3FO0H

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (wild-type)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
b'DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
molecule tags Immune system
source organism Mus musculus, homo sapiens
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
total genus 44
structure length 214
sequence length 221
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H01
1I1AC 3RU8L 5H2BA 4FQ1L 4GRLC 2ARJQ 5FYJE 3ZHKA 4HUXB 1P53A 2XFXB 1U41A 3SO3C 1JUFA 2XI9A 3DGGB 4PPTA 2E9WA 2A1WH 2VDPH 4LOUD 4U49A 3Q48A 1T4KB 3KLHD 1J05B 2EYSA 1V5JA 3I3EA 4G9FD 2J7LA 1MCFA 1WSST 1XIWD 5E94B 1F58L 1G7HA 3JVGA 4B7IA 4Q9RL 1WC7B 1MH5B 1EEYA 4E9LA 3GMRA 3WNKA 3GMNB 5A2LH 1R3KB 3KWWA 2OK0L 3GHEL 5FYLL 4XNUH 4F15C 3GM0A 1I3RB 3QPQD 3B9KA 4X4XA 4HXAL 2R0KH 1F6AB 4NCDA 1HDMB 3HNSH 4D2NA 3MLSH 2A2QT 4OGXH 4WHTB 3N1FC 1RMFL 3O41B 2BNQE 3MO1A 3G5YA 5CD5C 5J1AB 1JGEA 4JRYB 1BOGA 2F54E 3EJZD 2DN7A 4U7MA 4QXTA 2ADGA 3SE4C 2E7HA 2FR4A 3MR9A 5J9PA 3WDHA 1Q9WA 4JREB 4I0PB 1HIMH 4DVRL 4GKSA 2FO4B 3V52L 1D6EB 1MREH 1XF4A 3QRGH 5L8LB 4X6BB 2FJHA 4XRCA 2HT4D 5FKPA 5KW9H 3CU7A 5KS9B 5FCUH 1VB9A 5IQ9A 2H1PL 5BV7B 1J87A 4PB0L 1R6VA 2NMSA 5KZCB 4MVBD 3KPRA 4GRWF 3KXFE 3MRMB 1ZS8B 2IGFH 5GZND 1HHHB 1A5FL 1YA5A 2CD0A 4JKLA 2R39A 3QDGE 3FKUS 1P7KB 5C2BH 2Y07L 2XICA 4HJJL 5D7JD 5BMFL 2FJHB 4HAGA 4M1CC 1T0MA 3KYKL 4XB7A 4YX2L 3QIBA 1ZE3C 3VFOA 3FZUC 2EDQA 4KKLD 1KTLB 4YIQA 1IGIL 5C0BE 1BQHG 2CLRB 3DRTA 3PP4L 4R2GB 4UV4H 1S8DA 5J6HB 1CU4H 3RWJA 3RAJL 3BPOC 2LU7A 4CMHB 2QHRH 3H9SD 5KSAA 3D2UA 3K2UL 4P23D 3QIBC 1S5IH 1KCUH 3V4UL 3P77B 3R06A 1MRDH 4I2XA 3GSNA 2R29H 3GRWA 1FNAA 3WSQL 3IXAA 4NZDA 3RRQA 3OAUL 5FECB 1ACZA 1DSFH 5TGBA 4GMSH 5ETUA 3KPPB 4OZGB 4MLSA 4OZIA 4HH8A 4EN3B 3FFDA 2X4NB 3BFOA 3MCLH 2C7UB 1SY6A 2HKHL 1G9NH 4JQVA 3O4LB 4P3DB 1ADQH 1LNUA 4I8DA 3RVUC 3ULVD 5JIIA 4JFXB 1Q8MA 4M4PA 4R96A 5AD0A 3JTTA 5C70A 2P7TA 4N0CC 4HLJA 2Q8AL 2VIRB 3WFHB 1RVFL 3QCVH 1IQWL 4MXWL 4UT6H 4P4KA 4DK6A 3JWNC 3T0ED 4Z9KB 5FUCE 4UDTA 1KELH 1HILA 4LKXA 3O45B 5DQJB 5EBGA 5F72S 4X98A 3G5VB 2R2EA 4PP1D 4MDJA 4MSWB 2F8VA 4RRPA 3UJJH 2G2RA 1VENA 4ZODA 2P42B 5CJOH 1P6FA 5E5UB 1P4BH 1DE4A 2CIKA 2AXJA 4TULL 3DETC 3B5HA 1IC4H 3T0XA 5C9JA 1EA9C 3LEVH 5C92A 4V1DE 4NHUB 4HS8H 2UV3A 5TDOB 5CGYD 5EBMB 1IEBA 1QVOA 4APQC 3DWTA 3HPJB 1MLBA 2R1YB 2WNGA 1TVDA 5FK9B 4JO4L 4KZDH 4OBSA 4HULB 3WO4C 2PR4H 1DE4B 4YDLB 1S78D 3OHXB 4LAQL 2PETA 4LSTH 4MJ6A 1EVUA 4MNQA 3EOYG 3GEWB 1HH9B 3DSNA 1PSKL 1U3ZA 4AJ0A 1RJCA 4WTXA 4FQHB 5A2FA 1QD0A 4Q2ZA 1F4XL 1XGUB 4OZ4A 1Y6NR 3H0TA 3U46A 3PJSB 3KPRE 1P9MA 1QR1A 1FL5B 4NRYA 3K4AA 4DUXA 2Z93A 4MZ2A 2P8MB 4OZFB 1IAOA 1LEIB 4KGLA 1RUQL 4JZNA 5F7MC 2VSDA 3AM8A 4U6VL 3TJHD 3UBXI 1G9MH 4OCWH 1M6OB 25C8L 3MOQA 3IDYB 5T3ZD 3SDXE 1A1MA 1NAKH 4ZPTB 5E5RB 4H0IA 5FYKE 1ZLWK 3D85D 3LKOB 2IAND 4NZTL 1Y6KR 4JDVB 4NWTH 1NMBL 4CVUA 5DMGD 5CEXA 1VKXA 4R7DA 5F89B 2F15A 1W8OA 3IB4A 1MCEA 4LGPB 3JV0A 3WUWA 1NMAL 2MHAA 3RWFA 2CDFB 5EIQA 3NCMA 3BESR 4BA8A 1CZ8L 5JMOC 5C08B 3WV0A 5D7IF 4XP6L 4X7CC 4QOKD 1QQDB 4EDXA 4LLDB 3OSKA 4UIKL 3MV01 4WUUD 4QOKE 1UVQB 1CK0H 3RUGF 1WK0A 4ZUVB 3NPSB 1ND0A 4ZAKB 1RK0B 2V9QA 3QBTB 3WO4B 4LQFL 5DO2C 5FUZH 4H8WH 5CBAA 1JHKH 4NO5A 4ZXBB 2UYLB 3W5NA 5ISZD 4NNPL 5EOTA 4X99A 3EUUA 2H9GB 3EO0A 4XP5L 4APQB 1A6WH 3GNML 3P4LA 3D6GA 1I7RA 3HLAB 4IRJC 4MS8C 3D85B 1F4HA 3C60A 5FYKD 3O41A 4JJHA 2WINA 2VDKL 4ONOA 3RJDA 3P4OA 2DQTH 5F7KC 2P8LB 5CEYA 5SWQA 1JWSA 4PJ5D 1CDBA 3QXTA 1QRNB 3EJYD 4LNRB 4Y0GA 4PJ9B 5FCSH 1HHJB 3IDJA 4JM2C 5T5NF 1U95B 4XNYL 2ITCB 3QFJA 1P7QB 1U42A 2YUWA 1DVFB 1MJUH 3AMKA 4PGEA 1PLGL 3MRLA 1B0RB 3VGHA 2RFXB 1A9EA 1I8IB 2YZ8A 3QXWA 4ONFL 1RUKH 2VLRE 3RA7H 1T4KA 1Q9KA 1YQ2A 2XRAH 4WW1B 1AIFB 2P8PA 2AV1B 1EAPB 4JAMA 4P9HC 1XAUA 4GSDH 4X5XB 1R0AH 2YD3A 1H5BB 1IFHH 3GI9L 1Q9OA 1EEYB 2DIJA 5B22A 4OD3H 3WJJC 3VGAB 1UZ6E 5CHNB 1TJIL 1I8MA 5D2NC 4D0DB 1PQZA 2IPUK 4NP4L 5DS8B 2FATH 1YYMH 2CPCA 2BRRH 3I84A 3QIBB 4N0UE 5D7LD 3SJVB 1A6VH 4FQJL 4YNYA 1MFEH 1CYGA 5DUBB 5DFTA 1X4YA 1UKSA 1DDHA 4AEHH 1AHWB 3S7GA 5HDLA 1QLRB 1INEL 1BVKA 5JO5A 2KUTA 2CRMA 4CN1A 2H2SD 3QDJD 4G6AD 4DOHE 4U1SA 2G60L 3SDXF 4RIRA 4PRNB 1QG3A 3CDGA 3QYCA 3RL2B 5DJZA 3X12A 3ARDD 3HNSL 4HQQL 2X9WA 5I18H 3ARSA 4ZG1A 4G3YL 1UWXK 3WEXB 2NXZC 2MQ3A 3BKJH 1KJ3H 1KIPB 1WEJL 2XKNB 4Z18A 2VXSL 3QO0B 2EXYD 4TVPL 3G5ZA 1VDGA 2NY6D 2OI9B 5E2WL 1T5XB 4LKCA 5F1IB 4NT6A 3TN0D 2YC1A 2P7TB 1KIQA 5TQ2L 1JUFB 1YNLL 4U1SB 5IFJB 5BRZB 2CDGA 1DN0B 3IF1A 4XWGH 4XVUD 1MUJA 1IL1A 2VN4A 1H15A 4MB4A 4OTXH 2BNQA 4OGAD 5A2JH 1IQDA 4K9EC 1ZSDB 3P0GB 4PUBH 3RDTC 5MENA 4QRQA 5JNYB 4P2QD 5I73C 5L2KD 2ATKA 4R3SB 1DQLH 2VNCA 4PRBA 2DQIL 2X89A 4HEME 1KPRA 4PP2A 4WNQB 1D5BB 5AZ2L 3H7LA 4X6DA 1FQ9C 5JLZB 2VXQH 4JY5H 5BVJB 3RWJB 1B0GB 4TRPL 1BMGA 1GC1H 1RZFH 1IEBB 1QVOB 1JF6A 3GJFK 3C9NB 4CJ1A 4KDTC 2IGFL 4HCRH 1XGPA 5ETUB 4F7TA 3GIVB 3GMOA 2F8XC 1N7ML 4BSVA 5KVEL 1AGEB 2XY2A 2YPKB 5EC2B 1D5IH 5ID0B 3O6KH 1S9VA 1WZKA 3T1FA 4IDJH 3VRIA 4HH9A 2WBJD 1QACA 3HRZA 1XF2A 4FABL 