3FO0H

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (wild-type)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
b'DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 214
sequence length 221
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H01
2AABH 1T2JA 3RP1A 4PRNA 4PJBF 3ULUH 4KZEL 3KPPB 4K9EC 4PJEF 3ZLQC 1JHTA 3IJSB 2VSCA 5C09A 2Z31B 1BQUA 1IAIH 1F8TL 2X6MA 5EU5A 1OT2A 5GGVL 5MEQB 4P2OD 5DZLA 1CFTB 2EH7H 4AIOA 4UAOC 4PRHE 3BHBB 4EBQH 4BK4A 4M43L 2NY3C 1EHAA 1WBYB 3V8CA 1M1SA 4LPCA 5EU6A 3SOBL 3QXVA 1KGCD 3IFNL 2H1PH 4Y5YB 4HF5L 2RAMA 1T3FA 5FYJE 3GK8L 5HYJA 3L3IB 3C08L 4JB9L 4IIQA 5EFIA 1T1XB 2E8YA 2AJ3B 4G9DB 4C57C 1EHNA 1NGQH 3AS0A 4JJ5B 1JI2A 5EO9B 2E9WA 3FHAA 3WKML 3U7AA 4ZYKB 1BLNA 4YDLC 3DVGB 5JR1H 5FYLL 2Q8BH 4JR9L 5D1ZA 1H3GA 1TTUA 5EZOH 4G80A 1FFNA 3QIBD 1X5YA 2YC1B 3BN9C 3Q3GA 3V0WH 4W70A 3U9UA 5FYJH 2VLJD 3MV7D 5L0QB 4JDVA 1U95A 2VITA 3MBEC 4IDLA 4XNUL 3NFSL 4UMGA 2QADB 1D9KA 1WJ3A 3MRMB 5MERB 3WJJA 5AG8A 1EEZB 1FYHB 1ZSDA 2L4OA 4TNVF 1MCRA 2YD1A 2X9YA 3ARXA 1AGEB 4U6VL 3ULUF 4NZRL 1ODAA 3C60D 1ZMYA 4JN2A 4IMLA 2RBLA 1N5AB 4XPHL 3L7FA 2CPCA 4R96A 1JWMA 1HINL 2HTKC 5E8EA 1A64A 4FTVD 4MXVF 1H0DB 2IPUG 2IH1B 5EOTA 1ZT7B 2HJKB 4P2RB 2YWZA 1JYWA 2HLAB 4U1SB 2X4OA 4OD3L 3RVXD 3WIHL 1I1FA 2X05A 2YMXL 3L3KB 4XGZA 4GAYB 3IAPA 2HA1A 4I5BB 3LQAL 4ACPA 4KROB 1WTLA 2CLZA 1V05A 5CGYC 3QIUA 35C8H 3KLDA 4PYHA 4S2SB 3DYMA 3QDAA 3GIVA 2WWMC 1IARB 1A4JB 1ZVYA 2Y6SD 1HHKB 2DD8H 7FABL 3HA0A 2FD6H 3BEWA 4MB3A 4PRDA 3RTQC 3V4UH 3SDDD 4LSQL 5CZVL 1EK3A 2PYEA 3EYOA 4XMKL 3DBXB 2PXYA 1R3JA 4EZMA 1KB9K 1J05B 1F11A 4KXZI 1UWEH 5I71C 2XWJA 3MRQB 1JF5A 4HG4K 4JRXB 4P9MH 3OKNA 1KIQB 5DRWB 3FTGB 2FB4H 2XQYK 1S5HA 3GBNL 3GSVB 4IJ3B 3GB7A 3ARDC 3S34L 2DIBA 1QSFA 1BECA 2D0FA 4X6CB 3U7YL 2R8SL 3OKDA 2DLEA 4HLZH 4Y2DD 1R0AH 3TO4B 1FNSL 3BZ4A 4G7YH 3EFFA 1U8NB 4UNTA 1FDLH 5DK3A 4JHZA 3UEZA 5L2KB 3CLEH 2DQHL 4EOWH 4YXHL 4PGCA 4Z76A 1UCBH 1WWAX 5SX4I 2WIIB 2FLRT 2Y36L 4P5MB 1UWGL 5I18H 4K3JH 4DAGL 5C0EB 2ZOKA 3N9GL 4AH2A 4X4ME 2HLFD 2BFVH 5I2IB 4K3DL 1UM6L 1IQWH 3RZCD 1N3NA 5ADPL 2IBZX 4XVSL 3O81A 1QSED 4M1CC 3EIFA 1NDGA 1TITA 1WIUA 2YXMA 1ZGLM 1B9ZA 2PNDA 4YC2B 3QXAA 3EYQC 4XPFH 2V5TA 4NZUH 1IGCH 4RBPH 5KG9A 2WSKA 5CJOL 5DHYA 2YD5A 3TBTA 1J7VR 1QKZL 5A3IC 4QF1B 4QXTB 4M1GH 3C5JB 4NQDD 3RWGB 2E7HA 2WUBH 4LSUL 5K9JL 3E3QC 1DSFL 1Q94A 1AO7B 5IQ7L 2BNUB 2AEPH 2GSIA 5C71A 2NY7H 2P24A 3QUKA 1FN4A 2A77H 2BVQA 1G1CA 2XKNB 5E8NB 4PTTB 5DA0B 4GRMB 1G9NH 5GZOC 3G5ZA 43CAB 1AHWA 4NJAH 3GHBH 3IGAB 4ISVA 1KXTB 3BDYH 3G5VB 5JLZB 2AEIT 1T6VN 1OP5K 1X6LA 2Q6WA 3BGAA 3UXFA 3DHJA 5JMOC 1QBLL 4NN5B 1KUMA 2YUZA 2AJZA 5EOCL 3WHXB 3BWUC 5F7HA 2YUXA 1ADQH 2ZUVA 4LDEB 4Q74A 2VAAB 4QXGL 4I0PC 4KKLC 3MO1A 1CICC 5K9OB 2F8XC 4NHCH 5CP7B 2Y5TA 4ZOCA 4DTGL 3G08B 2IGFL 3RGVA 4YNYA 3B9KC 4CVWA 5JZ7D 1AFVH 4DUVA 2EYTA 3F65A 4DKFL 5GJTL 2EO9A 4HV8B 2PO6D 2WQRA 3CX5K 4S1DC 3E6FA 4WFFE 1VACA 4Y4KA 5BMFH 2F54B 5CFHA 3L5XL 1BX2A 2HKHL 2COQA 2CLVB 3HI1A 4LLQA 4M7JL 4LAJH 5GGSB 5LBSL 2VDNH 3O2WH 1JNNL 5GS3A 1U93B 1W0VA 1R3HB 3MLXL 2PTTA 4PR5B 1D6VL 2NTSP 1HI6B 4XWOD 2EKSB 5I9QB 3EOYG 5HGDA 3MGTB 1I3RA 4Z7OF 4JKPH 4ZTPL 2XZQL 4JGJA 2R39A 2FX8H 1JVKA 1CE6B 3MRBB 3VWJB 4LOUD 5EO1B 1VERA 1I9JH 1M7XA 4ZFOA 2VN7A 4YH6A 5IOPB 3MR9B 5HHNA 1IGIH 2G60H 2NY4D 2BP3A 5T1KA 4YFLI 3CSPA 3B5GA 1AXSA 3QUZB 5D2LE 1O7VA 5E9DB 5CSZA 3TC9A 2G2RA 2L7UA 2Z31C 4LVHB 4ZFZA 4NWUH 5CD5C 4F9LA 4PJ7B 3FT2B 3CDGA 4F58L 4NO0B 1RIUL 2RB8A 1RAMA 2DI7A 4OSUH 4UTAH 1GC1H 3O4LB 3INUL 1WGOA 2HG5B 1OM3H 2W60A 5TPWL 2O5ZL 4GS7B 1GGCL 5MEOB 4NQXB 4XNXL 5I74B 2BSED 5C0DA 3C9NB 4XNQB 1U8PB 4QHLA 3UP1A 1YC8A 1T66D 4L8SA 3PQYD 4Y5YC 4Q6IB 4LCYB 1HYRC 2VLLA 3BWAB 4R0LA 2FYYB 4U3CA 4OV5B 3BRDA 3BT2L 3MFGB 2ICWI 3F58H 5T3ZL 3V6OE 3SE4C 5LGJA 1INQA 4E41D 4N8VA 5L9DH 4V1DE 5D7SL 5IW3A 5DMKA 2R2EA 5GGQL 4ODWA 1KTRL 3LKQB 4P57A 2H26A 4AEEA 5FIEA 1T7XA 1VB9A 2B0SL 2E27L 5IB5A 4D94A 2OJEB 2ZCKH 4WUUD 5L0QC 2I9LB 2O5XH 2RCSH 4YPGB 2QADC 4R8WL 4TVPL 1DN2A 3MA7B 2I07B 3VGBA 5BRZB 2EDHA 5IB2A 3WS3B 4ZFGH 3L3JA 4OJFL 4ZMAT 4OGAC 3O11A 2XPGA 4ZUSA 5LGHH 5CIPB 5IM7A 4HPOL 2E7BA 1A14H 3H7LA 1FL5B 3OR7A 2JJSA 4IRSD 4JY4A 2E5EA 5BV7L 5GSRA 1KEGH 1MAJA 3B83A 1A3LH 4L4VE 1OT1A 4WO4D 3VFNA 3AS1A 5KSUB 2FRGP 3MRJA 4NNPH 3FAWA 1INEH 1NGPL 1MCKA 3I6KA 1CGYA 5AD0B 4Y4HA 1VFOA 1ZWIB 4LCWB 4JFOB 4UOJA 2GK0B 2GITB 2XTJE 5BV7B 4PJ9B 4LCCB 4XCEB 3RL2A 1NGYB 1VDGA 2CRZA 4NQEB 3C6LA 3GIZH 4KROC 1G7IA 4KJYA 5HHVH 2A6DB 4FFZH 1M71A 3JUYA 2APVA 3BD4A 4LEOA 5T5FL 3EUUA 5ANMA 4G6AC 4XC3H 3WFBL 3VGGA 4RAVA 1IC7L 3NPSB 4L4TD 4S1QH 1A9EA 4N90D 2Q7YB 1S7UA 4R97B 1OW0A 3HE7D 3SJVB 1I3GH 1OF2A 2FJHA 3G5YA 2FH6A 1M7DA 1GL4B 2MJWA 1NBVH 1NLDH 1X4YA 3EYSL 1F3JB 2X89A 1NSNL 3NVQA 4FS0A 4M5ZH 5DC0A 1CGSL 5I1EL 1BD2B 1LE5A 1MOEA 1KG0B 4BH7B 3WBDA 1DQDH 3C8KA 3LV3B 3QG7H 5GXBB 5F96H 3MMEA 5E8PB 5C0BD 3QDJD 4IJ3C 1FNHA 2HN7A 5FECB 5TQ2L 3IDIB 1DQQB 3KYKH 2WBJD 4Z7QF 3DYPA 5H94A 4G43A 3QNXA 1SVCP 3VXMB 5EBGA 5I17B 3TO4C 1A7OH 2G9HA 