3FN3A

Dimeric structure of pd-l1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
215
structure length
215
Chain Sequence
MFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Programmed cell death 1 ligand 1
publication title A dimeric structure of PD-L1: functional units or evolutionary relics?
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
A PF08205 C2-set_2 CD80-like C2-set immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn3A02
2O93L 3QAZC 4P2OC 1F6AB 4M7LT 5AG9A 4NQSA 5JW3L 4F2MA 5GZND 1RZJH 4CMHB 1Q1JH 3VDCA 2P5EB 3BPNB 3PWLA 1N2RB 3OKNA 4RQQA 1A0QL 1H3UA 2IQAB 2MPAL 3CFCH 4XPTH 1DLFH 1RZ8A 2WP3O 4WCYL 1CXFA 1E4XI 3VXQA 4NCC1 2DJUA 1MCOL 1BX2B 2YA0A 2WM0A 2VZ1A 3WN5A 5ANMB 5KVMC 5HYJA 3HI6H 4JJ5B 4IS6A 3FOMA 5C0BD 3UO1H 1BPVA 2Y07L 1GPOL 2Q1EA 3V4VL 4PV8B 4ZODA 3TH2T 1PG7X 4PJEE 4DN3L 4ETQB 3DX6B 3GIZL 4RGND 2JCCE 1ZT4B 2AJSL 4XPBL 2CKBB 1Z3GH 1KN2L 1ZHBA 3ES6A 4HUVB 1FG2B 1I3RB 2E7BA 4UTAH 4QLRA 3V5KA 3MJ8B 1FL6A 4MA3A 4W6YB 4X4YB 3PABB 1LO0H 3FFDA 1BFSA 4XNUH 1L6ZA 2Y7QA 1T04B 5K9OA 4RAUA 3MRMB 3VCLA 2YA2A 4UNTA 1MWAB 5FXCH 4NKDB 4PY8J 1ZLSL 5C0AB 3OMZA 4MNGE 2XQBL 4L9DA 1VGEH 1H15A 2R56L 5MI0B 4E41B 4BZ2L 5HPMB 5IGXH 3CH8A 3QEQB 3RUGA 5K33A 3B6SA 4C56D 4NYLA 3MNZA 4YDIH 1FIEA 1VFAA 1ZLUK 2D7MA 2X4PB 3RNQB 1Q9LA 4P2QE 3VXUE 3W9DB 3FL7A 3LSOA 3TC9A 5SV4A 4EI5C 4FQCH 1FNEB 2APVA 5EPMB 5C08A 3OG6B 4PRHE 5HGAA 4PLJD 4YNYA 4OAWA 4XWOD 2HJLA 1FNFA 4PJ8D 1U9KA 3RQ3A 1KB5H 3DETC 2NXYD 2Z0BA 3FRPA 5F3HA 3T77B 2QL1A 3SE4A 3GJFH 1BFVH 2NW2B 3OJDA 4OLXH 1JGDA 1ZLWK 4KROD 5CBEA 3QDJE 4M61A 1LGVA 5DQDH 1PY4A 4JZJA 4XAWH 1MFCL 2ATPB 1FLRL 5AYUL 2MCPL 4UNUA 1Z0MA 3H0TB 3RDTA 4Y1AB 3G6JB 4UINH 3O2WL 1DR9A 3NMEA 3SDAA 4U0QB 3MRFA 4QRPB 2IPUG 3HCVB 3LRSA 1GGCL 1MCWW 2YK1L 3HAEH 3ZKNC 2R15A 1I8MA 2DL2A 1FNGB 1IAKA 3FO0H 4J3OC 1ND0B 4MQXD 3MGOB 5T5NG 3ETBF 5C8JB 1MF2L 4JN2B 3N1QC 1A1OB 3GSQB 1UM4L 1HILB 2BNQB 5TPWL 2QSVA 1T2QH 1WITA 3REWA 3GMRA 4JG1H 4OV6F 3WFEH 4OLUL 3QEUA 3MV9E 3V7AE 3RY6A 2VLKA 3RWHB 1N5AB 4U1LA 1UYWL 1FCCA 3P30L 3MRLB 2EYTA 3D0LA 3WLWD 1TZHA 3WJLA 5BS0E 3X12B 1BF2A 2DB8A 2VKWA 3G08A 3O3DA 5GSVA 5FEBA 4MA1B 5GS2D 1EBAA 4M02A 2R2HB 3U9PL 3QUXD 4KHXL 5CGYD 4XBPB 1P53A 3DVNB 4JKLA 2E6JA 4NC2B 3SKOB 4PJGF 3O4LE 2VLME 1RIHL 3CZJA 4LLYB 1PD6A 5C6PB 4F57L 4X6BB 5HGHA 4FS0A 3UPCA 4AMKL 2IPKA 4YUEH 4K94H 1EHNA 4M8QB 1DSFH 2JELH 4KMQA 2VQ1A 1TNNA 1CXEA 1A47A 4M7JH 1I1YA 3ZYZA 5D7JB 1S7XA 1RJYA 2R9HC 4G9FB 4HIHA 3RIFF 2VQTA 4DQOL 3PL6D 2QADB 3NFPA 1T7WA 4TVPE 4X5XA 3BZ4A 1E27A 3QXAB 4JRXE 2WW8A 3P77B 4MHHG 5CKAA 1I85A 4MDJB 4F7PB 3T09A 3D69A 3RTQC 3OB8A 3INUH 1H3VA 1FO0H 3BDYH 1ZEAH 4AM0A 3F58H 1XGRB 4PJAA 1U8PB 2ERJC 1A3RL 4KGLA 2IQ9L 2P8PA 4LSDA 5IB4B 2AV7A 4IRZL 5H94B 3BGMA 4IDJL 5E70A 1NGXA 3DO7A 3V79C 1Q72H 2QQLL 3FOLB 3UTSD 4F37F 5DS8B 3D48R 1XGQB 4R97B 4MLIA 2F58L 1JNLH 1E28B 4Y7MA 1G9MC 4QO1A 4QRTA 4TVPL 3LN4B 1AD9A 3WL9A 1X4YA 3WNOA 3WD5H 5D1XB 2UWEE 1CBVH 1H0DB 1J05A 35C8H 3FONA 1J5OL 5KTEH 4M7LL 2DMBA 2NXZC 3QI9B 2X4OA 2CLRA 4JY5H 5GGTL 1DVFA 1SJHA 4Y5XA 1J10A 2NTSP 3TIDB 5DRWA 3BH8B 4U05A 3WNNA 2DAVA 3LRGA 3RA7L 4YDKL 4ZPTA 3I3BA 4UMGA 5D7LE 3T0AA 1BQUA 3KXFB 5IT2H 3UJIL 5FB8B 3P11L 4L8SB 2AJZB 1QLEH 3VRJA 9CGTA 1GGBL 3OAZH 4YK4B 5I71C 1EEUA 1CZ8L 1IEAB 3OJMB 3GHEH 4RFNB 2P5WE 3L7FA 4XVTH 4KKBD 3R8BB 1D5MB 1YY9D 4IJ3C 5ADOL 4XP5L 4Z95H 3VFSB 1PQZA 4ALAH 3HPJA 4PJFF 2LVCA 3WXVH 4JM2A 3QDAA 4LLMA 3QNZB 3QWOA 5DUML 2X9YA 5JMOC 4OD1H 4JCMA 4PRNA 5E94B 2VR5A 5E6YA 4NGHH 3FB6B 5FDWA 5BXFB 4X4XA 1INQB 5IW1B 3TA3B 3GSVB 5DJ0A 3MREA 2EKJA 4G8GD 2P45B 3QFJA 3ZE2E 4RAVB 1ZHNA 3RVUC 5F70A 2HJFB 3ARWA 1U8IA 1LILA 1XGTB 5EOCJ 1AGBA 1X9QA 3B9KD 4TTGA 5MENA 1SYSB 4AEIL 5D7KE 1G9ML 2D3VA 5KSAD 4ZG1A 1TETL 3L9RA 4JFQA 1R3KB 4M1CD 5EZLA 4NM8H 4OD3H 2VISA 5T5FH 1DL7L 5F9WC 2GJZB 1U3YA 4YLQT 2EDBA 3MRIA 4LSVH 5DJ6A 3PP4L 4QTHB 1NBQA 5MEPB 1NGQH 2RBLA 2XWBB 3IFOA 4LKXA 5FA3A 1F8TH 4Z7UF 2ZOLB 5A3IC 4HEPG 5DRZA 4ZFGH 3MRHB 2YN3A 4NC0B 2JJUA 3HRZA 3CMGA 1ZGLA 1CL7H 5KVDL 5BV7L 3TN0B 4Z0XB 4JRYB 2V5YA 2YD2A 5CKGA 4EDWL 2DQTH 4HWEH 2OCFD 4YDVB 4HJ0C 4UV7L 2EEBA 2R2EB 4LLVA 4P23D 4OKVB 1ADQA 4MNHA 3ARGD 2GCYB 4JB9L 2DBLL 5F89B 5IJVA 1AGDA 3OXSA 4WV1A 5IBLC 1YQVL 3TIEA 1UM6L 2FEDC 3T2NH 1WQVT 4X8XA 2J8UB 3NZ8B 1J1XL 2F54D 4HKZB 4HUUB 2DTMH 4Y2DB 4HG4J 5A43C 3CNKA 1JRHL 4K3DH 4ZSOB 1OSZA 3AMLA 3IFLL 5E9DE 3R1GL 3RWGB 1P4LB 1YECH 4L9LB 2ESVD 4O58H 4CNIA 2R69L 2YRPA 1EHAA 1U58B 4TYUA 4DKEH 4GG6E 1CE6B 4UUJA 2GSGA 3LPFA 3AU1A 3BEWA 1NGPH 4IMLA 4QOKD 1A5FH 4NJ9L 1KLUA 4DFHA 2V7HB 1N5YL 1VFBB 3RBSA 3OB0K 4WW2C 3O2DH 3LKSA 3MA9H 4D3CH 3T0EA 3MLRH 3ESUF 3V0VA 4EIZC 4DEPC 4KTDL 4YXHL 1A4JA 4NKMA 1MRFL 5AYQA 4OTXH 1KUMA 2A9ML 3NFSH 3PHQB 5CEYA 4YQXH 2V2TB 5DK3A 1ZWIB 3AAZA 1N8ZB 1MCPH 1KN4H 1OCWL 2DLFH 4N1EA 4NO2B 2AGJL 2NY0C 3WIHH 1I1RA 1OAZH 2KKQA 4PRAB 4RZCB 4D9LH 3KPQA 2BOBA 4XVUC 1AD0B 5IBTH 2FR4A 1DBJL 1GXEA 1WISA 4H88L 4OCSH 1OD9A 1TMCB 3HE7B 2DQDH 1NGYB 4XPFL 1ACYH 2Q7YA 1QRKA 4LDOB 1PSKH 1YN7A 3CUPB 4LNRA 