3NH7L 3SDAC 3HMWH 3BGFC 3CX2A 2DLTA 2BVPB 2Q6WB 2IPTL 3MXVH 3CH8A 5DRWB 4KQ4L 4G7VL 3OKOB 5FDWB 1WCBB 2BVQB 2OTUB 4UTBH 3V4VH 4NC1E 4Y19A 3MLZL 3LV3B 1YMMB 4PJGB 5ICYA 3MRRB 5E8OA 2BSTA 4PJ8B 1VEMA 3TBSB 1U8KB 2JJVA 5ID1A 2BNQD 3EIFA 2YSSB 2D0FA 3VXSE 1LE9B 1E4KA 1VFOA 3QPXH 4X7EC 1DQJB 3MRBA 2XA8L 2PYFB 4R26H 4MWFA 1D5ZB 3MLTA 3B9KC 2VLKE 4TTGA 2QQQA 4AIZA 2CKBA 2NZ9D 3RWIB 4XBPB 1KCRL 2UWEF 3OF6D 1YY9C 3JWOL 3FQNB 3L3DB 1KB5B 2L7JA 3BUYA 1LE9A 5DZLA 4UB0L 4HS8L 5IB2A 1BQLL 3QUXC 1QLFA 4KI5E 5IV2B 1PBYA 2W65A 4ZD3H 4XP5H 3S37X 3UTQB 2EICA 3MGTB 3FTGB 1WTGT 2HJKA 4H8WL 5E2JA 4RFEA 5I66A 4HF5H 1BD2B 5B39B 1NKRA 2PTUA 3PHQB 4QEGA 2O5ZL 5HDBF 4JKMA 4HV8A 1CFQB 1S5HA 4BQCA 5I71B 4YUEL 3MRGA 3W9DA 3HC4L 3VFMA 4QYOA 4MCYA 4G5ZH 4G80A 4QRPB 1U6AH 2Y36L 1K5NB 3GSRB 4O00A 2CKBH 1DQTA 3DURA 3ZDZE 1XCTB 3V95A 2AI0H 5J1AA 5E70A 4PTTB 4CN4A 4LLVA 3QHTC 4X7DC 3IFLH 5GIRA 1NGZB 3DRQB 1CVSC 1ZHBA 1BOYA 2APVA 4PGEB 5JZ7C 2CUHA 4J4PA 1K6QL 5K33A 1OCWH 1EJOH 3C6LA 1SYSA 4Q74A 3CU1A 5D1ZA 2YEZA 4W4NA 3HPJA 4NC2B 1LE5A 1AI1L 3MLWH 2YKLH 4KK9C 5FYJU 1U3HC 1F8TH 3T4YA 3TO2A 1IGML 4R8WL 5D93C 2FIRT 3RKDC 5T1DL 4X5XA 4N9OB 1KT2A 3TT3L 5FYKH 1QFHA 1MHHB 4DQOL 4U1MA 3TIDB 4ELMB 5KSVA 4PJ5A 3SE8H 2Y1VA 2FBJL 3T0AA 5EOTB 3Q1SL 1B2WH 5DMGC 5I1IH 2G5BB 2NR6C 1KOAA 5KTEL 3MBED 1IGTA 2EECA 4LHUA 3TZVB 1BVKB 4JG0H 3SDXB 4WFFE 5AG8A 2FX9H 2LABA 3DX6B 4K94H 3ZYJA 4LGSB 1D6VL 5EG6C 5J7CC 5FGBA 3X12B 2DQCL 3RGHA 3QA3A 4X4ZA 4IHOB 5A43C 4KKNA 3P2TA 5C08E 5MEQB 1DBJL 1NFKA 2FYYA 2I9LB 2F9BT 1NGQL 5SX4I 3UCRA 4DVRH 1CL7L 1MWAL 4JPWH 2VDQL 4KKCC 4RGNB 1JGEB 3ELAT 2GW5A 3FN3A 1AH1A 4ISVA 5E6IA 2BRRL 4ZO8A 1MJ8L 1OGTB 3CXDH 4BYHA 1HHGA 1H3PH 1BQLH 2J1KA 3L5WB 4NZRL 3IU3B 3BAEL 2BVOB 4YBQC 2DKUA 5H37G 1T03L 2A83B 5EC1B 4WU7B 1S7XB 2QSVA 2EDNA 2DM3A 3EDEA 4GRMA 1HSAA 5CGYC 4C56A 2E27L 3TYGL 2BOCA 1U92A 3DROB 3JWDC 4X6FA 4N5ED 1GZQA 2VISB 3CLEL 3U7WH 4KJWC 5IW1B 3MOBL 5EU3A 35C8H 4MXVE 4I9WE 5E9DB 3AUVA 1R5VB 3UEZA 4Z7VE 2WINB 4QXGL 4P46C 4KJPD 1AGFA 3P11L 4J8RA 5JIPA 1YMMD 4PP1C 4F58H 4P3DA 4PJIE 1RJLB 2F5BH 4HFWB 3QR2A 4Z77A 2NPLX 2JIXB 4ESKA 1P4LB 5D96C 4PJBE 1T04B 4YBLC 4J1UB 2BK8A 4MAYD 4J7RA 2O5XH 5IG7A 3TP4A 2IQ9H 3V6OE 2XZQH 4EIZC 4U1KB 1NSNL 3PHOB 1ZA3B 1T21A 4Q6IC 3BT2H 5I8CA 4H8WC 1RZJC 2R0ZH 5KVMC 5KSBA 3MBEA 2FEEI 4MJ2A 5D6DC 3GMLB 12E8H 1BBDH 2ADFH 4OZFG 3VA6A 4LHJB 4P57A 5C86A 3GUTA 5J11C 3C09B 1X9QA 1FYTD 1RZKL 1C08B 1S9YB 5D2NA 4KJPC 2UUDK 5E8OB 1ULVA 4TYUA 4XP9H 5DK0B 1IAKB 1U8NB 1PFCA 1GC1L 1RZFL 3NCEB 4TUKH 1FZJA 5IBUB 2PN5A 2DQJH 3MLRL 1ZLUH 4ODVH 3H42H 2E27H 2X4SB 1NAKL 1HIML 5E99L 3RTQB 3ZE2F 2NY0C 2B0SH 2N1KA 4JFOA 4O02L 3CSBA 3SE9L 4Z76B 1X5XA 2WK2A 1IFHL 5EU7C 3VXME 3VXQB 2C4FT 4GW4B 1TQBC 4NZTH 3RWDA 4GMSL 4G8FA 4M6AA 1DBBL 1WAAA 1IAKA 4BSVB 3QHFL 2RR3A 3HS0B 5HVGB 4IRZH 1IJ9A 3V5HA 3WN5C 2NXZD 1QLFB 2VDQH 2HJLA 3MV8E 3NIGF 4EZMA 4PLJC 2W65B 3LQAL 1YQVH 3CFCL 1UB5B 4KK6C 5ICXB 5I16A 2JJTA 5F3HB 3WNPA 3SKOA 4ZUVA 2D7NA 1EZVY 3S36X 4TPRL 1QFUL 4KKBC 1UM5L 1AD0B 5I8KL 3GBNH 4KI5F 4XAKD 4JHWH 2BCKA 2J4WH 3WD5L 5BJTB 4M3KB 4HK3J 3U7YH 4DK3A 1C12B 5KANI 1UJ3A 1MRFL 1AD9A 2X4PA 4ZTPH 2ICEA 5MENB 5E2VH 4NQDA 5ICXA 4JRXD 2IMMA 5IESL 2DLIA 1R3HB 3QCUH 1YPZF 5GGTL 5I19H 5GIRB 1S7UA 4NO3A 1SYVB 3PWVB 2CR3A 3O3DA 5CILH 1CLCA 4H1LA 4PJ9A 3VA2C 3FMGL 4EUPA 4F57H 1N59A 3QIUA 5CLTA 1CGUA 2IH1A 2Q8BH 4ODVL 2VC2L 2FHBA 2YOCA 3O2DL 3WS6A 5D6DA 5GSRB 2F5AH 5CCKL 1T0MB 3DNKA 5HHXH 3CMOL 1JZ4A 4K7FA 3X3FL 5IMMB 3QFDA 5EO9B 4IM8A 5D72H 4PGJA 1S7SA 1RIUH 2WLYA 3NIFF 3IVKB 5HDBE 5GS1B 5HYJD 2H9GA 3EO0B 1S9VB 3MRNA 3FCTA 4EI5C 2ORBL 1UQSA 3WUWB 3QWOB 3NCJH 4YGVB 4DZBB 4NO0B 5DQDL 1ODAA 4HH9B 4O51A 1C5CL 3QIUC 5CJ5A 2X2YA 4ELMA 4MQSB 5KSVB 2OM5A 4FFVC 3Q6FB 2EDEA 1B2WL 3TWCH 2AI0L 3ULSB 4JRXB 2YPLB 4MQ7B 1JF5A 3KPSE 1OAQH 2IQ9L 4L4TD 1KJVB 1TVBA 5FXCH 3HE6D 1XH3B 3VXPB 4HIHA 1SQ2N 3SQOH 1INQB 4NSKA 1U8PA 3T08A 4IEFB 4JY4A 4PTTA 3MGAA 4HLZG 1MFDL 3RVUD 3ULVC 4EEEA 4FXGB 1EGJA 3FT3A 3S36L 1OM3L 4KJYB 3MRQB 1DBAH 4MWFB 1ZLSL 2AABL 3T65A 3BGMA 3Q5YA 3TBYB 4FTVA 2NY1C 2Q86A 1I7ZA 1Y18A 1CBVH 3AC0A 5H2BB 1JPTL 4DOHB 2J8OA 3LKSA 5IF0A 2VZTA 2VAAA 4OFIA 1HSBA 3BKJL 3O2VL 1FFNA 2E8ZA 3GMMB 1JHTB 3WLBB 4J12A 43CAA 1PKQE 3UP1A 2X89D 3MV9A 4JCMA 1ZHLB 2IALA 1GIGL 4YO0A 1A9BA 1I1AA 2Q3AA 2JJUA 5I1GL 4CNIA 4M93B 3MV11 2APTA 3LKSB 1M05B 2GKIA 4G9FA 5D7JC 3KPSB 3V0VB 3VXTB 4JR9H 2XY1A 4WEMB 2X05A 4ZOBA 1KC5H 5CJQL 2CDEA 5KW9L 4Y4KB 4HXBL 4JQVC 4LAJH 1EAPA 2NY1D 1MEXL 3Q3GA 1DZBA 4K07A 3AXLA 4P2RB 4Y2DB 3NFSH 1NGQH 3LSOB 5CMAB 4MA8H 1SBSH 3I2CH 1NAMH 4JPVL 2VZUA 4YC2B 5T3XD 1JPGB 4JE4B 1MRFH 4YO0B 5EOCL 1NMCB 2DYPA 4OV6F 5F7WC 2R0KL 4L8DB 3SJVA 5BCAA 1TTUA 2Z92A 4Z7VF 4QXTB 3WHXB 2VZVA 2H6PB 3EFDL 1QFWM 1CICA 1PZ5B 1RUKL 1CBVL 3MA9L 3QUMH 5CGTA 3ULVE 5EB9A 1AP2B 1JPGA 4X5WB 3P9LB 1RK1A 3S3JA 1NKOA 3SGEH 1NCAL 3S5LB 1OHQA 2DYPB 1DTUA 5B3JF 5E8PA 1A1OB 1FORH 2ADFL 1L7TH 2BSED 5GJSH 5C1MB 1VFAB 3MLZH 1WC7A 3SKJL 4BSWB 1RIVL 4GRMB 4JQIL 1FH5L 4Q6YA 1T1XB 2A6KA 2F8OA 4KK5C 1DFBL 