4G6ML 4O9HL 1Y6KR 1FVDB 5DUBB 2FO4B 1FVEB 4RGOL 1MJ8L 3IFPA 1C5CL 4P9HH 4KRPD 3HNSH 3UTTB 5IVZA 4Z0XA 5C8JB 3L7EB 1A9BA 4GG8B 4N0YH 2X44D 1T7YA 2GEEA 1X5AA 1E4KC 3AREA 5SWSB 3U7WH 5C9JB 5F9JA 2ADIB 1P6FA 1XT5A 3JV5A 3BKJL 4M02A 5AZEH 2IANB 4X98B 3VXSB 4Z7VB 4AY0A 2NX5B 2Z93B 2PUQT 1K3ZA 4YC2C 3MNZA 1IT9H 3MROA 4XPGL 3TH2T 3PABB 2FJGA 2EXWC 4YHIA 3RX7A 2FECI 3FB7A 1RZ8B 3TM6A 3UZVB 1E6JL 4PV9B 2GY7B 1ZAGA 3C2AH 2O5YH 2DM3A 3K8LA 3CFBA 3MUGA 1OGAA 5BQ7A 4LLWB 5EBLB 3QIWD 3QUYD 3DUUB 4X9BA 2DWDA 3O3UN 1D5BA 4QOKA 3CUPA 5IG7B 2IG2H 1A22B 3MXWH 1MF2H 2XZCL 2XN9B 4C55A 1GYAA 1I1CA 3EBAA 4GAGH 5GRWA 4BQ8A 2B4CL 5FDWA 5IHBA 3TGXA 2QQNH 5IBUG 4HIJB 5A16A 5TE6L 4X83A 4CUCA 2CGRH 3IETA 4OFVA 1ADQA 3VFWB 1BVZA 4NN5C 4Z95H 4XPBL 1K3IA 1H8OA 2ZUUA 4G3YL 1H8NA 1E28B 4NBXB 3IKCB 1RZJL 4PJ8D 1FLRH 1JZ3A 3GMMB 1A6PA 1P1ZB 3RPKA 4GKZA 1YDPA 4LQFH 5FV1L 3UTZB 2FWOA 4GW5A 1UYWH 3Q48A 3QEHB 3O3BA 3T0XA 3O9WA 4P5KB 3GRWH 4NNXA 3X3FH 3ZE2F 5I1JL 3ZDZE 3L3HA 5D8JL 1L6ZA 5HDQH 1CLYL 1NAMH 1KB9J 1X5IA 4F7PB 1KACB 1F4AA 1G6RH 3GDBA 5BZWB 2DOCA 3P4NA 4HG4J 1DBJH 3MJ8B 2A6IB 3GO1L 5BO1H 4U7KA 3OHXB 5IGXL 4JFPA 1HILB 4G42A 5FAAA 3RVVD 3NN8B 4NZDA 1JNJA 2AJVL 5IROA 1FLTX 3FT3A 5L8JB 1EFXA 1XCTA 4FN0A 2R0LH 4PRPD 5HGHB 4M6OH 4YWGH 5I9QC 1XIWA 1H3UA 1T04A 1A6VL 1VADB 5JHDA 4X6EA 3MOQA 3TT3H 5MENE 4KMTH 4GMTL 3VDBA 2GSGB 5CBAA 3LEXB 1UB5A 3IF1B 4HMCA 3VWJC 2X4NB 2OTWB 3NMEA 2EYSB 2ICWJ 4RWYL 1NDMB 3D85D 3MV7B 3IDUA 1VKXB 2MSPA 3GMQB 4O2CA 1K6QH 4LCIH 3QUZC 1L9NA 2FHBA 2YPLB 1QOKA 1NMBL 3B2UC 1BQLH 4RA0C 4G8FA 4LVHC 1C1EL 5C0IB 1DJSA 3BEVA 2X4UB 3DV6B 4BSWA 1NCWH 4PGBA 2KZWA 3ARWA 4C4KO 3WFDL 4RIRB 3KPTA 5MEPB 5EZJA 2W0KA 1KCSL 1S7WB 5HHOB 4QXUL 2JCCE 1QP1A 5I1CH 5D2LA 1DCLA 1S7RA 4GS7C 4HIIB 5IW1A 2DMKA 4X4YB 3NIDF 3VXUA 5IT2H 1EO8L 4HIXH 3U0PA 5CZXC 4ELKA 3EJYC 1MJJA 1KCUL 4Q6IC 5DS8A 4PY7A 1OQOA 3QNZB 1P7QA 2ZJSL 3RY4A 4G6JH 4M48H 2G75A 1IC1A 5IMMB 4QHUB 1FO0H 5IBLD 5AZ2L 4JFQA 1G1YA 2RHEA 2ARWA 2PN5A 3PXJA 5E5MB 1YEIL 1ROWA 4HZLB 4YBLB 3QDGB 2Y06H 3MUJA 1ZLUH 3K81A 3DXAE 4MCZB 4MB4A 5EU4B 3L5HA 4JO1H 4NT6A 4YUEH 5HYEA 1XGUA 2VLRB 5BJTA 3QRGH 4X7TB 5DMYA 2R0KL 1N64H 5J9PA 2HAZA 4LSDA 4V1DA 2ENSA 1CLZH 2ZSWA 1BBJA 1VFBA 2LU3A 3VXRB 2X1WL 3HZYA 1NFIB 1PDKA 3BH8B 1RZKH 1RK0B 4PJIB 4P5TA 3ILQD 4AZ8A 1A7RH 1K8IA 5DRXA 3DRQA 2F53D 1MCWM 3RNQB 3Q6GL 2A74A 2OP4H 2RGSA 5L2JA 1BJ1J 4KTDH 1BIHA 1OLZA 2J88L 3KJ6H 1LO4L 2R1YB 3OKOA 1H3VA 1XZ0B 1JF1B 3NZ8A 4LSRH 3O3AB 4OLXH 3SCMD 5DR5H 1U41A 5BV7C 4PJ9C 4LCCC 4MS8D 5GIRA 4URTB 2DQDH 4XNYL 1HDMB 2I9TB 4LIQL 2FX7H 3LEVH 4L4VA 3T0ED 2FHCA 4RGMB 5F1KC 2VKXA 1WBZB 5KTEL 2QSCH 3QISA 5FGRA 1H3TA 4APQA 3K7UA 3D0LA 4K2UL 3TBVB 4YHLL 3EJZD 2EE3A 1RU9L 4NM4H 3NPSC 5KN5B 4FXGB 3HMXH 4RAHA 2EIBA 1I85C 3FQNA 4R97C 3UO1H 5DJYA 4PJXF 5EA0H 1I1YB 5C3LD 2EE9A 3IDGB 3L5WB 5IFHH 2NZ9C 1T0MB 4P2QA 3W9DB 4JY5H 4LF3A 4YDJA 4XMLL 4R4BA 4ZPTA 2XWBB 4PRIA 4NC1E 3TLRA 3V79C 2ARJA 3MCKB 3OAUL 3AXLB 4B50A 1EGJL 1DDHA 4OIIL 1YZZA 1AI1L 1QRNE 2Z35B 2P5EA 2A6KA 4FQHB 4X7SH 3MC0A 3UJJH 4MXWL 1ETZB 4J23A 5DK2A 2MFNA 1CL7L 4JZJB 1HKLH 2VDOL 2EDXA 1EFQA 4EN3D 2YD2A 2EE2A 4O00A 3PIQB 5KVDL 2EDJA 1VGEL 4HX1A 5HYSG 4QRQB 1X5ZA 2OR8A 3OX8B 5DD6B 2VL4A 1CYGA 5E94B 1WEJH 3EOAA 3BZDA 3S88H 4XRCA 4FQLH 1A6AB 3PWLA 3CX2A 2OX5A 3U46B 2BOCB 3WXWL 3DGGB 1MQ8A 3QQ9C 5IEKA 1OAZH 2E9IA 3QI9B 1DN0B 1YEHL 2J6EL 3QH3A 4D0DB 1U8OA 3NIFF 4J8RB 1HOCA 5BVJA 3HCVA 4PUBH 4ONFL 3D3VE 3PF2A 1DQJB 1UXWA 4OCYL 4U0QB 5GS1A 4R7NA 4JQVC 5D96B 1J1OH 2PO6B 4HH9B 1LEGB 1YN7A 2AV7B 5F7LB 3HR5A 3T1FA 5I1GL 3SBWA 1F4WL 2HT3C 2V17H 1GAFL 4JM2F 4AIZB 4AG4L 1J12A 4KAQH 3L3DA 1UH4A 3K1DA 3ZDXE 1S8DA 3O0RL 3FMGH 1Q9OA 2VDML 4OZHE 4WEBH 1YPZF 4GG6E 4HXBL 1MQKH 1XGTB 3ULVD 3T3PF 2GJJA 2IPUK 2DM2A 4JFFE 4Z5RA 3MRGA 4FXKA 4TSCL 4M00A 2VZVA 4DUWA 2D7NA 2NY1B 3QQ4B 4UIKL 1U8KB 3OKKA 1S7SB 4X5XA 5SX5K 2BSTA 2FCBA 3R1GH 4ZO8A 1SQ2N 5ITFA 3H0TA 3HE6B 4WTWA 3SE3A 3NA9L 5D9SB 3S3JA 4XB7A 3CK0L 2IPKB 2V7NA 2NY4B 3PP4H 3RWCB 2B4CC 4MA3A 3FFCB 4WW2B 4Z7NE 3STBA 1E27A 5DI8B 5JNYB 5HYIA 1KPVB 1RIVH 4Q97A 4RGNE 4WV1A 4X6BA 5F7MC 1RVFL 4KKAD 3HNTH 4HQQL 5CBEB 3GRWA 3UCRA 4FQXB 5HGBB 4NP4L 3W5MA 2BNQA 2AJYH 1NAMA 3U6RB 1KB5H 3QZWA 1KYOK 3UTOA 3SDCD 4P4KA 1G6RA 1I7UB 3QUXA 1H9VA 1RZJC 4CNIB 3T2NL 2YPKB 4NRYA 5SWZB 4QYOA 3BZEB 5DWUL 2JJVA 4DQOL 3BRGC 5KS9F 3EZJB 5ILTL 1JGLH 5C0GB 1UJ3A 1Z3GH 5AWNH 3SY0B 1YECH 1T5WB 3GSUB 1AR1D 5D7KD 5BOZG 4B7LA 3LN5B 3QFDB 2IEPA 3PE9A 1UACL 4OLYL 5CJ8A 1RULL 3T8XA 3H7BB 4C59B 1OQXA 3MRRA 4GAFB 4JFDB 4G8GD 3F5WA 4H20H 5FGBA 1XGPB 1TFHA 4R4NC 1R5IB 3PV6A 4JZNA 4MA7H 3D0VB 3DMMB 2VLKE 2V9TA 4WUUB 1LILA 3BQUD 4PB0H 5I0DA 5DJDB 5AYUL 4KVCL 4JDZB 3ZSSA 3SGDI 3QWOA 2BHZA 2UY6A 5D6DC 4I2XB 5FUCE 4TULH 3IVKB 1P9MA 1YMME 2VQUA 5HTSA 1ZV5A 2ZSVA 3C09B 5C2BL 1S9VA 5JXAL 2BNRB 3LPWA 1PKQA 4PLJC 1CK0L 1YEFH 4MDIB 5IJKA 3D18B 4KI5E 1JGVL 1E0OB 5JUEL 4L1HA 1PFCA 3QJFB 4RNRA 2D31B 3GMOB 1FFQA 2RQ8A 3TZVB 1FO0A 4Y16A 4YFDB 1RJZB 4XCNB 3U36A 1XGQB 3TO2A 3KXFE 3GMRB 