3FO0H

Crystal structure of hapten complex of catalytic elimination antibody 13g5 (wild-type)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
214
Chain Sequence
DVQLLESGPGLVAPSQSLSITCTVSGFSLTNYGVDWVRQPPGKGLEWVGVIWSGGSTNYNSALMSRLSISKDNSKSQVFLKMNSLQTDDTAVYYCAKHWGGYYIPYGMDHWGQGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An aspartate and a water molecule mediate efficient acid-base catalysis in a tailored antibody pocket.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
molecule keywords Catalytic antibody Fab 13G5 kappa light chain chimera
total genus 44
structure length 214
sequence length 221
ec nomenclature
pdb deposition date 2008-12-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo0H01
2Z9TA 4X80H 4OD3L 3TA3D 2YMXL 4OF6A 4Y2DD 3WMSA 1JPSL 3ELAT 4OAWB 3FAXA 3BQUD 1A6TB 1KT2A 1A6UL 5IKCA 2XWTB 4GBXC 5D1XA 1P4BH 2K3TA 4I0PB 2FEDC 1OAQH 3SE4C 3VXQA 4YZFE 3ARBB 4MLIA 4KVNL 3BN9C 4YHIA 3HLAB 3WHE0 2A6DB 4Z7VB 4MDJA 5EIVA 1HNFA 3K4ZA 3EYSH 3QUMA 3D25A 4LOUD 3LRHA 4BQ6A 3RVVC 5T5FL 1CL7I 2MCPL 2B4CC 3C8HA 4IEFB 5I6XB 2D7PA 2IBZY 3LKNB 4IDJL 3MBEC 4U2YA 4EI6A 3MLUH 3QWOA 1JRHH 5TF0A 4B5EA 4Y16D 1UB5B 4LASL 5I0ZA 5EOCH 1QRNE 5DHVH 1EEZA 5H37G 1JGDB 3MV9B 1MWAB 3LN5B 1MIEH 2B2XL 2WLYA 4UIMA 2VDPL 4U1KA 2DIJA 1U8QB 4CVXA 4HK0B 1FC1A 5B3JF 4WU5A 1TZHB 4JJHA 2GSIB 3MV7B 2VQ1B 4M4PA 5DR5L 5EIIB 1XZ0A 3F6LA 5D70L 4MCYA 2H32H 3C09C 2R56L 4M6OH 4M62H 5FA4A 2EDLA 3GFUA 3MGOA 4YXHH 2UYLA 1GGTA 3QNYB 4JG1L 1SJHB 3ZHDA 2BSRA 4JAMA 1QFOA 4BFGA 1OB1A 3WO3B 4IMKA 5KVGH 1NC4D 1ZLSH 3NFPB 2YD3A 1U8PB 2D7TL 2R4SH 1DN0A 4QRTA 2VDNL 3GJFB 3ZTJG 3VFTA 1X4YA 5BW7C 5D6DA 1DANT 1LK3H 4KMTL 2XNAA 4OLYL 1VGEH 4H8WC 5IK3A 5L8KB 3L95B 5IB5B 3BESR 1I8LA 4EEEA 2BOCB 4JVUA 1N3NB 4DW2H 1F6AA 3LQAH 1V7NH 2OR9L 2KZ1B 2YRPA 1ZHNB 3LKNA 2ARJB 1GGIH 1DSFH 5DD6A 1AIFA 1S7WA 4WRLA 4QTIL 3QQ3A 4OIIH 1NAMB 4LVOC 5CS7A 3EO9L 4UQ2A 5GRJH 2X4QA 2Y23A 3STBA 1B0GA 4S10A 4PUBL 4H1LB 3DUSA 4YHIB 2Z35B 2P4AB 1A4KA 3CFCH 4G5ZH 4EZMA 1UA6L 5F9JA 3S35L 1ONQB 4CVZA 4YFLI 3TBVB 4PRBA 2YD9A 1GCFA 5C6TH 2MJWA 3GDBA 3QISA 3DV4B 3PL6D 3EGSA 2V2WB 4HK3J 3QCVH 4QRRB 4B53A 2EH8L 5L8JB 3QCTL 4APQC 3HZKB 2G2RB 1RHFA 3OKEB 4N68A 1DDHB 1Y6NR 4KKCC 2HG5A 5DHVA 1BFVH 2VL5A 1RJCA 3P30H 4DAGH 2I07B 3OAUL 4KGJA 4JKPL 5C0CB 5J9PB 3FT3B 3VJ6B 4DGIL 4P5TD 2GI7A 2XZCH 4BK5A 5IM7B 5DJDB 2W0PA 3HMXH 4KJWD 1RZKL 2VLKD 4Q0XL 3BI9X 5D7JB 4KTYA 5E08L 1QSFA 3CFEA 3D39E 1U3ZA 1CXHA 1BWMA 5J11C 4LLYB 3ARFD 2AABH 3BWUC 1IGJB 2EDYA 4PRHB 1UACL 1FFOB 5FF6B 3DWTA 1AXIB 5F9DC 3OR7B 4GAYB 3QEGH 1QSEB 3UTTE 4HPOH 5F1OB 3KHOA 3X13B 4X99A 1D9KC 1EO8L 2MPAH 5HHOB 2FH6A 5MENA 1VERA 3SE8H 1MOEA 3QXAA 3LS5L 4ODXA 3QUXB 2B4CH 3H7BB 1A6VL 1IM3B 4MD4A 3EFFB 2BFVH 5D7JA 2N7BA 4OTXL 4B7LA 2VN7A 4IRSC 5F7HA 2WM0A 4TNWK 1S5HB 2HJKB 1VACA 5HGDA 1MQKH 2WZPD 1DVFD 1WAAA 1MEXL 4GRWH 3TZVC 3BPCA 1YY8A 5D1ZB 3BHBA 5DEFA 3G5ZB 4OV5B 3KHQA 2D9CA 4RWHA 5AYUL 4FTVD 3TIDA 3MCKB 3PWVA 1PY9A 5HYEA 4U05A 1FN4B 3DNKA 1KLUB 5EO1A 4QOKA 3TH3T 5CJXC 3LPWA 3ECBB 3QEUB 4G8IA 4TVPD 2R69H 8CGTA 3IVKB 4APQB 1JPGB 1ONQA 4CVZB 3VG9B 3OXSB 1FORH 1GZPA 1D5ZB 2MKWA 4JY5H 5GS1B 2V5YA 5I71B 4WO4B 2MSPA 1G6RH 2H6PA 2ORBH 3GGWB 2ZOLA 4ZAKA 4HW6A 4ZOAA 4OQTA 4H8WH 5HDBF 4JG1H 1F02I 4BH8A 3V79C 1J0IA 1GL4B 2O61B 4ZTPL 1Z0NA 1ZHNA 5CGYC 2CDEA 4R3SA 1NH6A 1FL6A 1UWGH 4XH2A 3T65B 3CLEL 3C60D 5JOEA 3D69A 3ARTA 5E2UH 1EFXA 4IMLA 4OD1H 4KZEL 4KTDL 4LLQB 5IHUL 1N5AB 4WUUA 3EW3B 2CK0H 2J8UA 5ILTL 1EJOH 2APVA 3N1GC 4Y5XC 2X44D 3T2NH 3GUTB 3AS3A 4WWKA 5EC2A 2CLRA 4UAOB 2PW1A 4LCWE 1BAFL 5IB4A 1RJLA 1LO3L 4KDTA 4PREA 5C07B 3GMNB 4M7LH 2Q8BH 3EO9H 3QIUD 1BQLL 3BKJH 3BUYA 1CGTA 4RMSA 3O6MH 1Y0LB 4OKVA 4OZ4B 2NY1C 1U3HB 5JXAH 4YLQT 4ZO9A 2IH1A 1T04A 4L4VB 3IJHB 2IAMB 4P59H 1P84J 5FUZL 1PEZA 3RX8A 5J1AB 1TTUA 4WEBL 1ZT1B 5BOZG 4NUJA 4RAUA 4HEME 4QCIA 1CL7L 5AG8A 5C6WH 4WFEE 5L2JB 5C6TL 3MX0A 5I9QB 3BZ4B 3VFUB 3LMJL 3S96B 5DHXB 4KROD 1A9BA 4MCZA 3IB4A 1TXKA 3VG9C 4JQIH 1ZLUH 3SDXE 3LIZH 2DMBA 3PWLB 3T4YB 2CKNA 4R4BB 2D0FA 4XHJD 5B4MD 2AXFA 4GLRH 4PP2B 3THMH 3JWDH 2DQEL 3UZVB 1MCCA 4JGMA 1VPOH 4RNRB 2R1XB 4HWZB 4JM2D 1N2RA 3REWB 5D1QA 1QBLL 