2ZUQB 4PJIA 1ZANL 3N85H 3FFCD 2FJFB 5HYJA 1ZAGA 4Z7OF 4KMTL 2CXKA 4MJID 3CPLB 2QL1A 3FAXA 4X6CB 5JA9A 3VXRB 1H0DA 4CVXA 5IGXH 4POYA 2YN3A 3D1MC 1PGRB 2A9MH 3KYMB 1VFMA 5E8PB 3GIVA 3GMOB 3LVEA 3QRFM 1E4JA 4JFOB 5HBBA 3ZTJH 3GDBA 5C0JB 4YHPA 2X1WL 1BOGB 4GAYA 5TF1H 2NY2D 4NO5B 4HCRL 4LFHD 3BKCH 5C0CA 4HUUA 4GW5A 1IAIH 5GISH 2FX7L 4LCWD 1CQYA 1OTUC 5IHUH 1CFVL 4OD2B 1A4JB 3EFDH 5FDWA 1ES0A 5IEKB 1CE6A 3SBWA 4WU5B 2IF7A 2IG2H 5JW3H 4LVOB 3U0PA 3SKOB 2EH8H 2LQRA 1HQRA 3TNNA 3VFTA 4FFVD 4JRYE 5JOFA 4UZGA 5IMOB 1FNFA 4KC3B 3F5WA 1G7QA 3VXSA 3DX9A 4M6OL 3TBSA 2NY0B 3KDMA 2YSSA 4P5KA 3RTQC 3SGKA 3BH9A 3PHQA 3O8XB 4BZ1L 1IAMA 2IH3A 2YD7A 3ARDA 4TVSa 1L0YA 3D25A 4AQ1B 4QXGH 1B88A 1VACA 3EW3B 4HMEA 1BAFL 4NO0D 4DEPB 3QB7C 4UILH 2OTWA 1NFDE 4Q9CA 3NACL 5MI0C 5DRWA 2W1NA 3FQXA 3WIIL 1DQQA 1F00I 3HE7B 4JY6B 4WI6A 4PD4K 1G7QB 2QSQA 5GZNC 1G9EA 1H5BA 4N90D 1B6DA 4M8VA 3T0EB 2FSEA 4X9HA 5BZDA 4JDTH 3BJLA 3JBG7 4PYGA 1YPZE 3RBGA 5GXBB 1L4IA 3S35L 4MHHG 4HPOH 1G0XA 1OARH 3FOMB 1RPQA 3LY6A 2OTWB 5BOPA 3ZKNC 4OZGA 2YMXL 1JPTH 5F3BA 2PR4L 3GIZH 2BMKA 1I7UA 3CSYB 1SMOA 4LSRH 4GKOA 5EA0H 3KPOA 1UENA 3L3IA 1AFVL 5D96B 3PGCB 4UU9B 2QQLL 2WIIA 2XWTB 4LVHB 1T0NB 1T21B 5I8CB 4WUUA 1A3LL 2HTKD 3GZKA 3W0WA 6CGTA 3MUZ1 1W2KT 3JWDH 1GHFL 1RUPL 4ODBD 3O9WD 4PRAA 1B4JL 4OIIL 2J88H 1IARB 4FG6C 1ZHKB 4N0YL 2WZPD 1HYSD 4YDVA 3W39A 3TV3H 3HHRB 1IM9D 4PJAB 1DQDH 2XWTA 2DAVA 1GL4B 2CIKB 2ENSA 2NXZB 1JNJA 3JV5A 1X5IA 5IBTH 3QWQB 4R4FL 1KG0B 5T5NG 3TBWB 3LEXB 3LD8B 5F9OH 5KVGL 3REVA 3NIFE 5DO2D 1N8ZB 4GKSB 1VFBB 3REWA 3QCTH 1X5GA 2E5EA 4UIMA 4FP8H 1R3IL 2Y06H 1H3WM 3P4NB 4GLRH 3QUZD 1EHLH 1FZMB 5CLWA 3D18B 4JO3L 4XPAH 5HI4C 2VLLB 3VDAA 5D5MF 1RZJH 1FFNB 5F9DC 1G6RB 1ONQB 5HHNA 4XAWH 3QJFB 4C58B 1BREA 1OB1B 3MLWL 1D5BA 4LLUB 4M93C 3EO9H 4J6RL 1EUTA 3ZKND 2ZKHH 4PGBB 4PRID 4Q0XH 5C0EB 5J1TC 4RMQA 3D0LB 4RFNC 4GKNA 2ZSVB 2JE8A 3BN3B 5HI4D 4Q2ZB 4PJCB 3DMMA 2AJVH 4XXDB 1P9MC 1HCVA 4DGVH 1KTKE 2UY7A 5FFLA 3RWHA 1LWRA 4Z0BL 1RFDL 5IKCB 4RNRB 4KTYA 2R15A 4WDIB 3RNKA 3VH8B 5E00B 2VSCA 4P2OD 1WF5A 2BOCB 2PXYA 1L0QA 3D39D 5T1KD 4IHOA 3VFPB 3BZFB 2UWEB 2QHLA 4Y1AD 5K59F 3HC0A 4PJAE 2PCPB 4YBQD 5HVWA 3VD3A 1FVCA 3AS1A 5D1ZD 3QNZB 4M1GH 1J86A 4I3RH 3I75B 4RGNE 4N8PA 2NY7L 3BDYL 4AIOA 2UZXB 4HX1B 1N64H 1QFUH 3FO9A 2A0LD 1KIRB 2H1PH 2H32A 1U91A 3PWVA 2VXVL 1NMAH 1C5DB 2EH7L 2IADB 4A6YL 3SCMB 4LHUB 1JK8B 3KPRB 1PZ5A 5TPWL 1LP9F 2GQHA 4D8PB 1IGFH 2CRIA 4D3CL 3WXVL 1CD1A 4PJXF 5J13C 4MJIE 3G04B 2VWEE 3LZFH 5EC1A 3JXAA 5CINL 5E8EB 2XQYG 1GGCH 2BHYA 5EOCH 4HFUH 1RIHH 4P46A 3EDJA 2V5TA 2CO6B 3DX7A 2JB6A 1F3DH 1UH3A 4DGIL 4OCLC 1J8HE 1TXKA 4PGDB 4I48A 3KJ6L 4QHLA 1SBSL 3I2CL 1S3KL 5IHBA 1UB6B 5F9JB 4K2UL 2CGRL 4TUKL 3GK8H 3ARGC 4G6KH 2A6DB 5C6WH 4LFHG 2XZAH 3LB6D 1WWCA 4HZAA 4PRPE 2F54A 5GZOC 4GFTB 3W11C 3KPPA 3OXSA 4R4ND 1CDYA 1TCRA 2HLFD 3H8NA 4ZUWB 4M5YH 1G7LB 3PL6A 4NJ9L 3QDGD 3IFPA 3CUPA 4LPCA 2HTLD 1CTOA 1XR9B 4EI6B 3KXFD 4I48B 4JM2A 4OLZL 3B3IB 4XC1L 5C6TH 4AZ8A 4PGZA 4KZEL 5KJRH 1ZWIB 3MNWB 1P7QA 4O5LL 4LARH 3CDGB 3OHXA 7FABL 2MFNA 4NKDA 2B5IC 5D2LA 5FHAL 5D7JA 3GJEA 4CDHA 1RJYB 3ARXA 1FLRH 3T3MF 3PWLA 2R2EB 1TETL 5C0GA 1FNGA 3SKJH 1U8OA 4LSUH 1JMXA 3STZA 1LO3H 3MV9E 3WS6C 1AIFA 2P8PB 4LRIC 3P30L 2E9BA 1OP5H 3C6LD 3HZKB 4I0PD 1MI5B 5E4IA 5FO9B 4LLYA 2QSCH 2IBBA 1LHZA 2BSRA 2W92A 4U7SA 2AVGA 2Z31D 1MY5A 3EYQC 1JGUL 2XPGB 4JO3H 4XPAL 1U8QB 2HN7B 5DMIH 1LO5B 4LSVH 3WN5A 35C8L 2YK1L 3HG1D 3EOAA 1JZ8A 5CIPB 1EPFA 3TCLA 3MJ7B 3ULVH 5FV1L 1XMWA 5D2LF 5KN5A 5J9PB 4OFVA 4HK0A 3O2WL 2LTQB 1IRAY 1FYHB 4RMVA 4U6YA 4DCQB 1CLOH 3DPBA 3ESVF 5FUOH 3SDAB 5DJZB 5DT1H 1DQMH 2VL4A 4S1SH 5DK2A 2HTLC 3RDTA 1XGQB 5GS0L 1MIEL 3SE4A 4XVSL 3QEUA 4XPFL 5F3BB 2Z92B 4NKIL 4OF5A 2HFTA 5E9DD 5GSVB 2EIEA 4HXBH 5EBLA 2OP4L 4L4TE 2MQ0A 4XCCL 4PRHB 5AUMB 2A6IB 3QEHB 1QFWH 1OTTD 4EI5D 2JK5A 1NCNA 15C8H 3NGBB 2W0PA 4HC1A 2X4TA 4WI5A 2OQJA 2DLEA 5EFIB 1C7TA 3C5ZB 4EN3D 3OR6A 4O9HH 1D6VH 1UFUA 3OJ2C 2XZCL 4OIAA 5C0DA 1HWHB 3ZYIA 2WUBL 5E4EC 1ZVHA 4X83A 4N0FA 4H1LB 4GRWB 4WWKD 4F33B 4UT9L 1GPOH 3FN9A 3VXUA 3JV6B 4Y8AA 4XHJD 3MRMA 1E27B 2RAMA 3CK0H 3HA0A 1B0GA 2QSTA 1R3JB 5DYOB 4QRRE 3ZL4L 1KB5H 1P4IL 4EI5A 3HE7D 4FQXB 4YAQA 2BDNL 1D9KA 1YEHH 1T3FA 5ILTL 3V7MA 2AJXH 4M6MH 1S7XA 3BPOB 3CVHL 5D7IE 4U6TA 5FF6B 1EGJH 5MHSD 3FO0L 1U3JA 2OJZL 2XTJE 2V2WA 1NBVH 4GBXA 5FOBB 2BMKB 4WW1A 1Y6MR 5DDHB 3TA3B 4TQEL 1I7TA 3KWWB 4PGBA 4V2BA 3FB8B 5F1OB 1C5BL 3MREB 3MV8A 3RUGB 5KAQG 5CEZH 1SY6H 3JUZA 5F44A 4HWNA 1UA6L 5AWNH 4LEXH 5DMKA 4F2MB 1FAIH 3BPLC 1WCBA 4TSAH 3ZDYE 4NNXB 4N0RA 3UPCA 4P4KC 3FHQA 4ZUTA 5DDHA 4J1UA 4JJ5A 1FFQA 1JWUB 4D9LH 5C0IB 1OWWA 5GZOD 5L6YH 3LSOA 5CMAA 1QOKA 3BD5A 3QDGA 3WCYA 5EO0B 5F7EL 3O4LE 2EDDA 2Q86B 3KXFA 4IIQB 5H8DA 1OVZA 1NAMA 4ZSOE 3QI9B 4JREC 4H88L 1UYWL 4DN3H 2H32B 4E5XB 3HUJF 1FFOB 4MMXC 5IMLB 2GAZA 4HKJA 3F7YB 4OCMC 2HVJB 4JFED 5KSAC 1NBZA 4AT6B 2O5YL 1QSEE 1MJJB 2HH0L 1NCTA 2IBZY 5IUSA 2ZSWB 1S7VA 1O0VA 2NY1B 2IQAA 2VR9A 1FZKA 1L9MA 2DWEA 2XT1B 4W81A 1IC5L 1TZIA 4RQQB 1F45A 4M62L 1L7TL 