5I8KL 4XVJH 1T20A 4MJID 2JCCA 1DVFB 2DM7A 2VXTL 4PJXA 4MAYD 5F1IA 5KSVA 5ALCL 5CINL 3UROR 3T0BA 2VO5A 3CC5B 1C12B 3PGDB 5HJ3B 4K3EL 2CIKB 4YBLC 3CFKA 1VFAA 4OLUH 3TIEB 2UVEA 4YHPA 5KZCD 2BCKA 4LSTH 3WHE1 1J8HB 2XZAL 4PRBB 4XCFL 1JGUL 3BPCA 1E6OH 3O41B 1JPSL 5F89B 3PHOA 3GJFK 1LO5A 4NQTA 4ORZC 1KTKE 1AGFB 3H9YA 1UGNA 1F6AA 3AMKA 4ODUB 4LKCB 5FCUL 4BSVB 5D6CB 4ZUVB 2KPNA 2Y5EA 3HZVB 4XH2A 3MRPB 1JP5A 3RWIA 1JHKH 1GJIA 1TZGH 1OPGL 4L8DA 3K2UH 1DE4B 2CO7B 3QDME 3SGJA 1ZVSA 3NTCL 4U0RB 4DCQA 3HN3A 3DX7B 4DZ8A 4P59L 2FL5B 1M6OA 1FYTA 4PJFE 1L7TH 4H5SA 5HYQB 4Y2DC 4M7LL 5DZNA 2VISA 4E0RB 2YN5A 5HI3C 1X9QA 5IUSA 4Z7UE 4AENA 4EBQL 5GZNC 3DSFL 1GOFA 1GZPB 4UBDD 1MVUA 4JHBA 4EDXB 1YJDH 3VG0H 4RGMC 1FE8L 3BP5B 5DMIH 3G6JF 5FOJA 1LEKA 3LHPH 3MOAH 4Y2OA 5JHLH 3UTPD 3HMXA 3HRZB 1F45A 1U92A 2HLFC 3QQNA 3QFJD 1JV5A 4JM2A 1K2DB 3KYNB 2ATPA 2XIDA 1ZE3C 4KJPC 3RIFF 1GVIA 3CAFA 3BP4B 5ICXA 1Q9LB 4CVXA 5I66A 3NABH 1MRFH 2P43B 4DWHA 2YD3A 1YPZA 2HJLB 5CP3H 4HHAB 2Q8BL 5JDSB 5EN2A 3UYRL 4ZAKA 2NZIA 2IFFH 5EZOL 1ZVHA 4FQQB 3STZB 2X42A 4PTUB 4XNZB 2QKIB 4PRHB 5FYJL 5IHZB 1HNGA 2BVOA 4O2FA 4X99A 4JZJC 1V3LA 5DQJA 5IVXF 2JB5H 1BBDH 4UQ3B 4MAUL 1DL7L 2JF1A 1UB6B 1DQMH 1AP2A 5FM8A 5CILL 3RRQA 5I1KH 5I76B 5I30H 3IYLW 2NW2B 1AXTL 1WAAF 1RZFH 4KRNA 3I75A 3W0WE 1ZHNA 4OUUB 1IKFL 4P46D 4KZDH 4X8JA 3CXHK 4JG0H 4OV6F 2AVGA 1OSZA 4BFIB 2C3WA 5JOPE 5DHVH 5JMRA 1GHFL 3GSXA 4U3XA 2J8UE 2C1PA 4PJ8B 3TV3L 3UTSE 1ZLSH 1NGXA 1F2QA 4UILL 3SDAB 4C56D 2AK4A 3QI9C 2IQAA 5D70L 3PWVB 1RZGB 1OAQL 3QHFH 4FFVD 2ESVE 4UOW1 2C7UA 3HAEH 4L8CA 1PLGH 3PDGA 3WNOA 3QEQE 1IZKA 2R15A 5IEHB 4Z8FL 3WE6A 3S5LG 1H5BB 4WFGE 4PP1D 3TA3D 4MNHB 5EBMA 1NC4A 5D96C 5L8KB 2PO6C 5DJ8A 4M93B 3FQRB 3VFUB 2P7TA 1SY6L 3S4SA 1DEDA 4LNRB 4YX2H 2Q1EA 4NQCD 2UZIL 3VGAB 3V4UL 5A40E 4JFYB 2DQTL 3D3VA 2B1AH 3GMNB 5DD1H 1G7PB 5F3BB 4CMHB 4GW4A 3NBNA 1YN6B 1UWEL 1MCCA 4GRLD 2DQCH 5C07A 5CGTA 4M7KL 4WWKA 2OK0L 2HFGH 4HJ0C 4P9ML 3F7VB 4K9EH 1CFNB 1JYVA 1CIUA 1D5IH 3TVMA 2NY1C 2QQLL 2D7PA 3GGWB 4OLZH 3VD5A 3DETC 3HE6C 2FATL 4ODSH 3T65B 5T3XE 3QB7C 2NY4C 1J1XH 4QRPA 2R56L 4XWGH 4WW2C 5FA4A 3MRKA 4OCSH 1NFDE 2CKBL 3LRGA 1YNLH 4FQXC 3ZSTA 5EU7C 3TYGL 2EC8A 5KVGH 2FGWH 5HVWA 1R3LB 2A0LC 4JFEA 4LSVL 5EU6D 4C4KT 4EOWL 5C0RL 2J12B 3DV4B 3RU8L 5FOBB 1UCBL 4KTEH 3DTXB 5DVLA 1S7XA 5HYJD 5BXFB 4N0UE 1D5ZB 4ODTH 4JFHD 4PS4H 1QA9B 3IDMA 5GS2H 2APTA 5TDNA 3M8OH 5TE7H 4MJ5A 4MQXD 1JZ7A 2OL3B 5JOFB 4OF3A 3ZZ1A 5CWSA 5T33H 3TJHC 3WXVH 1NCAH 4YR6B 3OGCA 5D1ZD 1VHPA 1XF3A 3K4DA 5K93A 4DUXA 2DLTA 1IGCL 3ES6B 2YRLA 4PGDB 5ISZA 5J89A 5JW5A 4HGWA 2Z8RA 2VDLH 7CGTA 1NJ9A 4HWEL 5FB8B 2EIDA 4GAJL 1OWRM 4MCYB 4OFIA 2J2ZA 1D9KD 4F33B 2HMIC 3MZTA 1AE6H 2PTVA 4HMDA 2H2SC 1DUZB 4XXCC 5HY9B 1CDIA 2H6PA 3ALPA 1U3HB 2QEJA 2NY7L 5FGCE 3ZMRA 3DMMC 4IRJB 1LO2L 1E4JA 3ZL4L 1QFWI 2E8ZA 1PJ9A 4MX7B 3PWNA 5GGTH 4AMKL 3HUJE 1Y18B 3BD5A 4DVBA 4EXPX 4FOMA 3TH4T 4NKOB 4ZDHA 1ORSA 1JRHI 2D7TH 4FZ8H 1PSKH 3QPXH 4EJ1C 4U1MB 2FEDD 3F62A 3E6HB 3DVNB 3GEWB 4XP9H 4EVNB 3MX0A 2VLKA 2WZPD 2RFXA 4FQJH 3F12B 4CJ0A 4WFHE 5FO9A 5E6IA 5IB3A 1EJOH 4YHZL 4AEIH 2HKFL 4LKXA 1AQKH 3GMPA 3QIUD 5FYJU 3H9HB 5J13B 1YEGL 5IESL 4OM0L 4FNLH 4S0TD 1KEMH 1ERNA 3TZVC 3AU1B 1F00I 4JVUA 1EO5A 4AEFA 2DJSA 3C87A 4OT1H 2QR0B 1XF1A 3FONA 5LQBH 2NXYD 2PYED 1DVFC 4N8VG 3VFSA 2M1KA 4MD4B 2PXYD 3NFPB 4LVEA 2AJXH 1IGMH 3PL6A 5F9WB 5K9KB 1D3CA 3LRSB 4JQIH 1KCLA 3I9GH 3LEYH 3SDXE 1KPRB 4ERSL 2HFEB 2RJMA 1U0QA 3C5ZB 2Y07H 2VSDA 3AFLA 3ARFB 3VFMB 1UM4H 1ZA3A 4KJWD 1AY1H 1SM3H 2CMRH 5IVXA 4HUWA 4G8IA 2H41A 1QSFD 1KELL 3UC0L 2AEQL 5ERWA 1F90H 2UWEE 3BISA 1I7RA 2IH3A 4ZQKA 5CKGA 4JFZH 4U4BA 1G7HB 3MYJA 1I9JL 1WAAA 4K7PL 3KPMB 3O45A 1RJLB 2LAAA 2ADJA 1KYOJ 5I1DB 2DN7A 3KPQB 2GUOB 5DJAA 2CXGA 4X4XA 5JTWA 1O5DT 1T22B 2A6JA 1CXKA 4U0RC 4XVTL 4D8PA 4NUGH 5KSBF 3CU1A 1R5VB 3BRFA 1N0LA 5JO5A 5INDA 2P47B 3MV8E 3E3QE 5D5ME 2XNAA 3LKOA 4FQPA 4UDUB 5DDHA 2Z92A 1FORH 3LN9A 5T1MB 3A6BH 1MNUH 2LAGB 4O51B 1OB1A 1BEYH 3V8OA 5C7XL 3V2AR 1C5BL 1ACYL 2GAZA 1ES0A 1OWWA 2VAJA 1C08B 1HXYA 4GLRI 2X2YA 4F7MB 3TEUA 1GGBH 2V5YA 4BJLA 3QDHA 3NAAH 4Z7UA 5L6YL 4Y4FB 5CP3A 3FOMB 3IU4H 4EDWL 3GBML 5EZLB 2VDPH 3T2QA 4GRWB 4GW1A 4KK5D 4I0CC 3MBXH 5AEAA 2Y4SA 2GHWB 4L5FH 1SJVA 3LKRB 1TVDA 5DJCA 2X4QB 1QEWA 1W0WA 3BIAX 2W65A 5HBBA 1RHHB 4L1DA 5CAYB 1U58B 1Y6MR 3DVIA 2AW2A 1BQHA 3N1PC 2CR3A 3FB8A 3ULSA 4F7CB 25C8L 3MRIB 3F6IA 3QCVH 4FG6C 3VRLE 2HVJA 4XPTL 1G0DA 4HLZG 1I7TB 3HB3C 2DKSA 1ZLWK 1G9MC 3IDXH 3B4NA 1DBKL 3V5KA 4HS6B 4BKLB 1G7QA 4N9GB 4J3TA 4WFED 1IGYB 5LGHL 1KCRH 1KLUA 4XZUB 5IV2A 1MHHB 4RZCA 5DHVA 3RGVD 2JIXA 5HVFB 2OXHA 3MCG1 3QXUA 4WHTA 4I4WB 5EUOB 3D69A 3ESUF 1RD6A 4PJ8C 3C60A 4KUZL 4ODXA 3HAEA 1ITBB 1SBSH 3SDAC 2I25N 4XNMA 4Y89A 2HWZH 4ZUWA 4Y1AE 4Y4KD 3I02A 4LL9A 2OZ4H 3RL1B 1IEAA 2ATKB 5CHNA 5HHQB 1H5BC 2AXFA 4KWUA 3MV9A 3OR6B 3HHRB 5CUSH 3UTSA 1HN1A 4DGIH 1XF2A 4M93C 5KW9H 2YSSB 4JPIA 3BSZH 4KGJA 2I24N 3VGAC 4S1QL 4BFEA 1CFVH 3TN0B 5DTFB 1NEZB 4E42B 5IF0B 5DEZA 4LAQH 2ZCLL 5E00A 4XP6H 1JGEB 