1NL0L 2G5RA 5D9SB 5AD0A 1YEJH 1MCPH 4APQD 1H5BC 3EO1A 5K33A 2LV4A 4X6DE 1CLYL 3L5JA 2ZNXA 1QVOA 2K7QA 5D7KD 4XWGH 5EZLB 5DMJB 1NDGB 1TZGL 4HUMB 3W0WA 3EO0A 1A7NH 5GRYA 2FECL 4X8JB 1OCWH 3U7YH 1JFQH 4HWBA 4ZTOH 5C09D 4LHUD 3ZDXF 3LS5H 4TQEL 5GSVB 3WO4C 3IDYB 4TSCL 1KN2H 3EZJB 3CMOL 2Q8AH 3QNZA 3FFCD 3U36A 4R90H 5D7IF 3QDJB 1IKNA 3K8MA 2J6EH 3FO2B 5F70A 3OR6A 3GMLB 1H3VA 4JREB 1ZVHA 3RWFA 2R2BA 4PP2A 3BRGC 3EHBC 4G43B 5ID1B 2YPKB 3MRJA 1A02N 3O6LH 2H1PL 3QUYB 4BSJA 3SN6N 5KSBF 1CD1A 4YQXH 3U6RA 4P46D 4YHOL 3RY4A 3FMGL 4U33A 2VLKB 1CDUA 1I8KB 4IMKC 3V7AG 3OZ9L 3QQ4B 3QUKB 4E0RB 1BF8A 3JZ7A 4YHMH 5DEGB 1CLZL 1I7ZA 4NP4H 5ICZB 4YAQB 2R9HD 3QFJD 2VLLA 1W0YT 4YHKL 1M7DB 5L9DL 5FCSH 1CGUA 3NZ8A 3PWLA 1HH9A 1YQVL 1G7HA 5DUPH 2FBOJ 3GMNA 4NN6C 5TDNA 4K94C 3O3DB 2H8PA 4QY8B 4N0UB 4NIKB 2ICEB 1HN1A 3VWJB 4LDEB 3I75B 1T83C 3ZKNC 4L9LC 4XMKH 3NCEB 3RVWD 3NIGF 2WQ8A 4P2RE 1ZT1A 1QA9B 1KB5H 3L6FA 1J8KA 4P4KA 4MA7H 3GIZL 5I1GL 2C3HA 3R0NA 2P8LA 2X4NB 3MMEB 1DQML 1SYVA 5FM8A 3GSNB 4DOHB 5GS0H 2DLTA 3EYVA 2NY7H 5JIPA 4M7JH 3C9NA 4YHLH 1A4JA 4Q97A 3MBXH 3BGFC 1M05B 4K3DH 3BE1H 2L4OA 4NUGL 1U8JB 5EUOE 5D7LE 5FYJD 2BRQA 5EFIA 2EC8A 3HB3C 2P8MB 1T7VA 1TCMA 3HZVA 3O6ML 4NO0B 3EOAB 4MAYC 3DX7A 4HUUA 3P4LA 1F11A 1KLFA 3BIAX 4OIBA 1G9NH 1PG7X 5DMYA 2AQ1A 5IMKA 1I7UB 1CICC 4R96A 1RULL 3JWDC 4PG9B 4ZNCD 3RGVD 1QRNA 1FC2D 4M5ZL 1C7TA 4U6YB 3X17A 3QIBB 4UUJB 2XQYG 4Y4KB 1FFPB 3PHQA 1DQQB 3QH3B 3HCVA 4W70A 2J7LA 3VFMA 4HWUA 4JLRA 4BFEA 4ZFGH 2IQ9H 4OZFG 4XCFH 2P8LB 3JV6A 3P11H 2HVKA 2CLVA 4RQQA 1TVHB 2NPLX 1C5CH 2NY1B 4KHXL 4HWBL 4QHNB 5KVFH 5T1LA 4ODTH 4JN1L 5EORH 2XOTA 5GGTA 3I75A 3MV9D 4PRID 3HR6A 5HVHC 5BRZB 4YAQA 3OJVC 1SY6H 5E8NA 4LCCB 4M7ZC 1MF2H 1CI5A 1J12A 3MRQA 4PJ7B 3ZMRA 5D7SH 2RHEA 3ZT7A 1XH3B 3RVTD 4NQED 1T3FA 4L4TE 1VKXB 3MLVH 4QHKJ 1RVFL 4Z7WE 2R0ZH 5DRZB 2EYSA 4GQ9L 2OTPA 4HUKB 4LEXH 3C5ZB 3MODL 1FYTE 1T21B 1SEQL 4ZS6C 2P44B 5E0QA 3GHEL 4TSCH 1SHMA 1NQBA 4UI2A 1CD1B 4Y4HA 4PLOB 4M93B 4PJ7A 3GBLA 2N7AA 5SX5H 3WE6B 4UZGA 4JPWL 2WIIB 4CUCA 4OD2B 3MRBA 3U7AA 1BQHB 1RV6X 1Z5LB 5E5UB 1RJYA 2QKIB 4R6UA 5IHLB 4LKXA 1J8HA 1FV1B 3S88H 4I2XA 3O2DA 3O6LL 3NCJH 1JP5A 2NXZD 2OZ4L 1CVSC 1XGPB 4F9PC 1ED3A 4YQXL 3ARRA 1W8OA 4JZJB 1S9VA 2CK2A 3CXDL 1T1YA 4PJ9D 4UILL 1G6RB 4YHML 1DBMH 1OAXL 1XGRB 1IGIL 1ZANH 3HZMB 5GRVK 1Q72L 1I1AD 4KV5F 5I71C 3H9HA 3DSNA 3FQRA 1XF2B 4MHHI 1YQVH 5E5MA 2P43B 1A22B 3PABA 1FFPA 1T66C 1NJ9A 2P8MA 3DX6A 2Y9RT 4KV5E 4AENB 1GGUA 1UZ6F 4P5KA 4DVRL 3S4SA 3GK8L 3K8LA 5BXFB 4IOSD 1I1FB 2X4OA 2NY0B 2J1KA 2X4RB 4PLKC 2UYLB 4KY1L 5KZCD 4NNXB 4F7TB 4OGAD 1FBIL 1U8PA 5DJ0A 3GBNH 2NY2D 1CDCA 3FRPA 4EVNB 4ODHH 3GI8L 3QJFB 4ZSOE 4YHYC 1VFBB 3CFJA 4MA1C 3RVXD 3BPLB 4RMUA 3O6FA 1QA9A 4OCSH 5D6DC 4AJ0A 1F6AB 4MQXC 1JNLH 1WCQA 2E7LC 1JI1A 5ALBL 1CU4L 4LEOA 3TH2T 1OSPH 4XVJH 5BV7L 1T20B 2FO4B 4L9LA 5FO9B 4HKXB 4OF3A 5FYLD 4N1CA 4FTVE 3JWNC 2P24A 3DRQB 3ULVH 3P9WB 5L0QC 2DQCH 3TBYA 3SO5A 2JB6A 4LSSL 4YDIH 4BUHA 1RJLB 2C3VB 3NAAH 3P77A 4LLDB 2IALB 4ODWA 5EC2B 3QUMB 3GSUA 1D3CA 3T65A 5C08D 5ETUA 1AR1D 1NC2B 5ADOL 2AJYL 2EDEA 5AZ2H 5H94A 4AENA 1ZA3B 4XCFL 3LOWA 1RAMA 4RWYH 1T2QH 4JY6A 4MWFA 3VFSA 5E2VH 5T1KD 5IMLA 1WZ1H 5D2LE 2DI8A 2ICWJ 4FTVA 1B9ZA 5FCUH 3TJEH 4L8DB 3MJ7B 1AR1C 2EE3A 3LKOA 4S2SB 5MHSD 1EEZB 5TE4L 4FQJL 4V1DD 1ZLVK 3MBEB 1D9KA 4QGTA 5F6HI 5TE6L 4I4WB 3O6FD 1MJ8L 4KUZL 1PG7L 1G9EA 5T33L 3QRFM 1S7RA 4XCNB 1U8LB 3WBDA 5CD3A 1IGFH 2PR4H 4OZGA 1F00I 2ZCKL 5CEYB 3WS6C 5J6GA 4Q9QL 3MRRB 1UWEL 3MRGB 5ISZE 3O8XC 1GZPB 2DLIA 1A1OB 4JGUA 1XF2A 5BMFL 3EZ8A 4YBQD 5C9JB 5SV4A 4Z6AT 3IDIA 2VLRD 2ENSA 5A40E 2E6PA 4PJFF 4B50A 3GHEH 3OAYK 3DX6B 5IR1A 2YUXA 1JPTH 5DWUH 1NDGA 3VW3H 3AXLB 5E5MB 1J05B 3DO3A 3SCMA 1N26A 3BPNC 2E9IA 4UT6H 1HIMH 5HGHA 4J3SA 4MNQA 4GSDH 3MRPA 3P3YA 1B6DA 2PETA 4O51A 1WBZA 3ULUF 1VEOA 3FRPG 1CFVH 3U4EA 2UWEE 5DVMA 4U6XB 4PGJA 4JO3L 4DQOL 3ROLA 1U3JA 3LVEA 2R2HB 1EAJA 3UAJC 3MJ9H 1ITBB 2V5SA 5KSAC 2Z31C 2VOTA 3V52L 1AD0B 4D0DA 1MAKA 5I0DA 4OZHA 1SVZA 4JKMA 3FOLB 5C3LD 1J11A 4HBCL 4PJXE 2XG4A 3KPMB 3C5ZC 4ZUWB 3MLXH 1UQSA 4DFIA 3C6LA 1J18A 1U58B 5EU6A 5F6IB 5FECA 2YA2A 2AV1A 3DRTB 5E9DA 1EXUB 2B1AH 3LN4A 4MNHA 