5C0BA 4U3XA 5EZJA 1G7JB 3PE9A 5KSUA 2A38A 4PGDA 1N6QL 5JO5B 3VGBA 5HJ3B 1NBZB 5KANG 4AT6A 1KJMA 4QXUH 3P3YA 2AK1L 5HHOD 4BK5A 1RU9H 1TTFA 3EYSL 5EIIA 4FQCH 1CICC 4F7PB 4ZPTA 3AFLA 5D1ZC 4HWEH 2OXHA 5I1DB 5LXGL 5L2KB 1I3RA 2F54B 2DWDA 1DLFL 2ARJA 2XWBB 3ARBB 4QYOB 5FKAA 2IBZX 5B38A 4CNIB 5I16B 1WZLA 1LP9A 3QQNA 4Z95L 4XZUB 5JDSA 1CQKA 2X4NA 3VXOB 1YJDC 1I1CA 3AM8C 4LKCB 5F1IA 3T04D 5L2JB 3CVIH 3U46B 3ARGD 1ZEAL 4JFDB 1IC4L 1HE7A 5GRXG 3WXWH 3NPSC 5E99H 4NZUH 1NC4D 1E28B 3UJIL 5I1LB 1H8SA 1A7OH 3L6FB 5F88A 3AAZA 1Q72L 3R0MA 2DQGL 2VN7A 1CFVH 1F13A 1RY7B 4PLKD 1VFBA 3ARRA 3FOLB 1V7NL 3KPLB 5J6GA 4AEIH 5C0GB 3HAEH 1QRND 1ZA6B 2W9EH 4AH2A 3BQUC 4ORGA 2DTSA 4JQXC 1KTDA 4QRPE 3TBTA 1KELL 5GGUB 5BZWA 2I07A 4HIEB 4PJCE 3WHXA 4M1GL 4QOKA 1KT2B 3BIKA 4PP2B 4XP4H 4PJ7F 4I5BB 4MA7H 3ZZ1A 2EDWA 1V3JA 2IPUG 4K3HA 5C6PB 1PG7W 4YHML 1U93A 4W6XB 4RGOL 2YD4A 2BVTA 5E4EB 5T1KA 3B9AA 3RNQB 3VFWB 3L3OA 5IOPB 3MCLL 3PWNB 5ID1B 4G7YL 2FLRT 4Y16C 2D03L 5EO1B 5J3HC 4YPJA 1OTSD 3MNVA 2H3NB 4F9PC 3FQXB 4WUKL 5MEOA 3S4SA 2WP3O 4H5SA 3BE1H 5LBSH 3ECBA 1JPSH 3MFGB 1QO3B 3MZGB 3NCYS 3Q6FA 2NR6D 1AJ7L 4AENB 2MWCA 3HKFA 4LIQH 3MOBH 4V2CB 3SGKC 4KI5C 2Y5TA 3C60B 4R0LB 4DW2H 1E6JL 2JIXA 1FL3B 4H1LG 4WFEE 3MBXH 1P1ZA 1ITCA 5AUMA 2E7CA 3O81A 3PJSA 1YPZB 1VEOA 1CD1B 3VWJD 3E2HB 4IS6A 5BS0B 1BVZA 3ARDB 3MGTA 3DXAA 3VD4A 5BVPL 1MIMH 2BC4B 4XPTH 3ZE1F 1Q0XL 2GSIB 3BHBA 3HZVA 1KCLA 1ZT4A 3LS4L 5DUBA 4XC3L 1MI5D 4FXKA 3WFEH 3HCVA 4NJAH 2F53E 4NHCH 1CDIA 5CCKH 4URTB 2I5YH 3NAAH 1GHFH 1FGNL 5I1JL 3ABZA 2XNAB 3MLPA 1UM6H 4APQD 4PLKC 4XMKL 2BDNH 2XQBH 2DQCH 2Z8WC 2FATL 1ZLWH 5T1LB 3EOBB 5DSCB 4M43H 1T7VA 4Z7VB 4M00A 4P9HH 1TCRB 4K8RD 3GIZL 4XCEA 4NRXB 5ERWA 4HFWA 1XGQA 1M05A 3V0VA 3PGCA 5D7SH 1GOHA 3RPKA 5ALBL 3LN5B 2XRAL 3ORJA 2ERJC 1KGCE 3ARGA 1JN6B 2O93L 3FT4A 5BS0E 2A6IA 3QEHA 4DVBA 4HPYH 5AYUL 4YXLL 3JUYA 3TPUB 1XF4B 5FGCB 3K74B 1BX2A 3QRGL 2VE6A 1F90H 3IU4L 4HGWB 1OW0C 1E6JH 3N06B 3PQYE 1IAIM 1MCCA 4ZQKA 3QDJE 1QSFB 1MPAL 4G9DB 5HHOA 3JV4B 4NRYB 4OZFA 5E00A 4HUNB 1J1PH 2FZ3B 3ALPA 4NPYA 4Z7OE 3VD9A 1SHMA 1NC2A 2VABB 4LVEA 4WO4A 1HQ4A 5F96L 4BZYA 1RK1B 4F7CA 1EBAA 5ISZB 2E6QA 1RURL 2NZIA 3RKDD 4HKXA 5ANMB 4JG1L 1KTLA 1WFOA 4LQFH 3KYOA 3QJFA 4FQIH 4RGOH 5DUPL 4HK0B 4Y89A 1KFAH 4X9IA 3STBA 4K9EH 2APXA 5DFWH 4PS4H 3MRKB 2IH1B 3SHSA 2HFGH 1H9VA 1SVCP 5D5ME 2PW1B 5SWSB 5EBWA 4XI5D 4XP1H 2WQ8A 5CEZD 3PGFL 3REVB 4UDUA 5E8EA 4TOYH 1RZIA 1MFAH 2HLAA 1LO4H 4N8VA 5F1KC 1OP3K 3U2SB 3QSKB 5F9AC 2BFVH 1MQKL 3FCTB 3MODH 3LQZB 2JK5B 3UZQA 2ICCA 5MERA 4DKEL 2P48B 1J0IA 1JNLL 5IESH 4YHLH 3FFCA 3V6ZB 4ZUTB 4G42A 3KPTA 1AY1L 1J18A 4HX1A 4FZ8L 5EZLA 3CVHA 4HT1L 2GK0B 1FH5H 3CX5J 3MXWL 1YEHL 3OXSB 3FB7B 5IFHL 2V2TB 1YC8A 4L4JA 1IEAB 1JV5B 3C8HA 3GSXB 1FCGA 4LF3B 3STLA 3CXHJ 3JTSA 4PJ9C 1JGVL 4R7NB 2HT4C 5FB8A 4MHHI 1X6NA 3L6FA 3BD3A 1KB5A 3I6KA 4AG4H 3ME0A 4M61A 5JMRA 3IU3A 4NKMA 4PJGA 3FT3B 1UACL 4KAQL 3HG1E 3T65B 2VXSH 4O2FA 1A9EB 2WUBH 1JRHL 4HCRA 1U8IA 4BZ1H 2ITDA 3LEYL 3ARED 4P2QE 2PYFA 5IJKC 5TE6H 3I50L 5T5FH 5KSUB 3PG2A 4JAMB 4HV8B 1TLKA 4Z7UF 1PY4A 5JW3L 5CWSB 1U93B 4RMRA 1QSED 2AV7A 3NH7H 3O6FC 1AGFB 3FONB 4EIGB 2WWKT 1G0DA 5I17A 4O2FB 3OB0K 1MQKH 3LQMA 4XNXL 3FOMA 2VR5A 4ELMF 4NQSB 2FGWL 3DURB 4NHCL 3HI5H 2X9XA 4O4YL 4DZ8A 2I27N 5INDA 4X99B 1NEZA 4WEUD 2FL5B 1HZHH 5B8CB 3UTPE 5E6ZA 1IAOB 4XCNA 2IMNA 2RJMA 2A6JB 4Y4FA 4NKDB 2DIBA 5L0QC 4P2YA 1D5MA 1TENA 4O58L 3UTPD 4HKZA 4H20H 4ZUUB 4NQXA 1E28A 5HI5D 4IRSD 1JWSB 2WAHA 4P48A 4LEXL 1QBML 1QZ1A 5HHMB 1ADQL 1IM3B 4Y1AB 4RISL 3KNBB 2V17L 1DVFD 3ARWA 5IW6A 3OAYH 3MROB 1DANT 5J0BA 1NFIA 4I13B 1A7BA 5I75C 2OSLA 1JNNL 2CSPA 3BVNB 1VPOH 3LDBB 3EO1B 3KG5A 3P73B 3RU8H 5HDQL 4GG6E 5MEPA 1LDPH 4O2CB 3KYNB 3L3KA 3DRQA 3B9KB 4NWUH 1BFVL 4AMKH 3EGSA 3UYRH 2LVEA 2YKLL 3ZTNL 1OPGH 4I18B 2IPKB 5D1XA 4H26B 3N50A 4V1DD 2NX5E 2XN9D 4UIMB 3RL1A 1AGBA 2DJSA 3SOBH 4NBXB 2FDBP 1EHLL 3ZE1E 3C8DA 3KR3L 5D70L 2NYYC 2I25N 2Y06L 1JHLL 1PW3A 4L9LA 1NBQA 4QO1A 3AGVA 5JW4M 2R4SH 4XPGH 5BRZD 5L2KA 4GS7B 1KYOJ 5KVDH 4OKVA 1AXIB 4OLZH 3TV3L 1RZ7L 5JXED 1V05A 4JFDE 5E03A 1DLHA 1LEGA 3VDBA 3IJHB 3PDDA 3VWKD 2JLLA 2W9EL 3MLYL 3UTTA 3V0AC 4Y1AE 4OIBA 1BF8A 1GGBL 1M7DB 2KZ1B 4WWKC 4OQTL 4QRRB 4LCIH 1NDMA 1U95A 2QKIA 2VO5A 4K2UH 2V6HA 5CIPH 2ZUWA 4BKLB 2RBLA 2OP4H 2GIYA 2CLVA 4ODXB 3HG1A 4CADA 5DEZA 1U58B 3S35X 2P45B 4Z95H 5TE6L 3TBTB 4BJLA 4L4VA 5GRJL 4XBGA 5DRNA 3DARA 2P24B 3V6BR 4QRRA 2XXCB 2YMXH 1S8DB 5J6HA 4WENB 4UI2A 1U8JA 3RIFK 1NUFA 3RZWA 1N2RA 1FL6B 1T7ZA 4RGMB 4KJQD 5HYQB 1YJDH 4X6CA 1ZLSH 1ACYL 1KCVL 4X4YB 4W6WB 4JFPA 5DF0A 2OR7A 3KPNA 4HJ0D 5F6IC 2DICA 4PV8A 2AJYH 4P46B 3DO3A 5IVZA 1DUYA 1BAFH 3O3BB 4I3RL 3NZ8A 5I1JH 3DMMD 3OKKA 3QWOA 3G6JA 5IMLA 3PUCA 1IGMH 1U3HA 1N0XH 5C0CB 1CD8A 2L0DA 5EOQH 3U83A 3E6FA 4IRZL 4JVPA 2OL3L 4M7LL 4MNHB 4OLYH 1FN4B 4PJ5B 4KK6D 3GKWL 4XNZC 4ZFOB 2GFBA 4PJFB 4UDUB 5KOVC 3VGDA 5DJ8B 1HEZA 5FYJH 1S7RA 1CGVA 3BPNC 1CXEA 1Z0NA 2V17H 4N9GA 2D7OA 4LLQA 3F58H 1CGXA 4UINL 1KXQE 3NABL 1JI2A 4JY4B 4J6RH 1YEJL 5J13B 3F7PC 3HI6L 