2EDHA 4HAGA 4G3YL 3MRNA 3OG4B 2B1HL 1A7QH 3UC0L 4QKXB 3SJVB 5FOBB 1DUZB 5HYQA 1V05A 1TVHA 3DUSA 4Z76B 3U0WH 3L3DB 1FL3B 4HUMB 4I3RL 1CF8L 4MXWH 5E03A 4ZFFB 2ADIB 5D2NA 2A83A 1H8SA 4ORGB 4LGRB 5F1SA 5K9KB 1UWEL 3ARBD 4JFXB 1CN4A 4HPYH 1RZFL 2X2YA 4MD5B 1AGFB 4LMQI 3JV6A 2F74B 2J4WL 4BA8A 1RHHB 2VDPH 4E41E 3LZFH 1KTDA 1NFDA 4PP1D 3MUJA 2GT9A 3Q3GA 4HZAA 1ZKAA 4UI2A 4Y4KB 4LCYB 3GK8L 1BWWA 1HCVA 2EDFA 4OLZH 3VG0L 2VLRB 1M7DB 3VWJD 4J3SA 1L4IA 5FOJA 2LFGA 5BRZE 3QULA 1FFOB 1FZKB 5BMFH 1QSEE 4CKVX 1TJGL 4NZRL 5D6CA 1LE5A 2R0KH 1YMMB 2RIKA 1SM3H 1F4HA 4P99A 3RWDA 4AH2B 1UWXK 4NQEA 3SY0A 4W4NA 1QNZH 1H3WM 4QXGH 3W82A 4YHKH 1IAOA 1SEBB 4NQSB 3ZSSA 3EHBD 1NJ9A 3VGHA 1A6UL 3PWLB 4HHAB 4Y1AE 4ZFOL 4RQQB 2OZ4A 3V6OE 3U7YH 4N5ED 1MVFA 3UTTE 3RVVD 1KCSH 4GQ9H 1RZ7H 4TTDC 1RZ8B 5EU4A 1NBVL 1QYGL 3LKPA 3X14B 4FOMA 4YHZL 3S5LG 4FRWA 3S36H 5AAWA 3O11B 4I5BB 5HYJB 1E6JH 1JPGB 1OP5K 3HZKA 4IS6B 4XH2A 3ZKXC 2SEBA 4XNYH 2OXGA 4N8PA 3SOBL 5FUOH 5KBNC 1A21A 1UZ8A 4P2CG 2BNQE 2HN7B 4PRPD 3MRPB 3A6OA 1ZHKB 2PO6C 5EORH 3CSYB 1TZIA 1ZHBB 2ZZUT 2CK0H 2OM5A 2XN9A 3W0WE 3V5KB 1FL6B 5J4MA 4XP6L 1U3HA 3CFIC 3SKNA 4FFZL 1IM9D 2Y6SD 4NSKB 3VXMB 3IYLW 2Y7QB 5K9OB 4RAUB 1FNSL 5EOCH 4Z0BL 3QP3A 3KPRA 4JFDD 4XZUA 4PUBL 3IDXL 4NZUH 3O6ML 1FGNH 4LFHG 5LXGH 4DW2L 3FZUD 1KIQB 1FAIH 3RUGB 3NTCH 3B6SB 1U0QA 2GFBB 4YHMH 4NYLB 3MNZB 5CUSH 3U7WH 1VFAB 4M4RA 3TO4B 3OAUL 5C0GA 3ABZA 3LSOB 3U7AA 4J8RB 4G9FE 1IAIM 3BP5A 4MJID 5HGAB 4YNYB 1NCWH 4OAWB 4XRCA 1Z5LA 4DVBB 5EO9B 3C09C 3O3AA 5EH1A 5F3HB 1EDQA 4LSTH 2UZIL 3OJDB 5C0IA 5B8CA 2LE9A 5IKCA 3BDBA 3RZCC 5CBEB 4M61B 3WS6A 1HHJA 4JZJB 3IDUA 4HUWA 3QCVL 3O6LH 2ICCA 1MRDL 4JE4B 3PHSA 5I30L 4JY6B 4KHTH 5SWZA 3MV7A 3SO3C 4LVOC 1EHXA 3RDTB 1R0AL 2MKWA 4L4TA 4JPWL 3HE6B 3RVWC 3DSFL 5FDYA 4M48L 4A6YA 2WUCH 3GSNL 3LRSB 4DGYL 1AR1C 4QTIL 4XB8A 1CFNA 2E5EA 1I8MB 1IAKB 2VE6A 4XBGA 1HINL 3HZMA 2QLVB 3ZO0A 2BVEA 4JFZL 4HQQH 4WI4A 4G7YH 4NC1E 4R0LA 3MODH 3LEXA 2P8LB 1VFOA 5D2LA 2F5BL 2OSLB 2QSQA 3GHBL 3GMRB 1XMWA 3I6KA 5JNYB 1VEOA 3PWJA 4JM4H 1CICC 3WFCH 3TT3H 2VLKB 1L0QA 4KKAC 4AL8L 1EFQA 2OS7A 3FFCB 1BFTA 1Q9KB 2EDEA 1BM3H 2EYTB 3D0LB 4ZTPL 1T7VA 4HPOL 4X7SH 1TZHB 1F90L 3G08B 3O3DB 5GSVB 5GGSY 4MAYD 5IG7A 3QWRD 4AG4H 1U8NA 3CCHB 5C0BA 3A6BL 3B2UD 1V5JA 4HXAH 1MCDA 4OCYH 5JOFB 3BRGC 4UOJA 4PFEA 2W65A 4O9HH 4ZUSA 4PLKC 5J12B 3BSZL 3C5ZC 2E7CA 3G6DL 1KB5A 5DHVB 2DQUH 2VXTL 3QIBD 4CVUA 5E5MA 4LCCA 3GJFA 1I1YB 1ZTXL 3E1F1 1RJYB 4XNQA 1WAAF 4O2FA 5DEGB 4PGDA 1UVQB 4OZ4A 2BNRD 3NFPB 2YSSB 1H8OA 3N9GH 5FO7A 2CQVA 4P5TC 1E27B 2CLZA 3QDHA 2YBRB 4K8RC 1MLCB 1E4JA 4KXZI 2X4NA 4JG0H 1D9KB 5C6TL 5LBSH 1BIIA 4X6CF 4Z7NE 1ACZA 3O8XD 3EGSA 4PJAB 5DF0A 4HD9A 4YE4L 1P7HL 3CXHK 1REIA 1U8HA 2P8PB 5D5MA 5D71L 4C56A 2AV7B 3HAEA 3ULSB 3OAYK 5KVGH 3BGFB 1UCBL 1C1EH 2FH8A 1OSPL 3L5WA 5FV1L 3VDBA 4HGWA 1NGXB 1OY3B 4JRYE 3DO7B 3N85L 3VFGL 3TZVC 4QRTB 3QHZH 3T4YA 4AQ1B 5JZ7D 5DD6A 4HDIB 3P9WB 4PJ8A 3PWPD 4PD4K 1J05B 4PJ5B 2MTPA 4KI5C 1BBJA 3FONB 2PYEB 4WUUD 3QH3A 4NUGL 2CH8A 1TNMA 5SWSD 3LQZA 4Q58C 1AFVL 2GTWB 1DVFB 3MCLL 1J0KA 1W0VB 3BP7B 5CJBA 5DRWB 2A74A 2NY6C 3JSSA 1DBBH 4KK6D 4F9LA 1JPTH 3C60D 3MUHL 4J4PC 1S5HA 3MJ9L 4JREB 4XMKH 2OL3L 1S8DB 4BK5A 4KXZH 2CR3A 5CEZE 1S7UA 4CL7A 1B4JL 1D3CA 3DO3A 1MHEA 5CZKA 5I6XB 1RK1A 5E95B 4LSUL 5FYJD 1LHZA 3ZL4H 3MRDA 4WFFE 5BVPL 2V9RA 4QYOA 4JM2B 1VKXA 4K8RL 4ONHA 1TQBC 4KI5E 1F4XL 5HI4D 3BN3B 4PRNB 3H9YA 2HKFL 4BFGA 4S0SD 4JFFB 5FDWB 1LK3H 5CJ8A 2APWA 3QIUB 4TRPH 4YHIA 2FX8L 4J7RA 5DJ0B 2HFTA 3MREB 1EXUA 1JMZA 1EX0A 3QFJB 5CEZL 5JIHA 1ZHNB 5AZ2L 3FO9A 3D39B 4LSRH 5DQJA 5DR5H 3BHBA 4J1UA 2AJYL 3VFTA 1AGBB 4F8QA 4F7MA 2NY2C 2UWEF 3UXFA 4N0FA 5MENB 2OJZH 1B6DA 4JO1L 4N0YL 5HTSA 1C5BH 1J8HA 3L95B 5F96L 4BYHA 1SYVA 3DV6B 1DQML 3QT2A 3U0PA 3LKRA 3QUXA 5BOPA 2OTUA 4OFYA 5K9JH 5EZLB 3HZVA 4GMSL 1NH6A 1LO4L 1U36A 1T1WA 3MRBA 4PYGA 5CILH 5DJ6B 1MUJA 5E99L 3OV6A 4OZGA 5E8NA 1R5VA 4LKXB 3IFOB 4NFCA 5AG8A 2ICEB 2JB5L 4ZO9A 3QPQD 2ZUSA 1M4KA 1KJVA 1ZA6A 3VFWB 3MLYH 3QNYA 2V2XA 1KB9J 4N5UA 5DRZB 1IEHA 3OJVC 5F3BA 4JO3H 1JPST 1ZGLB 5C2BH 5L6YL 4KJPC 1U2HA 2I07A 4WO4B 4FABH 5ITBL 3OXRA 3O0RL 3PL6A 3B8SA 4ZXBB 4QCIA 4LFHD 1FSKB 2DJSA 25C8H 4FZ8H 4MNHB 3TYGH 5IJVB 4X83A 4ZPVB 3SE3A 3Q1SH 3C5JA 3DYPA 4WV1B 4N8VA 3TIEB 1U42A 4NBXB 2V5RA 4KJWC 3IAGC 3CU7A 2IAMD 1KFAH 1SBSL 1OTUD 2ZG1A 1JP5A 3MNVA 4EN3C 2K1MA 5KJRL 3OGCB 5FF6A 2I60L 1VB9A 4LVEA 5CP7A 1HYRC 5DDHA 2XA3A 1OSZB 4HIJB 4KK8C 3UTSA 1IAIL 3PQYE 5EBLA 5EUOE 3K8LA 3G5XA 5EZIL 1N6VA 4CNIB 4D0CA 3WN5C 1W72B 4G6KL 1IT9H 3WS3A 4UUJB 2GSGB 4I13B 4JY4A 2IG2H 3U36A 2CDGA 5FGCB 5E1AA 4BJLA 5ACZA 5KANI 1P7QD 5EOTB 2WIIA 4Z7OF 2RQ8A 3TFKD 3UCRA 4UV4H 2GJJA 1RD6A 3T0EB 1A6WL 4RWYH 1S5IH 4EXPX 3TT1L 5BV7B 1S7WA 5E2UL 1HHGA 1TDQA 3BT2L 1A4JB 5TH2B 4M7KL 2X44D 4DKAA 3X3GL 5E00B 4LPWA 2RJMA 4I77H 4IJ3B 4PTUA 4JO2H 5IVXB 3KLHC 1B3JA 2DIJA 3KPQB 3BZEA 2BMKA 3G5ZB 2FR4B 3WHXB 1KJ3H 1U8OB 5HYJE 1T7ZA 4PJ7A 3S34L 4NKQB 2QR0A 2JK5A 3C08L 4M6NH 3BN9C 4JR9L 4YWGL 3PNWB 4MQSB 4NKOB 3ESVF 3LN5A 5C0CA 