4TPRL 3BW9A 3O6KH 3TVMC 2BNRA 4U7SA 2XFXA 4BQ6A 3CGTA 1FYTA 2GKIA 3W0WA 2AQ2A 4I3RL 1UM6H 4JRYD 4UI2A 3GJFH 3WSQL 4FFYH 1SJHB 2HFEA 4OCWL 1VGEL 5JPMB 1V3LA 1MCWM 1S9WB 2FJHB 1MY7A 2WSKA 4LU5L 4C4KO 3ZKXC 3O41A 3MV9D 3O9WD 1P6AB 1EDQA 5E9DE 1F58L 1T0PB 1BJ8A 2XKUA 4D2NA 1ZLUH 1H3TA 1S7VA 3I02B 3S35H 4PD4J 3BPOC 4LASH 1YYLH 1HH6B 2BOCA 4XBEH 5E03A 1O0VA 1Z0NA 1U8MB 4XCFH 1P7QD 3U7AA 2EE6A 4CU6A 4IRSC 1OPGL 1MWAB 2L4OA 2IGFL 3G6DH 2AEIT 5D2LF 2J7LA 1N8ZB 4MXVE 4TUKL 5GRWA 1DFBH 3DHMA 5ETUA 5F44A 4MAUH 2HG5B 5DT1L 3EFFB 2C1OA 3UBXB 2YPLE 4DVRH 2R4SL 3RWJB 1JNNH 3BP5B 3ETBF 4GQ9H 3CK0L 3T0EC 1RHHB 2X4QA 1WJ3A 1O7SA 3GSXA 1CDIA 1QG3A 4BSWA 5JXEC 1RZGB 3CSGA 4OSUH 5CAYB 4NM4L 4LSDA 5T5NG 1EZVX 3SKJL 3M8OH 1PY4A 2K7PA 4YHYB 1ETZB 1MAMH 4XC1H 2ICES 1XCTA 3NCBB 2VDML 5F7WC 4YX2H 1P5VA 1P4IH 1AY1H 5TE6L 5HI4D 5E8OB 2DMBA 3ZYJA 5TF1H 3FTGA 3MXWH 4R97C 3RHWK 3PV6A 3ME0A 2ZJSL 1N3NA 2P5ED 1DQTA 5TQ2H 1TJGH 5A43C 3RNKA 2W91A 1HI6A 2OL3L 5F70A 5DURD 4XX1G 3NCYP 2Q8AH 1IQDB 1XGUA 4TUJA 4FA8A 5MENB 1NEZG 1LK2A 4G8GA 3KYOA 5K59F 3BN3B 1CDCA 4DEPC 1NDMA 3HZYB 4EVNA 2DTSA 5LJYH 4LLDA 3NBNA 5GGQH 2DBLL 1X5LA 3ZE1E 4M1CD 2IFFH 4QXWA 2ESVB 2GK0A 4LHUG 2CKBL 1QFWH 5FKPA 3G04A 3O9WC 4NN7C 3HNTL 3KS0H 2LU4A 4XMPL 2X4RB 4UNUA 2Y36L 2C3WA 2NX5D 1TJHL 5FCSH 4ZO8A 5CILH 4BELD 2DAVA 3Q1SH 1UT9A 2A6IA 2YD8A 3BZFB 4E0RB 4JB9H 2FX8L 1GZQA 3EJJX 3MLVH 5GXBB 3U9PL 3C09B 5ACZB 1I9RH 3E6HB 1NGWA 4OTXH 3T65A 4OJFL 2ICWB 2XNAA 3L5XH 2NW2B 1TVHA 5BS0E 5DEGB 4NKQB 3IF1B 2Q86B 4PV8A 3QUYA 1CWVA 2QLVB 1WWBX 1ZANL 4JANB 5EU4B 2GJZB 4NO5B 4G8FA 3QZWB 2Q3ZA 5EO0A 2DM3A 5HHNB 3EZ8A 2VO5A 5EO9A 4KGJA 4QXTB 3MLZH 1A6UH 4ZTOH 2B5IC 4OIIH 5GGVL 3PWPB 4HXBL 3LQZB 3RRQA 5IHBA 1MJUH 4EJ1C 1MHCA 1OOAA 5C0RL 4Y1AA 1JTPA 1JUFB 1TNMA 3ESVF 4PV9A 1HKLL 1MLBB 3G5XB 2B7DT 4POUB 5AWNL 1MH5A 4NQCB 5IHZA 4KROD 