3MRPB 4PJ9C 1VEMA 3T0EE 2XKSA 1OAZH 5T1KB 5F1NA 1G7QB 1AY1L 2DICA 1KFAL 2QHRL 1YEDA 3GMPB 4ZOBA 4YPGB 4IDJH 1QEWA 3UJIL 4QWWC 2LU3A 1X5FA 5DRNA 4Q9RH 3VXUA 4U7SA 2APFA 5BJTB 2VWEE 4HZLA 5HGBB 3IDJB 5AG9A 1VSCA 1ZT7B 3JVGA 3RPIA 4WNQB 4MMXC 3F5WB 4NKMB 1O7SA 3WIFB 2YC1A 5IMKB 1I1CA 2BSSA 2RJMA 3U0TB 3ZKND 4MD5B 5IHBA 5F7WC 1NCCL 5E4IA 3VH8A 5D7JC 1HXYA 3MRCA 3D69B 4RDQF 4YPJA 2KH2B 1G0YR 1P9MA 5DQ9B 4M8QB 1T03L 3QSKB 2BMKB 3PWPE 3L3DA 2W91A 5KSBE 1IZJA 3TCLA 1N5AA 5D1QD 5H2BB 3PWNA 2Y7QA 3CH1A 2IMMA 5DJXA 2WSKA 3S36L 4DN4H 1JV5A 5CJOH 2RB8A 1ZLSL 3S35X 3LEVL 4NWUL 3EJZC 1VENA 3DMMD 4L1HA 5F7FA 4W6WB 3G9AB 3REVB 3BP4B 1CGSL 1NUFA 1NGXA 1DEEA 4UTAH 4DW2L 1V7NL 3RHWK 4TVSa 1V3MA 3AREB 5HI4D 4MA8H 3EJZD 1C08A 5AZ2L 1SEBB 2ICEA 1T2QL 5F7EL 4NO0A 4LSQL 2OJZL 3VGAB 3CU7A 4QF1A 1RMFH 4MA1B 3V6OA 2C7UB 2DQGH 3STLB 3FTGB 4K07A 4KK9C 2W0LA 3N9GL 4Y19B 2DYPB 4HT1L 3G5VB 3NH7L 1K9TA 4G5ZL 2H2PD 1TMCB 5EUOB 3LQAL 2PTUA 3NA9H 3BP6B 4WY7H 5K9OB 3TP4A 3WFHB 3GSXB 25C8H 5IFAL 4P4KC 3M1BB 4OF0A 1KCRH 2C26A 4XMPL 3FO1A 1RK0A 3N1FC 5K9KB 2FD6H 4QTIH 5DVKA 5ACZB 1VFAB 2IAMC 4JM2C 1FNGA 4GKNB 3QQNA 3QCTH 4GKOA 1HI6B 1K8IB 4GFTB 2AV7A 3S34H 3JWOL 3DTXA 2CKBA 3EJJX 5SWZA 3SDAB 1UJ3A 1T1WB 3P30L 2H8PB 4QY8A 2JCCB 1N64H 3FO2A 3SDDA 4DUVA 1UA6H 4G9FD 3S35H 3GSOA 4EI6B 4GXVL 4K71C 1U8MA 5GZNC 5KAQG 4YZFF 1RZ8B 4ZO8A 5DK0B 2BVOB 3PP4L 4M6NL 5E08H 5DRWB 1RQ5A 1FFOA 1R3LB 4GSDL 3T0DA 3KPRA 3H9HB 4WGWB 1I8KA 4DZBA 3JTTB 4JFPA 3G9VA 2VL5B 4XCCH 4DAGL 1LD9B 3OAUH 2ZPKH 1QHPA 4K9EL 1VFMA 4HPOL 4QRPE 1T4KB 4KPHL 5IMOB 4QRPB 4IS6A 3NBNA 3X12A 4MGXA 3PQYA 2NYYC 5I15H 2Q76A 2A77H 3FOMB 3EBAA 3Q3GA 1MRFL 2Y06L 2PXYD 4TTDC 2A73A 4R97C 4N0CD 4EOWH 5EH1A 5B3JE 2DD8H 5D9SA 1T0NB 1OAZL 4M6ML 5KW9L 3BP5A 1CXLA 2DIAA 3U46A 3NTCH 4GW4A 1EJ6A 1H9VA 5ADPL 3AUVA 5CJQH 5LAXA 2MPAL 5KAQF 3T2PA 4X0KB 3BVNB 4R7DA 5I73B 2PN5A 3QZWG 1RJZA 3BT2H 4Q9RL 2PYFB 1K8DA 2NW3A 5C0RH 3V6FA 5TFSH 2X4PB 3KXFE 2Z91B 2O5ZH 2AJUH 4JM2A 4KRLB 3RVVD 3TWCH 5DF0A 1QVOB 4JFEA 5DD3H 2CIIA 4Z7QE 3D18B 5I8KH 4PJEB 4RFEA 2EDNA 3EAKA 4F37F 3FQTB 1K8IA 2LFGA 5B4MC 3I9GH 5GJSH 1U8HA 3FN9A 4R2GD 5ETUB 4FFWC 2Y72A 4LPUA 3MRHB 3HS0A 3VFRB 6FABH 1FE8L 1HOCB 1YEKL 4IRJA 1E4XL 4U1IB 4HKZB 3M17B 4R4BA 1ZT4A 3QG6A 3ESUF 3GSVB 4ELMF 5IVXB 1YEHH 5BV7B 1P53A 1OAUH 1UJTA 4GRLC 2HKFH 5GGVY 4CNIA 3STLA 3I50L 5GGSA 4EUPH 1T7ZA 5IHUH 5CD5C 2H41A 1KGCE 4U1JA 3GRWH 5EUOA 2PW1B 1XF1A 4UNTA 2FECI 1CXKA 1F90H 5KSVA 5T3XH 3BN3B 4WENB 2EO1A 1CG9B 1IGMH 3RL1B 4CL7A 3Q6FA 1IARB 3SOBH 4XBEH 3RX5A 4XP4H 2E9BA 2EKJA 4WHTB 5DZNA 4Y4HD 5GS0D 1ZEAH 1BFOB 4TUOA 5C6PB 1TQBC 4HT1H 1V8HA 4PJ9A 5I73C 4UBDD 1KV3A 1QPXA 3PDGA 3UTPE 2WUBL 4QNPF 3PUCA 1VGKB 4HJGB 5FKAB 43CAB 1NBZA 5MHSE 4YX2L 3MUY1 4RDQG 3DECA 5CMAA 4IHOB 1YNTB 3QBTB 4DJMA 3H42L 4LSVL 2ED7A 4HIEB 4WO4A 1CICB 2F53D 1I7TB 3E0GA 2NR6D 4F9LC 4OCRH 2VH5L 1I3UA 5C08B 1FYTD 3IU4H 4WEBH 1QLFB 3BYTA 5DURD 5FGCE 1UCBL 3FFCB 3B9EA 4IIQC 1CTNA 2HRPL 2H6PB 4X9IA 1ZHBA 5HI3D 5BJTA 1A6AB 4G8IB 4A2MA 3VGAC 2CQVA 4JKLA 1EGJH 4K8RC 2Q76B 3O6KL 2DWDA 1R6VA 3MRIB 1KXQE 2BVPA 4NOBA 4KKAC 5KANG 3GB7A 1LK2B 2VE6A 1YYMH 3V5KA 2BSTA 4LPXA 3IDJA 1NKOA 3GBML 4Y16C 3M07A 3B8YA 1YA5A 1QBLH 3T0VA 3ZYJA 5MEQB 3MRLB 3HE6B 3WKML 1TJGL 3ARPA 4M9PA 4PJEE 4E42B 4HPYH 4U6VH 2D2OA 3B9KA 2OTWA 5TH2A 5HHOE 1KN2L 4HJJH 3V0WL 5I76B 3IRPX 2HJFA 4LLVB 4ORZC 2Q8AL 5HYSA 5GRJL 3LN4B 4MNHB 3TA3A 4RMTA 2W9DH 3CFDA 5DLMH 4GUPA 3V5HB 2EEAA 3F7PC 4TUKL 5EWIL 3LV3A 1IEAA 2R2CA 5D2LF 4FHBD 1WWBX 3I6LD 2IC2A 2AJVH 1QP1A 4UB0H 3RNQA 5C0AE 3I2CL 2IG2H 3B9AA 2HFEA 1QLFA 2UVEA 1SM3H 3CU1A 3BT2L 3PE9A 4ISVB 4K9EC 3GMRB 5CINL 3T0XA 2PNDA 2BVPB 3SQOL 4G9DA 4ZNEA 1IGYB 2NTFA 1WK0A 4WU7A 4AIXA 1LP9E 1UVQB 5TQ0H 4IBLT 1XR8B 5D5MA 4XNZC 3MZGB 2UWEA 3SGDI 2IANA 1BBDH 5IEHA 5GGRA 3C09B 2HVJA 2W0FA 1HWGB 5DD3L 4Z8FH 5I16B 2OL3B 5FM5O 3VFGL 3RGHA 1F3JB 4QRRE 1TCRB 2C3XA 4HIEA 35C8H 1JHTA 3MRIA 5ENWA 5DJCB 3ULUE 1NCTA 3Q2CA 3PGDB 1A7RH 1A7OL 5CMAB 5J6GB 4N90D 2DQHL 4Y4KA 3MCLH 4PJ8D 3C8KA 1DLHA 4ZO7A 1BQSA 3H3BC 5F9JB 5AD0B 1OGAA 2JKXA 1OP5K 1T0MA 4LOUC 4H0GA 3BSZH 3VGDA 4C4KT 5EA0H 1T66D 2BNUB 2C1OB 5BZWA 4PGDA 3I02A 1MFDL 1OQXA 