2CKBL 5KJRL 4HBQA 4Y4KC 1MJ7H 5ESAB 4EOWH 3SGDI 3GSQA 1A7NH 4HUVA 3HMXA 3VFNB 3RZCA 4XP9L 4PJBB 4OB5H 4RZCA 3HCVB 2X7LB 2PO6D 3DV6A 1DBKL 1B6UA 1JFQL 2MCPL 1YMMA 2AEIT 3HE6C 2OL3B 2QADD 1FE8H 3ISWA 4UT6L 5IW3A 1KEML 3EHBD 1H5BC 3HB3C 3H3KA 4M3JA 5IBTL 3GUTB 2BY2A 5E2UL 3QQ9C 3UPAA 4P9MH 2V7HA 3BKML 2YBRA 5JR1L 3KJ6H 2BVUA 1JYNA 3CVIL 5EZOL 2V5MA 5ACLA 2KBGA 1XGTA 4K8RL 2X4OA 2BOBA 4OLYL 4WVRA 5LGJB 4J3VA 3PV7A 2C3GA 1MAML 2ESVB 3JWDL 1KCUL 3TO2B 1IMHC 3QIWC 4GW1A 4XWGL 2HVKB 5HDQH 1EIBA 1FBIL 3IFNH 3BO8B 2YBRB 1MCPH 4JN2B 5CSBA 4RWHA 3QUYA 1F3DJ 1HNGA 4JVWA 9CGTA 1S7VB 3CMGA 3V6FA 3BD4A 4PRPB 4PRDA 4Z7UE 2VQTA 5L7XH 1JP5A 5GRJH 4D9QE 1CG9B 2VXTL 3LD8C 1YN6B 2NLJB 2VMFA 3MBEC 1T20B 3MR9B 3RGVD 2I9TA 5GRZA 3ZHDA 4U3HA 5SX5K 3TA3C 3CXDL 3QUZA 2IPTH 3MXVL 1INEH 1LGVA 2QLVB 1JZ7A 1CDCA 1MNUH 2KPNA 4HKXB 4HGMA 4OV5B 2DLGA 1S9XB 3MODL 3MRFA 1FG2B 4MD4A 3THMH 1KEMH 2OR9H 2YZ1A 3SJVE 2AJUH 4D94A 2B8OT 4OLVH 5CJQH 3MLYH 4BH8A 2VDML 1FZMA 1PY9A 4N0FB 4S1SL 3QUYD 2APWA 2P1YA 4LVHC 1PVHA 1YPZA 4KUZL 5EU4A 3QXDB 3VFTB 1U0QA 4LCWA 4B7LA 5HHVH 1RVFH 3DBXB 4NIKB 2GJZB 2Z35B 3OGCA 4IJ3C 5FO8A 4LHQB 5L8KB 3RVTC 1WIOA 3MOAL 4QGYA 3IDYC 4Y5YA 2IEPA 4UOJA 4LHUD 4CU7A 2R9HD 1D5XB 3QUKB 4KMQA 4NQSA 1MCJA 4R4FH 5C71A 4XNUL 1EHXA 1G9NL 1U92B 2ZOLB 3DHJA 1QFWI 1J5OH 1MFBL 2VISA 4GW4A 4D0BB 5L9DH 4TQEH 4NO0A 3QG7L 2F53B 1BEYH 3FB8A 3D48R 4AQOA 1P2CB 4HWBA 3UZVB 4XPHL 4OLWL 3EOBA 3A0OA 1F2XK 3ZTNH 2V2XB 2Y5EA 2GTWB 2QTEA 1JNNH 3F7QA 2C7UA 3RAJH 3ZE0F 2D03H 3INUH 3T3PF 5F9WC 5TQ2H 1EUUA 1EFXB 4YE4H 2LVCA 3O8XC 3U4BH 4YDLC 4M61B 2QQLH 2W38A 4W4OC 1A7QH 2LTQC 1OY3B 3PP3H 1G7IB 2VDLH 1I8KB 4IOFD 4EQ2A 2JB5H 3G04A 2F74A 4UU9A 5C2BL 3PL6C 1QBMH 1RHFA 4UV7L 3BGFB 4UTAL 3OG6B 1NCWL 4WFFD 3SKMA 2ADJB 4WI3A 3HE7A 3EDFA 2WQRA 3HI5L 3R8QA 3HC4H 4Y16D 2D4DA 5AEAA 4GG8A 4JDVA 4LBEB 4XCYA 2F58L 4QHNB 3FO0H 4G9DA 1Z5LB 2K7PA 4GRLD 2AV7B 4JFEE 5DEGB 3B5TA 3QQ3B 4KTEH 2A83A 3QEQA 1PX4A 4Y8DC 1MCDA 1UM6L 4JZJA 3RVVD 1J1XH 4NOBA 1RUMH 2X4QA 3FQWA 3OR7B 2ZCHL 4L8DA 4MJIA 5EUOB 5IP4A 3PWPA 1DJSA 4UNTA 4XNMA 1U36A 5IB5B 1TJHH 1RURH 4EKXA 4Q6IB 3O3BA 4ZO9A 1X5KA 2B4CH 4EI6A 3NOIA 3GKZA 4M7LH 1EVTC 2NW3A 4XNQB 5CINH 3C5JA 3GMPA 4QT5B 1NAML 5IVXB 1MCNA 4UB0H 1MCRA 3P9LA 4XPBL 5I1CH 5DJDB 4N1CA 1Q9WB 4D0CA 2AERT 1CD9B 5D2LB 3F7VB 1ZVSB 4EUPH 2DM7A 2YWZA 3OKEA 2I9LA 4K55A 5JUEL 4LLQB 4JHZA 3SOBL 4LDLB 1MFCH 2NW2A 1CF8H 1GIGH 2HJFB 1KCSH 3HZYB 1WWWX 2ATKB 1VGKA 2MMXA 1W0VA 3C5SA 4R8WH 2NTFA 3ARGB 4R2GC 1VADA 2GCYA 4UTAH 2P47B 1ZS8A 3HC3L 2Y23A 1ZGLM 1OTUD 5CUSL 1OP3H 5MHSE 1GRWA 4HT1H 1EHAA 1DVFA 1WBYA 3UYOD 3HPLB 1WITA 4QRRD 3TO4B 2AABH 2RB8A 5GGSB 3C87A 2Q1EA 1J1XL 1I1YB 1AR2A 3DIFB 1QLEH 1JPST 5SWSE 1FZJB 2M8XA 3DGCR 1S7UB 1GOFA 4NO3B 4P9ML 5SWSA 4O2EA 4M02A 4HIIA 5BV7C 1OT1A 1HSBB 4EUPB 1D5IL 1FO0H 3WLBA 1JTTA 1RI8A 4D9LL 2V9RA 4K9EL 1OAYL 1WBYB 2IFGA 2MPAL 3B2VL 3FO1B 4XC3H 1SEBA 3R1GL 4ZOAA 2EXWD 1NCAH 3C6LC 3EOTL 3IXTA 2OZ4L 1ED3B 1J8KA 1LILA 1V7NH 5E08H 3SDDC 1Q72H 3X14A 1NCBH 1YEDA 2EO1A 3GK8L 4RX4A 1R3LB 3ROLB 2CLVB 2VAJA 4LSDA 1CD0A 5CWSA 2BVYA 4BZ2L 4PRDB 1C16A 4KMTH 1G9ML 4OCWL 3X11A 3NIDF 1QR1B 1TZGL 2NY6C 3UYRL 3IKKA 3AB0B 2J88L 4LLWA 3L7EA 1R5WA 3E3QE 1FV1A 1ERNA 4KVCH 1JWMB 2XKNA 3WUZA 4XBPA 4HWEL 5DA0B 3I3BA 5FGSA 4Y19E 3L3HA 4Z7WF 2J2ZA 4XWOC 3DXAB 2W9DH 1C7SA 4P5KB 4BFGA 3ARFB 5IMKB 1BLNB 4HEPG 3IRPX 5IROC 2VLJA 1KJ3L 1DUYB 5CZKA 3EDDA 4KK8C 5AYUH 4NBZB 3EYVB 3ZKXB 5JW5A 3LKRA 3OGOE 5ABDE 5EU5B 5DWUH 4U1NA 4JQXA 4O9HL 1XT5A 2AXGA 4QGTA 5GSRA 3GB7B 1NFDB 3QDAA 1KULA 5C2UB 1PQZB 3NCCB 1S7QB 1J11A 1WCQA 2B20A 2FJFA 4MNGE 3L3KB 4NKMB 5HYJB 2G60H 1X4XA 2W0FA 3F12A 1J9CT 3MREA 4XVJH 5DRXB 4C56E 3ARQA 5BVJA 4JFHD 2KDGA 4ZAKA 3LQAC 3KLDA 5IHZA 3D69B 5I71C 4NQDE 1Q9LB 3JZ7A 5HGHB 3M1BA 2FBOJ 3EO9L 1X5HA 5C09E 4FOMA 2L7UA 4KVNL 1WAAF 4CAGA 4OI7A 3SY0A 4PJBA 2JELL 3K8LA 4KROC 3S37L 3HNVL 3ZYOA 4C55A 1AO7B 2V2XA 4FN0A 4M1DH 3D0VB 2D3VA 4FZEL 3QEQE 2EEBA 3OMZA 1LE5B 4L29A 3TZVD 2P4AB 3GBML 2VDRL 2YHGA 4KHTL 4XPTL 1KEGH 4CJ0A 1Q1JH 4NC1C 1ZVYA 3IJHA 1C5BH 2YC1B 4UAOC 4IJ3B 2MTPA 3UTTB 2L4OA 2OBGA 5I1LA 1F11B 2EYSB 5GRYA 5F88B 1QFPA 1AP2A 1QEWB 1T7WA 2GT9B 3SDCC 3TT3H 4RRPG 2RCSL 1M7IA 1NGWA 4NQCA 5T1DH 2H2PC 2ZKHL 4Q0XL 5CIPA 3TBWA 5HYJE 4NKOA 2AKRB 5FYKL 5C0BB 5MI0B 2BXZA 4IOIA 3PWPD 1VHPA 3FAWA 3DSFL 4LIQL 4ZSOB 5GGSY 3KNBA 5EO9A 1AY1H 3IT8D 2HVKA 4K3DH 4JFZH 4HIJA 3BZFA 4GO6B 3LH2L 4QHNA 1IC7H 3QG7H 5GJTH 4TUOA 7FABH 2NX5A 4W6YB 4KV5E 5TDNA 3MCKA 4NGHH 2B39A 3DO7A 4PRPA 3S88H 1FL6A 4MA7L 3GGWA 4L3EE 2BNRA 4XNMB 4YK4B 3C9NA 3D85A 4QY8B 3AS3A 2ZSVA 3K8MA 2GTZB 5EO1A 5DQDH 2D9CA 4ERSL 5F7YC 1LEKA 5IB2B 2DRUA 1FYTA 2CUMA 4OBRA 1Z0MA 1OOAA 4MQXC 5JHDE 4CMMB 3CFBB 3S37H 1KN4H 5HHQB 4KUZH 1OGTA 3RGVC 2AJYL 5C0AD 4ODXA 43C9A 2DKSA 3FFCB 3V6ZA 4G8GD 3H9SB 3V0WL 3WNOA 4RFEB 5I66B 4G8IB 4PFEA 1MY7A 5DD5H 3T0DA 1I3GL 4YBHA 2BVPA 5DD1L 1B0RA 3NACH 1ZA6A 4F9PA 4ELKA 2MHAB 3RWFB 1K2DB 1A6TA 1NMBH 1HQRB 3RJQB 3VWJA 1OTTC 3K1DA 5IFJA 1J0YA 2OJEB 4ZS6C 1E4WH 4OM0H 3L3GA 2ZUSA 