4KKCD 1QZ1A 3LY6A 4LRIC 4CMHC 4YHML 5J3HD 1XR9B 2DDQL 3FQWB 1E4XH 3VCLA 2AI0L 3ULUD 4MZ3A 5GRUH 3RWEA 2A9NH 4HJJL 1PG7L 4AT6A 2V7HB 4PJHE 5HDBF 5T1KD 4YIQB 1KNOB 1DQDL 5C0AE 4HLJA 4YHNA 4GQPH 2XT1B 1A6ZA 3RPIA 5JA9A 4HIHA 4AK1A 32C2B 3DECA 4AL8H 2EIZB 1HK6A 4WNQA 3O3DB 2GJ6A 1A7OL 5EDXA 3QA3A 1A1NB 1U8MA 1F8TH 5DRZB 2D9CA 5GGVH 1W8OA 3GBLA 2DYPB 3CZJA 1BP3B 3V5HB 4S1SL 3VD4A 2IC2A 3B8YA 3MNVA 3QRFM 3WNNA 2NY2D 1HEZA 2YEZA 4M43H 3THML 1FG2A 4UINH 3TBWB 5B8CB 1TETL 3SOBH 4J3VA 3IFNH 1N59B 3LN4B 4HF5H 3H9SE 1ONQA 2R1XA 4LQ1A 4NO2A 3GK8H 1TZHA 4JCMA 1KTDB 3C08H 4F7TA 4GSDL 1KJMB 1IC5L 1IAMA 1IT9L 3IFOB 4G8EB 3MBEA 3OG4B 4GKNB 5FYJD 2V2TA 1JWUA 3PNWB 5TDOA 3WKMH 4U6TA 1TVBB 3MRCB 4BK5A 1DEEA 1I9RH 4HT1H 5FYLH 2Z4QA 1L4IA 2P8LA 2CRIA 3X13B 3AUVA 4HAGA 2EDTA 5KVMC 4G5ZL 5HGGS 1KJ2B 2WMPA 3WHE0 3JVGC 2IG2L 4QY8B 1U3HC 3B6SB 4S0SD 5CEZE 3CXHJ 3R06A 2Z8SA 2R29L 1P7KB 3GNML 3NFSH 4IRJC 3VI4E 5B22A 3CSYA 5GGTA 3T2OA 1X44A 3LH2L 4A6YB 5BS0A 3DX6B 2R2BA 1I9IL 5KSBA 3PUCA 3UBXA 1S9YA 3ILQC 4Z9KB 4Q58C 3V6FA 2AJSL 4U6VH 1LP9E 4E41A 3HC4L 1FJ1A 5C0JA 4N5UA 4Z78B 1BFOA 5CEYA 4Y4HD 4XPHH 3SGEI 3ELAT 8FABA 2HRLA 1FNGB 2D4FA 4QTIH 1HINH 3NGBB 3WL9A 5CGMA 4MNQA 4P3CL 5DQDL 4NKDA 4XC1H 1UVQA 3ROLA 2MOVA 3C6LD 5ID1A 2ZG1A 5IW6B 3HUJA 4JRXE 4J7RA 1A02N 4OD3H 3RTQA 3WIHH 5J13C 3NCJH 2YMXH 5H35A 5E2UH 1CD1A 4JKWA 4V2CB 4HPYL 2IPTL 1CDUA 2GFBA 3FOLA 5HDQL 3KWWB 1S5IL 3IDYB 4J12A 2R2HB 3T4YA 2JB6B 1A2YB 4D0CA 1AC0A 4X6CE 2M2DA 3D9AL 2DLHA 5CJXC 5F9WC 3RAJL 2CRYA 1PG7X 2JE8A 4LSQH 5CZVH 2X89D 5T1LA 3C5ZC 2NW3B 4OTXL 4XMKH 3ARDA 5EBWB 1I4FB 3ARFC 4YK4B 1JMXA 3OAZH 3CH1B 3GKZA 4MXQD 5E6YA 1QFWM 1VPOL 5D4QA 2ZG2A 4NUJA 4ELMB 2DL9A 3BYTA 4IMKC 3WNMA 4XCYA 1ZT4A 3SDXA 4K7FA 3IT8D 3GBNH 4UTBL 3CZFA 5IJVB 4NHUA 2P5WA 4IRZH 1AKJA 1CCZA 5DJ0B 3SKNA 1QQDB 3VGDA 5I15L 4ZS7H 4LCIL 1J5OL 3OKMB 2XXCB 2R8SH 4L3EA 2WWKO 4P0DA 1BQLL 2UWEA 4AEHL 1FNSH 1V7NL 3VGEA 1EMTL 4JRYA 4QRTA 4BUGA 4UV4H 1AD0B 1CXEA 1QBBA 3ARED 1AO7E 4YXHH 1FNLA 4ETQA 3VD3A 1JN6B 4ZXBB 4NN6B 4Y19B 5EOCJ 1T5XB 2HFFA 1FNEB 4KK6D 2GJZA 5E4IA 3QO0B 1Q1JL 5FK9B 4HKXB 5HD8C 1U42A 4LCUA 1UWGH 1CXIA 3LKSB 6CGTA 1P4IH 1XF4B 4X0KA 5FO7B 4N5ED 4DAGH 5MENB 4NKIL 4K3DH 3LS4L 3MV8A 1W72B 5ADPH 4XVSH 3QR2A 3CFJB 3WUZA 4GQ9L 2DWEB 4G6JL 3NCEB 3FO9B 3MREA 1AGCB 1OGAD 4Y4FC 2H8PB 3QULB 1A5FH 4JLRB 3ZDYF 5CJOH 4QOKD 1TZIA 4HDIB 1CDJA 1QKZH 5EC2A 1FP5A 3EOBB 1A4KA 3DWTA 2NTFA 5A2IH 4LSUH 3CDFA 3VJ6B 1HHGB 5K9JH 1FZOB 2WLZA 4ZUUB 2C1OA 1MHPL 1DSFH 5IQ7H 3CSGA 2XTLA 3JXAA 3DRTA 2F9BT 1HH9A 2OTUA 4G9FA 3RQ3A 4R26L 3FO2A 3RI5K 3SE8L 4JHWL 4I0PA 4FZEL 4R2GD 1CICA 2F54E 4JKKA 2APXA 4OB5L 2P8PB 4OLWH 4HS3B 4HC1L 2HVKB 3B9KA 5C09B 1HHHB 1QBLH 4XTRC 3FRUB 3V6OC 5EOCH 4I9WD 3BO8A 3O9WD 3KJ6L 5EU5B 1QSVA 4QXGH 5IHUL 1NH6A 4P3DB 3QEGL 2Y25A 3LB6D 3CNKA 4MSWA 3FO0L 4HMEA 2OZ4A 3DXAB 1PQZB 4BQBA 1NMCB 4JO2H 1KIPB 1N8ZA 2IGFH 4OGXL 5D7IF 3KR3L 1NEUA 2ZUTA 3UDWC 1INDL 2NNAA 4P4RB 1FVCA 4C83A 4H26B 1UM5L 4QO1A 2FR4A 1PZ5B 1HSAB 2YD6A 3BE1L 3RWFA 5DEFA 5CZKA 3WS6C 1QLRA 4NO3A 3GJEB 1EFXD 3REVA 4NM8L 5AUMA 3L5XH 4I3GA 3K74B 5J12B 2ERJB 1OAXH 4NM4L 1XIWD 3VFRA 4M7JH 4MNGA 3TN0C 1XGRB 4MJ4A 5LBSH 5JHDD 5D1ZB 1J9CT 5LAXA 2VQTA 4JEGB 3PJSA 4U1LB 5FA3A 4FP8L 5HI4D 3MLXH 3O4LE 1JWSB 1FFNB 1D6VH 3Q2CA 3VFVB 2X7LB 3KPPA 3Q3GB 5K59F 3TESA 2MQCA 1NBYB 4JDVB 2Z31A 1SJEB 1U95B 4ZTPH 2XZQH 4NFCA 1YYML 3KYMB 4QTHB 1KJ3L 3OJDA 1SJXA 4FFYL 1UZ8B 5MEQA 5H8DA 4LDLB 1CFTA 4YHKH 2XG4A 4UT9L 4JO4H 5C0ND 1NFKA 3BHBA 3WLBB 5C08B 5J6GB 1U8IB 3RDTB 1EVUA 2AJUL 4KC3B 1MH5B 4BQCA 1KV3A 4Y5YA 3D39E 1NUDA 3VXUD 4F58H 1RIUH 3L3IA 5ESVB 3QZWG 2X4OB 1R24A 3SE4A 3B3IB 1I1FB 2AJ3A 4G9DA 3INUH 5FYKE 1BZ7B 2VXSL 4JN1L 4XHJD 2O5ZH 1GGCH 1P7QD 4JJ5A 3VD9A 1KN4L 1TLKA 5EO9A 3I85A 3VWKB 4XNXH 4ZYKA 1EZVX 3SKMB 3DVGA 2CLZB 5B8CC 2EIEA 1QRNB 4X6DE 4M8QA 1Q9WB 2DQJH 2VABB 3S37L 3LOWA 1I8IB 2YC1A 5BOPA 3BT2H 3KPSE 4MJ6B 5T3ZH 3QWQB 4TVPE 1J1OL 1EAPA 2BRQA 1JCKA 3MRMA 4XPAL 5MERA 2AAVA 3JTTB 5D7SH 1EEZA 1UWXK 3PV7A 5GGQH 1J0JA 2CIIB 2RIKA 1QG3A 3JV6B 1IM9B 4V1DD 3H9ZA 1AGEA 2B0SH 3IDJA 2E27H 4LLYB 4P5TD 1N5AA 2CO6B 2B7DT 5CIPH 3FRPG 3PXHA 3ZKND 3TBSA 1H0DA 1Y0LB 5EIIB 1ZT7A 1ZTXL 2HJKA 1A7NL 4P2RA 4R8WH 4TVPH 1A21A 3O6LL 2HLAA 2GW5A 1C7TA 4PJ7F 4OJFH 3ZE0F 1HH6B 4N8PA 1PG7W 4HPOH 3L3KA 3DIFB 5L8LB 4GAYA 3X12B 4K8RL 3LQZB 1WZ1L 3HG1E 3PWJB 4I5BA 5HHMD 5MI0B 3U82B 2ZP0T 5M95B 5BV7H 3WFEL 2X1OA 2PW1B 4YZFE 4YPJA 3NGBC 4RFEB 4S2SA 3KPRE 3WIHA 1A4JA 4WWID 4L4VD 1NGPH 3EYUH 4PJDE 2AJYL 4U1JB 4X8XA 4GXVL 1KB5L 4NZJA 4APQD 2C9AA 4OZHB 5ETUB 1FCCA 1JJUA 1NC2B 3DBXA 3BPLB 5IVNA 2XTJD 1NCBL 4GG6B 3IDYC 4UBDC 3ARGB 1J05A 1LQSR 3ARBB 4JFFB 3MRQA 3T77B 4QGTA 3W82A 1J10A 1QYGL 5JIPA 5T5FH 4JRXA 4P2QD 3WFBH 5E0QA 1KIQA 2BRRL 1Q0XH 1IC7H 4PRID 5DRWA 3FTGA 4D9LL 2GT9B 3GSVA 3BD3A 2P5ED 4BQ9A 5CJQL 4YK4C 3UTTE 1FL6B 4X6CA 4AQOA 4ZNEE 3EYSH 3QXTA 1M7IB 1WICA 1NSNH 4R6UA 3LKPB 3TO4A 1Z6JT 1CGSH 5I1EH 2BVQB 1U8NA 4RA3A 4H20L 4PJBB 3SHSA 4RMUA 5L2KA 3RWDB 4PJEB 5B4MD 1ZLVK 