4LSDA 2XV6B 4H26B 1NMCC 4C56E 3HNVL 3JTSB 1X6NA 4LPCA 4P9HH 5GISH 1EHNA 2HWZL 1C5BL 4N0FB 5C0GB 2APBA 3WNPA 2ITCA 3OKLA 4HH9B 2WUCH 1DBKL 5IT2L 1FNEA 4YHLL 1FCCA 3MRDB 1MQKL 5JA8B 5M95B 3RZCD 3F8UB 5DC4B 5B22A 4I13B 3QIBC 1Q0XL 2IALA 1EIBA 2AXGB 2OX5A 3FQWB 3DXAD 2MKLC 1JZ6A 5HI5D 1I85C 4NQXB 5J12B 4OCWH 1G9NL 3AFLA 4XI5D 1BZQK 4NBYB 4BQ8A 4NQVA 1QZ1A 4ZFFB 4EKXA 4ODWB 4WI3A 2WWKT 3HB3D 4EQ3A 1D6EA 3KPQB 1F3DJ 4NUGH 3H42H 4XNQB 3SDXA 1CD8A 3LKRB 5ISZD 1MHPH 3Q6GL 5JDJA 3OXRA 2WWMD 2IEPA 4I9WE 5D7LA 3ZDYE 3F6IA 3QJFA 1MAML 5BZDA 5EO9A 3FQWA 1KCLA 4XWOC 4HIIA 1IL1A 2B0SL 5A2IH 2VLRE 4KK8C 3WNNA 1G6RL 2ORBL 5I8CB 2ED9A 1PDKA 4JFYA 4N8VB 1YUHA 4YIQB 4ZXBA 2AQ2A 1QYGL 2UZIH 5CSBA 4AH2B 4JQXA 3KYOB 4HV8B 1IAMA 4JPKL 1ZSDB 5KOMC 4XPTH 1G9MC 4LFHD 2AK4D 1CLCA 4DKFL 1QSED 2DQIL 1EEYA 4WTXA 4MNGE 1FL3A 4GAGL 2WNGA 1C5CL 1WICA 1NGYB 2DQFA 3WEXA 5HY9B 4PLNC 4MNQE 3MV9E 3ARXA 5FB8B 3HMWL 2EO9A 3MRNA 1HQRA 3NFSH 5CEZD 4OF8A 3MV01 1MHEA 3G6DL 1UWXK 3ARBA 4Z76B 1XGTB 2DBLH 1IM9D 1MJUL 5IB3A 2FR4A 5DJCA 1UXSA 1KTLB 5E2JA 1NDMB 3O3AA 1U3YA 5TPWH 4HJ0C 1IQWL 2R0LH 3BP5B 1K5NB 2OTUA 5KG9B 5D2NA 4U0RB 3BPCB 1CL7H 4WW1A 5BRZE 1HINH 1ZHLA 2NX5A 2OXHA 3QHZL 3VWJD 2AJVL 4JFQA 3AAZA 1P7HL 4P23B 3QFDB 3K3QA 4NDMB 3VXNB 3L5HA 1PY4A 5IW1A 1MHEB 3MZTA 5MI0C 2CXKA 5D1XD 2DKSA 4U6HA 3CXDH 4OGYL 4PGEB 3QFJB 4OFDA 5C0DB 3N06B 1J8HB 4GRMB 1A3RL 2BC4B 3VD4A 1G7IA 1L7IL 4U1LA 3LEYH 4AM0B 3QUML 2DLEA 2BOBA 3TA3C 1DUZB 3RBSA 3DXAA 2NX5E 2WBWB 4WV1C 5DC9B 1NL0H 4I18A 4P46B 3D3VE 4DUXA 4NT6A 3P4MB 3LCYA 1FHGA 1FLRH 1MI5E 4LQFL 4XBGA 1T3FB 2C4FT 1KCSL 4XWGL 1YUHB 4MJ4A 3UCRA 5EU7E 4QRQA 4PLJC 4QEGA 5IV2A 3CSYB 1QR1B 3R06B 2F5BL 4NC1C 1V3LA 4MXQC 2SEBA 1K2DA 4YDJA 5F1IA 3FFCA 1T6WA 2XZQL 2F8OA 1KXTB 2ATKA 4X7TB 3DMMA 2CO7B 4NQXA 4RAHA 4WUUB 4PLJD 1P4LA 1OM3H 2F54E 1DBAL 4CMMB 1C5BH 2JJTC 3CMOH 3U4BH 1RFDL 3D85D 4PJHF 2DJUA 1KXVC 4ONGL 1A7BA 1JK8B 2HA1A 3MNZA 4J1UA 1JRHL 3MXVH 1RZ7L 4F7PA 4NFCA 3JUZA 1Q0XH 1ZA6B 3IDGB 4LASH 3BP4A 4U6YA 3NPZB 4EVNA 1FJ1B 1JNNL 3QRGL 2FHFA 4OFYA 2HFGL 5JNYA 2ITDA 5TDOA 1S7QB 2PTVA 3D0LA 4F57H 3B3IB 4QTHA 4D2NA 1GGBL 5IB2A 1HXYB 1MCRA 3QXWA 3SGDH 4MQXD 3V7MA 3L1OH 2YBRA 2RFXA 3U1SH 4LQ1A 4M8VA 3SDCC 3OV6A 3P9MA 2HAZA 5CUSH 2VDKL 3TCLB 2Y5EA 1QQDB 1PVHA 5FDWA 3HPLA 1OPGL 1ZVYA 4YXHL 3W0WD 1A4JB 2ZG3A 2Z8VC 3BDBA 3GGWA 3QUZD 2X1OA 2FX8L 1ADQL 4XRCB 2AK1L 1CFNB 5FA3A 3VXSA 2D03L 4Y1AE 3HZVB 1F4XH 5LBSL 1S7QA 1E4KC 4FQXD 5DMKB 2WINB 5DUPL 3TPUB 3DGCR 5HVFB 1AO7A 4ELME 1QYGH 2UZIL 2YKLL 4CAGA 1KEML 3S37L 3TN0B 1MVUA 2ZUQC 1V7ML 4BZ2H 1XCQB 1EERB 4PJBA 3SO3C 2HVJB 2IAMD 4XMKL 5JMRA 3KLDA 1PG7H 2CH8A 3H0TA 3HNTH 3O9WC 1U3HD 3BKMH 2CRMA 3OKNA 5I8OH 3BGAA 4HLJA 4C57C 4YBHA 2R8SH 5GGQH 3H7BA 4KKLD 3LKSB 5DFVD 2QSQA 1L6XA 4JDVA 4OZGF 3F7RA 5E1HB 1PFCA 3K4DA 2AJ3B 1EH9A 2R2EA 4U1LB 2QQLH 4K3DL 4KUZH 3VW3L 2R9HC 4GXUM 1KIUA 5DVLA 2XKNA 4XHJC 1HH9B 5LJYH 1JMZA 2Y36H 1BOGA 2APXA 4OBRA 1AGFA 2ZCKH 2SEBB 1O5DT 2F8VA 3HG1A 4UT6L 5SWSE 3HE6A 4NQSB 3RFZC 1J1XH 1Q8MA 1A6ZA 5AAMA 5CP7B 1D6VH 3AXLA 2R2BB 2R1YB 4Z7WA 1LHZA 4JQVA 3KLSA 2VXVL 5FKPB 5E03A 5F89A 3HRPA 5IR1B 2N1KA 2ADIB 5DD0H 2ICCA 5JOPE 3I6LE 5I18L 2ZUTA 1RSFA 1WAAE 3AMKA 3E2HB 1S9YB 1L7IH 3LEYL 4YGVA 3GMLA 5M94B 1U6AL 2XQBL 5C08E 3U9PL 1Q9KA 3PHOA 1U8LA 5J12C 4ZUUA 5EU4A 2VE6B 4FQIH 4TULH 5IMOA 3P0VH 2ICWB 3TBTB 1UACH 4NCC2 3CLFH 1A7PH 4KTEL 2DLFH 1J88A 1DL7L 1LEIA 5EBWB 4J12A 3BDYL 2YK1L 3KLAA 4ZUVA 1KCSH 3AB0B 4R97B 5D1ZD 4L4TB 5EU3B 2VN4A 2FATH 3UTZA 1RIVL 4GG6E 2LU7A 1WVZA 4M02A 4MA3A 4PJEF 3TIEA 3UDWC 1JGUH 3QIBA 4ODSL 2V2TB 5C08A 4MJ6A 1IQDA 4I18C 3N1MC 2X70A 1LMKA 4JO2H 5BQ7B 3L95A 4JO4L 1DBAH 4PRIA 5MENE 5JW5B 3GM8A 2QQQA 4EI5C 4AY0A 4LARL 5ABDE 3AS0A 3TJHD 4PB0L 4JG0H 3UTOA 5A2JH 2BDNH 4XNQA 5TF1L 1ORSA 4PJ9B 1FVDA 5EOTB 1RK0B 3UC0H 2FJFB 4JAMB 3LAFA 1EDQA 5J56B 5IQ9A 4UU9A 4P3DA 4BUGA 5C07E 3S36H 2BNQA 2B7DT 4EN3D 1SMOA 4F57L 4NUJB 3NFPA 5D7JD 1OW0C 5GGSB 2W60B 1KN4L 3BH8B 1OB1B 3L3IB 5JIIA 2HT3C 1GC1L 3MUGB 4HIHA 2BHUA 4HGWB 1MRCL 1Q0YL 1ZANL 1HOCA 4K7PH 4TSBL 3MRDA 2W9EH 1G7PA 3RRQA 1ADQH 3IJHA 3TO4A 1J0JA 3G5XB 5DHYB 4MQSB 5F7EH 4TNVF 1FZKA 3KPNB 4DN4L 4LCIH 3MV7A 1GHFL 