3QXWA 4ODVL 1NANH 1YN7B 4ZQKA 1EGJH 4M6OH 1INDL 3HMXL 4G8GA 1FLTX 4H26B 4ONFL 1JBJA 2WWKO 5SX5H 4XMLL 1YEJL 5L8KB 3B9KA 4H0GA 1VSCA 3FMGH 1FYTA 2IWGA 5KSAA 5E6ID 2Y72A 3FQNB 2YUZA 2X4RB 3SE4C 2LU7A 3VJ6A 1C12B 3MO1A 3TPKA 3CFJA 5DEFA 1N64L 4X9IA 2DI7A 4KUZL 2Y06L 1N0XH 5DYOA 3KPTA 5ID0A 2NY7H 4OKDA 1KTDB 1NFDB 3Q3GB 1F3DJ 1D5BB 2AVGA 2LU3A 4BQ9A 3RUGE 5KZCB 3GSOA 2J3SA 3SDYH 5CBAB 1DN0A 5J1AA 3SDAC 1KCKA 2H9GB 3QULB 4Y5VB 4XVJH 3TBWA 5C08E 1BREA 4DGVL 3R8QA 1HKLL 2XQYK 2DMCA 4QF1A 32C2A 3PWUA 3ARGA 5ALBH 4KJYA 3BUTA 5D6CB 1D6EA 1QPXA 2UZYB 3DRTA 2PNDA 3PGFL 1MY7A 2WUBL 1YC8A 3VMOA 5T1LD 4NQEB 3SY0B 2F54A 3WE6B 2W0FA 1OAUH 3QB7C 2HTKD 1CGSL 1NJ9B 1FNLA 1TCMA 3SPVA 4UILH 1G6RL 4Q97A 3STLA 4OCNC 3WJLC 3B4NA 2ESVA 2HWZL 1I9EA 4W81A 5D8JL 3LH2L 1V7NL 1MJUL 1CU4L 1WIPA 4IRJD 1HDMA 2JJTA 3EYVB 4OF0A 4QOKA 1UC6A 5EN2A 5IK3A 3HZKB 4I0PD 1U8MB 1YNKH 1A8JH 4PB0L 4XH2B 1JWUA 3GO1L 2YC1A 2FECI 2OK0H 2H3NA 4CJ0A 2R0WH 2BRRH 5D7SL 4FQLH 3D2UD 5HI5C 5GS0C 4I4WB 2E27L 4ONGH 2VLKE 3JWOC 4N0CD 1TZIB 4P3DA 3LAFA 4DK6A 1NPUA 1AP2A 5CS7A 4XMPH 3DARA 2JJSA 1DQDH 1U3HB 4Y19D 1OB1A 2DICA 2BHUA 4K9EH 4EJ1C 5DSCA 4RBPK 4P3WA 5T1KD 4OZHF 4R4NC 2VWEC 4GMTL 1CXKA 1KXVC 3L3JA 1CWVA 2CJUL 4XZUB 3MJ6A 4I1NB 3GZKA 5KSBA 4JCLA 4GAJH 2OR7A 1JPSL 1UA6L 5GGVY 3SGEH 3RGVD 4KJQC 4GBXA 1MJJB 3G6JF 1OTTD 2Z8RA 3IJYB 4OJFL 5L2JA 3S35X 4KKCC 4XWGL 5C0NC 3OR7A 4KY1L 5I1HL 4WEUD 3IDNB 1RU9L 2XWJB 4FQ2H 3BP5B 2D7PA 1BLNB 1Z5LB 2R4SL 4LU5L 2NQCA 5DVNA 5GJSH 3U1SL 3ARBA 4PG2A 2P24A 1KLGA 3QRGL 4ZOCA 3O3AB 5DZOA 1CG9A 2OI9C 1QLRB 1KYOJ 2VWEE 3HMWH 2WZPD 3TVMD 2CUIA 4Q7DA 5FKPB 5C0IB 3JVGA 4BZYA 4WW1A 1C16A 1DBKH 1RURL 4LSQH 4ODWB 2PW2A 5TDNB 4K3JH 3W39A 5TE7H 3KPMB 1OAXL 5GGUB 3LMJL 3ZDYF 5JTWA 3P0GB 5GS0L 4HF5L 5SWZB 3VWJA 2VXQH 5DC0A 1LDPH 4G42A 3FQUA 5CZVH 1N7MH 4L4TB 4DZ8A 3GMLA 3OL2A 4PGEB 4A6YB 2A0LD 3ZHKA 3E3QC 5E0QA 1OGTB 3V4UH 3BKCL 2VAAB 4KKLC 1CFNB 3V9FA 4XBGB 3HZMB 1GGTA 1F6LL 3BO8B 3TESA 4R0LB 4HWBH 3U48A 2VITA 3NZHH 2AW2A 3QA3A 4ZD3L 4GXVL 3SGKA 4NJAH 4LIQE 3E6FA 5FYLL 4DUVA 1MFNA 1QBAA 3PWJB 4L1HA 4MYWB 1URLA 1Z9LA 1OL0A 1DEEA 1ZLVK 3X17A 3MYJA 4WFEE 2ZCKL 1MFBL 2A6IA 4HULB 5IG7B 4M6AA 2E9WA 3E3QE 3IGAB 4O2EA 2QSTA 3O2VL 1A3LL 2YKLH 3FB5A 4F3FA 4B41A 3DI3B 4JQVA 1BQLL 2K7PA 1VENA 2O5ZH 5JPNA 4PRPA 1A64A 1N3NA 4LIQL 5EBMA 3CMOL 3SDXA 4C4KO 3F5WA 4X0KA 5EO1A 3QFJE 4N90E 3HC4H 3ZDXE 5E5MB 3NCJH 5D72L 3EYUH 1VA9A 2Y5TA 1KULA 2OMBA 5MENE 4O2FB 5D7IF 1UKQA 4PGDB 3PDOA 1IM9A 4L3EA 3BH9A 1QRND 5SX4I 3BP4B 4K71C 5HBBA 2CLZB 1IEBA 5DMIH 3EYOB 1IGYA 1GYAA 4JFDA 1F58H 4JZOA 4JO4L 3VG9C 1FCGA 3F7PC 3OGOE 1ZV5A 4FQXC 4XVSH 1TLKA 3IDYB 4PG9B 3UJTL 1U8HB 5A40E 4Y4FC 3HC3L 4BH8A 3VW3L 5D5MB 1CFTA 5EBWB 4JN1H 1T20B 5J6HA 4UZGA 3U6RB 4PJIB 1YEIL 3L5WB 2E8ZA 2ZG3A 4JZNA 4HGWB 3QSKB 3KGRA 3QXTA 4MJIA 5EZOH 3KLDA 4PJGA 3WLBA 4GRWF 1U92A 1HYSD 3T4YB 3B9EA 5DD6B 1KIPA 4LQFH 3MLZH 5IESH 4ETYA 1BEYH 2GKIA 4KRMB 2PTVA 2FWOA 3QH3B 2OR8A 3RZCB 3CLFH 4NNPL 4YHLL 1AE6L 3PG2A 3JUYA 1T6WA 4MCZB 1CS6A 3SDCC 1AXSB 5FO9A 4MA7H 1S5HB 1EO8L 2EECA 5EUKA 1MCCA 2ENYA 2Z35A 4FMFA 5I15L 2YD6A 4OZFG 1JGUH 4ZYKB 3DJ9A 1KTKE 1MHEB 4OT1H 2F8XC 1HIML 5IQ9B 5ALCL 3IF1A 4OSUH 2O61A 2RHEA 1X3DA 4IIQC 3MRDB 1J0JA 1D6VL 4MAUL 4GOSA 3VDAA 5B4MC 1VKXB 2XKNA 3MXVH 4GKZA 2PR4H 3UTZA 2YPKA 3OSKA 1DBAH 4NN7B 4ONHB 1GC1C 1KJ2L 2VXSL 1NL0L 5H35A 3SKJL 1BVKA 1FVCA 5CCKL 3GI9H 1PLGH 2N7BA 3WNKA 2HTLD 1L7IL 1GCFA 4U6YA 3P0VL 1PZUB 1EXUB 2V2WB 4P2RD 2CKNA 4DOHE 2X7LA 2D03L 3BHBB 1KELH 1OM3L 1MHHA 2IGFL 2IPUK 5DUBB 4J1UB 2PYFB 1V8HA 5D2NC 3CVHH 2IH3A 4F7MB 5I1JH 4WEMB 2OYPA 4N0FB 1BQSA 3GSWA 1T22A 4MAYA 5D93C 2AK4A 1SYVB 3QWRA 4UT9H 1ZOXA 3QUZC 3LKRB 3QUXB 1RUPL 2OTUB 1AQKL 4KZEL 3EJZD 3QDGE 5DMKB 5D1QA 1QO3A 2J8UF 4LCIL 1WLHA 3MRBB 4XP4H 3QISA 5E8NB 5HYSG 1R5VB 4N8CL 3EYFA 1YJDH 5FM4A 3D1MC 1MPAH 1KCUH 1ZA6B 2IALA 4G7VH 2BHYA 4MXVE 1RQ5A 4GLRI 4W6XB 5F3BB 4PJFA 3QIBA 4NOFA 2XA8H 1YUHA 1FN4A 4UNVA 2I07B 1R5WA 1V7ML 1BD2B 1YNLH 5A16A 1F3RB 3OXRB 4K7PH 2VL4A 1HHKA 5D2NE 5EU6E 2BNRA 3WUZA 1FZJA 4S2SA 4RMQA 4LPUA 5LWYL 4R2GD 1WFNA 3GBNH 4WI7A 3RX7A 1LO2L 3DECA 1P4BL 1GC1L 4LCWD 1JNHA 1NMCB 3DVGB 3MLUL 5J9PB 2BVTA 2WINA 1N6QH 4GS7B 4GRLA 2ZSWA 1NFDE 5TDPA 3OKEA 1IFHH 3PIQA 1MAML 3MNVB 5IOPA 3GM0A 5FF6B 5CP7B 1OTSC 2DWDA 2ZJSL 4MS8D 1OOAA 3GMMA 3N1PC 5L0QC 1F45A 3G5XB 6CGTA 3PWPA 2YZ8A 3H9SD 3S3PA 1RVFH 5SV3A 2BY1A 3MACH 4YDJA 4WUUA 4JY4B 4Z7UA 4JDTH 1F4WL 4KH2A 5HHXL 5SWSA 4P3CL 3LN9A 5ACZB 4NQEE 1OQXA 3BXNB 1KCRL 3KR3H 1XGUB 4WI9A 1KENH 3C60A 4GW1A 1XF1A 1WZMA 4LHJB 3MROA 4MJ6B 1S7WB 3BKJH 4Q6YA 3NCBB 4NN6C 3QO1A 2FHBA 3K1KC 5I9QB 4IBLT 4DKFH 5IF0A 1JV5A 3IDIA 2CSPA 3LEYL 2AXFB 1QEWA 2J12B 4XCEB 5E2TL 2BMKB 2CPCA 3HNTH 3QDMB 3CLEL 2J88L 4PJ7B 2QR0B 2JK5B 2OMNA 4TUKL 4XPGL 5BCAA 4LLQA 3NBNA 1E4WH 2G5BB 5F9JB 1DEDA 1FVEA 1WBYA 4HMCA 5H2BB 4ZQKB 3L1OH 2XG4A 4G8GB 5IVZA 4F33A 2P49B 1AKJD 4YFDB 3Q6GL 3IVKA 4YO0A 1TENA 2H45A 2BNUA 3ULUF 2XN9E 3QIWB 2WLYA 4A2LA 5F7UA 2X6MA 2EH8H 3B9KB 1G7IB 1S7TA 3C2SA 1N0LA 1RZJC 