5DMGC 4KK8C 2MTPA 1WBXB 2IANE 3VXSE 5ICZB 2NX5E 2B8OT 4MD0A 1OGTB 4PB0L 1S7VB 1BZ9A 4MYWB 1HHJA 4P5MA 4ZODA 1OP3H 3MLPA 5C0EA 1E4KA 3UPRB 3LQMA 5I2IA 4NRZB 1TCRB 2ZUXA 4HFWB 4X6FB 4RGOH 1MJ8H 2Y5TB 1C5CH 3EDEA 3Q5YA 4ZXBC 4NN6C 3S37X 2VRAA 4H0GA 4J6RL 4PJAE 1G0XA 3Q5TA 2XN9E 4QF1A 3KNBA 4QXTA 2JK5B 3C5JA 5F7FA 2OCFD 3RWGA 1T1ZB 1W8NA 3CMGA 1AO7A 2BNUA 2ZNWA 3BKJH 4XVJL 2W9LA 3DX9B 1CS6A 3NPZB 4XPGH 3T3MF 3VDAA 4B0MM 1JPST 3CMOL 2XKNA 5E8NA 4PTTA 4GRMA 4U2YA 5E03A 43CAA 6FABL 5MP6L 3IGAA 1F3RB 1GRWA 3FB6B 3OXSA 5I1LA 1E6JH 3G5VA 3HZMB 5JLZA 4DKDC 1ZS8B 1I3RB 1YMMB 4NDMB 2CH8A 2UV3A 3BUYB 1I8MB 3WHXA 4LGRB 4KPHL 3U0TB 3EHBC 3K46A 2XZCH 2VAAA 4ZFOB 2EDDA 5CCKL 1RUML 4EI5B 4WY7H 2B4CH 4LK4A 3QUML 3FHQA 5T1KB 4M7LT 5K9OA 2ZUWA 1KGCE 1YNTA 5CP7A 3RX8A 1UKQA 5TE6H 1MSPA 4QWWD 2H9GA 2F8VA 3G08A 1I1AB 3KXFB 1TZGL 2X9XA 3K2UL 1JGDB 5GGVY 4W4NA 12E8L 2BNQD 3MRFB 3MLSH 4XPBH 5INCB 4G3YH 3QUMB 4HV8A 4HZAA 3ZKQD 1RZJH 4P4KD 4C58B 1N6QL 1L7TL 3QUXD 2F54A 15C8L 5HYFA 1A1MB 1S7QB 1NMCC 2CLVA 1NGZB 2FIKB 4Z7VF 3MACH 1PKOA 1S9XB 5I1JH 1CI5A 1U93A 4L8SB 5D8JH 1R3HA 1NBZA 2VLJE 5D2NA 1CLYH 1YJDL 4M62L 3MV7E 1QBAA 1HI6A 2ZG3A 4JPWL 3MGTA 3ZTJH 1KC5H 4ODBD 3S4SG 3GO1H 3QQ3B 4MVBD 5L88L 5J12C 2ERJC 1RIHL 3OBAA 5IGXH 3MRBA 1MAKA 3VWJA 5EO1A 2NY0B 1B2WH 5DMKB 5HGAB 5J4MA 4KRMB 2PYFB 3QDMB 5D1ZC 1X5GA 2CSPA 5CLWA 2MQ3A 2H26B 5IOPA 4JHAH 3MR9A 3WN5B 2WIMA 4JM4L 4PBVC 3U83A 2AXJA 3QUZA 5DUML 4PJFB 4FTVE 5E9DA 3KLHC 5KOVC 4GOSA 4GUPB 1A6VH 3MRNB 4GMTH 4OI9A 2PETA 3WJJC 4PJ7A 3FT2A 1KIRB 4NO0A 3WJLA 1HCFX 1UA6L 4LSSL 3O6FB 1UQSB 3EZ8A 1BBDL 3RDTC 4NQXA 2A38A 3PGCB 3ETBF 4D9QE 5I1KL 3C9NA 1NMBH 4XNQA 1U8PA 4R3SB 4PLKD 4HK3J 1B0GB 1UG9A 3QDGE 4Q6IA 3IDNB 4LCYA 3BWAA 1MLCB 2FYYA 3EFDL 3WFDH 4OV5A 2GTWA 2HJFB 1XFPA 1KCSH 3O6ML 4QXUH 4Y16D 4CVZA 1LNUB 2DF3A 4IOFD 5CEXB 3ARRA 4NC1C 3SO3B 3BP6B 3S36L 3V5DB 3VWKC 4P2CG 1EO8H 3ZYIA 3LKQA 5EOQL 1KCUH 4RMSA 4HSQA 5IVOA 1DLFL 3DOSA 2ZJSH 5I16B 2VR9A 3P9WB 3OKEB 2B5IB 2OJEA 3BKCL 2I9LA 3A67L 1UJTA 5AZ2H 1GOHA 2H2PC 4YPGA 2X1PA 1TENA 2W9EH 5GISL 3MA7A 3G5YB 1JHLL 5FKPB 1HNFA 1M7DB 1YEIH 2I07A 4N8CL 4YX2L 5BRZA 4PRAB 1PX3A 1FAKT 4WU5B 4PG2C 5CIPA 2B1AL 5I1IL 1GSMA 1ZGLB 1FZKB 2AKRB 3ESVF 1FL5A 2CRMA 1G0YR 4LHUB 2DQCL 1VEOA 2J8UB 4P23A 5KSUA 2NY6D 4ENEC 5IWLC 3MGOB 2A83B 5FCSH 1I7ZB 4K9EL 4PJGF 4PD4J 4K3HA 3WCYA 4Y5XA 2ESVB 5AD0A 2O26U 1ZWIA 4LCWA 1IAII 3EGSB 4JFOA 2GK0A 2GITA 3QEQB 1FYTD 4NQSB 4PJ9A 4LCCA 2ICES 4XCEA 5J8OA 1NGYA 5JXEC 4NQEA 3RHWK 5MI0C 8CGTA 4RBPK 4ODSL 5I8EB 2FZ3B 1CBVL 1NAKL 2A6DA 1LO4H 1HZHL 3IFPB 2WWKT 3KDMB 4CDGC 1YNLL 4U1NA 1BREA 3Q1SL 1CGUA 2JKXA 3MV11 4NQDE 4Z0XB 4K8RC 2FGWL 3TCLB 3WNPA 1CD8A 3F7PC 4L3AA 1I85A 2Q7YA 3QCUL 1GGIL 3ZKMD 4XNYH 3SJVA 4JM2D 3BPLC 2GKIA 4LIQH 1ZK9A 4HH8A 3ARGC 4PS4L 5CMAB 2N7BA 5TE7L 5T3XL 3ARBC 3IAQA 2FEEL 4NCC1 3L1OL 1F3JA 1FPTL 3ARTA 2MQ0A 4K2UH 2AXHA 4YHLH 1BD2A 1KG0A 1RU9H 1YY8A 4BH7A 4YHIB 4ZOBA 2UY7A 3LV3A 3UTQB 3DX8B 3KAAA 4I77L 5E8PA 4ZAKD 4HBCH 3IS0X 5E2TL 3IDIA 1DQQA 5E2JA 3TJEL 1NFDB 4PJIF 3VXMA 5I17A 3OAUH 1VFMA 1EGJH 4OIIH 4E5XB 1AE6L 3SGKC 1AI1H 2P8MB 2Z9TA 2F5BL 1FVDA 5FDWB 5DUBA 4NPYB 2FO4A 2W0FA 4MXWH 1FVEA 1CL7H 3IETB 3SDYH 3UTTA 2VDOH 3GMLB 1SEBB 3REWB 5C8JA 4ZNEA 1HSBB 4GG8A 2BDNL 1ZEAL 2AXGB 5ABDE 4RFNB 1VGEH 4I18A 3GSWB 3WLWD 4WTZA 5C6WH 5SWSA 1OTSC 3G9VA 3JZ7A 2D7TL 5E56A 5C9JA 1PSKL 5GS0L 5FFLA 3FT4A 2ADIA 2F74B 4XP9L 2AK4D 5HVHB 2IANA 3VXSA 4Z7VA 2OM5A 3WXWH 3FN3A 2Z93A 4JQVA 3IS1X 3PABA 1GZQB 2BJML 4HUKB 4P99A 4K55A 1WK0A 5F7WC 1MCIA 2HTLD 1RZ8A 5KAQF 1NC4D 2J6EH 1YEHH 4PV9A 2IADB 3E2HB 2WBWB 2CKNA 4LLWA 5EBLA 1TMCB 1IGJB 3DUUA 2CQVA 4OCYH 5IG7A 3UYOD 3D3VD 5EIQA 1EHLL 3EO1B 4Q9BA 1I9EA 5I1GH 1F4WH 1GAFH 4AG4H 4HIJA 4WWKD 5EU7E 1U6AL 1URLA 2WM0A 1FAIL 1XIWB 3KLSA 5C6TL 3O0RH 3PHQA 3VFWA 4POZD 4EUPB 1T80A 1BQHG 2VDMH 4RMRA 3TVMD 4M3JA 1AY1L 5DJ2B 3OQ3B 5F88B 1E28A 4P3WA 3IKCA 1U9KA 1T2XA 4WI8A 5D1XB 5SWZE 1F90L 3GMMA 4EI5C 2OTPA 4TSCH 5I75B 4YEEA 1P1ZA 4QRPD 3UTZA 1H3PH 3JTSB 3P4MB 4JFZL 4G6FD 3QEHA 4UIKH 1OOAA 2ZKHL 4P5KA 1I1AC 2YZ8A 3SO5A 2HRPL 2RR3A 3NA9H 4F9LC 1YY9C 3CK0H 4JFED 4QNPF 4PGBB 3MNWA 4F7PA 2NXZB 4LARH 3BDBA 4TPRL 4XBEL 5BZWA 4QRUB 1RVFH 1UADC 4WVRA 4HQQH 3MJ8A 3HAEG 2A6IA 1LO3L 3RKDD 4NP4H 3OHXA 3R4DA 3EOTH 2IALB 1HILA 1FH5L 1MHEB 5CSBA 4UZGA 3RVWD 3NN8A 4XP1L 3RWHB 1FNAA 4L8SC 2BVPB 2VIRB 4HWUA 4WUUE 3T2NH 3A6BL 1MNUL 2CR6A 2LQRA 5HGHA 3GSRB 3O6KL 5ISZD 5DWUH 1VADA 3NFNB 4WI7A 3PDOB 3D48R 5DA4A 2AP2A 3LEXA 3IF1A 5KVEL 2OS7A 2X4NA 2W07A 2NY0C 2OTWA 4HCRH 2EYSA 3BPOB 3IU4L 1NDMA 4YBQD 3WN5C 1VKXA 1M05B 3GMQA 2XWTB 1UACH 4KKBC 3UJIL 2BY1A 4OLYH 2WLYA 4NSKB 4L5FL 3GUTB 4R7DB 2VJXA 4HUNB 2AQ3A 2YPLA 1RULH 3QEUB 1JZ5A 2J7LA 5C0IA 1VFBB 5D6DA 4OCWL 3DV6A 2YBRB 1NLBL 4RIRA 5MEPA 3O6FC 1S7WA 5HHOA 1UZ6F 1MUJB 4HIIA 2VLKD 4WHYH 4X4YA 2VE6B 3RIAK 5AYUH 4XI5C 2AGJL 4KJQD 5E6ID 4Y88A 2EDEA 4OZIE 3QNZA 4L4TE 4F3FB 3BDXA 4IOIB 4H1LB 4N90E 4CN1A 4OLVH 4NRXB 4ZPVB 2GQHA 1BFVL 2IMMA 5C2BH 5IMMA 1D5XB 4QHUA 