2EYTB 2JE8A 4QRRD 2CD0A 1IKFL 4DGVL 2UZYB 5D93C 3KPQA 1NJ9B 4PJ7F 2MCG1 1AC6A 1MSPA 2GJJA 4PBXA 4KDWA 3T08A 3W2DH 4KTDH 4RAVB 4WV1A 4BZ2L 1CGSH 4G8GD 3LB6D 3WSQH 4GKZB 4MVBC 3HNTL 4NGHH 4WTWA 4JKKA 2XFXA 1QLEH 3OKLB 4CKVX 1CR9L 3U6RB 1SJXA 3ZHKA 4M8QA 1KEGL 3MLSH 4PRIB 2OJZH 4LSUL 3CNKA 3UJTL 4P9ML 1K85A 4D94A 2GCYB 3T3PF 2GT9A 5GS1A 5SWZD 1JV5B 4M61B 5GRZA 2XWBB 3U46B 4CVWA 5BXFA 1UH3A 4WI6A 4OCSL 4PJ5A 2VYRE 2BY2A 4ONFL 4F7EA 4FRWA 3UTZB 5ALBH 5FYKD 4ZUUB 2JJTA 2E7HA 1OP3H 1KIQA 3LMJH 4HUVB 2BNUA 5HHXH 4JFZL 4NZRH 3O81A 4JO1L 1OT1A 3NCMA 1P4LB 3LIZL 2YC1B 3I3BA 2J2ZA 2LTQC 1F58L 3E3QE 4Z7UA 4G6JL 3IVKA 1A6PA 2A6KB 1AD9A 1WWAX 2R0WH 4G8GA 1HILB 2CIKA 1FQ9C 2AV1B 3DRTA 1MLCB 2OR9H 2J4WH 1OTSC 4XTRC 1FVEA 3WE6A 4XB7A 4KRPD 4G8EA 5I18H 1VADA 4HWEL 4QHMA 4G9DB 2XN9A 5DK0A 3NACH 3SDAC 4MNGB 1LDPL 3D39B 1LO5A 5E5RB 5E8PB 3MXWL 4PTTB 1EBAA 4P2QA 2DD8L 1RUMH 3KR3L 1QSEA 2BXYA 3DXAB 5DUBB 4XCYA 4WU7B 3P0YL 3TVMA 4KPHH 4YEEA 1KELL 1YC8A 1FZOB 5FUCC 4LLVA 3T0BA 3ARDC 4PGEA 3LDBB 2G75B 5E6IB 4X99B 4UIKH 1UWEH 2VLRB 4NRXB 3NCYP 2P5EB 4OI7A 4FFVD 3QXDA 4YNYA 5E2WL 5F6HJ 2ATPB 3ZYIA 2AJUL 4PTTA 1WFNA 1RI8A 1BFVL 3BO8A 1V3JA 2A74A 4PJCA 2E5EA 5ACZA 4JKPH 1E4WL 2GJ6E 4KROC 5CJQL 1REIA 2OQJA 2G60H 1KJMA 1F4AA 3MLTB 4C4KO 1I8IA 5E00B 1HILA 4QT5B 4LVNC 5ERWB 2BNQD 1NCWH 5GGUB 1ODAA 1LDSA 2BERA 5I19L 5D5MF 4RGMC 3FT4B 4LP5A 1CLZH 1UYWH 1SQ2N 3UPAA 3U9UA 3RTQA 5FUCE 5C1MB 2NXYB 5GJTL 1IEBB 3RZCA 4LCUA 4TOYL 1CE1H 2V9TA 4KKBD 5TDPA 5DQJB 3RL2A 3VXRB 4XH2B 1LQSR 5D2LA 3HCVB 4K7PL 4WUKH 2B4CL 1RZJH 1A6VH 1U0QA 2I9TA 3OF6A 1QQDA 5CGYD 2BK8A 1S9WA 1WTLA 4P2RA 2XWBA 2H2SD 1I7UA 1GVIA 3CC5A 4Q6IA 2X4QB 2CR3A 1IKFH 3HFMH 2WWKO 3KS0J 4GBXA 4PTUB 5GRXG 1UKTA 2ZUWA 3U79A 3RWIA 3VA6A 5EO9B 3W2DL 5H35A 4CNIB 1K6QH 2F9BT 5D6CA 1BD2A 5IF0B 5HI4C 3DMMB 3UTSD 5C8JA 4J1UB 3GSVA 3MGTA 5FK9B 2MHAA 3G6AA 4RIRA 2XQYK 5SX4H 4L4VE 5T5NF 2NZ9D 4URTB 4JM4L 3EYVB 3WIHL 2DQJL 3L3KB 4MAYD 1QEWB 4PYGA 4PJHE 2E7CA 4UV4L 1MCLA 4OFPA 2VITA 1M7IB 4WFED 1D9KD 3ALWA 4RMRA 3FN0L 2QV2A 1KF9B 3EYOB 4MNQD 3FCTB 2BHYA 4H5SB 2CIIB 3LZFH 1U3HC 2X9WA 3KYMA 2YZ1A 2FIRT 4X9BA 1P7KB 1TLKA 5GZOC 2VSCA 1CGWA 1G7MB 4ZTPH 4LVOB 4WGVB 1OT2A 3RKDC 2YD8A 3QUYA 1I1AB 1CIDA 4HHAB 4U1KB 1VFUA 3P9LB 3VXRD 4X6DA 1ZTXL 2APTA 3D18A 3RWFB 4TN9A 4FP8H 1YMMA 3IU4L 2NZIA 1GOFA 2I60H 4E5XB 3RHWF 2FDBP 3FL7A 4ODTL 3SKUD 3ZE0E 3HAEA 5C0JA 3W0WE 3TV3L 2VERN 4EN3A 3ZSSA 1SY6L 4MA3B 2EE9A 5FHAH 1CLOL 3UDWA 4I3SH 2VLJE 1QFWH 1OL0A 2ZCHH 5E99H 4X7SH 4MX7A 3MXWH 1F2XK 3HG1E 1UM5H 2CDGB 3BRDA 3PNWA 5HJ3B 5JXAL 1MHHB 4N1EA 4MMZC 1XF5B 2PW2B 1KACB 2R0ZL 3P0YH 5H37H 2V2TA 3MRNB 4QKXB 1BFSA 3NH7H 5E4EB 2HTKD 3O9WA 4WW2C 1OGTB 1RK1B 5DSCB 4YWGL 4FABH 5JOFA 3OG4B 2EXWD 5JPMB 1DLFL 4UIKL 2FB4H 2X1PA 1TETH 4MJ5A 2KQMA 5GGSY 2G5BA 1F97A 3VWJC 5DFTA 3P9LA 3O4LD 3H3PH 4K2UL 4R8WH 3CPLA 3THML 3RDTA 2GK0A 4Z77B 1IEAB 4Z8FL 1HHJA 2CJUL 1I4FB 1EHAA 4TSAL 5EBLA 2I9LB 1MREH 2EC9U 1NFKA 2X40A 2FWOB 5BRZD 2OZ4H 3BZFB 3GSNH 3Q0HA 3V4PL 3UPCA 4QRSA 4DZ8B 1AR2A 4JM2F 4BFBD 4R2GB 3IETA 4QLRA 3NIDF 5FGCB 3ULVD 5KVMC 1T89C 4CMHB 3DARA 4XC1H 4FTVB 1E28B 4XCCL 4DN3L 4NC0B 2XPGB 3RIAK 4H5SA 3LH2H 2D4DA 4LKCA 1A7NL 1OOAA 1MFDH 2QR0A 3VFGH 4MJIA 3RWEA 1AGBA 4D8PA 2LVCA 4HIXH 1HI6A 1LK2A 2EIZB 3HNVH 2XKNB 4P2OD 1FRGL 1UEYA 4POUB 1HSBA 2A77L 5FO9A 3PGFH 3TO4B 1OAYL 1GXEA 2Y06H 5K93A 3ILQC 3DVNA 4OV6F 4HUXA 4PJDF 3WFHA 3EOTL 5FM5M 4YR6A 3WIHA 1Y18A 3W11D 3HFML 5CWSA 2EDXA 4OLVL 2E7LA 5HHOD 1AKJD 1WAAF 1XZ0B 4OCYL 3ZL4H 2OR8A 1BD2D 4N0FA 1F6FB 1UXWA 3IXAA 1X5YA 1JNHA 2W9LA 4LSTH 4OCWL 4NPYB 1BM3H 2NY6D 4PRAA 3ZKXB 4GS7C 4N5ED 3RWJA 1EAPB 4ODHL 2ILLA 3GI8H 4YHOH 5IVXF 1L0XA 3X11B 3PWJA 2XTJD 4HX1A 5EFIB 1N6QL 5FGSA 2IANE 2NQCA 1JNLL 3OF6D 4QF1B 5DMIL 2CXGA 3C9NB 3C8KB 4NP4L 1IAOA 4CRPA 1J8HD 5IVXE 5A2FA 5C0CD 4YHKH 4C83A 4CU7A 3FQXB 1QOKA 4LDLB 3T1FB 1NMAH 2CRIA 1ERNA 1GZQA 3QDMD 4OLZL 4GG8A 4D9LH 3D5OF 3K2UL 2WANA 3NAAL 1TVBA 3DSFH 6FABL 3PWUA 5DMGC 4UTBL 1LILA 5EC1A 5IEHB 2C9AA 3AMLA 3GSNA 1JHTB 5ADOH 3T8XB 4CMHC 1U8KA 3HR5B 4M6AA 4HUXB 3HUJF 4W4OA 4KDTC 5J1TC 2OL3A 5EN2B 3SDYH 3VFVB 1UM4H 2CKBH 4GAGH 3FO9B 3QA3A 4F7PB 3O9WD 4WNQA 