5EO1B 5EBWB 4JFDA 2DQJL 3E1F1 4JO4H 2N4IA 5HI4C 2DD8L 3ET9F 2XQBH 1OVZA 1OLLA 1LD9B 2EIDA 1WWWX 4JLRB 1CF8H 4NKIL 1AGDA 4IS6A 3RBGA 3PDOB 3DO7B 5EBMA 5HYEA 1JWMB 4FQ2L 4I0CC 4KI5E 4O51A 3MRFA 3I9GL 4HKBB 2IH1A 3MRDA 2P4AB 2JCCB 1DBAH 2AJ3B 1GGTA 2M26A 3UJIH 4Z0BH 1M7DB 5I1JH 2VITA 4BSVA 5IB1A 1MPAH 2VN7A 2Z35B 1YMME 2ZUVA 3CNKA 4FZ8L 1AO7D 4IJ3C 1FO0L 5EUOE 4MA3A 3PHSA 3PP3H 3CXDH 1F4WH 3KPTA 4K07A 2QR0B 4MA7H 4ZUWA 4YDKL 1OY3B 3O4LA 4QHLA 4M1CC 4XP6L 2YRZA 3JWOL 1NANI 3VXRA 2DQFA 3X3FL 2ZP0T 3MRGA 3ZMRA 1WAAA 5EORL 1LEGB 4F2MB 1HSBB 4M7KL 4ODVH 5D7KE 1YC7A 3RL1A 2BNRB 4P5TD 2XFXB 2EECA 4QRPE 1FYTB 4QT5A 4PJCF 2P42B 1ZLVK 4LHUD 4LRNH 4TULH 4RNRB 1S9VA 3VG0H 2HFEB 1JWSA 4EN3D 1IZJA 3O41B 3H6JA 3SGEH 4K94H 2HWZH 2Y1VA 4GSDL 2NMSA 4MDJA 5E6ID 3B9VA 3SOBH 5FUOH 1S7VB 2R1WA 5DQDH 4U0RB 4ZXBD 3TZVD 1VB9A 2MNUA 3G6JE 2X05A 5FV2A 1FSKB 4O5LL 2BOCB 4OI7A 4M7LT 3T8XA 1KIQB 4WWKA 3ELAT 1YYLL 4F9PC 1J0ZA 3OPZL 2CUMA 1X5XA 4O02H 1Q1JH 2ED9A 1N0XH 1CGWA 2IBGA 3K46A 3WIFB 5C0ND 5DZOA 4XBGA 1YY8A 4OI8A 1RI8A 4PJCB 5DD1H 2C1OB 3NCEB 4FG6D 3AROA 4FTVE 4XCYB 3A0OA 3QHFL 4CN4A 3WIHA 2FNBA 5FK9A 4DVRL 2GT9A 3SDAD 1BIIB 3GSXB 4NQEB 1Q9KA 4PY8I 5BOZG 4BSWB 2F54E 5ERWA 4KROC 2A0LD 5JUEL 2ENSA 3FB5A 1IARB 2X4SA 3ZE2F 1FRGH 3M8OL 1FAIH 2DQDH 1CFQA 1XCTB 2H45A 3L3GA 3MGAA 1UH3A 2SEBB 1E4KC 4Q97A 3FTGB 1FBIH 5E8DL 5E7BA 1ORSA 1HILA 4K8RL 1J86A 1BQLL 3S9DB 4XCEA 4DGIH 2Q76A 5DJ6A 3RNKB 2H6PA 1OHQA 3AB0B 4LEXH 2R15A 1HI6B 3ULVH 3KS0J 1XGUB 1FNSL 1HHGA 3HG1A 2GYSA 3KYOB 1TTUA 1UWEL 5T3ZE 5C0FA 2A73A 3WD5H 4XWOD 2PETA 1NDMB 4EVNB 5I1IL 2Q3AA 1YQVL 4LLDB 2DJUA 2UZYB 2VDRL 2P5WA 3RTQA 1A02N 2YD5A 5A16A 4KK5D 4P5TC 2HAZA 5CIPA 3DARA 3VD3A 2GK0B 3UYPA 4A2MA 3NOIA 4EN3C 4XPGH 3DVGB 1RZ7H 3G04B 1CICA 3NACH 4LFHG 4PJ9A 1L6XA 1PBYA 4LRIA 5E6IC 3MOAL 3S96A 3BOVA 4S2SA 2IG2H 3MJ8B 