1RJLB 1IC7H 5C0AD 5KSAB 5E8PA 1MFDL 3I3EA 3BQUB 1OWWA 4OGYL 1NCUA 3RWJB 3BWUC 2EDQA 5B8CC 3PV7A 3VJ6B 2B8OT 1T0NA 3KPRE 3MO1B 3WS6C 1UZ6E 4U1NA 5L7XL 3CFJB 5EU5A 5JDSA 2YRLA 6FABL 1ZANL 3QUML 3GFUA 5LAXB 3FB8A 1XZ0B 4X6EB 3A67L 2P48B 3B5GA 2CKBH 4HKXA 3O4OC 4J12A 3IKCB 4TSBL 3J8F7 5D1ZC 1EHLH 2DQGH 4FFWC 5DD5L 3S37H 3HLAA 2DM7A 2EH7L 2QHRL 3TBWB 4L4VD 4CJ1A 3VI3E 1A9BA 3V8CA 5HHPA 4QRQA 2FLBT 1MIEH 4H20L 4KWUA 4P23B 4PS4L 3PWUB 4QF1B 4FTVB 2F19L 5CSGA 5L9DL 2EXYD 2A77L 1D6EB 3IB4A 1QFUL 1MWAH 2AJ3A 5IIEA 1MEXH 3CK0H 4MA8H 1MCSA 2ILLA 2DD8L 2YPLD 4I0KA 4GSDL 4K2UH 5BOZG 1D5IH 2W0FB 5FGRA 4EN3B 1L7TH 4HBQA 3KPOA 5SWZE 3MV7E 4OIAA 2DQIL 3K80A 4L1DA 4YXKH 3SPVB 1PYWA 4FZEL 2G75A 1I1CA 1I8KB 3STLB 5C7XL 1JNNH 2X4SA 2ESVB 3LD8B 4ORZC 5J7CC 3NN8A 1WC7A 2E7LC 1RZJL 1Q1JL 3U2SB 4Z7VA 5FHAL 4HEME 4LVNB 1HDMB 1HQ4A 2Q3AA 4G8FA 4PV9B 5IK3B 4FG6C 2EICA 3CFCL 3EO9H 2VOTA 1HEZA 5GGRY 4BZ1H 1PKQB 3MV01 1P7QA 2YC1B 3QCUH 4JPVH 1UADC 5D2LE 1JIBA 3RUGF 2H3NB 5IVNA 4KRNA 4U0RB 1EVTC 3EZJB 2FL5A 5IEKA 4BH7A 3HI6L 1NDGB 5I73B 4Y88A 1EPFA 3UO1L 3BYYA 4NO0D 1N26A 3QUYC 1AP2B 2F5AL 4P46D 3VGAC 4V1DD 1ROWA 4OF6A 2Y36H 3P4OA 5JHLL 4FFVC 2QBWA 4KV5E 2VLJD 4DVRH 5I17A 2UY6A 5C0BE 3TNNA 4FXLA 3TWCH 4UTAL 1JHTB 3VA6A 3RPIA 1WIOA 1KC5L 1I7ZA 1QBBA 4OF8A 3VXRE 2MQ3A 3NPSB 4LNVA 5KSBB 2XZQH 4RGNE 1LO0L 2EYRB 4GAFB 4IOSD 2X10A 5ICZB 4EZMA 3CSBA 3GKWL 4NKIH 4NN5C 5ID1A 2LV4A 1ZXQA 4XWOC 3OR7B 4U7MA 5IHZA 3OKDB 4PJ8C 3EKCA 3UJJL 2WSKA 5E6IA 4IDLA 1PEZA 5F44A 2NXYC 2KH2B 4S1SL 3AS1A 1RIUH 2BC4B 2AEQL 3ARBB 4FHBD 1YPZB 4KROC 4MD4A 1CG9B 4NZTL 5GRVL 4PJCA 3IJSB 1MCIA 2G5RA 3SGDI 12E8H 4FQCL 4WNQB 4ODXA 1C16B 4R4FH 5I1AA 2PW2B 3W39B 4MB5A 5DA0B 3E0GA 3Q6FA 5I76A 1IM3A 5SWQA 3QJFB 4NBZB 1A9EA 4C56E 1UACH 2J7LA 3FCTA 4NRZA 4JFYA 1BFVL 4OLXL 4KTYA 1GIGH 3FQUB 4G42B 1P4IL 4RFOH 1BJ1J 4DZ8B 3GMLB 2HFFA 4XAWL 4K94C 3VMNA 3S36X 1VADB 1X5YA 1U8QA 2XRAH 3DUHA 5CIPA 4MQXC 3MA7A 1PGRB 3MBEC 4E0RB 2HT4D 3PP3K 5T1LA 4QRSA 4C57C 2I5YH 4PP2A 5H8DA 4NO5B 1ZHLA 1MY5A 5I2IB 2EC8A 5I1IH 3QA3B 1HSBA 2YMXL 3CFKA 1IKNC 3ARDC 1R3IH 3IKKA 3FO0L 1FZMA 3SGDH 1EV2E 3WUWG 2WNGA 1NUDA 4F80A 4OFIA 1YN6B 5I1KH 1DEEB 1WT5C 4POZC 4Q0XH 5HVWA 3MYJB 4GKOA 2H26A 3D87B 3FB7A 4KVCH 1T2QL 5CGYC 4EUPG 2CUHA 1U3ZA 4HH8A 1H3PH 2A6IB 4JG1L 4IRJA 4R6UA 1WZ1H 3LKOB 4O2EB 2ADJB 2F8OA 4I0PA 1EUTA 1GAFL 1KT2A 1XIWD 1ZMYA 4F3FB 2IBBA 5DTFB 4PJAF 4I48A 1VACB 4QY8A 1R5IB 5IB1A 2A1WH 2X4TA 1N3NB 4G6ML 3N50A 4Z7QF 5EBMB 3D2UA 1HH9B 3FTGA 1JWMB 2VNCA 3SDXB 4X0KB 4HGMA 1IE5A 4KQ3L 5EO1B 1P84K 1S9KC 2XYCA 2R2CA 1GGIH 3IU4H 5FGSA 3CZFA 2VKXA 1CGWA 5F9DC 2Y5TB 3GSUB 4Y19A 4H0HB 4YUEL 4DUWA 1J8HE 4K94L 5ESAB 3PDOB 3FQXA 3VRIA 3SE3C 5T1KA 1DSFL 3BH9B 4GRWH 2JELL 3TH4T 1IEBB 3ZT5A 4W4OC 5ENWB 2IANA 4M7JL 1DJSA 3TN0D 2ZUQC 4OZGE 4PGBB 1M05A 4CAGA 4XP1H 1QUNA 1MREH 1A7BA 1KPVB 3RGVA 2HT3D 5DK2A 2O5XL 2YD7A 3LV3A 2NR6D 1CDIA 3HTLX 4TSCL 4UBDD 1FO0L 4O51A 3LQAH 3IFNL 3JTTB 3MUY1 3BDYL 1ZEAL 3F58L 4HWBA 4PJGB 3IU3A 4JM2F 1U92B 4MXQD 4H25B 4ZUTA 4I3SH 1RUQH 1LNUB 1KIPB 4LBEB 3TBVA 1A1NB 2H2SC 4Y2DD 3VXPA 3I6LE 4E42A 3EYQD 2D31A 5ETUB 2F9BT 3TVMA 5ICXB 3MOAL 1Q72L 5CSBA 4P9HH 1ZLUH 4WFGD 4GKSA 3TBTA 2OQJA 4OGZA 2X89D 3GKZA 2AAVA 4DK3A 1MJ8H 1WAAA 3TCLA 5DT1H 2VDKH 5EUKB 3BEVB 2Z35B 2XTJD 5FIEA 3PGDA 3UTSE 3ARFB 1R3HB 2LTQB 4JRWA 2EXWD 5E2VH 2R8SH 1ZLWH 3N1MC 4MGXA 3JTSB 4CW1A 2O61B 1K3IA 2AS5M 3ZTNH 5IT2L 3QQ9C 3F6LA 4X6CA 2AP2A 3PWNA 1DFBH 2FH6A 4GKZB 4KPHH 5DJYA 4X4ME 1NLDH 3UTZB 3VFRB 1ORSB 3GHEL 5H35B 4WTWA 1A7PH 3CDFA 3GRWA 3I9GH 3WYRA 3NGBC 4X7DC 4UQ3A 4Y4HD 2WBJB 4CVWA 1MFAL 4ALAL 3ZYOA 3WXVL 4U6YB 1GOGA 2FATH 4QNPE 4MX7B 1C5DB 2FO4A 2NY3C 2X7LB 4OD1L 5C70A 5KG9A 4HFWA 5A1AA 4NGHL 4U1SA 3W81A 1S9YA 2FX7H 3FN0H 1YMHB 3GSWB 3K2MC 4MAYB 2BVOA 4PJ7E 3SJVD 4WGWB 5B3NA 1RMFH 3EFDL 2GJ6D 1QO3B 3RNKB 4O2CA 4XP9H 5C0CE 4IHOA 1U41A 3P73B 1U91B 4G8GE 5HHOB 1NLBL 5J1SC 2N56A 4OQ1A 2VDNH 2GUOB 1X44A 4PJFB 3QIBB 5EO0B 4F7CA 4LSVL 1FN4B 4PJXF 3KJ4C 3V6ZB 5J13B 2KZWA 5FM8A 1NGQL 4QXTA 1FYTE 1AY1L 1JGVH 2KQMA 4JKMA 3ARGC 5ESQB 5I18H 2BNRB 1FZJB 1MQKL 4JKWA 2MSPA 4J3WA 1OW0A 3E6HA 3M1BB 4ZFGL 3Q0HA 2V5MA 1KJ2B 1SEQH 4NZJA 3SCMC 5I16A 2RFXB 2VLRD 1CL7L 4WWID 3HZYA 1NMAH 1OLZA 1JNHB 3K7UA 4FQ1H 3O6FD 2NTFA 3HPLA 3HUJF 4HWEL 3BMVA 3O8XB 2ZSWB 5KW9L 3V7AG 5TDPB 3P2TA 3OKEB 2W9DL 2OTPA 2VDQL 3ZE1E 1RULH 5GGSB 3RAJH 2DQFB 5IOPB 4NZDA 1CQKA 2XZCH 3BIKB 1HHHA 5CFHA 2H2PC 3T2NL 1K2DA 1TTUA 5IVXF 4WHYG 2D9CA 3QEGH 3D25B 3NCEB 3UYOD 5HVHC 2CMRH 2WQRA 4DAGH 1ZVHA 4LAQH 5I8OH 3CX5K 4N9GA 4YDJB 4WUUB 4Z7UB 3NCFB 1BJ1H 5SWSB 4ZNEA 3K4AA 5JW4Q 1YECL 3VXSA 4O58L 2GSIB 2F54E 3MLTA 5TDOA 4M1DL 4OZIF 1HQRA 3CVHA 3BZFB 4KUCF 4AJ0A 1RUMH 2EDDA 4M7ZC 2FIKA 3C60B 1B0RA 5E08L 2L4OA 4PRID 4U3HA 3S98A 1A5FL 3WIIL 1NAML 3QO1B 4GW5B 5F7WC 4OI8A 2ESVE 3QUKA 3EFFA 5DD3L 1QR4A 4P2YA 3D6GA 3ULUH 5DD0H 2ARWA 5IF0B 1RZKH 4OGAD 3O2DL 4M4PA 1CXIA 4JJHA 3MA9L 2AEIT 3MLRL 3L3HA 1KPRA 4QOKE 3NFSL 2M2DA 4YGVA 1K6QH 2E6QA 4YQXL 5JO5A 2AXGA 4MVBD 1KN4L 3WIHL 1CDGA 1FVEB 