1GGCH 3U2SA 3ARGC 1JF5A 4HKZA 5C92A 5TE4H 5ACLA 3TO4C 3QEUA 5DA0B 1JJUA 4BZYA 2R1WB 3O3DA 1R3IL 2DBLL 3ULUL 3KYNA 2OYPA 3CVIL 5JR1H 1CT8A 3RNQB 3L5XH 4P5MA 3WNOA 4QRSB 4DZ8A 4Y19D 1EZVX 2AK4B 4N8PA 4YUEH 3MRBB 4AEEA 1UKQA 3UZEA 3VMPA 3A67L 4R0LA 1HINL 4U1GC 3P2TA 4GS7B 4ZDHA 2YS4A 3EFDH 3BEVB 2EYSB 3F7YB 2DM4A 3MO1B 1OTTC 1AGFB 4WW2F 1NEZA 1X5IA 4QHMB 1MJUH 3G5YA 5IHZA 4TTDD 4ZQKB 5SX4I 2Z31A 2VLKE 3U7WH 3FB5B 1J05A 2Q6WA 3PL6A 1JPST 2AGJH 4NRYB 1DUZA 3CIQA 1UQSB 5JOFB 4DUWA 3QHZH 3CCHB 3SGKA 1UCBH 5F1SA 1JN6B 4DTGL 3QFJA 1CFVL 2NCMA 3QA3B 4K3JH 4M1GL 1DJSA 4WFFD 4DQOH 2W1NA 3O6KH 5EO0B 5IW1B 3ROLB 1XGQA 4J3TA 2XY2A 3IGAA 5CZXC 2BXZA 5DA4A 1NAMA 4MXVF 3X12B 5JOPD 4NO5A 1RY7B 4DN3H 3PF2A 4G6MH 2ID5A 3BDXA 2HVKB 4G6FD 1PBYA 4WIQA 2GUOB 1HDMA 1SEQH 4KUCD 2Q1EA 1LWRA 1FRGH 5IB3B 3ORJA 4DFHA 3LQZB 3PWUB 2PCPA 3OGCA 4OZHE 2D4FA 3HN3A 2NW2B 5J4MA 5T3ZD 4M1CD 2X1XR 1FGNH 2R1XA 4OQTH 4OZHF 3GIVA 4OGAC 2XXCB 1JNNH 3QNXA 3QRGH 1UJ3C 4XNXL 3DTXB 4Y4KD 4PJ5E 2VNCA 4PJ8B 4XCNA 5CD3B 1WBYA 1MCOL 1B0RB 5F7DA 2IH3B 1FZKB 3KPNA 5KTEL 3IDGA 5E1AA 4JRYE 4C56A 1R5VB 2VDKH 5CWSB 2FRGP 1BBDL 4KQ3L 4LP4A 2BOCA 1P4IL 2OMNA 3L3HB 4K94L 2ZUXA 3UTQA 2YD1A 4ZPTB 4JDZB 1T83A 2BNRE 1OTSD 4LHUA 5F3HB 4JY6B 3C60B 4MWFB 4P4KB 3TBYB 1QFUH 4JRWA 2IJ0C 1DBJL 3DIFA 4HXBL 3VXUD 1NC2A 1CXIA 5B39G 5JUEH 5C2BH 1RUQH 4LCWA 4LCYA 3KWWB 1QFPA 2IPKB 5IB4B 3V8OA 2P7TB 1BVLA 1NCNA 3EOYG 4NJ9H 3ZKXC 1V7MH 3BUTA 5CUSL 4ZFFA 3HZYA 1N0LA 1OPGH 3DROA 1OSZA 3S4SB 3M8OL 1EA9C 1MI5D 1I1AC 3BKML 1AXSB 1DQLL 2UZXB 4XPFL 3QIUC 1IZKA 4LCWD 2NR6C 4I77L 2I5YL 3FB8A 1Z6JT 2EDBA 1JGEB 3T09A 4P9HL 3QDJE 5T5NG 3TBWA 3LN5A 3MFFB 1U41A 3O41A 4E0RA 3JV4B 4TVPE 3IJSB 4L29A 4PGDB 1ND0A 1FNEB 2WUCL 1BFTA 3N9GH 3WDHA 4Z7OF 5DVNA 4WCYL 3SJVE 3QIUA 2C1PB 2BMKA 1JGLH 2QQLL 4QXUL 1OWWA 2GK2A 3CVIH 3KAAA 3NA9L 4WY7L 4APQA 1RU9H 1CU4H 1FVCA 2P42B 3RU8H 3L5XL 5DS8A 5L8LB 3IAGC 1KT2B 1V05A 3RWDA 3LQZA 3S37X 2JJSC 2FD6L 3MJ9A 5GGQL 4OM1L 1CS6A 1IAKB 3CX2A 2GK0B 4PGBB 4Z77A 5BVPH 5JW3H 1J1XL 4J3VA 1J10A 4AEFA 4RZCA 4YDIL 1HHIA 1SJEA 3EFDL 3T0WA 2A6DA 1JN6A 3JWOH 2GQHA 4S1DD 3MROA 4JFDB 4HZLB 3BPLC 3WIIL 2ADJA 2XWJA 3KYAA 1C8PA 5JPMA 2ZSVA 4LLUB 2B5IB 3TYFA 1RD6A 4WWKD 1JYWA 4X4YB 4PLKD 5ESQA 3WN5B 4ETQB 1T4KA 5D71H 2VLRA 4CADB 5TJWK 5SWSD 1IM3A 3ARFB 3BHBB 4ZAKD 4QO1A 5F89B 3BZEA 3QG7L 4P2CG 3L7EA 3TM6A 4NN5C 4FQIL 4TULL 2HJKA 4Z0BH 3MRKB 1HHGA 4CGTA 2J6EA 3HG1B 2X89A 1PQZA 2DLFL 1ZGLP 4JPKH 3MA9H 2YK1H 4PJAA 5C0JB 3U30B 4Y4HB 4I0KA 3O4OC 3QWRD 1KPRA 2ZOKA 4V1DA 5GGTH 3IJYB 1BGXL 5DD1L 1SYSB 2NY3B 2J88H 2VZUA 1HHKB 5DUBA 5F88B 3MRLA 2GAZA 1T21A 5CKAA 3MA7B 2JTDA 2WBJD 3ARDD 4RAUB 3MJ8A 5ID0B 4JDVB 3VRLE 2PTTA 4FQ1H 3EJYC 4LIQH 4O2EA 1YN6A 4W81A 3WL9B 5JW4Q 3ARGA 3BDYH 5ESQB 3WN5A 1KCKA 4JCLA 2OZ4A 5FV1L 3CDFA 4ORGA 3TZVB 3O2DL 2AJ3A 3VFOB 3G5VA 5C0RL 4PRNA 4ODSH 1FGNL 5BRZA 2IAMA 3N85H 3UC0L 1JWUA 7FABH 3MROB 3TBVA 4KROB 5AEAA 2Q87A 2C7UA 4MB3A 5HI3C 2H45A 3MV8A 4EBQH 2LE9A 3VFVA 3ZDZF 4U1SB 1NUGA 3UTSE 4C83B 1I7TA 1CFNA 3DX9B 2XZZA 4RGMB 5EC1B 1P4IH 4K94H 2W38A 2Y7QB 4HS6A 3QIUB 1TVBB 3MV8D 1P2CA 5C07D 1X5AA 5SWQB 1FPTL 2B8OT 3LPGA 1JTOA 1IT9L 5LCVH 1RHHA 2B1AL 3FRUB 1S7UB 4HXBH 4J2XA 2YN3A 1YJDC 2EZ0C 1NPUA 5TDOB 4TUOB 5FHBL 2IGFL 1KFAH 1PJ9A 1AIFB 1S7WB 3MTRA 4NJ9L 1MCWM 4FNLH 5EDXA 3Q6FB 1B6UA 5JLZB 4JFFE 2EYTA 2HLAA 3MLWL 1MQ8A 1S9KC 1DQLH 5LGJB 2WWMC 2VAAA 3TESA 5ICYB 3U0TA 5FYKL 4I77H 1INEH 4K7PY 2D3VA 4N0UA 3D85A 1ZAGA 1K3ZA 5HPMB 4LCIL 1GHFH 3C6SB 1KEGH 4LCYB 4P9MH 5D1XC 2VZSA 1PSKH 3ARGB 4OB5L 1JHLH 4XP6L 1K2DB 4YDJB 3U4BL 1G9NC 3WSQL 5E7BA 4NQEB 3LQMA 5FFLA 1QR1A 3RIFF 1ZHKA 3INUH 4LVNB 4ONFH 2R15A 4L5FL 4XP1L 5INDA 3R0MA 5FYLE 1I9JH 4KJPC 2P5WE 3IDXH 3O3UN 4P5TA 4XBGB 2YD2A 4LIQE 1E4XI 3UJTH 1S5IH 1GGBH 1FDLH 5MENB 1KJVA 5E70A 4M9OA 3LEVH 4NWUH 1QLRA 1HKLL 4YFDB 4HCRL 5F88A 3ZYOA 3QFDA 5IEKA 1S78D 2BC4A 4LLYA 4UQ3B 2YOCA 5A2KH 2J4WL 4KAQL 5DT1H 4X9HA 4YE4L 3FN3A 5KG9A 3H8NA 1EGJL 3BIKA 3EUUA 2Z93A 4JFZH 3DVIA 5K59E 3P4MA 1LDPH 4MJIE 1QKZL 3KLAB 4JGJA 1A6TA 2YD5A 4NBZB 1YYML 3PV6A 4Z0BL 1FFRA 5HDOA 1PAMA 1D5IH 1ETZB 5AWNL 3RVXC 1RPQA 3QZWA 4ETQA 5C0DA 1LP9A 5DTFB 2YPKA 5H8DA 