3RY6C 3VGEA 3CXHK 4X4YA 5EUOF 4U6VH 1UWGH 4WI8A 2N56A 5ISZE 3MLTB 4MCZB 4IMLA 5CJXA 1J0ZA 2DBJA 4JO1L 1MJUL 2VQUA 4MJIB 5D6CB 4R6UA 4PR5A 5SV3A 1I9RL 1KCVH 3BDYH 4TTDC 3A6BL 4DTGL 2IANB 5CZXD 3QQ9D 4N8CH 3T09A 1I7TB 1NANH 4LQ1A 1NBYA 1QO3A 2YPVL 3GMPB 5DSCA 1RUAL 3PHOA 3O6ML 2Z8SA 3KHQA 5BW7A 2VJXA 5CBEA 5D4QA 3TC9A 1U2CA 1CE1L 2P5WD 4WRLA 4P9HL 2KQNA 1KACB 1MCOL 2BSRB 2HMID 1RZKC 1LO0L 1MCBA 3ES6A 3O6LH 1BM3H 3DI2B 4RA3A 1CGSL 3ULVF 4XTRD 1CFQA 5HYFA 3TNMA 4FABH 2FJGB 1OPGL 1WIUA 1A2YA 4P99A 5E9DE 3X13A 5ITBL 1BVLA 4ZUUA 3WL9B 5L6YL 5BW7C 3DX6A 4KI5D 1N5YL 2ESVE 3UJJL 3GI8H 3E8UH 4CVZB 2F5BL 5CJOL 5D7JB 2GFBB 4PJFA 3UJTL 5A2KH 2X4RA 1FFOA 2DLHA 1R3IH 4NQVB 4J3SA 3KDMB 3EYUH 1RQ5A 2ILLA 1T22B 1YEFL 3MJ8A 1U91B 2A77L 1ZHBB 12E8L 1BBDL 2VKWA 3SN6N 4L5FH 1HQ4B 1MHCB 3ULUH 2YRZA 1W72B 2VQ1B 2HMIC 3MOAH 4P23C 3TYGH 3KR3H 3NCYP 3O6FA 4LDEB 1BBJB 1HHGB 5DJXA 1CL7I 4JGMA 2AJSH 4N8VG 4YXKL 5DURB 1BHGA 3KYOB 1TQCB 1U3YA 4NQVA 5D8JL 4PREB 3MUJA 4PYHA 1SEBB 3HRPA 2D7PA 2XKSA 4JN2A 5JDJA 1VEPA 1OGAB 2QR0B 1MRDL 3UO1L 2XACC 1HOCA 4O4YH 1S78C 1IBGH 4HLZH 3WFDL 4OUOA 4HMDA 1OAUH 2GUOB 5I1DA 2XKUA 4P23A 1RU9L 2H32H 1GZQB 5GS2H 3RGVB 1CVRA 4UBDD 4NUGH 3ROLA 3RKPA 2AGJL 4XBEL 3BI9X 4LSUL 5FGCE 4UUJB 2VOTA 1CGSH 5DZNA 4YHIB 1CS6A 1A7RH 4V1DA 2FEDC 2W0KA 4YX2H 5LCVL 1CLYL 4KJQC 3TZVA 1NANI 1I1RA 3P4MB 3QIBD 3SO3B 4HQQH 4JFEA 1E4XL 5I1CL 3SDYH 3LV3A 1I9EA 2WSKA 3QIUB 1KCRH 5HPMA 1UM5H 1D6EA 4U1IA 2WANA 4L4TB 2R1XB 1WBZA 5K93A 5M7QA 5ESQA 1YMHB 1JRHI 1G7MB 2NTSP 5F9WB 3TEUA 3W9EB 4MDIB 4R4BB 2JKXA 1BGXH 5HYIA 2MKLC 3WJLC 8FABA 4LCCA 5HYSB 5C0DB 1U8OB 3STZB 5GS1A 3UBXG 2CGRH 5FAAA 2Z8VC 5ENWB 4P2OC 5F7EH 4M9PA 2YD8A 4YHZH 2V7NB 1WT5C 2QADB 3NZHL 3B8SA 3SEPA 1MCHA 3LDBC 3SQBA 4NKIH 3FQTB 3MRPB 1U8NA 3WFEL 3C6SA 4Z0XB 4L8CB 4Z78A 1UEYA 2AXHA 3QAZB 4PRHD 5A1AA 3SKMB 1M71A 1OB1A 4UQ3A 5FDYA 1FNEB 1I7RB 3HLAA 1AQKH 4HWBL 3L3IB 4OD1L 4C54A 4HC1H 1JFQH 2MCPH 5F9JA 1P69B 3RWGA 2QADC 3VWKA 2EH7H 4L9LC 5DEGA 2ORBH 2O26U 4WV1B 5HY9A 1OAZL 3S36H 2EC9U 1ETZA 3PABA 2HFGL 3MJ6A 1BFTA 4YR6A 3GMQA 3P30H 4PS4L 4QF1A 1LO3L 5T1LD 3GSXA 3STLB 1UWXH 2SEBA 3DVIA 2KZWA 1QSVA 3ZE0E 3NMEA 3QDME 4JPIB 1JYVA 2ED8A 5EZIL 1HWGB 2LU4A 2QSCL 1NJ9B 3CK0L 1Y0LA 2WBJC 5C08D 3MV9B 4DFHA 3ALWA 4Y5VC 4Y4FC 4WW2C 4G7YH 1TVHB 1KIUA 3O45A 3BDBA 1FNSL 3SCMA 1HCFX 5TH2B 5IVXE 4P57B 4DGYH 3ZKXC 5GHWH 4NDMA 5ALCL 3KYAA 1MPAH 1X5JA 4GQ9L 2MKWA 4ZAKD 4GT7A 1BQUA 4FRWA 2WLZA 1E6OH 3FRUA 2VL5A 1KIQB 1CF8L 5IM7A 1K4DA 4CU8A 2YD5A 3B43A 3T3PE 3U7WL 3D87B 1MOEA 5DMYA 2XG5A 5BO1H 2CIIA 5CD5D 5HPOA 2HRLA 3C09C 4Y4HA 3MCKB 3QQ4A 2ATPB 1MHPH 4I18A 3OV6A 3T0WA 3H7BA 4OQTA 4AEFA 4UINH 5TDOA 5DLML 4PJHF 4JO1H 2XA8H 2J6EA 3DYPA 1X6LA 3WIHL 3AB0C 4OD1H 4XNQA 1TQCC 1CT8B 1JTOA 3IDXH 2LFGA 2ZUUA 4QRQB 5ALBH 5FYJL 3MACH 3QDHA 1MIEH 3QCUL 5GGTH 5GGRA 5I19L 5FO7B 1LMKA 5D7SL 2MCG1 4G9FE 3H3PL 4ENED 2H26A 4R90H 1MJ8H 5GS0D 1EO7A 3KLSA 5JA8B 4X0KB 3QO0A 1RUML 4EN3C 4X80H 3B6SB 1BP3B 2HJFA 3HZYA 4G8IA 4OZ4B 1T5XA 2COQA 3VFUA 5CZVH 5IB5A 4MJ4A 4PJXB 3CD4A 3TFKC 3NFPA 2HLFC 3ZDXF 2UZIH 4GBXD 4PG9A 4QHUA 3VFSB 1T2QH 4HKBA 1XGPB 2DQHL 4NM4L 3W11D 4HUXA 1X5YA 1CI5A 2P8MA 3IAQA 4XZUA 1LDSA 2R56H 2DBLH 1FC1A 3TIEB 4ZFOL 3ZKMD 4Y4FD 4G43A 3O6KL 2JF1A 3UAJD 3VXNB 3LQAH 4LCWE 2HFEA 1R3LA 3HRZB 3SKUD 1UZ8A 4NN6B 1H8NA 3L3OB 5IOPA 2C26A 2HFFA 4CBPA 2FX8H 5I8EB 4KZDL 4ERSH 5DJYB 3TO4C 3VRJA 3RHWK 4C59B 2A9ML 1NGYA 1XGRA 2DI7A 4N90E 1FLRL 4MNQE 5B3NA 1CGTA 4G43B 4PJCF 1UB6A 5FHAH 4HIEA 5A3IC 5C08A 4EQ3A 1LO5A 2XQBL 3BKYH 3SPVB 4XMKH 2GJ6E 3HR5A 1FJ1A 4PJEA 4YE4L 3MPCA 5TE4L 3RFZC 4GAGH 2ZSWA 1R5VA 5I8EA 3SQOL 1A4JA 4RGNC 1VGEL 2HT2D 1A6UL 3EFFA 4PJ9D 1ED3A 5IB1A 3AS0A 3SDXA 3MA7A 1YNTB 3BYTA 4RAVA 3W81A 3QCTL 4Z77B 4F9LA 4ZDHA 2GSGB 3F5WB 3K81A 5C3TA 4X9GA 1BZ9A 3QDJA 3LKNA 1YNLH 4KRLB 4B0MM 4HS6B 4Y4HC 5MEQA 1UXSA 1AO7D 3O0RL 4XGZA 5D1QC 1ZT4B 3NA9H 1FVEB 4K71B 1Q1JL 3W82A 3MBXL 1NCBL 1QUNA 3L7EB 1T7XA 4PJAF 4PRHA 3IDMB 3MRJA 5CEYB 4X6CE 2EE3A 5DMKB 5B38B 4HFUL 4Z7NE 4K23H 2X70B 5GISL 3ZT7A 2XWJA 4MNGB 4QHMB 2R9HC 1U8JB 4KVNH 3LKQB 1J1PL 4F7MB 4RA0C 4HS6A 2FHCA 1X5ZA 4Y5XA 2ED9A 4HAFA 4WWKB 3MRQA 1N5YH 5C9KA 4KTDL 2ICWB 4NRXA 4NQDB 5ERWB 5D93B 1F3RB 2VUYA 5IWLC 2JIXD 5I76B 1DUZA 4NZJA 4OCYH 2VKXA 5T3ZH 5BOZG 5I1GH 3QFJD 4FFYH 5IW1A 4LLWB 1T1YB 5L8JB 4YK4C 4HKJB 2K1MA 4WEBH 1I85C 4WW2B 5T33H 4UBDC 1LD9B 4NQED 4R9HA 5EA0L 2PXYD 3RZCC 1Q9OB 4FQXA 4YAQB 3QQ3A 2R4RL 4JHWL 1EBPA 3H6JA 5IK3A 5I1AA 1ZHNA 1I1AB 1KPVA 3ARFA 4KWUA 2MOVA 3OAYK 1YDPB 4PRIA 5C09B 4LVNC 4HHAB 5JHLL 4YFEA 1UQSB 4HUKB 2P5WB 5L2KE 4HZLB 3MYJB 4L8SB 1ZT1A 2H3NA 5TFSL 5KVFH 3VRLF 3OJDA 4X9FA 4BFIA 5ADOL 1K3IA 1QFWL 2BRQA 1OAUL 1V3KA 3WXWL 4WV1C 3HFML 1QA9B 2RHEA 1A22B 1UT9A 1DBBH 2DQFB 4KVCL 4UMGA 1OF2B 3PGDB 3C5ZA 1MCKA 5ANMA 2ZPKL 3AU1A 3G6JE 1G84A 3OTTA 4QRSA 3SDCA 2ESVD 1BX2B 1Z3GH 1KV3A 2Y5TB 4ODWA 2NW2B 4WHTA 4NUJA 5A2IH 1F11A 2AQ3A 3T2NL 3TT1L 5DUMH 4JPVH 2ZCLL 3P73A 1Q9LA 3P40A 1R3HA 3RIFF 4U7KA 1XFPA 5E08L 3DGGA 3FL7A 4YFDB 4NNPH 5HHOB 2BSSB 