2XV6B 4DKDC 1OAZL 2X5PA 1CE1H 5GRVK 4GBXC 4TNWK 1FL5A 3S5LB 1FFNA 4MQTB 1P5VA 4P2RA 4H8WH 4KTEH 4N0UB 1YDPA 4V2CB 5FYKH 3VXMD 3U4EA 3IETB 3IVKB 5CSZA 2BNUB 2DQDL 4D9RE 3X13A 3DVFA 1NFKA 5MEQA 2PXYD 1PSKL 1IRAY 5MP6H 1A7QL 5HI3D 5E8PB 2OLDA 5JQHC 1X5FA 1PZ5A 1JZ6A 4HSQA 2DMKA 4O00A 3U0WL 1T0NB 4UDTA 5EU5B 3TO4D 4CVZA 4HS3A 2AI0H 3IXTA 43C9B 3CDGB 2NX5D 3DX7A 5E2WH 3QEHB 2AKRA 3VWJC 1YY8A 1ZA3A 1A6PA 1S78D 2FJFA 4IOFD 2CK2A 4HKXB 2MHAB 3CDCA 4X99A 1BQHG 3STBA 2A6JA 4U1HB 3HLAB 4LLUA 4J3VA 3MRCA 4NWUH 5CJOH 1LK2A 1A9BB 2VDPL 4QRQB 2BDNH 4PLNC 4OLZL 2Y5EA 1I7TA 5JQ6L 3IS1X 1JGLL 5IR1A 2AJ3B 4U1GB 3OPZH 4LCWA 4LMQE 3NVQA 5JW3H 1EAPA 5DK0A 3VWKD 2IAMB 5HJ3B 3SGKC 3HE6D 4F9PA 4JFPB 1MQ8A 2H32A 3CVIL 1G7QA 2R0KL 1LEKA 4NP4H 4W70A 3RIAK 2I24N 3DOSA 1PYWB 2G75B 1WSST 1IKFH 2B0SH 1A6ZA 2FZ3B 4P2OD 4YHKL 4N1HB 3H9SA 3NN8B 1WC7B 2A6DB 4OCLC 2Y07H 1GPOH 4Z7VB 3MOQA 3V4VH 5D70L 2ZP0T 3KVQA 3TEUA 3P4MB 3EDFA 2IQAA 3U7YL 1KCSL 2X9XA 4GQ9L 2BVUA 3GIZH 1P7QB 4W68A 1QZ1A 4ZO6A 3FFCD 5EBGA 1MI5B 4UDUB 3FHQA 3T2OA 1CLZH 4BFBD 3S36L 4TSAH 1JVKA 3BPOB 1NCDH 4EIGB 5ANMA 4JJ5A 1ONQB 4DTGH 1RFDH 3EOAB 4XNYL 1KIRA 5FUOL 3VFUB 4LPVA 4YGAB 4FNLH 4KVNH 3P4OB 4I18C 2J8HA 3K0WA 3MUGA 3NOIA 3MGAA 3OB0H 1ZT4A 4HK0B 1GRWA 1NFIA 3ARPA 5I17B 5EORL 2CKBA 3V2AR 4P2QD 3VI4F 3ROLB 4F58H 1AXIB 3QXDA 4PRHD 4U2YA 4XCFL 3MJ8A 1VEPA 2COQA 1VHPA 4BZ2H 2YHGA 1BGXL 4PRPE 4X4YA 3U30C 1FFRA 3SDXE 1AKJA 2Q3ZA 4XC3H 5DMYA 1MJ7H 5EOCL 3MZGB 5IQ7L 2YPVL 1JZ8A 4XPAH 3VGFA 3RL2B 1FVDA 4FMKA 5IHZB 4NZUL 5GS3A 1D9KD 5C0AA 4LCUB 3DMMC 3MCG1 4NUJA 1FGNL 4G6JL 4L3EE 5EFIB 5LXGL 2P46B 2Z8WC 4YAQA 2X05A 3CC5B 3NTCL 4YHML 4P9ML 1P6AB 2Z31C 3A6CL 5CUSL 2HFGH 4JFDE 3RNQA 4PJCB 1CGTA 5B3JF 1F6FB 2Q6WB 3W9DA 1B6UA 2G60H 1FNEA 1QHPA 3OAZK 5I1AB 4X7TA 2IH1B 5I76B 1IM3B 5KOVC 2M26A 1M71A 1UH3A 3LS4L 5SWQB 5F6IC 1A9EB 3UDWC 1XR8B 4PJ5D 1NC4D 5DHVH 4NRZB 4U31A 4LSTL 4JFYB 3T77A 3CXHJ 2PYED 4WRLA 4OZHA 1MCRA 4L4VA 5GQBA 4ZTOH 1RJZA 2YK1H 5HDLA 4MJIE 3S3JA 4PJGE 1J1PH 2FNBA 3O6LL 4YX2H 5CIPB 1CT8B 4IRSC 4KHTL 1MCJA 3H0TA 4NQCE 1UM4H 2EZ0C 4PD4J 4XCCH 1LQSR 2YPLA 5J8OA 4I2XB 3ARUA 1ZHLB 1NKRA 2WUCL 4PJDF 4OLUH 1J0IA 1HK6A 1QFWI 4MB4A 3CFKB 3SQOL 3ZKND 1UYWH 2GAZB 3VH8G 5J06A 2VZOA 4U3CA 1ND0A 4HQQL 2CRYA 4G7YL 3MGOA 3QQNA 5C8JA 2NY1B 4JN2A 4E5XA 3GSQA 1EBPA 3VRLF 1FJ1B 1UWXH 3DX9B 3FB7B 3D85D 3QIUD 4YHYC 5D1QC 4IRJB 1RIHH 5C1MB 5DMGC 3MPCA 3RWHA 4NOBA 4JVWA 4ZDHB 4I48B 1I8LA 2AJXH 4TVPD 1Q94A 4X7SL 5DC9B 2MCG1 5LGJA 3X12A 2X4TB 5D5MF 5C0JA 2LQRA 3MZTA 4G8EB 4PJIF 4AG4L 1G0XA 3RWEA 4JHAH 4JPKH 4X7EC 4XBPA 4HXAL 3GGWA 1OP5H 5JHDB 1PG7W 4R9HA 4P46A 2XKUA 4EDXA 4X6BA 1UGNA 1QFWH 3MFFA 3VU2A 1S7RB 2AK4E 4O9HL 4LK4A 4M8QA 3FQXB 3VRIB 2F53B 5JORA 5ADPH 5KSVA 5F88B 1G7HB 4KZDH 3U46A 3VFNB 1KBGL 1ULVA 2X9WA 4GRLC 2IQ9H 1M05B 2R9HD 4P0DA 2V9TA 2EDWA 4IRZH 3N9GL 2VDLH 3RGVB 5DK2B 2NZ9C 1JGEB 5CLWA 2MOVA 2QQLH 4R90H 2VAJA 4PJFE 3RBGA 4MDJA 2CXGA 4F7PA 1ZS8B 3RTQD 4JG0L 5FA4A 5LBSL 4O51B 1MNUL 5D7LD 3NIGF 2GYSA 5DMJB 4BQBA 3VXNA 1RZGB 3RVTC 4M7LH 4RDQF 5IB4A 4CBPA 5KVGL 1F5WA 5CP3H 3T8XB 5GGTH 3VXPB 5H94A 4DGIL 4E42B 1C1EL 3R06A 2P5WD 5EB9A 3GMQA 1PKOA 4KK6C 3P9LB 3FOLA 1BAFH 5DS8A 1JI2A 1XGQA 4GKSB 3UJIH 3P11H 3ROOA 2WWMC 2YWYA 3LN4A 2E7MA 4M5YL 5D1XA 3WKMH 1IGFH 1OHQA 4LAJH 4WU5A 5D7IA 3TCLB 4ZO7A 2AJUH 1FFPB 3ILPB 4U7SA 4UB0H 2QKIA 3PGDB 2APBA 4FP8H 1OAYH 3TIDA 3BH8A 4L8DA 2VR9A 1DBBL 3PWPE 3K4ZA 1JPTL 4WWKB 5DUMH 1ADQH 3W5MA 5FB8A 4L8SA 4XMKL 1IGJA 4WUUE 4Z7UE 3PWNB 4HLZH 2VSDA 5SWSE 5DJYB 5DVMA 4UTBH 1IEAA 1Q9OB 1J0HA 4MMXC 2R39A 4GT7A 3KYNB 1D5MA 1I4FB 1YEDA 5HYIA 4K7FA 3ZL4L 1S7SA 4R7NA 1JNJA 2X42A 1Y0LA 3QNZA 2BVPB 4M5ZH 1PBYA 3FO2A 5E94A 1TETH 4U1SB 1LK3L 5FYJE 4LVHC 5BXFA 1W72H 4TRPL 1INQA 2GTZA 5IW1A 1EIBA 4M43H 3CX2A 3SEPA 1IQDA 1DL7H 1K5NB 2BVOB 4KUCD 2VUYA 4RAVA 1BJMA 3RVUD 2Y25A 1XIWA 4OI9A 4NT6B 5DR5L 4X8JB 1LP9B 2HJFA 4M00A 3C6LC 4O2CB 1CDUA 1RJCA 4E9LA 4IHOB 2OJZL 5HSFA 3K46A 1C5BL 5IVOA 1EERB 5BV7H 1R3KA 5K9JL 5KVDH 3STZA 5T33H 4UIMA 3BPCB 3THMH 4F7CB 5CILL 1DQJB 4QXTB 2XWBA 3ALPA 4JB9H 2DBLH 4AQOA 3LRHA 3H8NA 2DWEB 3TF7C 3KPPA 1QRNB 4K07A 5A3ID 2ZOLA 4B7IA 1BBDH 2YEZB 5E9DD 5KZCD 5E5RB 3J7HA 4JO3L 5DVKA 5I16B 3MV8B 4X80H 1ES0A 4XNZC 3TN0A 43CAB 4Z0XA 4FABL 1I1AB 1ETZA 1LEGA 2NTFB 3HPLB 5MEOB 2O5YH 1FDLH 1B90A 1RPQA 3REVA 1CK0H 4YDVA 25C8L 3LKNB 2DI9A 5F7MC 3IFLH 2ATKA 2GCYA 3R1GH 2AJVL 4APQB 1HHHB 5IBLD 3F62A 2FEDD 1XEDA 1IC5H 3F7VA 3UYPA 1XF4A 2J8UA 2XY1A 1KFAL 3EOYG 1EJOH 4HKZA 5GIRA 3B9AA 3IDJA 3QQ4A 4S1DD 4HUUA 4ODTL 1E6OL 2IPTH 4Y2DA 5EZJA 4N9GB 3O41A 3OAYH 4WHCA 2ARJA 4RDQG 3T1FB 2QQNL 5JR1H 1U95B 4L9LA 3QFDA 4NQUA 1HQRB 4L29A 4LPCA 2FRGP 2X89A 1WCBB 1U58A 4X7FC 2FJHB 2FIKB 1IT9L 1XT5A 5DJCB 4KFZC 3AY4A 3K74B 2A38A 2IG2L 4P4RA 1SVCP 2NNAA 3VE0B 4NDMB 1U8KB 4QEGA 5IFAH 1DBJH 1VFBA 2VB5A 4OLYL 4H88H 4UV4L 7FABL 5CGTA 3UYRL 5H37H 5KVFH 1S5IL 3EJJX 4R3SA 1KPRB 3DIFA 5AEAA 1HHIA 5JO5B 4I77L 4RGOH 5IW6B 1N8ZA 1KTRL 4YBLB 4JO2L 3UC0H 5TF1L 3T1WA 4Y4HA 3D9AH 2VDMH 4ZAKC 2A73B 