5JXAH 4RMTA 3WFHB 3OAYH 3STLB 2AK1L 1JGVH 3SO3C 4M7ZB 5E5MA 5JUEH 3ABZA 5CD3B 1X5FA 4MCZA 1MI5B 3QPQD 5EU4A 5KSAB 2VLRA 3PL6D 1JK8B 4X7TA 3QDJE 2B5IC 1V8HA 2VXTH 3S96A 2WK2A 2FH8A 5CUSL 5ALCH 4PP2B 3O3EB 5DD5H 5CINH 5DJYB 2CXKA 3VXRA 3M17B 1NFIA 4KFZC 4K3EH 3BH8A 4Z0BH 1RK0A 4PJIA 4YDJB 4NQVB 4F2MB 4KTYA 1CFVL 2J4WL 4X5LA 3RNQA 4DKAA 2ARJB 1UH3A 1CGVA 5TFSH 2XZAH 4XCFH 3N50A 4OI7A 4OZFB 4NQCA 1JPSH 2R1YA 5DK2B 3G04B 4HWNA 4MQTB 4HULB 2DQGL 1XZ0A 5FCUH 3O3AA 5DMJB 3W39B 3UBXG 4RCAA 1P84K 5I73B 4S1RH 3RJQB 3LPFA 4HUVB 1OPGH 1HDMA 2I9TA 5A43C 4AL8L 4QRRB 3NTCH 3ZKXB 1WBZA 2X4SB 1KPUA 4P59H 3P40A 4UT7L 3O4OB 3QXWA 3M1BB 4M7LH 3TBVA 5IEKB 1Q9KB 4KUCF 5KN5A 4FXGA 1X3DA 4ORGB 4O2EB 1TNNA 5IMKB 4XAKD 3DSFH 1RHFA 4OF7A 1I1YA 2UZXB 1F42A 2Z91B 3IDGA 3L5WA 4HIEB 1T0MA 4UINL 2D7QA 5I8OH 1FE8H 1QPPA 2X4TB 4PJHB 1CDBA 4HWZB 3FZUC 5GS1B 2VZ1A 2V9QA 1CLOL 3AXLA 5C0AB 5DFVC 4BZ2L 2Z35A 2ADFL 4IDJL 4FQHA 3AAZB 1DUYA 1MCLA 1RMFL 1HYSC 4H8WL 2VOTA 1ZHKB 1ETZA 4UIMB 4U1IB 4JZJA 3KYAA 3VRJB 2XFXB 1EGJA 5F7YC 2D7MA 1I9RL 3MJ9L 4HT1L 1Q9OB 3PIQA 4JPVL 4MLSA 1CGWA 4NYLB 2DLIA 5F6HJ 3NIGF 3UYRH 4QRQA 1ZANL 2V9RA 3OX8A 5DD6A 1G9MH 4FFWD 5E94A 3VW3L 1IAIM 2CUIA 3E1F1 2FLBT 4LVNB 1Z5LB 4TTDC 1XR8B 1A3RL 1CE1H 4RISL 1A6AA 3U46A 2BOCA 3DGGA 1PGRB 4JO3H 4MAUH 1BM3L 1DL7H 5FUOL 2JIXD 5CILH 4RFNC 5B3JF 3QI9A 3H9SB 1DN0A 4D0DA 1AXTH 1CR9L 3VI3F 4J8RA 4WV1B 2VXVH 4YO0B 3VXNA 1IKFH 2B2XL 2IWGA 4CN4A 1DQJA 5HVHC 4QTIL 3K4AA 3W0WD 5ID0B 3TFKD 5CEZL 3U30B 4HH9A 2J6EA 4XC1L 1GHFH 1LEGA 3OV6A 5HI5D 2EC9T 4LPUA 3TV3H 4UUJA 2OR7A 5GS0C 1OTTC 4UILH 3MV9D 4MQ7B 2YN3A 5D70H 4AIZA 3NCJL 3UTSD 1OAQH 2ID5A 4ZS6C 5E2UL 1YUHB 3ME0A 3E2HC 3BP7B 3LVEA 1NUFA 1NL0L 1MLBA 4Z8FH 1MAML 1CG9B 1AC6A 2VDKH 1XGTA 4MWFB 4WFGD 3F8UB 4M03A 1SY6H 3UPCA 3D1MC 1HQRB 2UZIH 2DQUH 1LP9B 1P2CB 3QQ4A 1U8KA 1S7SA 2X70B 1SYSA 2DQTH 1XIWC 2HT4C 1MFDL 5E08L 3X3GL 3HE6A 3V0AC 1PD6A 2EH8L 1LK2B 3OB0H 5D9SA 3DI2B 2IPKA 3G6AB 4OZGE 3RWCA 5FEBA 3FFCA 4WW2A 1UKTA 2IAMB 4M7KH 5DI8A 5JNYA 2OK0H 1KPVA 4YHOL 3L6FB 5D1XC 1FRGH 2NY3D 3OWEA 5CBEA 1J18A 5I75C 4M1DL 5HGBA 4MDJB 3ILPB 4OD2A 3I6LE 2QQLH 3MSPA 3U6RA 2GJ6D 4DOHE 5A2JH 4IRZL 1JF6A 1I7UA 2F8OA 4ZS7L 3DROB 2IJ0C 5DURB 2YKLL 2FATH 4CNIA 2YPKA 2R56H 2NXZC 5SWZA 3BZEA 5GS2D 1M4KA 1QLFB 2CKBH 5FHBL 3WUWB 1PKQB 1ZLUK 4UV4L 3TYGH 5C0GA 3HMWH 4LLVB 4LSVH 2OL3H 2YA1A 5C0RH 3QNYB 3SY0A 5I1HL 1DQTA 3RU8H 3EAKA 3I6GB 3LN5A 3QFDA 2G5BA 1LO0L 3BN9D 1JYXA 2ZZUT 4WUKL 1P4IL 4ONHB 1T20B 3MBED 1IEBB 2BOBB 5JW4M 5H2BA 1JZ2A 2BHUA 3AY4A 3A6CL 3H7BA 1U91A 2NR6C 4HCRA 4JFDA 1NCUA 4FQ2H 4MGXA 4XXCA 1XGPA 2F53E 5ITBL 3RBSA 1A47A 1R5IA 3S5LA 3S97C 3BYYA 1GPOL 2ICWB 3BPOC 3D0VA 3DMMA 3O8XB 1A5FL 3OF6A 4HWEH 1WC7B 5DJDA 4GAJH 4PGEB 2HTKD 4GO6B 2FDBP 4JDZA 2OI9B 1LO5B 1MHCB 3SKJH 4OIAA 4I2XA 1PAMA 1U8LB 5BS0D 3IVKA 1BWWA 1RFDH 4HJGB 5IBTL 3JUZA 1Z9LA 1DZBA 5DK0B 1LO2H 3EDKA 4I1NB 2BNRA 3UAJC 3ZL4H 1N2RB 4MD5B 1OCWL 3D18A 5CGYD 3ZO0A 4S10A 5A2KH 4AMKH 4MNQD 5JORA 4OLWL 2VERN 4YE4L 1FFRA 4XVUC 3QJFA 2WWMD 1KCVL 1IAKB 2KQNA 2D31A 3GMOA 3TZVA 5D7LB 1QFHA 3JWDL 1RJZA 4XCNA 4H5SB 1XGQA 3RTQD 2GTZA 3GMRA 5HVGB 2QSTA 4KV5E 3TBYB 1DVFA 1BF8A 2GIYA 1QR4A 3RUGE 3VXOB 1N7ML 1MVUB 4M7ZC 4YHZH 2N7AA 2HKFH 2XYCA 1C12A 5HJ3A 3B2VL 1YEGH 4JO2L 2CIKA 2R0WH 5C70A 5IESH 4OM0H 3TIEA 3D2UB 1LEKB 4JANB 2EZ0D 5IMOB 5KSAC 1J88A 1J8HA 2UUDH 1K5NB 4BSJA 4PRBA 1HWHB 5T1LD 3O41A 5F89A 3WDJA 3K80A 1BVKB 3ARDD 2DLGA 43C9B 1LK3L 4ODUA 4LKCA 1OAXL 2MHAB 5D6CA 4BSVA 3RHWF 4ZUVA 4WI2A 1YPZB 3HZVA 4HUUB 3MRPA 1TVHB 4ERSH 1JNHB 1XH3B 4F7EB 1DE4A 2XXMB 1NANH 3MPCA 4X5WB 4ONOA 3DX7A 4PJ5B 2YR3A 2P5WD 2FL5A 1AKJD 1KELH 3UC0H 2AEQH 4R4FL 3CFEB 5F97E 5DQJB 5HYQA 3I3DA 2VDQL 4LBEA 2NQCA 1WFNA 4L3ED 4YHKL 3TIDB 4Z77B 5I73C 4K7PH 3W9EB 4P2YA 4JO4L 1MFCL 3ISWA 5D7JB 1GZPA 3P4OB 1WVZA 4JRYD 4M1CD 4EDXA 4ALAL 4GRWE 4XX1G 1IKNC 3VFGH 4CJ1A 3ZKXC 3EYQD 4XVTH 2UZYB 3OJ2C 2V5SA 3O4OC 3HRZA 3VXPB 3MLZH 1EEYB 2I60H 3UPAA 5A3ID 2DBLH 1O0VA 1K2DA 2VZUA 1IQDB 5DSCB 5C0CA 5C2UB 3MV8D 3BP4A 5KS9B 1Q9LA 5DJXB 2C7UB 3G5XB 3PWPB 2HJLA 4HHAA 2LFGA 5JDSA 5C7XH 4W4OC 1C5BH 3ULVE 3CJJA 4GRWH 1ACYH 4PGZA 1L6XA 5GS1C 4NCDA 2DQJL 2DM4A 3STZA 5IQ9B 3MFFB 2FECL 2R0ZL 4PTUA 2QKIA 4PRHA 5L6YH 2FSEA 5IHZA 3LZFL 1MIEL 3VE0B 4EDWH 3GBMH 1ND0A 5FYKL 5EUOE 2VC2L 1UB6A 3S3PA 4G9FD 4HS8L 2J8OA 3D39B 5I76A 5C07B 4H8WC 4I0PD 4KKLD 1DP0A 3ROOA 1RUKL 1CICD 3ECBB 4OUUA 3U4EB 2LV4A 4LVNC 2AQ1A 4DKEH 5IB4B 3LKNB 3D5OF 25C8H 3B9KD 3MLWL 4U05A 4XPTH 4BFIA 1ZA6A 4CMMB 1JPTL 3QP3A 2E7CA 1JUFA 4X6DB 4KVNL 1SMAA 3DI3B 3NCCB 5D1QB 3SDAA 1DBKH 4FABH 4S1DD 3PWVA 4Z7WE 2ZUYA 4UV7H 2CDFB 3KPSB 4WV1C 1QO3B 5IEHA 4DK3A 2KL6A 1H5BA 2DRUA 4MNHA 2PW2B 2QJDA 3U30C 2FIRT 3FQRA 3VFUA 2DBJA 1S7XB 3EYUL 4KUZH 2EYRA 4GBXB 4LNRA 3IDMB 4JFYA 4WW1B 4DN3L 1ZT1A 5DC9B 3GMNA 1NBQA 3DO3A 3V7AG 4N1HB 1G7PA 2ORBL 3FCTB 5D2LF 1LEIB 5F3BA 1P6AB 1YN6A 1LVEA 1B88A 1SY6A 4PYGA 3RWJB 1CD0A 1HXMB 4CAGA 1FFPB 4N0CC 2IMNA 3F7VA 1Q0XL 1CFNA 4MVBC 1JE6A 2H32B 3HG1B 2Z31D 1B90A 