3WKMH 1EEQA 4MX7B 1T5XB 4PRHD 15C8H 3CJJA 5ICXB 5I8OL 3FFDA 4U6VL 4CJ0A 1I4FA 1MIML 1BZ7A 1WLHA 2DI7A 5DD1H 5JDSB 4FXKB 2VC2H 5GSRA 1DQDL 2YD7A 5JHDE 3OMZA 3TVMD 2DS4A 3V0AC 4C58B 1ZWIB 2UVFA 4GW5A 2J8OA 3MRMB 1NMBL 2PYEE 3JXAA 3S34L 3O9WB 2GITB 3HAEB 1DVFC 2W9DL 3QIWB 5DLML 3X3GH 2VLJD 5I1IH 5EWIH 3RTQD 4WDIA 3QQ9D 1GSMA 3PV7A 4OFYD 1YEEL 4M61A 1KJ2L 1VCAA 4UB0L 4OLEA 4L8DA 5B38B 5J13B 1P1ZB 4RGNB 3SQOH 2RAMA 3STZB 2A1WH 4M6NH 4ZD3L 3OXRB 1AXTL 3O11A 5I19H 3IJSA 4L29B 4DKEL 3BOVA 2A0LD 1P84K 5D1QB 4X5LA 2IPTH 1L0QA 2ESVE 4P2OC 3WHE1 1DBBH 3L9RB 4TUJB 5FYJU 4EBQL 4OJFL 5KSBA 2DWEA 4GOSA 4YDLB 2IPKA 1BIHA 5DD0L 3VFTB 2AJXH 1CE1L 2LAGB 4O2FA 5JQ6L 3P4OB 4R2GC 3UX9B 4DCQB 2VXQH 1OSZB 3MRQB 3UO1L 1A9BB 1H3GA 1A7RL 1N3NA 2NMSA 4M43L 4LMQI 2BNQE 2XTJB 1FO0B 3KS0H 1NAKL 3U9PH 2EDRA 2HFTA 1Q94B 2V2XB 5CJXA 1HYSD 2ZZUT 4H0IA 5SV3A 5I8CA 4Y2DA 3VCLA 4AMKL 4J4PD 4P3CH 4C56B 1KGCD 5DO2D 5KW9H 5D6CB 4D0CA 4TPRH 1DL7H 2DJ4A 3GHBH 4TOYH 1K6QL 1A6UH 3F7QA 4MXWL 5IVXA 4YGAB 3HC4L 5L2KE 1OLLA 2BVEA 1A1MA 1CE6A 2FATL 5GISL 3VMNA 4Q6IB 5J1SC 3UBXB 3S3SA 5TFSL 4L4VA 4HDIA 3BQUA 1INEL 4NKDA 2ITCB 2VQ1A 1NBQA 5E9DE 5F97E 2DL2A 4N5UA 1B4JH 3S8WA 5IF0A 2EXWC 5F9OH 1JHLL 1NFIB 1HEZB 5I1EL 5L2KB 3F12B 3VA2C 4JHAL 4PB0H 4PJGB 2QSVA 4JG0L 1ZLVH 3I9GL 5GJSL 5CEXA 3BQUC 2OCFD 4P46C 2PXYC 3NVQA 4Z7VA 1FJ1A 2V9QA 1DLHB 2JF1A 1KIRB 4FG6C 3G6JE 2BX5A 4QT5A 1CDIA 4LRIC 3NIGE 2XG5A 1UGNA 4KXZI 2HKFL 3D9AH 4X6EB 1DE4B 4ZOCA 1MAMH 2AEPH 4U7KA 4XAWH 5HYFA 1A8JH 2ICWA 3TBTA 5FUOL 2GITA 3QIWA 4X5XA 4N9GA 3QI9C 1AGDA 3DPBA 1CZ8H 4TSBH 3GRWL 5EPMA 3RY6C 3RL2B 3BZDA 5KOVC 3ECBA 1CXFA 1IEBA 3SO3B 2BRRH 2YWYA 4H1LG 5CHNB 4X7SL 1ZS8A 2V7HB 1RUAH 3MGAA 4RGNE 4DKFH 4O4YL 1MUJB 3VXSE 4E41A 3EDDA 3E6FA 4I0PC 1G1CA 3B2UC 2HJLA 1FIEA 4XNYH 5IV2B 1DUYB 4XTRD 3WXWL 5KN5A 1FN4A 2OJEB 1NUNB 3BH9B 3CVHA 2Q6WB 2XN9E 4YC2C 3QEHA 3NGBC 3TA3B 5GXBB 2NYYD 5KJRL 5I1CL 1J5OL 1BEYL 1HHHA 3QB7C 1F8TH 2BOBB 1GGIL 1M4KA 1SYSA 4YX2H 5I1HH 3RNKB 3LKQA 3V9FA 2FB4L 5FHAL 4O2EB 1CLOH 1BQHG 3WUWB 3K4AA 3PWPD 3MLSL 1YY8B 1OQOA 5GGVH 1BVKB 3B4NA 1IILE 4ZPVA 2ZNWA 4NT6B 4J7RA 1JI2A 2Z4QA 1I3GL 4R8WL 1RZFL 3NZHL 5IQ7L 3FZUC 1JCKA 2J12B 2R2EB 5JXEC 1PYWA 5DJ2A 1DR9A 1EEUA 1WIPA 3SJVB 3KGRA 1GOGA 5D8JL 1U93A 4GRWB 4TSAH 4XAKE 1J0HA 2ADGB 2A83A 4PPTA 4FABL 2HRPH 1MRDH 1P69B 2DB8A 3QCVL 3V4PH 1TTFA 2A1WL 4NZRL 2KDGA 4QYOB 1CF8H 4LK4A 4PGCA 2C5DC 1YNLH 4JFOA 2CUMA 2CUHA 3VDAA 2HJLB 1AD9B 4RA3A 3U0WH 3HAEG 1AHWC 3QUMH 4J8RA 5AZEH 2VDRH 3BKYL 1MFCL 5ANMB 3I3DA 4JE4B 5HJ3A 5EOQH 4V2CB 4Y7MA 1N59A 5IFJB 5HXMA 5I74B 3VGGA 2X10A 5DJYA 4X6CF 5L2KA 4I1NB 1EMTL 3PL6C 1A6AA 4S1QH 3DUHA 2A9MH 1UG9A 2GIYA 3O8XD 2DMKA 4X5XB 1XIWC 2HKHH 1MPAH 3MR9B 1G7LA 4S1SH 2W65B 3MV8E 3WJLC 1C12B 2GCYA 5IB2B 4MB5A 3C5JB 3KXFD 5CINH 1UH4A 3IAPA 3PWNB 1IC5H 1RIUH 3S7GA 3KYOA 4HV8A 3CUPB 3P9MB 4WI9A 4L8BA 3QUXD 4H1LA 3EOTH 1N6QH 4P49A 5CJ5A 4ONGH 2LAAA 2QL1A 4JFHD 1T22A 5DZLA 2BNRB 4OSUL 4X9FA 3OL2A 1BD2E 4IRJC 4MSWA 3C8DA 4OF5A 4QRTB 1PKQA 1TVDA 2WMPA 2XTJC 4OLZH 1BM3L 5CP3H 3H7LA 4WHYH 5F9WC 3L3OB 3K7UA 1XF3A 5IBTH 3VRLF 5CZVL 3Q5YA 4KJQC 5I75C 4G3YH 4XPBH 3KXFB 3DSFL 2VIRA 1G7JA 3RIFK 1D5MB 1WFUA 5E8OA 1HSBB 3E6HB 4JPVL 3T77B 4F58H 3MUGA 4HIHB 1UYWL 3AB0C 1UZ6E 2YPLA 3BW9A 3PXHA 5E2TL 3ULVE 2IH3A 4NQCD 2PYFA 3OAZH 4KJYA 1EFXB 1WIUA 1YPZF 4IOIA 2XPGA 4FZEL 3C5JA 3DVGA 3HRZB 3JTSA 4JFFB 4I3RH 2DBJA 3BVNA 1SVCP 1Z9LA 3BXNB 1NLBH 3VG0L 2EDKA 3MV9A 4MAUH 4QRUB 4O5LL 3GIVB 5FA4B 2V7NB 2YKLH 1ORQA 4LAQH 3ULVF 2FJGA 1DBKH 2VISB 5T1LD 1QSEE 3UTTB 1I1FA 3QDMB 2ENYA 3ULSA 2JJVA 1B0RA 1BF2A 2BVQB 5EZIH 4PJFB 3VXRA 5F7MC 1TENA 3AROA 1AGEA 2VUYA 2FYYB 1BZ7B 3SCMC 2R8SL 3SDYL 5F44A 1KPVA 4HUWA 2CK0L 3VXPA 1N59B 5DQDL 5IFJA 1QSFD 3RY6A 3EOBA 3ZLQC 5KJRH 5I1CH 4O2CB 1J5OH 5ITFB 1PX4A 3ARSA 3T1WA 3TIEB 3PV6B 1LO3H 3CFKB 5AUMB 1BQLH 3KJ6L 3VFPB 3BKJL 1MHPL 4PGCB 3U7WL 3NZHH 4H1LH 5IQ7H 1MH5A 4NHCL 4WW1B 4UOW1 5I16A 1J1PH 4G9FA 2B0SH 2OSLA 4X9GA 1RURH 2JLLA 4AIZA 1ETZA 4XHQA 5I8EB 1WCBA 4I0PA 1NC4B 4MLSA 4FXKA 5GSRB 4ZO6A 2FR4B 2NXZC 2BVTA 3NGBB 4Z95H 5ITBL 4OLWL 1T5XA 2E8YA 5F7NC 2JJSA 3QUXA 1X7QB 3O8XA 4NM8L 5JIKA 2VDQL 3VE0B 1F3RB 