4PRAA 3RHWF 1TPXC 1FL5B 4RZCA 4WTXA 1O7VA 3B5TA 1F13A 4KDTA 2R23A 1UJ3C 3U4EB 1B2WL 4ZUVB 1JI1A 3V52H 1PG7H 2KPNA 5CSZB 4JKPH 4K7PX 2VQUA 3ZMRA 5E24E 1NGYA 4HKBA 5E6IC 4TULL 4Y8DC 2CDEA 1A7NH 3RJQB 3EDEA 1EGJL 3NH7H 1D7FA 1JHKH 4X6DA 1WBZA 4K3GA 5INCA 3SJVA 3LB6C 4HLJA 2GJ6A 3C2AH 3EZ8A 1PZ5B 3L3DA 1FL3A 5JIKA 3FMGL 4CVZB 3QQ3B 4LF3A 2ADIA 4HS3B 4JEGB 3IXTB 4R7DA 4WY7L 3DX7B 4DWHA 4ORGA 1A3QA 1ZA3B 4K3EL 5K9KA 1NAMB 1EO5A 3NFNB 2NY4C 2HMIC 3KJ4B 4HG4K 2D0FA 2M1KA 4QRRB 4WHTA 3MRCB 1CTNA 4Z7WF 1N0XL 4NZRH 5JA8B 2RR3A 2NY7L 2VLLA 5DRNA 1IGMH 1XR9A 3SCMB 5T3XL 1A22B 3TJEH 3SDYL 3UTTD 1I7TB 2VLRA 1M7DA 4X9BA 5IR1B 1EZVY 2FYYA 3UBXB 5ITFA 4XVJL 4LCWB 3WEXA 1KCLA 3O6FA 3RL1A 5C3TA 2DQCH 2EDNA 4K9EC 4P4KC 1MHPH 4PBVC 4U4BA 1KG0A 1VEMA 5HPOA 1WWCA 2H32B 3BOVA 1T7XA 5HDOA 5C86A 1LEKB 3WFDH 5TE6H 4JVUA 1YMMA 1QYGH 4G6AD 4H1LG 1T83A 3JBG7 1YEFL 5IROC 5F7EH 1H5BC 4KC3B 3KWWA 2ARJQ 3H9SB 1SEBA 1OAUL 3AGVA 3AXLA 2B4CH 2XZZA 4WI6A 3KJ6L 3W0WD 4LHUG 4HHAA 2D4FA 4XXCC 1ZVSB 5KSBF 4TTDD 1NGZA 2AXHA 4GAGL 3ZSTA 1BMGA 3X14A 1EVUA 1S9WA 2DS4A 4PRIA 3O11A 4I5BA 4MJ5B 4F37K 1JPGA 2CRZA 4JHZA 1YNKL 4PRDB 5DJ8B 2Q76B 5GS1A 4FFZH 3EO1A 3MFGB 1KIRB 1CDJA 4A6YH 4RISL 4EI6A 1YPZF 1FNSH 2HN7A 2R0WL 2BRRL 3MRPA 5IMLB 2PO6D 3MUGB 5FECB 1ZHKA 5JUEH 1NFIB 4M9PA 4ONGL 2VXVL 2B2XH 2IBZY 3W2DH 3WNMA 3CSYA 4JQIH 2N7AA 3QXDB 4XMPL 1DQDL 1N4XH 1JZ7A 1OTTC 2K3TA 4F8TA 2FHCA 2D7NA 1AKJB 3ZE0F 4NSKA 1G0DA 3VXMA 3S9DB 3GNMH 5F7YC 3FKUS 2N1KA 4R26L 5HY9A 1FVDB 1CGXA 1E4XH 4NHUB 4OFPA 4Y19E 2D9QB 3M45A 3OKKB 5TF0A 5HYEA 4KMTH 4NUJB 5A2FA 1E4KA 3GMPB 2UZIH 3TVMC 4YAQB 1KIQA 2H6PA 3CD4A 3H3BC 3SBWA 2GFBA 1G7JB 2IANE 3TO4A 4LEOA 3QCVH 1EK3A 1MRDH 3FQTB 1JK8B 1EEQA 4J8RA 1LO3L 2Z9TA 5L2KD 2NX5A 4FQ2L 1IL1A 4NFDA 3QPXL 1CDYA 4X7TB 4DVBA 5C07B 5EO9A 1M71B 3FQWB 4XNMB 4X6FB 3HMWL 2A0LC 3RRQA 4OZHB 4MNQB 4L4VB 4Y5YA 4DGYH 3RZCD 1FH5H 1DBKL 1RJZB 4QTIH 1Q0XH 5TE7L 1IGIL 4RMWA 1HINH 5E7FA 2UY7A 5KN5B 4D0BB 2AK1H 2B5IB 4JY6A 2VXQL 2KL6A 2EE3A 1LDPL 3KYMB 5CZVL 2F5BH 1MCKA 1N7ML 1F4AA 3RVWD 3GHBH 3VWKA 2YPLB 3HE6A 3SDXF 3AFLA 1FE8L 2EDJA 3MOBL 3V4UL 1AR1D 1WAAE 1T5WA 5BZDB 2OP4L 1J86A 4ZTPH 2XT1B 5I74C 1PY9A 2WLZA 4E5XB 2P8LA 4XTRC 2R1XB 4P2OA 1JWSA 5F7DA 3ZYIA 3NZHL 2OSLA 1C7SA 1MHCA 3A6BH 4X6CE 4OLWH 5JNYA 5IEHA 4U6HB 1CICD 2Z4QA 2IFGA 4KKAD 4OZFB 4HIIB 4U1MB 3DURB 1LD9B 3FFCA 1NMBL 1QD0A 2MNUA 1Q9KA 3BSZH 3MQIA 3QWQB 1Q94B 5LGJB 2EE6A 4OQTH 1JHLH 5C0JB 4J6RL 3H7BB 2VXTH 1CFVH 3SHSA 1DBMH 3CCHA 3RWEB 5E56A 2YKLL 1CCZA 5AZEH 5I8KH 3GGWB 1BP3B 4NO0B 3NIDF 3JV4B 4P46B 4EDXB 4KU1A 4V1DB 5JOFA 1GOHA 3CU1A 3MFFB 3HG1B 1WEJH 4PLKD 5ICYB 3C5ZD 2VLJB 3HC4L 2ZSVA 5CD5C 4P2QA 5JORB 1XH3A 1C7TA 5KSVB 4LRIC 4PRHA 5DHVA 3U46B 3NCJL 1BD2D 1EZVX 5DEGA 1HH6B 1UVQA 5DGQA 4AT6B 1UCBH 2YSSA 3HC0A 4P5TD 1OSPH 4HJJH 4C58B 1Z9MA 2EKSB 1A14H 4K8RD 5DMIL 4RBPH 5E4EB 2YBRA 2VL5A 2R1WB 1MLCA 2WWKT 4KRPC 1F58L 2YWZA 2VC2H 5GGRB 5FA4B 1YEGL 4F15C 1D9KA 1NAKL 5EOQH 5HYSB 2VJXA 4F7EA 4M3JA 2DLTA 8CGTA 5GS2H 1H3TA 4XVSL 3VXNB 2QQKL 4YEEA 3G9AB 5CEZD 1D5XA 3RJDA 1NUNB 4JN1L 2NW3A 3ULSA 4PLOB 3R06B 4KAQH 3GMQB 5GRXG 5EZOL 3MJ9H 2P44B 2ZCHH 2OX5A 3ROOB 2OL3H 1U2CA 1WJ3A 3KPSE 5D4QA 5BZWB 1FAKT 4HDIA 4LQFL 3MLZL 1B4JH 5IESL 5JPMB 4WU5B 5D7IB 4KQ4H 4PJ5A 1BEYL 1NC4A 3KLAA 3V5DA 1J0YA 4Y16C 4POYA 2PYEA 3CLFL 4LSUH 2QKIB 2W38A 1KACB 4FQQB 2E8YA 3S4SG 1YJDC 2GTWA 4FA8A 1W0VA 3BP7A 4X9HA 2NY6D 3M8OH 4L8DB 1X5KA 2Y1VA 4J4PD 3B43A 4MA7L 3V7MA 2BFVL 1NSNL 4HMDA 1IGJB 2HKFH 5JOPD 1S8DA 3ILQC 4D9QD 1ORQA 2HRPH 5CWSA 1JGUL 5DI8A 2IBZX 3VXSE 4BKLB 4OT1L 1MIML 2AQ3A 3ZKQD 4LLDA 1Q9WB 1T80A 1A4KB 2IADB 2XKSA 1YEDB 1F4YL 4RGMC 4K7FB 2XXMB 1S7SB 3KYOB 4R7NB 4IMKA 1WZLA 3MXVL 3QDMD 4GRWB 1TFHA 4OLEA 1MCEA 1Y0LB 2PR4L 4LHUD 1DBAL 5BVJA 2A2QT 1X5IA 4UIKH 3FO2B 2HLFC 2J5LB 4JFFA 1PLGL 2GTZB 2ZCLH 3QIUA 4GMSH 1IQDB 5HYFA 2VRAA 4KDWA 1TQCC 3D39A 1XIWB 1KELL 3MR9B 1IAII 4JGJA 2DM3A 1BZ7B 1QBML 2JTDA 1CTOA 2APFA 3QIWD 3LY6A 2NY2D 5I1JL 1ZLVH 3AM8C 1JF1B 1TVDA 3L95A 2VDRH 5GPRA 4ESKA 3DV6A 4UT9L 4P2RE 3LPWA 4U33A 3DWTA 3BQUD 3STZB 5ITBH 2VERN 4UIMB 5CP3A 5GGTA 4TNVF 4XP4L 3KNBA 3BVNB 5L8LB 3OHXB 1K8IA 5HHMD 4R2GC 1ODAA 2ICEA 1KCUL 4JGMA 3KPPB 3VFWA 3I50L 3D5OF 4Z7OE 3DHMA 4UAOC 3PQYD 3T0DA 5C9KA 4KJPD 1SBSH 1ES0B 4F9PC 1HNFA 1U8LA 1YNLL 4WO4A 1NC2D 4K7PL 1ETZB 1LEGB 5FCUH 5IB3A 1VPOH 5IW3A 4ZXBA 5KJRH 2I60H 5EA0H 3REVB 4HUXA 1RIVH 1M6OA 3WJJC 3GBNL 2ATKB 4FTVD 1GSMA 1IAIH 4ZPVA 2EDXA 2JJVA 1AO7B 4KJWD 3F7VB 5D7LA 5BJTB 3GBMH 1XF4B 4G9DB 1QP1A 1N6QL 1GZQB 1W0WA 5GIRB 3IDJB 1UG9A 1IFHL 3BPNC 3QQ4B 4L3CA 3SDDB 4EN3D 4UOW1 3CFEB 5EZJB 1BQHA 4JDVB 2P5WA 3OGCA 4EVNB 1P5UA 3MLVH 3O41B 4R96B 5I1GH 2ARJB 4HIJA 3QFDB 4L29B 1P1ZB 4PJXA 3BT2H 1W72A 4M7KH 5GGQL 1RVFL 4G6FD 3X3GH 4X5WB 2D2OA 4J3TA 1MLBB 5F7HA 5KSUB 1YYLH 1WFUA 3MACL 2AQ2A 4JDTL 4P4RB 4YC2B 3BRDA 2C7UA 2XTJB 2NNAB 1DQQA 4CU8A 4U7KA 5DHYB 2UYLB 3W5NA 4MD0B 3KR3L 2FX9H 5EOTA 3WV0A 3H9SE 5TGBA 4JR9H 3HUJA 3NA9H 1Z0NA 4YWGH 1T1YA 2P5EE 3BKJL 3P9MA 4R3SB 3VFOB 2X70A 5TH2A 3EO0A 