4NBYB 1P84J 2VH5L 2ZCLH 5CD5D 3VFTB 4A2MA 5ALBL 4YHMH 3T65A 3KPRB 2DDQH 2AI0H 2IAMC 3S35X 4JPKL 4HJJH 1PG7H 4M5YL 4PJDB 1Z9SA 1F02I 3OXRA 1R3LA 3PWNB 1FIEA 2BXYA 5EU3A 3DV4A 5FOBA 2VXUL 1KENH 1A6UH 3DTXA 4PG9B 1P69B 5I8CB 1AGDB 3RIFK 5BXFA 4CRPA 1D5ZA 2CKBA 1QA9A 3HPJB 3EYVB 4PJCE 5B39B 2OL3A 1F4XL 5JOFA 4JGUA 1CQYA 4YR6A 5DO2C 5TGBB 3U4AA 1OTUC 3G6JB 1EEUA 5E1AB 4S1SH 4PREB 3ES6A 4PGDA 2OQJB 3THMH 2K3TA 4LPYA 4WIQA 1FFOB 5FB8A 4J4PC 5JW4Q 3P0YL 1TETH 5FYLD 2OMBA 2BSSB 2QADD 5D93B 2GY5A 2Y1VA 4F33A 1IC4L 1DUZA 1MCFA 3JVGA 3T0WA 5HY9A 3I3BA 4GSDH 4NNYA 4OGAD 1U3HA 1IC5H 3RIAF 1L0QA 4GXUN 3O8XC 4BFBD 1KJ2H 4IRJA 4KU1A 4F9PC 1TJHL 3BAEL 4X4MA 5KVFH 4MX7A 1YEJL 2EEAA 1Y18A 4LLDB 5JQHC 2D2OA 2OI9C 4NKOA 1CGXA 4P2RD 5IVXB 1ACZA 4HUWB 4A6YH 1KJVB 3QWRA 4G5ZH 2NYYC 4U1MA 3E6HA 5F1SA 4EVNA 4PLNC 4YQXL 1FG9C 2YD4A 4XBGB 4PJAB 3MYJB 3GNMH 2R29H 4DW2L 3IKKA 4TSAH 1CVSC 3LH2H 4WY7L 4KROD 4JAMA 4OFPA 3SGJC 3KPLB 1T6WA 1I9IH 3H9HA 3UTPE 2X40A 1VENA 2V2XB 3QFJE 1IEHA 4TUJB 2AJSH 4FA8A 4Z6AT 3C6SA 3HC4H 1RURL 3MLSL 1REIA 2QR0A 3HR6A 4ZUTB 1B0WA 4ODHL 4P3CH 1J0KA 5DQDH 3LKOB 4MD4A 1MCWW 3V52L 1IGTB 1IMHC 2EDFA 3KHOA 4ELME 2NLJA 5CJXA 2C4FU 3JWDC 5K9KA 3SN6N 1T7WA 3LRSA 3DGCR 4P2OB 4DFIA 5JQ6H 3MACL 4JRXD 4HPYH 1KPRA 2IPTH 4LLAA 2HFEA 3C5ZA 4U1GB 3ARFA 1S5IH 3VFMA 2YK1L 4MMXC 2PR4L 4RQQB 5HDLA 4IS6B 2V2WB 1LD9B 1KC5L 1WSST 4DZBA 2L7JA 5F7EH 4K23L 3D9AH 4IMKA 3RVTC 4ZD3L 3RAJH 1B2WL 4POUB 1D6EB 4XCCL 1MREL 3TO4D 3KPMA 4JHAL 4OTXH 3RY5A 4OI8A 1RJLA 4LPVA 5I1DA 3KPQA 4Y19E 5L2KD 2GUOA 2GCYA 1VPOH 4OQTH 4LP5A 5GRVK 3ULSB 1O7SA 1DLHB 4HGMA 1R5VA 2HVJB 4XAWH 2SEBB 4FQIL 4C56E 4XT1C 4GKSB 1OVZA 3QIBB 5LVEA 3B9DA 4UTBH 2VLJB 4UDUA 4QT5B 5D7JC 2ICEB 5I15H 4OFYA 1J5OH 3IXTB 4OAWA 3N1GC 5T1MA 4O51A 2C3GA 3BX7C 4AEHH 2M26A 4KK9C 1C08A 1V7NH 2EXWD 3X14B 3W81A 1EMTH 4F7MA 3C60B 4JVPA 1QR1B 3HAEB 4GFTB 1W72H 4LEXL 4Y4FA 1J0ZA 3FOMA 5EZLA 1N5YH 1C5DB 4FTVB 1AO7D 1Q1JH 2N56A 5DD3L 3LKRA 2AXFB 5EC1B 4NKIH 3LS4H 5J6HA 1RHHA 1U58A 2OXGA 1F13A 5I19L 4WI6A 4JPIB 5C09E 3JBG7 4GQ9H 3X11B 3IXAB 3OJMB 3MRIA 3ZE1E 2W9EL 2XY1A 1AXIB 4HUXB 4D9RD 1I7TA 3ARQA 4U6XB 3WV0A 3BW9B 1CFSB 1KOAA 2WANA 3PP3K 5BCAA 1K4DB 4HS6A 4BKLA 4N9GA 3RA7L 3ZTNL 2E6PA 3SDDB 3ZDZF 1MHPH 1WLHA 4XZUA 1QFUL 5EU6E 3ZHKA 3V6OA 1MHHA 4KKNA 5F70A 4WI9A 2QHLA 4OBRA 5J57B 4R26H 1RUPL 5HYJE 4I4WA 5EUOA 3SE8H 2E6QA 4JHWH 4JFHE 3RY6C 4FZEH 4HIHB 5L7XH 3DURA 4Y5VB 3T09A 5IR1B 3T0AA 2GI7A 4OB5H 4WTZG 5D1QC 5IIEB 2MMXA 4HC1H 1FV1B 3UDWA 2F54D 3AS3A 3RL1A 1IL1B 2ATKA 3LMJL 3MLRH 1CGTA 4M61B 5HHQA 3ARZA 3WO4B 1FC1A 4Y8AA 2NY5L 3WS6A 5IHUH 3OR6A 2IF7A 3QEGH 3TYFB 1Q38A 2ZOLB 4TVSa 4Y2DB 5CLTA 2YSSA 3FO0H 2XQBL 2UYLB 2XG5A 4GBXC 1FG2B 5HHPB 1LE9B 4OGXH 3TN0A 3KR3H 5DTFA 3RBGA 1INDH 1NEZA 4E42A 5IF0A 1KTLB 4TN9A 1UM5H 1UXSB 1JGEA 2VDRH 3T4AB 3VWJD 1UEMA 5EO0B 5C08E 4F7TB 3BE1H 1XR9A 1NUGA 2I5YL 3WIIH 3FQWA 1RUQL 3LS5L 4FQCL 4NM8H 2V7HA 2V2TB 4YIQA 1KNOA 2DJUA 3QUZD 3RZCB 3MGAA 1T7ZA 4Q6YA 5E9DD 1QSEB 1W0YT 3MLUL 3B2UD 4TRPL 4HBCL 4EEEA 2JCCF 4YLQT 1QNZL 4FP8H 4J3SA 4NO0D 32C2A 3NH7L 4EKXA 1XF5B 1WFTA 1AD9B 4F80A 2EIZA 1UH2A 4J3WA 4NQDB 3VDCA 1IAOB 3O3DA 3IJHB 4QHNB 2DIAA 1YYMH 1KJ3H 1S9WB 1A1NA 4TTGA 4FFYH 1KF9B 2DYPA 1ED3B 5CZXD 4PBXA 5KSBB 3EJYD 4UT9H 3V5HA 1E4WL 1G7MB 3SDYL 1S9YB 1TNMA 3V6FB 5JIHA 1J86A 2R1WB 2AJUH 1BFOB 1WWBX 3MUZ1 3EKCA 3TBWA 5B8CA 3P73A 1BMGA 1N59A 1SVZA 1WF5A 3TCXA 3LN4A 1U3ZA 2XOTA 1Q72H 2XICA 1A0QL 2X4RA 5FM5O 1KJMA 1A7QL 4N0RA 4QHMB 3IFOA 4G8EA 4DGVL 5T3ZD 2VXSH 4JN1H 1RZ7L 2P45B 3ZTJG 3V6ZB 5GGUB 2R4SL 5TH2B 2BERA 3PNWA 1KN4H 4JGMA 4NFBA 4NOBA 1TVBA 3MRCA 3KVQA 3U2SB 1QSFE 3QYCA 3X13A 2C3VB 3DYOA 4YHYB 5D93C 3L3GB 3S37H 1X5XA 2ADGB 3RNKA 2ARJQ 4GKOA 1KJ2A 2YHGA 5BRZD 1FZJB 3QHZL 2IBBA 3V4VL 4QY8A 3B6SA 2ZCHL 4HD9A 3HI6H 3OGOE 1P7KA 4XPAH 1MPAL 4UU9B 5DVKA 3TPUB 1SJHB 4TVPD 4A6YA 3QXDB 3U79A 3DX6A 4P23D 1HHIA 1YEEL 5B38A 4UQ2A 4ZNCD 3CDCA 3HRPA 4AQ1B 3P0VL 4BA8A 4KY1L 4Z78A 5JA8B 1K85A 4LCWD 2NCMA 3DSNA 4K7PY 1FNGA 2H45A 4PJ9D 4OGYL 4NQED 3V7MA 1ZTXH 2CJUL 1A7NH 5J1AB 3VFOB 3O6LH 5IW6A 3ZHLA 1H3PL 5D72L 1HIML 3HS0B 3CXDL 4JJHA 3BGMB 1G6VK 1R5WB 4K8RH 1TXKA 1WZ1H 4MA1B 5F1NB 5ACZA 3KWWA 3WFEH 4QXWA 4NGHL 2R2HA 2XACC 4EI6B 2JB6A 1A2YA 4LARL 1FGNL 3RVUD 3O2VL 3SJVD 4A2LA 3OB8A 2NZ9D 1KT2B 5ADOH 2E7LC 4PV8B 2X10A 3EOTL 1RZIB 2APWA 2R23B 4X9IA 4GXVH 3UZQA 4PJBE 5JPNB 3LRHA 4P2OC 1MCDA 1H15B 4PJEE 1BD2D 4PB9L 4FXLA 4U1GC 2NW3A 3HC0B 5EBWA 1I4FA 1MY7A 3UZEA 1NCBH 2W0PA 4PY8J 3CH1A 4ZOAA 5FF6B 1TJIL 3FN0L 1MCJA 1QYGH 2R9HD 4ELMA 2IQ9L 3W11D 4XP4L 2YRZA 3PQYB 3TNMB 4FRWA 2BRRH 4ETYA 3VXMD 1V3MA 4D9LH 4HCRL 5IJVA 1A4KB 4L9DA 2VL5B 2W9DL 1PEWA 4E41B 1I8KA 1EUTA 4QRSB 5DJ0A 4MJ2A 1QQDA 5CJQH 2FBJL 4WDIB 2OJZL 2CDEB 4OD1H 4U33A 2BVUA 3OKMA 1EVTC 1VGKB 4RMQA 4QHKJ 2DLFL 3QQ9D 3UTTD 4U7SA 3EO0B 5MHSD 2WAHA 1IM3B 3LIZH 4LPXA 2QTEA 3QIBC 1AD0A 5SWSD 3GI8H 3UBXI 3N0PB 1JN6A 4ZXBA 3FRPA 4Y19A 1T5XA 2I27N 2HYMA 1EO7A 1FNEA 3F7RA 4O4YL 4LMQE 3GM8A 3QO0A 5FK9A 4HKXA 3MJ6A 5BW7C 