4XH2B 5JOFB 2X1QA 1IAIL 1C5CH 1QYGL 5C0EA 1IVLA 5JXAH 4W4OA 4ZFFB 4LSPL 1KN2H 3D3VD 4MNQD 1RZKH 3LN9A 4LASL 3KAAA 3U2SA 3WJJA 2QEJA 3LAFA 5DTFA 5C0AA 2ZG1A 4X6EA 3MRPA 3T1WA 4TUOB 1MHHA 1MJJA 3C6SB 5DJ2A 3UTOA 3DIFA 4KK5D 3H9YA 4U1GC 1FZOA 2OMNA 3VFGL 4KXZI 3MRIB 4Z7QF 4N5EC 3O4OB 2DLFL 2GY7B 1GYAA 4GMTL 4NM8L 3BE1L 1NC4B 3TVMA 4WTWA 3DBXA 1J0KA 1BF2A 1HHHA 2ICWI 5E56A 3H9HA 1V3MA 2C1PA 5C0NC 5E6ID 2BNRD 3PWUA 3NIDE 1HK6A 2BFVL 3F65A 1DBAL 4YHPB 4ZO6A 1D5XA 1KIRA 1VSCA 4JFZL 5CUSH 4MVBC 3BJ91 2Y9RT 1K8DA 1MI5E 1G6VK 4LARL 1J0JA 4H25B 2DF3A 3EYOB 4HIHB 5JIHA 3CVHH 1LK2A 4O58H 2FD6H 1INQA 4NSKB 4FG6D 1X44A 3SE3A 4NQCD 3KJ4B 5FKAB 4MD0A 4AY0A 4TPRH 5D2LE 2WIIB 5GGVH 4HIXH 32C2A 2WMPA 5C0CD 3GSOB 1F3JA 3BGMB 3QZWG 1BJ1H 3FZUD 5TGBB 5EU6B 1AQKL 1NDGB 2EDXA 1J0HA 2FHFA 2ZCKH 3L3GB 5J89A 3SE3C 1KLGB 3FFDB 4HJJH 1WGOA 4OF6A 1B90A 2DJ4A 3S98A 4J4PD 3RX8A 5C8JB 1IEAA 2FLBT 3JV4A 3UTSB 1FNHA 2N7BA 3LPGA 1UZ8B 4NC0B 4RDQG 4OI8A 2VL5B 4MA8L 1BIIB 5D6CA 1H3GA 4Z78B 5HHPB 2E8YA 5GRUH 1GGTA 3HE6B 1MF2H 3AROA 1YYLH 1XGRB 3C8KA 4LCIL 3LEVL 1A3LH 3O3AA 1MCQA 1YUHA 3RWIA 4F57L 1AXTH 1D5MB 2CKBB 2CH8A 1GOGA 2VITB 4KXZH 3VWJB 1HH6B 3GMNA 2AK1H 3UX9B 5GS0H 1BIIA 2F58H 2H26B 3A6CH 1VESA 4P5TD 4RAUA 4TSCH 1L7IL 2PUQT 4LU5H 3MUY1 4YEEA 5ALCH 5JTWA 4XCEB 5DVMA 5EBMA 3W2DL 3ZSTA 4ETYA 3L1OL 1IGYA 1T1ZA 3BWAB 5IT2L 3O3EB 5EU6E 2X4OB 3VXQA 4NYLB 4CKVX 1T0NA 2H8PB 3A67H 3DUSB 4RBPK 1FHGA 3K46A 3IJSB 4F37F 3N85L 1ZANH 5GGVL 1FDLH 3ILQC 3M8OL 5FM5O 3BZ4A 3QZWA 1N6UA 4XI5C 5J6GB 3WIFB 1BFVH 4HK3N 4P49A 4Q9QH 4GXUN 5JXEA 1WUNT 2DQTL 1DSFL 4YDJA 5F7DB 4YHYC 2AV1A 4OLWH 1E4KC 5I2IB 1VGKB 4LMQE 3KPRD 1MHCA 3MV7A 4L4VD 1IE5A 5JQHC 4Y4HD 3VXMD 1UJTA 2H8PA 3MYZA 4LLVB 4TUJB 3VGAC 4F3FB 4R7NA 1P84J 5ELIA 5ANME 5K9JL 1OTSC 2CIIB 5BJTA 3HUJA 3QUML 3U82B 2PYED 5CSZA 2ERJB 3QXAB 1R24B 5HGBA 5JR1H 3OQ3B 4GKZA 1IQWH 4MXWH 3WIFA 3SPVA 1N4XL 5MEND 2YEZB 2PW2B 4GMTH 2IJ0C 4FXLA 1CK0L 5F1NB 1F4WL 1DQQB 5F8RC 2IPKA 4FQ2H 3MMEA 4PJFF 5D1XB 5E94A 2G75B 4PJBF 3MV7B 4U1JA 1ROWA 3MRHB 2OXGA 4AM0A 1YNTA 4OT1L 4YUEH 3WS3A 5LQBL 1P5UA 2C3HA 3ECBB 3TLRA 3DTXA 1HH9A 2OR8A 4X6BA 3PIQB 3MRKA 4YHZL 1A6ZB 5E0QA 1GH7A 4M1CD 5I1AB 4LSPH 5HTSA 3JSSA 4QNPE 3TO4D 1A6UH 4QY8A 4ZS7H 1MFEL 4FNLH 1ES0B 3S6CA 4LRIA 4LNRA 4Y19D 1ITBB 2XZQL 3DUUA 2I9TB 3DVGA 3TN0B 1G7LA 3PL6B 3QG6A 1C12A 2XG4A 4RX4D 5KSBF 1GPOL 1A6AB 3O4LD 4L4TA 3ZKMC 5HYQA 3ARDC 4Y4FB 1OF2A 4G8GE 1PEZA 5B4MD 3E2HC 2JJSC 5C0AE 4F7MA 1JRHH 1OQXA 3VDCA 1FG2A 5HYSA 5DGQA 4HPOL 5HD8D 3G9VA 1NGPH 1JL8A 1K4CA 3BDXA 1F4XH 4MB5A 4F37K 1YN7B 3FB7A 3CFJA 4I18C 4MGXA 2C3VA 4OZHF 4XBGB 2OSLB 5DRNB 5E6IB 4PRHE 4ISVB 4L3ED 4L3CB 5GGQL 3MA9H 1ZGLB 2GYSA 2PYEE 1KCKA 4JGUA 4NP4H 2K7QA 2FSEB 4M48L 4RMWA 5BZDB 5C9JB 4YWGL 3VWKC 1NLBL 3MRLB 3LRHA 4N5UA 1AXSB 4MCZA 4PY8J 2B2XH 5I15H 4MAYB 2VLLA 3BQUA 5T3XH 1HNFA 3RL1B 3QHFH 3CH1A 1Q0XH 1O7VA 5FUOL 5DC4B 3SKNA 2R8SH 3OKDB 3LOWA 3O3UN 1ZGLA 4FNLL 4JRXA 3RY5A 5HY9B 3MYJA 4OM1H 3D0LA 3RL2A 5E9DA 4S10A 3FRPG 5L0QB 5HD8C 4QXUL 2D0GA 4FQ1H 4HXAH 4BM7A 1CL7H 1MWAH 3MRCB 1OGAD 2A77H 3FONA 1W0WA 5B8CC 3C2AL 5E8DH 3EYUL 3S97C 3W0WB 2X09A 2ZNWA 3UTSD 3LN4B 5DS8A 3OKLA 4Y5VA 4XNYH 5BS0D 5IHUL 4QCIA 1RULH 4JB9H 4WDIA 5BO1L 1IZJA 4XHQA 3RNKB 2JTDA 4LCUB 4Y16A 3VXRD 4IOFC 4FFWD 1JGUH 2PXYB 3HI6H 3OKMA 4TNVK 2AK4A 5D7IB 3RP1A 2HKFL 5E1AA 3BT2L 1FAIL 2VDNH 5IG7B 3UZEA 5CEZL 1GGIL 1TVHA 3T0BA 2ICWA 1A2YB 4ZFGH 3ULUD 2BJMH 5ESVA 1BM3L 2BNQB 4ZFZB 4I2XE 1Z6JT 2YN5A 4M7ZB 3IKCA 1BPVA 5E2TH 1ZSDA 1OWRM 4DGYL 3LS5L 3VI4F 2JCCF 3RZCB 3VFNA 3GMLA 4WFHE 4NQDD 3MBEB 2ZUXA 4GG6B 5SV4A 5D70H 3MJ9A 1JHKL 3VFUB 3SE8L 1J10A 5DUML 3ARBC 4D8PA 5ICZB 3TFKD 4JO2H 3RIAK 2EDHA 3BO8A 5M95B 5I15L 5K59E 4CVWA 5IR1B 2DJUA 5IVNA 3ARFC 3WHE0 5HGAA 1HYRC 4M6ML 2Q7NA 4FQQA 1R5IB 4QNPF 1W72A 4YHNB 5IEHA 3RWCB 2CJUL 3G6AB 2DQEH 3ARBA 1YEIL 4F58L 4ENEC 1L6ZA 4EDXB 2C5DC 4JFQA 3FRPA 3CFEA 5DJCB 5F97E 4YXLH 4EVNA 2BY1A 2RCSH 2Z93B 3RTQA 3B2UC 1DEDA 1AQDB 4XHJC 1KBGH 2EDOA 5FYLD 5F9OL 4LRNL 2DQDL 1PSKH 1UM4H 1VFAA 4BFIB 5D1XC 2Y25A 4OM1L 1TIUA 4GBXB 4LPXA 1Z2KA 4K71C 1CDHA 5FOBA 3F6LA 4P23B 5KSAB 1N3NB 2HAZA 4BSJA 3L9RA 2BP3A 1UG9A 4PGCA 1KIPA 4Y4HB 1T03H 4YXHH 5HHXL 4AYFA 1GGCL 2X10A 5K9OA 1TZHB 4PJAA 5E7BA 3I6LD 4OFYD 4YDKH 3WIIH 4NYLA 3RBSA 3HFMH 1D7FA 2BNRE 1FFPA 4Z7UB 4LLDA 1GZPA 4YQXH 1WWAX 2AS5M 3VFRA 3B83A 2LU3A 4P4KB 3CFKB 4XCFH 1V7ML 4LSTL 5EO0A 5IFAL 1TJGL 3EO1A 5KVDL 2I60L 1ORSB 3RA7L 4MSWA 4R7DB 5F89A 4HG4K 2GJ6B 3D9AL 4LSSH 4XVTH 5HI3D 2G2RB 4S1DC 2J8UA 3BP7B 1WISA 4QHLB 2XN9B 2YPLD 3O3AB 1H0DB 4CVXB 5LCVH 2V5RA 15C8L 4H26A 4MLIA 5KTEH 1KLFA 1CLYH 2Q3ZA 1CFSB 2C4XA 4F9LC 4KY1H 5I1HL 3TCLB 4KFZC 5D1QA 3MZTA 3BKCL 4XXCC 2GTZA 3UTQA 5IMKA 3VWJC 1HXMB 1PX3A 4NN5B 5DFVC 3RVWD 3OKKB 5FGRA 3J8F7 3TA3A 1OAXH 3PXJA 4I0PC 1B0WA 3GFUA 3OG4B 4PJDA 4MD5A 1A6WL 3GNMH 1T83A 2PTTA 4WUKH 5ADPL 2QQNL 4WU5A 3L5HA 2NY5C 5TQ0L 4GAJL 2A9NH 3LIZH 4PD4J 4UV4L 2BY3A 4LEOB 5M94B 5FA3A 1I4FB 1F3JB 1WFNA 4QRPA 3OPZL 3O9WC 4OQ1A 2ED7A 4TVPE 3UTZB 1M7DA 1T66D 