3DIFB 4ODVH 1HHIB 5E00A 1INDH 3BZDA 2BSTB 2PUQT 3AREC 4DKFL 4Y4HB 3KLHD 4ONFH 5IVXA 4J2XA 5HHVH 4HIEA 1YEJH 3HNTL 3G5ZA 2UUDH 2DM2A 3WHXA 5ANME 1U8OA 2R23B 1YA5A 5C0RH 4G5ZL 2VIRB 3BN9D 4TPRH 3B3IA 3PNWA 1E4WL 4NKOA 1NEZG 4HKBB 2CDEB 1OT2A 3DUUA 1RUAH 3L1OL 2RCSH 3VD4A 2DKSA 2PETA 4OZIA 4X6DB 4H26A 1WBZB 5INCB 3MC0A 4PY7B 4OGXL 2GJ6B 1JYXA 4KUZH 1IC4H 5ISZB 2VABA 1F2QA 1K4CB 4OBSA 2EH8L 5EU3B 4YDLB 4LF3B 4P49A 4ODUB 4XBEH 4R7DB 1T0MA 3FQNA 2X4RA 3QNXB 5GZOC 3ULVF 1CR9H 4OIIL 1C12A 3SGJC 4LRNL 2AEPL 3U4BH 1HOCA 4WHTB 3EIFA 1F02I 4HW6A 5MERB 5C0AE 4Z7VF 2VLLB 5K59F 3ALWA 5DRNB 3ZKSD 5GRUL 4KK9C 2CKBL 1XR9B 1QKZL 3QEQE 1D5BA 2V9QA 1UFUA 1EHLL 2VXUH 2DQGL 3V6OC 5CBAA 4MHHI 3S37L 4WENB 1BOYA 1UKSA 2FYYB 2H9GA 4Y5VA 5ITFB 3WEXB 3OZ9H 3O6FB 4GG6A 3RL1B 1DLHA 2HG5A 4HBCH 2DI8A 1V3LA 3X3FL 1CGSH 2HLAA 1PDKA 1MIEL 5J1TC 1KG0B 4OB5L 3MLXH 4EXKA 1FZOA 4LSSH 1MWAL 3MXWL 4UOW0 1KV3A 3NIFE 5IMKB 1MEXL 3CK0L 4OZHE 4MA8L 5F1NA 4L4VE 3V95A 5CJQH 1CU4H 1J9CT 2W9LA 2FEEL 5IMMA 3KWWB 4K2UL 4PREB 1D5IL 5E4IA 3QG7L 3WE6A 1T2XA 4B0MM 1L7TL 3AXLB 4PJ9C 5DURD 4OCWL 4YXKL 2NPLX 1B88A 1L6XA 3UZQA 3G6JE 4NHCL 1JNNL 2YPLE 1NGZB 3NACL 3CXDH 3VFVA 2C9AA 1I3GH 4QRPE 4MA1C 1D5ZB 5I19H 4OUUB 1S9WB 3TBSB 4QHKJ 2UVEA 3FRUA 4PRIB 4MWFB 5L88H 3EYVA 1KGCD 4BZ1L 1U8MA 3DRQA 3DXAD 1BOGB 5GS1B 3V4PH 3EO1B 2VH5H 3QCUL 4JPVL 4KK5D 1YZZA 2ORBH 3HNSH 3HNVH 4GMTH 1S3KL 4EI6B 2V5TA 4BK4A 1CGUA 3T3MF 5GS0D 3LDBB 2CJUH 4I4WA 4PJCF 3VH8A 2DQEH 4DN4L 3WUWB 5D7JC 3ZDYE 1UA6H 2QADC 3NA4A 2B7DT 5DLML 3WO4B 2Y36L 3RKDC 4EUPB 1ZT1B 1CFQA 3CH1B 1SY6L 5DZLA 1UJ3B 4AYFA 4M6MH 5I1HH 5HHNA 4OLVH 5EU7C 1L9MA 3TWCL 3WDHA 5CMAA 5GJTH 5DA4A 2EIEA 2PXYB 1P84J 5HY9B 4G43A 2X40A 3GI8H 2XZQL 3QRGH 1X5ZA 3NCYS 5FYLD 4KJQD 3L3KA 4URTB 3RVXC 1MJJA 4ZFOA 4NKIL 4U6VH 4RNRB 1UT9A 2H6PB 1RURH 3IJYA 3EW3B 4FQPA 5C0ND 4R97C 5INDA 4LEOB 1OGAB 5J3HC 3NABH 5D1XC 3IDNA 1NGWB 2XWJA 2NX5B 5EC1B 5GS0H 1IL1B 5DXWA 1BLNA 3JV5A 5KOMC 1RIUL 3F7YA 2GY5A 4NC1C 1BFOA 3QI9C 5IM7A 4RX4D 1QLRA 4HUNB 4Q6IB 5FKPA 3BD4A 5EU7E 3QXUA 2YUWA 4Y5YB 3BKCH 1KXQE 3MBXH 4HC1L 4RA3A 4R4FL 2Q8BL 2DQHH 5FYKU 4ODWA 4TNWF 5TDNA 1J88A 3KPMA 4L8SC 5GGUA 1ZT7A 3T3PF 1OARH 4YK4C 3UTTA 1UACL 3GIVA 5JXEC 2BRQA 2JB6B 4POUB 4RFNC 3K1DA 1KCVL 1OT1A 5IJKC 4WFED 2P47B 4RFOL 2VMFA 4WJ5B 3VWKB 3ARFD 3G6AA 5FYLH 4PGEA 5I75B 4I9WE 4PRBA 5GISH 4NRYB 1OGTA 1AGCB 4J3XA 4KKLD 2VAAA 4YBQD 5D7IE 1T5WB 3O9WB 4PJEB 2BOCA 1QFPA 3BWAA 3BO8A 3G5VB 2I5YL 3TA3C 2JCCB 3QAZB 4P2OB 1JWSB 5F7DB 1EJ6A 3GUTA 2WBJD 1MHCB 3KXFE 4BM7A 5HVFB 3W0WA 1KXTB 3AMKA 2WV3A 5IEHB 1BQLH 1T2JA 2Z4QB 1KNOB 1CLYH 3BE1L 3LQAC 1MELA 5I1KL 1FORH 3BDXA 4Q0XL 3KYKL 5FUZL 4PB9H 3UPRB 4KVCL 1K8DB 4YPJA 1OVZA 5B21A 5DFVD 5EDXA 2YD1A 1H9VA 1WZ1L 4GRWE 3IGAA 1GGYA 4CU6A 5HD8D 4ELKB 4HT1H 1LVEA 5DZNA 2YD8A 1T21A 1OF2A 3EOBB 5HGBB 2PO6A 3O3UN 3T65B 2ZOKB 5HHOD 4PJDA 1MCFA 2ZSVB 3HA0A 2VDOH 4P2QB 3RIAF 1GGIL 3TN0C 1XH3B 1IILE 4LLWB 3VXUB 4Z78A 4JO4H 2DN7A 4HIXL 4RFEA 3IU4L 1AQDB 4PRHB 3QJHB 2AXJA 2L7JA 5HDQL 3GSNA 4OIBA 4RRPG 3H3PH 3VW3H 1UQSB 3ZLQC 3C6SB 5ERWB 3HC0B 1R3LB 3MJGX 1CLOH 1BZ9A 3AVEA 3BP4A 2J1KA 2ZKHH 3QDJB 2AABH 3EYOA 2VL5B 2O26U 3N06B 4XP1L 4F7EB 4FQXD 4TQEL 4PG9A 4Y4FD 2LU4A 1D5XB 3MMEA 2NW3B 5EBWA 1T20A 1WV7T 4L9LC 4PJIA 3U6RA 1S7VB 1DQLH 4EI5B 1TCRA 3LQAL 5L2KA 2FGWH 5EIIA 4ZMAT 1J8KA 5IFHL 3AY4C 2GK0A 4QHKI 1RUQL 5D9SA 4I8DA 3I85A 4YPGB 1NC4B 3KLAB 2EXWC 3V5DB 1HIMH 3V5HA 4LSPL 3RZCA 4HWUA 5GHWH 2JIXB 2J8UE 3SE8H 4OFDA 3MV9B 3JWDH 4LL9A 4MCZA 3SDCD 4OQTA 1LP9F 1AXSA 5DT1L 1KJ2H 2VXSH 2LVEA 1MSPA 3KPNB 1ORQB 4ZSOE 4WFGE 5CWSB 5DI8B 4ZYKA 5E2VL 1L7IH 5CJXC 2R8SL 4M8VA 4LLDB 5IQ9A 4HS8H 3ZTNL 5CZXC 3P3YA 3QDGD 4HAFA 3MUZ1 2IGFH 1CDCA 3O4LB 5F21B 5B4MD 3HE7C 1DFBL 4KPHL 4AENB 1NLDL 5BVJB 4L5FH 1A7PL 3I9GL 1RUPH 3D85B 3EJYC 4KZEH 1CICA 3L3IB 1P2CB 2V2WA 2V17H 4PJBF 5DUBA 5EU6D 2PYFA 2WK2A 4HX1B 1KEGH 2FX7L 3FN0L 5DO2C 4JRXB 5DEZA 2QQQA 2GW5A 3HAEG 1HN1A 3QUZD 4O02H 3ALXA 3T4AB 2R0LL 1V7MH 1RMFL 4CRPA 2FCBA 5JA9A 5DMKA 5BW7C 1QR1B 1WICA 1MAKA 3KNBB 4AEEA 4M1GH 5F7FA 5FYJH 1K8IB 1QOKA 5C0FA 4OV5B 4Y4KC 3MJ9A 4LOUC 3C5ZA 2OL3A 4OUOA 3SJVE 4NNXA 5J6GA 3RX5A 4LHQB 3U0TA 1AHWC 2GJ6E 1CIUA 3MLUH 4ELMF 3UTQA 3PDGA 2K9UA 5D6DC 3ULUC 1U8LB 1BD2A 1MFEH 5I18L 2VZUA 1G1YA 1QBLH 5HHQA 5IB3B 4FXKB 1QA9B 1T5XA 4P5TA 1ITBB 5CEXA 2ZJSH 4HUXB 5E6ZA 1M6OB 3CJJA 3G04B 2H1PH 4HS6A 3RTQB 4F15B 1VGKB 5JW5B 2W92A 4FQ1L 5D7LB 3ZHDA 3DVGA 5J9PA 3MLSH 3HI1B 2ERJB 4WHDA 1W0WB 2Q87A 3D3VD 2R29H 4L3CB 3ZKMC 3RAJL 2V7NA 1BQHB 2VLRE 2P5WB 2XZCL 2UZXB 1FBIH 3ZDZF 2A9NH 2CDFB 5ECJE 3QEGL 3ULVD 3ULUE 2NCMA 1IVLA 4PJXB 4DAGL 3QHFH 5GRYA 1T0PB 4LAQL 5I8OL 1YMME 2C7UB 2NXZB 5IB2A 1DQQB 2I9TA 3ARZA 4JHBA 5I8CB 1X7QB 3Q2CA 3BXNA 3SKMA 1XGUA 2J88H 1MI5D 4HXBL 4J4PA 1PFCA 1EFXB 5TGBB 4TUKH 5AAMA 3HUJB 1SQ2N 1T1YB 4MVBC 3P9MB 4MJ6A 5F8RC 5I71B 1X5XA 2X70B 4H1LA 3EO0B 5FYKE 4CDHA 3KDMB 1VERA 3ULUL 2BZDA 4NCC2 3T08A 2BXZA 4CN4A 2AXFA 4HIEB 4XCEA 4O5LH 4C83A 3KPRD 3QDMA 4LHUA 4XHQA 3Q5OA 3ULVH 3ECBA 3B3IB 1JTTA 