3KLAB 1K4CA 3OKYA 3VD9A 3MRCA 4ZXBC 3TZVC 1NUNB 2AABH 2A6IB 4X5XB 2F53B 1GZQB 2ZUQB 3MLWH 3RNQA 5DHVH 2ZCKL 3NFSL 1EXUA 4WV1A 4MNGE 5LVEA 1Q0XL 1NGWB 4PJAA 5C0GA 3T65B 2XOTA 5C0NC 2OZ4H 1A6WL 2XNAB 3ULUL 2A77H 4FG6C 4HEPG 1TVHB 5BVJA 4Q9QH 3GB7B 4PV8B 5FM5O 5I75C 3QUYB 2FSEA 5I1GL 5JOFA 1YNTA 3SDAC 3UDWA 5IMLB 5GRJL 3VXTB 2WIMA 5EO0B 1LO0H 1XZ0A 4YBQD 4M5YL 3LZFH 2LTQC 5EO9B 2P43B 5A40E 1B4RA 1RPQA 2A0LC 2XQYK 1H5BC 1WWAX 2YUZA 1KGCE 1MHCB 4X9IA 1CDHA 2OP4L 4ZTOL 1HHKA 1WIPA 1WC7A 2HT3D 2AK4E 2P46B 3QWRD 1LE9A 1MH5B 3OKDA 2AEPH 5DGQA 2DLIA 5C7XL 1AD0B 2APXA 5IHZB 4JKWA 1FGVH 1U0QA 5E2VH 4JFDB 3BEVA 1ZEAL 4PIRF 4K2UH 4L4VA 3HCVA 5I66B 1AI1L 3D69A 1CE1H 2JB5H 3BRDA 5IB2B 1IKNA 1WAAF 3BH8A 1AGDB 4X6DF 4IS6B 4P5MB 3S5LG 3TC9A 4O51B 3MRFB 2IH1B 3MRDB 2ADIA 5JW4R 1X5KA 4P9HC 2KZ1B 1QP1A 2VITB 2R23B 4BSVB 1DBAL 4IHOB 1JHLH 4XPAH 1T1XA 4WTXA 1G9MH 2WV3A 2EKSA 4XWOC 2AJVH 4GLRI 1UEYA 4ZUWB 4QXUH 4QHLB 5C0CB 3VMPA 3AM8C 4KK5C 3OB0K 4MQ7A 4RGOH 2BZDA 1QSEA 5ISZE 2NY1D 4NO3A 3QDJE 3VXRB 3H7LA 2EYRA 3MRGB 4L9LA 3UPAA 1FL5A 5BO1H 3SE8L 3QDHA 5ENWA 1BOGA 3HI1B 4HFUL 3QSKB 4E41A 3ARBA 1G6VK 3C60B 4FQHA 4OIBA 4BFIA 2FH6A 4ODVL 5JOPE 3RL1B 1ZOXA 4QT5B 3P11H 3EO9L 2XACC 1S9VB 5GGUB 5DTFB 2WLYA 1JK8A 1JWSB 4LFHD 5CBAB 1IQWH 2R9HD 1CQYA 5DVNA 4MDJB 4NC2B 2PO6D 4RA0C 2XWTA 1OAZL 43CAA 4R2GD 4K94L 4LVNC 2R1WB 3FOMA 1QSVA 5HGAA 3D3VB 2YS4A 1BJ1J 5B8CA 4ODXA 4UIMA 3T8XB 4WWKB 5TF0A 3EDJA 1KACB 4UTAH 2VQ1A 4WU5A 4KXZI 4HFWA 4KTDL 4YBQC 4PLNC 5HHQA 4OZHF 1YY8B 4XBGB 1Q1JL 2ZSWA 3RHWF 3SDXE 3T4AB 1Z6JT 3ABZA 4PR5A 4QTIH 2ZWLT 2R56L 5FK9B 4XHJD 1QLEL 2GT9B 3JUYA 1CFNA 1YEDA 1Q9KB 4U1KA 5ERWB 1EHLL 5KOVC 4JFZH 4LDOB 1G7HA 3HNVH 4LDEB 5GHWL 2DKSA 3ZT6A 1QPPA 5HVHB 3FB5B 2X4SB 3S37H 4K7PL 1YEIH 4HLZG 1CFQB 1M6OA 1J1PH 3B3IA 1B0RA 3L3GB 4WUUD 4TQEL 4LPYA 5DVOA 3ROLA 3U4EA 3FL7A