3A6OA 5ELIA 3D25B 1EV2E 2IAND 3VXSD 3LKSA 1G7LB 1XF4A 1OAKH 5MENA 4LPWA 1AGBB 4HBQA 3ZDXF 1MIML 5KAQG 1K4CB 4OZHF 5E2WL 2HT3D 4OLVL 3C60C 3CFJA 1TTFA 3NCFB 2DWEA 4IRSB 4GG6F 4Q9RL 4DGYL 4CADB 1T1WA 3FO9A 2X4PB 1AGCA 3VXQA 3QULA 4FHBD 1XCQB 4WO4B 4J6RH 4JLRA 5FDYA 4HDIA 3ULUE 2ZPKL 5F1OB 5SWQB 3CPLB 2BVTA 1NMAL 5DD0H 3MRHB 4KMQA 3CIQA 2XN9D 3EOBA 4LLUB 5DGRA 3RVXC 2PCPB 3BIKB 1GIGL 1HHGA 3EW3B 3VJ6A 4ZUUA 3WFCH 3S9DB 4MXVE 5IFAL 5DEGB 4Z7NF 1NCNA 2G5RA 1K8DB 2H3NB 3RX5A 5DD5L 3CMOH 1TJGL 2Y6SC 6FABH 5MP6H 4Z0BL 5IK3A 2P8PA 4OZIB 4HS3A 4L4TB 3SDDC 2VB5A 2HVKA 2ZWLT 3KPOB 1IGFH 1HHHA 2W1NA 5TFSL 3HC3L 3HE7B 3FRUA 2PKDA 4KPHH 2DS4A 3OJDB 4YDIL 5DYOB 1YEKL 4P3DA 3RKPA 5CCKH 1RUMH 4U1KA 4HC1A 2F58L 3QUMH 4Y5VC 1A6TB 4N1CA 3DXAA 4YAQB 1PQZA 4HKJB 1KIPA 4I13B 4S1RL 5SV3A 1IE5A 5C0BB 4P4RA 1QLEL 3QDJB 4H26A 12E8H 1YA5A 3P30L 4LASH 1PZ5A 1HSAA 3WO4C 4N0FB 2WBJB 4L9LB 1N6QH 1R24B 5KJRL 3GJFB 3GJEA 3CU7A 15C8H 5AG9A 3N06B 4GXUM 2O61A 4TSBH 5TDPB 4LDOB 3VRIB 1XGRA 5HXMA 2NY5C 5JPMB 3HI5H 4KRPB 4U1LA 4M8QB 2KKQA 2VUOA 4M62H 5I8OL 1JWSA 4R4ND 3GSNL 3VFVA 2X7LA 3AB0B 2K7QA 4JPWH 2VWEE 1NBYA 3C2SA 2DKMA 1CTOA 1SJEA 1LDPL 1WQVT 1EAPB 5L88H 2GK2A 4QTHA 3KYMA 1RIHH 3RZCC 2YPLD 2YPVL 4WTXA 1UZ8A 3GSNB 1KLFA 1HE7A 3ARPA 2W59A 3WLBA 4JM4H 4XBPA 4KI5F 5B21A 3FQUB 5C08A 5J6GA 3IDJB 1U8IA 3CCHB 3RDTA 5DUMH 4XMPL 4M6ML 3HKFA 4OZ4B 5T5NG 5HHOD 5F8RC 1F4YL 1MH5A 1QFWL 4PLJD 3HPLB 1G9ML 3TBSB 4I48B 5D71L 2XZZA 3QIWB 3QUYB 1UA6H 5ESVA 1CE1L 3DUSB 5ANME 4NCC2 1WIPA 4LSSH 1BFSA 3B3IA 1JRHL 4TUKH 1BZ7A 2AERT 2EDQA 4JO3L 1NCCL 1OARL 3VWKA 3KLAA 3WFZA 1BFTA 3GZKA 3SKMA 4J1UB 1QRNA 3PHSA 1V3JA 1IBGH 4IM8A 1Q9WA 2VXVL 2VABA 4D9QD 4RAUA 3RZWA 1AIFB 5DJZB 3EFDH 1I8IA 3QDGD 4O02L 5F7UA 4MJ6A 3WEXB 1BF2A 3OAZK 4U3HA 3JWNC 3O6MH 1S78D 1KBGL 1WZLA 2VLRD 3S3SA 1T83A 3JTTA 3H6JA 3S36H 2FX9L 2CIIA 4XB8A 3JV6A 1EHXA 1IM9A 3FFDB 1IFHL 5EOQH 1VFUA 4PG2A 3VXRD 4YHYC 4TUOB 1CZ8L 1DLFH 2EZ0C 4LLYA 5JZ7C 2FO1A 3BKCH 3ZT7A 4TQEL 5FHAL 2VMFA 2BC4B 4PJFF 1EBPA 3A67H 2VDKL 1E4XI 3TT1L 1Y0LA 5GISH 5EIIA 5IWLA 3P77B 1JHLH 1JPGA 4N8CH 2DQUL 3GFUA 5FKAB 1HH6A 4Z7UF 3VXTB 1RUAL 4EQ2A 3DIFA 3X12A 5JXEA 3RGHA 5I1IH 5IB1B 3LQZA 4JFXB 3PWJA 5EULV 2HFTA 3WSQL 2EKJA 4PRPB 4WHYG 2PW1A 5HI3D 1UKSA 5A1AA 4XWOC 4L8BB 5GZND 4RFEA 1T1YB 1EIBA 4EIZC 1FRGL 1WZMA 2Y7QB 2PF6A 4MD0B 1BZ9B 1HHJB 1HQ4A 4U1JA 4LOUC 2Q8AL 2HT2D 3O2DL 4OZHA 5ETUA 1NC2A 1Z0MA 1A6WL 3D85B 4MA1C 4Z7OE 4GG6A 1EXUA 4KJPD 3ARGA 1OGAE 2VQ1B 1CBVH 1NAKH 5D7IB 3ARBA 4JFFA 4QOKE 1HZHH 4IHOB 3T77A 5GSVB 5EWIL 4FMFA 4NBZB 4U6HB 4UT6L 1KB5A 3Q1SH 2APFA 4ZSOB 3PP3H 2QSVA 5EPMB 3HMWL 3JV4B 2OL3L 3DLQR 3KNBB 3QCUH 3I50L 1GGIH 1WCBB 2GT9A 4OZGB 3F7YA 2A9ML 4PIRF 1PX4A 1WT5C 1EZVY 1FL6A 5T3XH 3L1OH 4M3KB 3IFLL 1FPTH 5DJ6B 1M7IA 3LKPA 4FQ2L 3SGKA 1VEPA 1T66C 2VR5A 1A7PL 2E6JA 5ESAB 1FZMB 4PJBA 4DOHB 3NACH 3KGRA 3RWDA 4PJEA 1MEXL 4I77H 3OXSB 5I1LB 1WBXA 2YA2A 2Y23A 4YDKH 1UEYA 5ICZA 2J8UF 5E2TH 4I9WE 5F44A 1OGTA 1T0PB 2BSRA 4OFDA 3GSQB 1S7VA 3TJEH 4OFKA 2VLMD 4AM0A 3UPRA 1QUNA 3SKJL 1I8LC 2FJFB 1II4E 4NRZA 1TCRA 2F5BH 1QTYT 3CH8A 3QI9D 1CU4H 4HFWA 4MZ2A 1RFDL 1BAFH 1YNTB 4X6FA 4R90L 2DKUA 2H9GB 5DFWH 2KH2B 3P3YA 2BDNH 1ZEAH 2JK5A 4FQ1H 3L3OA 1P4LB 2Q3AA 1T1ZA 5GS0H 2F53B 2ITDB 1BVLB 4JREB 5JHDE 5EUKB 5IKCB 3IB4A 4IRSC 4YDVB 3EYFB 3DX9A 4WO4C 2BJMH 1U8QB 3WIFB 1NBZB 5D2NB 3SCMB 3FB6A 2R0WL 3HZMA 3OJVC 4GMSH 4HJ0D 1ZS8A 5ESQB 1YMMA 4NDMA 5E99L 3WNLA 3NCBB 1ZHLB 2MPAL 4TOYL 1BJMA 3BUYA 1I8MA 2NY1D 3T0EB 3U0TA 3AS2A 3H3PL 3L95A 2YXFA 1EHLH 1NFDF 4EUPH 3DETD 1B0RB 3HE6D 3OKLB 2VZSA 1J1PL 5F3HB 4EI5A 1F58L 2E9JA 3B9EA 1SEQL 1WFUA 3FFCD 3MA9L 3GI9L 4D3CL 1U6AH 5BZDA 1FAIH 1RJCA 4WU7B 1QVOB 1I1AA 3KXFA 3VXUE 5C6TH 4FQXD 1JGDA 1NUNB 3HE7C 1J0HA 1BWMA 3MRFA 2A0LD 5INCA 3RUGB 3QUMA 4JY6A 4NWTL 1NGWB 3U48A 1LGVA 1OSPL 4JG1L 3QO1B 4U49A 1A1MA 2W38A 1S7QA 1YMHB 3VFPA 3IU3B 4ZFFB 5SWZD 4C54A 4NZTL 2Q3ZA 3HTLX 4NN7B 5IBUB 2ZKHH 1NGZA 2FIKA 3TJHD 1S9XA 2HRPH 3E8UL 1OAUL 3VFGL 4EN3B 4N9OB 1LHZA 2GTWB 2WBJC 3HFML 4L9LC 5GGRB 4TPRH 4XBEH 2I60L 3MLZL 4OCLC 1LO3H 3QQ3A 4CVZB 2DBLL 3S7GA 2R4RL 2F5AH 3U9PL 1FH5H 2YUVA 5HGAA 4Z7QE 4JCLA 4XP1H 1DFBH 2PYFA 3QDMA 3MLTA 2HMID 4JFDD 2OBGA 3I2CH 1X5KA 4KRPC 1TQBB 2H2SD 3WN5A 5HPMB 1WWWX 3HNVL 1KXVC 3CVHL 3HUJF 1SYVA 4PJFA 5M7QA 3O6KH 3AB0C 1UT9A 3DMMD 4Q2ZB 4GUPA 3OF6D 3MRNA 5E1HB 3BMWA 1TIUA 5KVEH 5FUZH 1KIRA 1OP9A 4KHTL 3JWOL 4D2NA 2C4FT 3CVHB 4LSPH 4KHXL 1JTOA 5HHME 3O6FA 5EB9A 1UQSA 3MLYL 4D0BB 4DN4L 3UJIH 2P48B 3PGCA 4MMZC 2A73A 2Q86B 5I1AB 2BNRD 4R3SA 4P23B 3ULVL 2ITCB 1B0GA 4KDTC 3FAXA 3IDNA 3P4LA 4OCWH 4U6YB 5GRYA 1AQDB 5C0FB 3T2PA 1MLCA 1MI5E 1DBBL 4DKEL 4ZO6A 3QIWC 3QUYC 1NLBH 2HJFA 4Y5XB 4UNVA 3MJ7B 1AH1A 2APBA 1A1OB 2DQEL 1U8HB 2M8XA 3TZVD 4H1LH 4KUCD 1QFOA 2OSLB 1LNUA 1H3XA 3N85L 2Y72A 5CEXA 3BP6A 3V5DA 5CJBA 4FABL 1D5MB 1DVFD 4HKBB 3SDXF 2VN4A 2AGJH 4P2QE 4UV7L 4IBLT 4PRIE 5TQ0L 4U1NB 4CW1B 5I16A 4OBSA 1BFVH 3OKEA 5GRZA 3DJ9A 2P5EE 2DB8A 3LQAC 4H0HB 5JW3L 3KPNB 4EXKA 2UWEF 2V5