3RY4A 3UP1A 5FM5M 5HI3C 4NRXB 2G5BA 4UT6H 5F9JA 1MFDH 5H2BA 2H8PA 3DUUB 4PR5B 2AV1A 1U6AH 4NM4L 3GEWB 3SBWC 4OZIB 4ACPA 4N8VG 1NCCH 4KTEL 5FYKL 2Q8AL 3TO4C 3QUMH 3HFML 1YYML 2VABB 1RK0A 3QYCA 3QIWA 4JPIB 5GSRB 1G7IA 4IOFC 2Q86B 4TSBH 1RJLA 4HZLA 3LIZH 1T0MB 1IBGH 2ID5A 3BQUA 2WAHA 3VXME 2EH7H 3RWJA 2QHRH 1K9TA 5F9WB 2H41A 2EEDA 4MDIA 1S9XA 5HGGS 3MLWL 5LQBH 4JZJC 3QO0A 1HOCB 1G7PB 3DGGB 4PS4H 5LAXA 5E2WL 3F8UB 1XZ0A 4X6EA 3GMOA 3RDTC 5HDBF 5E9DB 5D1ZD 3IKCA 3S35H 3PQYA 2DD8H 4FFWD 5GRWA 1ZGLM 3HE6C 5F71A 1YQ2A 4XX1E 1NC2A 1FGVH 3ORJA 4GG6B 4NWUL 1CD1B 2NX5E 1DLHB 2HG5B 2FSEB 1W0YT 3HB3D 5DHXB 5B39G 4Q9QH 3E8UL 2HLAB 2D7TH 4Q9CA 3I3DA 2BDNL 4P23A 4FTVA 1HSAB 2P8MB 2PW1B 3BKML 1XCQA 3TYFB 2X4UA 1FZOB 4XI5C 2ICWB 1WK0A 3OPZL 5F1NB 3GSRA 1O5DT 1JFQL 1QLFB 5A2JH 5IMMB 5ILTH 5JXAH 3HMXA 5FHAH 5F9OL 1L0XA 2E3VA 4EN3A 2QTEA 3RY6C 3ZT6A 4YFLI 3OF6D 4NP4L 5JIIA 1PEWA 3RU8H 3BX7C 1I8KA 1IKFL 2B0SL 2NY1D 3VFVB 2X09A 4QXWA 4YHOL 3B83A 4Z7WA 3U2SA 3FRUB 3B2VH 2F5AH 1LO5A 2VYRE 4FG6D 4PV9A 3VXRD 1Z6JT 3DRQB 1PKQA 2EYSB 5JHLH 3DBXA 1JL8A 4OM0L 4M3KB 3BUYA 5J12C 4WW2B 5CIPH 1CLZL 2P42B 5KVEL 4TSAL 3ARRA 3ISWA 4G80B 1NCDL 4DEPB 1DANU 1KC5H 3VH8B 4DTGL 1NDGA 5TQ0H 1RFDL 5JDJA 3AREB 3QUYD 5JHDD 3UAJC 3FFCE 2NY0B 3WBDA 3CFBA 4CVXA 4FNLL 4KVNL 3BP6A 3GKWH 4FFVD 1BHGA 1TTFA 3U9UA 1CFQB 4MJ4A 4WUKH 5EG6C 3NIFF 1I85C 3O3EA 4MCYB 2F53D 5HHNB 4F58L 3MGTA 3UJJH 1D9KC 5CMAB 1JHTA 5ELIA 4AIXA 4FFYH 4S1SH 1UB5B 2E9JA 4G43B 2CIIA 2AEQH 1OWRM 4P5MB 2EYRA 4NZTH 4XC3L 5BRZB 3BGFC 5ICZA 3L3KB 1G6RA 4ZFOB 1MJ7L 3N1FC 1QSEB 4XPAL 1KEMH 4OCXH 5INDB 4HV8B 3UBXG 3OKDA 5CD3B 1X5LA 4Z5RA 4HKJB 2Z93A 4RMTA 3F7YB 1I3UA 2BC4A 1YPZA 4I0CC 1P4IH 4NFBA 1BFOB 2HFGL 2I9LA 5IM7B 1LEIA 1DVFC 3DTXB 4Y5XC 3IJSA 1GHFL 3P4NA 4WVRA 1IQWL 2G60L 2BVYA 4WNQA 4PJAE 4JREC 5T1DL 4WTZG 4N1CA 1XGYL 1ZT7B 1JPFA 3QJFA 2DOCA 3UTTB 5AWNH 4Z7QE 3GIVB 5ACMA 1C5CH 1JJUA 1UWGH 5I6XC 3JWOL 5E2JA 1LE9A 2YMXH 3O45B 1GL4B 1WTLA 2DF3A 2OR9L 4ZTOL 1T66C 3G6AB 1IARB 1J1PL 4PRBB 4IMKC 1VADA 4WEBH 4JM2C 4YX2L 5M95B 1PX3A 4WWKD 1DANT 2C26A 4PJ5E 4M93C 3SQBA 1MAJA 2APTA 2PYEE 2BOCB 3MBED 4EOWH 4XCCL 3BWAB 5DD1H 4E0RA 3S88H 3QIUC 2XNAA 3H7LA 4NO5A 4FQJH 5I2IA 2E9BA 2FD6L 3AS0A 4GUPB 4PJ9B 4LQ1A 3GUTB 1GAFH 3ARDD 1PX4A 3W0WB 2BXYA 3S96B 2EO1A 1YN6A 2HH0L 3KS0J 4G6MH 1J8HD 4XHJD 4POZD 3S4SA 4YHPA 4KQ3H 3UX9B 4OFYD 4S1QL 1SBBA 2D0GA 4PTTA 4ONOA 3LKOA 3ZKXB 2ADJA 3VD3A 2DDQL 2PTTB 1XF5B 3DXAA 4FQIH 3ARYA 5DTFA 3B9DA 1VACA 5CJ5A 4JFFE 2AJXL 3S97C 1T21B 1OF2B 1R5IA 4XXDB 4JDZA 1I7RB 3UZEA 1QSFD 4NQXA 2PO6B 2PN5A 3EOTH 4ERSH 1HH9A 2X1PA 5GGVH 1JWMA 4JHAL 4PJDB 4GW4A 4JPKL 4Z78B 3D39E 4WO4C 1NDMA 2E9IA 3MRKB 3JZ7A 4RFEB 4Z77B 3GRWH 4ZXBC 3OJ2C 3GSNB 5K93A 3GSUA 1FSKC 1QFWL 2O5XH 4TSCH 4FN0A 5ESAA 1F42A 3I6LD 4M03A 3BI9X 3P0YH 1CGYA 3DGCR 1BZ9B 1CFBA 5DJAA 2FIRT 5ADPL 4WV1C 4DCQB 4XAKE 4WI5A 3IFNH 1X6NA 2YD5A 4KZDL 2IBGA 5ENWA 3MV8D 2ZWLT 2FLRT 2C1PA 4PGBA 1I1AD 1VDGA 5C09D 1MRCH 3NCYP 1AXTH 2VDLL 1KPVA 4OM1L 1SMAA 5F72S 3MOAH 2YD9A 4NQVB 4R90L 3MMEB 1K85A 3FQRB 3MRRB 4APQD 1TCRB 5L2KB 3JTTA 5EIIB 2UV3A 1F3DH 5KS9F 1AR2A 1FRGL 2GK0B 4H25A 3C09B 5D9SB 4LBEA 1LNUA 2H2SD 3WFBH 1A1NA 3MCKA 2ED9A 4RX4A 5ETUA 3I75B 3V5HB 5JMRA 5ICXA 4V2BA 5BO1L 1FG9C 1BAFL 3CFDB 1XF3B 5I1EH 4HWZA 1J7VR 3T0EC 4O4YL 3WKML 5BV7C 5SX4H 1IGFL 4NO3B 4HCRH 2VZSA 3SO3B 4LVOB 4LPXA 2AJUL 3BEVA 4UB0L 4FP8L 2W59A 4YBHA 1MFAH 3ARFA 1R3HA 4YHNA 2YUVA 1OAYL 1ITCA 3I2CL 3NAAH 4PJXE 5FAAA 1T89A 3JTSA 3QQ9D 1ADQL 5FK9B 4PY8I 1AI1L 2BCKA 5IBUG 3DROA 1CL7I 3FT2B 5C0CD 5C3LD 5FGCE 4UTBL 1HE7A 3VFRA 1ORSA 1WIUA 4NCDA 4ENEC 1KSRA 5IHUH 1P6FA 2WBJA 1OAKH 2VN7A 3EFDH 4XPHL 4EBQL 3HS0A 4NPYB 4QT5B 2OXHA 3HUJE 2R0ZH 4GG8A 4QWWC 3T0EE 1CICB 1X5HA 2FB4H 4MX7A 1C5DA 2NY3D 4M5ZL 1I3VA 1BZQK 4TUJB 4JHWH 3V0WH 1FYTD 2EIZA 1X5AA 4OCMC 1NLBH 1W72L 3V6FA 5IVXE 1YMHA 3BKYH 2W60B 4M43L 2VSCA 3MRQB 1F3JA 4U1KB 3DYOA 1AY1H 3RNKA 5JW4R 4CMMB 1MQKH 4YJZL 2HKHL 3K2UH 4JFOB 5C0FB 1DTUA 3AC0A 3P73A 5EWIL 1U91A 3C5ZB 1II4E 5HHOA 4S1RL 2OL3B 4OZIE 2X1XR 3K8KA 1G9NH 3H42L 4I3GA 4NNXB 5J6GB 3U0TB 4Y5VC 1ZVYA 5T33L 1OLLA 2GUOA 3THML 3UTQB 3BW9B 5EO0A 1VFUA 1NEZA 5KW9H 4QRUA 5ESVA 4IOIA 3V6ZA 3EDJA 2W9DH 4QRRD 2VDQH 5F1IA 5ESQA 5HHQB 2C3GA 4WFHD 1NBZA 5M94B 1T5XB 4P5TB 1OPGH 3RWIB 5CEXB 1KTLB 3L7EA 3ME0A 1BBDL 3M1BA 3BGAA 2BY3A 3SCMD 1KJ2A 4X80L 2RFXA 1FQ9C 1OAQL 4HS6B 3UBXI 2XZAH 4S1DC 4BFEA 2O5YL 4FQXA 1FDLL 3O8XA 1JN6A 1CK0L 5TFSL 2QV2A 4Y4FA 3T0WA 5GGSA 3HR5B 1JUFA 3MNWA 3ARSA 1EH9A 2DQFA 2V7NB 5LCVH 4ODSL 2H2PD 3BIKA 4M1DH 1IC5L 1E0OB 2DQJL 1TZGH 2B1AL 5E08H 3TZVB 3GB7B 1EJOL 3D25A 3RP1A 2FDBP 1Z9SA 3WIIH 1ZGLP 1NAMH 4GLRH 2IPTL 4QGYA 4ISVB 3TJHC 1SJEB 5DD3H 1A2YB 5IB2B 1A6TB 4Q9RL 5JR1L 2P43B 2I9TB 2GSIA 5T1MB 2NY6B 3BZFA 4X6DF 4M62H 3SKMB 4BSWA 3SDCA 1NCAL 1VCAA 4D9RD 1T6VN 3KG5A 4HFUH 4DZBB 3VGGA 2B39A 4H1LB 4YZFF 1LWRA 2YD4A 4GW5A 1U3HC 5IFAL 7CGTA 4OD2A 5JIPA 1I9RH 1FIGH 4IIQA 5K9QG 2H32H 3QDGA 3I84A 2X1WL 5KVFL 1A1MA 2HVKA 1G7MA 4C83B 1XGPA 3GSXB 3KS0H 4LHUB 1S9VA