4H0HB 1TVBB 1NDMB 2YK1H 3FB6B 3T4AA 2ZOKA 2VZ3A 4RAVB 5EU6D 3KPOB 4JFDD 5CHNA 1DBKH 1MI5A 2DTML 4PJ8A 4CRPA 4AIXA 2MPAH 1KGCD 4X7FC 1L7IH 5DD6B 3MQIA 4F3FA 3ZKSD 3HE7C 1IZKA 4ZUSA 4M9OA 4Y5YC 5DR5H 2VUOA 3QI9A 5ITFB 2DD8H 3ETBF 4LP4A 1KFAL 3TGXA 4ONHB 2HTKC 4Q9BA 4QRSB 3GI8L 5DEFB 4U1NB 4WCYL 4WTZA 2PW2A 1GJIA 1T2QL 1YYML 2KH2B 1LD9A 5F1NA 4MX7A 1FDLL 3VU2A 3K2MC 4DGIH 4QHMA 3RX7A 3EZ8A 1MCOH 5CZXC 2Z91A 3U4AA 5J57B 3LEYH 3TPUA 4LSRL 4LGRB 2D7TL 3IFPB 4PJHE 4PJEE 4DN4L 1SYSB 3D69A 1A47A 1WJ3A 5GS3A 3MLSL 1EXUB 3KPMA 2ARWA 3MNZB 3FO2A 1HYSC 5TFSH 3C60C 1DP0A 4PJ7A 1HOCB 4KRMB 3BW9A 2UWEE 1XIWB 1KCSL 1BGXL 3D2UD 5CBAB 1G6RA 1ONQA 4JFYA 3I6GB 4EUPG 1JGDA 2W9DL 1PKOA 1SJEA 3FT2A 3IJSA 4P0DA 5IB3A 3MRIA 1NC2B 2VABA 4WO4B 1ZGLP 4KRNA 5DHVA 4KH2A 4DQOH 2AEPH 2B4CC 1FPTL 3SDCB 3MXWH 4K3JL 2BHZA 3U48A 3HG1B 4CADB 5AZEH 1U58A 3WHE1 1YQVL 4G3YH 2VYRE 4Z8FL 3TVMD 4XVTL 3OKEB 3BZDA 3O2VH 1RIHL 4Y16B 4XVSH 5IBLC 5GS0C 3OKMB 3PQYA 3VE0A 3GSWB 5GHWL 4HZLA 1HINH 4PB9H 1K6QH 3OJDB 4JFHE 4OCYL 1LVEA 3VXMB 1QEWA 2GT9A 4UTBL 2R0LH 2NTFB 4ZMAT 3MRRA 4U1IB 4UT7L 3MACL 3SE9H 5E2TL 2LE9A 1FO0B 4POZD 3H9SA 2BNUA 2NNAB 1MFAL 3KLAA 1PG7X 3U30C 4P4RA 4PJHB 3G5XB 4KKAD 3HPLA 3DROA 3T8XA 5EULV 3GSWA 5DMIL 4M7KH 4FXKB 1BWMA 1T1XA 1IEHA 3WJLA 5E1HB 2JJWA 3MC0A 1CIUA 1U8HA 1H3XA 3OXRB 1JYXA 2APBA 3C2AH 1KPUB 5E8DL 4EXKA 5CD3A 1SEQH 4ZFOA 5I30H 4JM4L 2CO7B 3D3VE 2Z31B 4YHIA 2A73A 5FV2A 5BV7H 5CP7A 1LEKB 3MNVB 1JHLH 1FV1B 4JZJC 5IV2A 4TTDD 3VFPA 2V2TA 3MUGB 1JTPA 4NFCA 1FNEA 4IMLB 4LF3A 1A1NB 3JTTB 5FB8B 3INUL 3HC3H 4ZTOL 4NM8H 5D71L 2VDOL 3WFBH 3L9RB 2YRLA 4I77H 4L3EA 3G6DL 2XV6B 5I1HH 1AI1H 4OD2A 3EKCA 1G7MA 3V6OA 5K9KB 1F5WA 1FVDA 3QIWB 4LCCC 5JDSB 1P1ZB 5EU5A 5JW4Q 1NL0H 1O5DT 1P84K 3QDMA 5JUEH 2YUVA 5BRZE 1RHHA 3U4EB 1N5AA 2X4UB 2OJEA 2YD1A 3MTRA 2B7DT 5IT2H 1E27A 4NN7C 3S9DB 3B9DA 5IROA 1DN0A 3F12B 3L3HB 2GI7A 2X4SA 4FQQB 3TNMB 1IT9H 4H0GA 3C8KB 2Y6SC 3PWLB 3QWRD 3RWCA 3QULA 4OGZA 1E4XH 4OZHA 1YUHB 1Z3GL 2J4WL 5DJ0B 4U2YA 4BQ9A 1FNGB 1U8LA 2BOBB 3BP4B 3DX8A 3IDUA 4X6FB 3M1BB 4M7KL 2OTPA 4JB9L 4OKDA 3TO4A 1JNHB 5TE7H 4IIQC 5LAXA 1QBLL 1E4XI 4XCCH 3OGCB 5T3ZL 5FA4B 1AGCA 3F8UB 2A0LC 2Q76B 3UTSA 2OR9L 5T1KB 2EEDA 4NQEB 4B5EA 5EIIB 4OLVL 5ECJE 4FTVE 5J12C 5E7FA 3NAAL 5DR5L 5FUCC 4FQHA 4GSDL 1XR9A 1WWBX 1N3NA 1KB9K 3B3IA 3BPLB 4S1QL 1TMCB 4HS3A 1HDMA 5C09A 2G5BA 4PBWD 5E6YA 3OWEA 2P5EA 1LQSR 5E1AB 1DEEB 5FA4A 1ORQB 3BPNB 4FFZL 1UKTA 4JPIA 4XWOD 1R0AL 1A6PA 3DECA 1RZ8A 4PBVC 2ADGB 5KBNC 5C07A 5DJDA 5EORH 4DW2L 4BH7B 4NCC1 4IRJD 2GAZB 2XZZA 1G1YA 4RMTA 4LRNH 4HIJB 1FBIH 1QRKA 1SJVA 4L29B 2VAAB 5TF1L 2HG5B 1HKLH 1YEKH 1MCWW 1JV5A 5BQ7A 1I85A 1YEEL 2GJZA 2Z35A 1WVZA 2NY3B 3GSUB 1BBJA 2ZG3A 5FO8B 3L5IA 4LHUG 5EN2A 1NCCL 2EDTA 5KN5B 3H7BB 5GRWA 3FJTA 4RMSA 5T1MB 4U1HA 3NPZB 3P4NA 1WFTA 5IWLA 2CRZA 3BYYA 3LH2H 2VB5A 2HT2C 3QO1B 4NQUA 3E0GA 5C7XH 4HUWB 1WV7T 4ONGH 1KJ2L 4ZXBA 1FYTE 3RDTD 2DWDB 2XWBA 4LLUA 1TJGH 1KYOK 3W5MA 1RIUL 1HZHL 2YPVH 2EKSA 1RZIB 3DO7B 2W0FB 4G5ZL 1Z9MA 2BNRB 2J6EH 2R1WB 4NRZA 4LEOA 3DMMB 4N8CL 1ZMYA 3UROR 4HSQA 3ILQD 5KOMC 4TRPH 5I9QB 1OP5K 2G75A 1VFUA 4XTRC 2BCKB 4Z7UA 2E7MA 4DWHA 4KPHH 5DVLA 3CH1B 1ZOXA 2PKDA 4A2MA 3ET9F 3F58L 3TT1H 2EXYC 4OF3A 3OJVC 3O4LA 1ZT7B 1UXSB 3NABH 3VXNA 2XIDA 2O5XL 3T77B 1TQBB 3BP6A 4GAJH 2DL9A 3N9GL 2FNBA 5T5FL 2PNDA 1GGUA 1A14L 1F4YH 2AJZB 2JELH 3KPNB 4MDIA 3FB5A 1H3PL 4DJMA 1T2JA 4LVOC 4PRIE 3I3DA 3C5SB 2F54D 4G6AC 4M7JL 4MXQD 3H9SE 4EJ1C 4KI1A 3K3QA 1SVZA 3ARUA 4LIQE 4R0LC 1T7YA 4LKXB 2FWOB 2A6KB 5GGQH 1BFOB 1PKQA 1YEGL 1CIDA 5F71A 2Q7YA 2R23A 4S1DD 3VXMA 1A64A 5LKNA 3DOSA 1G1CA 4D0DA 5E2WH 1FJ1B 2YXMA 1FPTH 1AXSA 4PY7B 3QDGB 3L5WA 4GXUM 4ZFZA 4Z0XA 3AMLA 3L5XL 1W72H 4ZNCD 3JWOC 1YJDL 3NTCL 3U0WL 1HHKB 4NHUA 4LCYA 1AHWA 4AEEA 5JW5B 4JG0L 1YN7A 1EX0A 3PHSA 1KB9J 4P59L 4ODHL 4NKQB 5IJVA 1M4KA 1MH5A 5BXFB 4GW5B 3OXRA 4R97B 3TJEH 4LSQL 5KSBB 3FRUB 2YA2A 1ADQA 1S7QA 3VXUE 1YNKL 3PQYD 1KC5L 2Z31A 3EYFB 5JORB 5JW4R 5DJ6A 3L5JA 4X98B 3TPKA 3G6AA 4KRPC 4OI9A 4JJ5B 5FGBC 3DV4B 3BQUB 1H8OA 1T1ZB 3BWAA 3PDOB 3QDMD 4L1DA 3U9PL 4QWWC 4ELME 5LJYH 3IFOB 1C1EH 3OKNA 3R8BB 1RZJL 1KN4L 3X3GL 3WFCH 4F7PA 4JDZA 2EKJA 1YECH 3TBYA 3VCLA 2DB8A 3MRCA 1A1OA 3M45A 1RZ7H 4CU6A 1JI1A 2DMCA 4YGAB 4N1HB 4OAWB 4M5ZH 5CP3H 5D7KE 4X4ME 6FABL 3DXAD 4HWBH 2ESVA 2OCFD 3NCJL 2B1AH 1OLZA 1NC2D 4WO4D 2EE9A 5L2JA 2NY4C 1B9ZA 4OUUA 1XF3A 3S96A 1NCDL 1S9WB 3L95B 3FN0H 5A16A 4MJ6B 1TZIB 4X8XA 4U4BA 2FH8A 1MVUA 4N0YH 1CICB 3K2UH 5EZJB 2CJUH 4NNYA 1AJ7H 3P9MA 3NZHH 4K3EL 2H2PD 1AKJA 1T0PB 5DJXB 3ULUC 1CG9A 1MFBH 1S5IL 2P43B 2A73B 4CUCA 5HXMA 2I07B 3JVGC 5EIVA 2PTVA 5IB4A 2F19L 1IKNA 4LPWA 3TH2T 3GJFB 2JCCE 3MRNB 3M8OH 3TM6A 5MERB 1I1FA 4I3SH 1FIGH 3WDIA 3QJHA 3H9HB 4PJIB 5HVHB 2D9QB 5D7LB 1K8IB 1IM9A 3W9EA 4YH6A 4ODSL 3RNQA 1ZHKA 3BH8A 3SGDH 3CFIC 4KROD 5T33L 3BN9D 2O61A 4JDTL 3BAEH 3V2AR 3QI9C 3U9PH 2R56L 3FQUA 3UBXA 1QKZL 2FB4H 3ESUF 3W0WD 3CFBA 3RVWC 1RZ8B 4JFEB 3VFVB 3QXDA 1MHEA 3PXHA 3SGJC 1T1WA 4XMLL 4BFBD 1U8KA 2GSGA 3WLWC 2BSTB 3LE