1FL5B 2FX7H 3ULSB 2AK4E 2ZUUA 1RJYB 2DQIH 4PS4H 4X4ZA 4HUWB 1ZV5A 3Q1SH 4S0TD 2EDDA 5D96B 1JGVH 5K59F 5MEQA 2JCCE 2NY4B 3LEXA 4X6DB 5JXEA 1OD9A 1IGJA 4AG4L 4DTGH 2Z31B 5HD8C 3P0VL 1HWHB 1BHGA 3HMWH 5E8PA 4WI8A 5DRZA 4PV8A 1FNSH 4J23A 3VU2A 3QWQB 4HQQL 4KMQA 4EDXA 4EXKA 1GOHA 4FXGB 4MQ7A 4I3SL 1U36A 3VWKB 1QFWL 5E99L 4PJ8C 3UTSA 3OKKB 3RWGA 12E8L 4K3EH 4Y5YC 5K9OA 3BXNA 3K81A 2JIXB 4HH8A 3EJYD 1JBJA 5T1DL 1JGUL 1X6LA 3HKFA 3NMEA 4MD0B 4U7MA 4HS3B 2ZCLL 3PP3K 4KKCD 3WLBA 5EPMB 1S7TB 2FX9H 1JFQL 5T1LB 4W6XB 5GS3A 5I1JL 3CSPA 5IFHL 3DOSA 3E6HA 2NTSP 1S7SA 1RIUL 2FO4A 4WJ5B 4G8FB 3IXTB 4OUOA 2P8PA 3VI3F 3MLYL 3UTQB 5F1KC 3H3PL 5ALCL 1M71A 1F6LL 1A2YB 3WKNA 5L2KD 3O6FB 4F7EB 4ELMB 2OMBA 5SWQA 5ELIA 3ALPA 1KG0A 3V4UH 1H8SA 2CJUH 1X5GA 3FTGA 1QRNB 4K7FB 1WC7B 5CEXB 2FEEI 4H26A 2H1PH 1XR9A 5CD5D 5D7IA 3F12A 2HLFC 1HNGA 4Z0XB 4JRYD 4XRCA 4LQFH 1KIRA 4BK4A 1UEMA 2O61A 3Q5TA 3B5TA 3RL1A 2HLAB 1OAKL 5SX5K 3OXSA 3ZKMD 4F58L 1MRCH 1Q0YH 3NCFB 5DMKA 3S3PA 1DZBA 3F58L 1BX2B 3HI5H 2W9EL 3QJHA 3PIQA 1D5ZA 2VJXA 5DRNB 1IC7H 4BZ1L 3LRSB 3OHXA 4HIXL 2ZWLT 2OM5A 4Y16A 1TCRA 2MMXA 4KK9D 1S3KH 4JFED 4O5LH 1S7TA 2HN7B 4XNMA 5J57B 3TFKD 5EZOL 4ZS7H 4NKDB 5C09B 2OP4H 5I1LA 1I9RH 4IJ3C 3H6JA 3RUGB 4X6CA 4GW1A 2FIKB 2JJWA 2IBZX 4YHZL 3CMGA 1QLEL 2WBKA 1T7WA 1DEDA 4PRPA 4O02H 4ISVA 1CQYA 5IBUG 2EIDA 1YEFL 3KPSA 5I75B 1P7QA 2YSSA 3BD5A 2VXUH 3TJHC 3U82B 4U1NB 2QADB 3HTLX 2ADGA 3ZDXE 1DQJB 3LKPA 4PRPE 3DGGA 5EU6B 5FECB 4Z18A 3HI1B 4I48B 3KPMA 3ROOA 5BO1H 4JM2B 1Z9MA 4P2QB 1MI5B 4MDIB 3KLHD 1QSZA 3VRJB 5D7IE 3E3QC 1YEDB 1I1YA 4CN1A 4HJ0D 2VLJB 5B39A 2R2HA 4OM1H 5HHXL 4PV8B 3ZTNL 3WFDH 2LABA 5JW3L 3QG7H 2ADFH 4I18B 4P46A 4JR9L 4U2ZA 1TQBB 5DDHB 3HHRB 1KENL 4YK4B 2I9LA 5KN5B 2XZAL 3RWGB 2AJSH 3OPZH 3IETB 4ZPVB 1KEMH 4LLWB 4HEPG 1OP5H 2ESVA 3WIIH 2YUZA 1OD7A 3OKDB 4HC1A 3CZFB 4UTBH 4XCEB 1JZ5A 3ZE2F 5EU6E 4AEIL 3P4NA 4NHUB 1JZ3A 4JHZA 1ZS8B 3D0VA 5JHDA 1P1ZA 2FX7L 3QXUA 4L1DA 4X4XA 3DBXB 1JTPA 4QRRA 5F3BA 5HHQB 3NACL 2X4TA 1HHGB 2X2YA 4NDMA 5EOCL 5IMMA 4EQ2A 4HWBH 5KVFL 1S7RB 1GGCL 5FV2A 2GJZA 4FQPA 3D48R 2B2XH 2NX5B 1ZHLB 3QZWB 1RUML 3KR3H 1N6UA 4OZFB 4YO0B 4CADA 4MS8C 3G6JB 3L5IA 5FYLL 4RISH 2YA1A 3MA9L 5D1ZC 4W6YB 5EZLA 3BP7B 4NNPL 2YD4A 4O58L 4X4ME 3D0VB 5JHDB 3NCYS 4WTZA 2FHCA 1XGTA 3VH8G 4C55A 4MS8D 1YN7B 2PO6D 4PJGE 4KRNA 2ADIA 4Y88A 1RZ8A 1I3VA 4GQ9H 2AI0L 3A67H 5JZ7C 4PRHE 3EYUH 3VMOA 4ZXBB 1QR4A 4UQ2B 5IFHH 1A14L 1R3LA 4HKJB 4JY4B 2D7TH 3NPSC 2R4SL 2FH8A 4WV1B 4Y4FB 5GQBA 4PJBF 1EEYB 1JYNA 2Y5TB 3MRFA 3WCYA 4O9HH 2JJUA 1MFBL 1ZA3A 5CILL 2XFXB 3DIFB 5I6XC 1N4XL 1P5UA 2B39A 2Q20A 4MQTB 3I6KB 1X3DA 1DVFA 1XGUB 2Y1VA 5JMOC 4I48A 1KPUB 3ZTJH 3P77B 1FPTH 4PJHB 3VFNB 5LGHH 1W0WA 1AI1H 4ZSOA 4OIAA 2M26A 2NY6C 5KANI 1KIPB 4FQQA 3VWKC 5F9WB 1I7RA 1JHKL 3HC0B 3O3BB 5J3HD 5FHBH 1JPSH 5FIEA 5F7DB 4FNLL 4HLZH 3T77A 4KJWC 1R3JB 3MGOB 1A0QH 5TQ2H 4JDTL 3E2HC 3D85B 1NCUA 4X6CE 1XT5A 3FCTA 2DYPA 1DVFB 1XGUA 2IH1B 4KJYB 4D0CB 2W60A 3RGVB 2CLZA 2V5RA 3DI2B 3QT2A 1PKQB 1H15B 1M7DA 3D87B 3I6GB 4JO4H 2LTQB 43C9B 4CBPA 3ZT5A 3IF1A 3CXHK 2MCPH 4OGXH 4Z5RA 4LARH 2VABA 5BZWB 1BREA 4TVPH 4XP9L 1TPXB 2O93L 1BX2A 1RHHB 4ALAL 3MLUL 2AW2A 4L3EB 4YXLL 1U92A 2VXTH 3VRIA 1EBPA 5IVZA 5SWZE 8FABA 4O02L 4KGLA 3TNMA 3BYYA 4XNXH 4BSWA 4KKNA 1KJ2A 2AABL 5EBLB 3RP1A 3EHBD 1KN4H 5DD5L 2OXGA 3ULVC 5B38G 4LPWA 4C59B 3MLZL 4QWWD 3C2SA 3JVGC 4JFHE 5D1XB 2HP4A 32C2B 3NCCB 3IGAB 3VI4E 2X9YA 4YGVB 4YHYB 1C1EL 2IF7A 2VDOL 1S7VB 1ED3B 5IB1B 1NBYB 4OZFA 4YO0A 3L7FA 1DBJH 3SY0A 1GH7A 1QKZH 1A9EB 1T0MB 1ULVA 2FJHB 2VDNH 3GMPA 2GJZB 5BOPA 1LK3L 2DQUH 4KMTH 1R5WA 1BQHA 1MFEL 1PKOA 4NZTL 1R5IA 3UYRH 1YEIH 4ZOEA 3KPLA 3B6SB 5GRUL 2VWEC 1D5BB 1U58A 3FHAA 4YPGA 3TIDB 4P4RA 4NSKA 1LO4L 4FFZL 4CU8A 4FXGA 4EN3B 5FKPA 4BFIB 1V3KA 2ZKHL 3JTTA 4JFPB 1H8OA 4D0DB 3GKWH 1QBMH 4NO2B 5CCKL 2UWEB 1LEGB 4KI5D 2VR4A 3HE6C 4PUBH 1CGXA 4RNRA 5E8NB 2MQCA 4NRXA 4LRNH 4ZFZB 3ZE1F 3GJEA 1YPZE 5M7QA 1JGLL 4QXUH 2G75A 4IRJD 3UBXG 4OI8A 4L3AA 2V7HA 1WF5A 1A47A 1U8IB 1X7QA 2FEEL 3B83A 4PRIE 2JCCA 2GTZA 1TETL 1D5XA 5BVPL 5E6IC 1PYWB 1AXTH 1L7TH 3EDKA 5IBUB 3BH9A 3P0GB 4JFQB 5T3XE 4WI5A 3UBXI 5I1LB 3HE7A 4L4TD 5C0IB 3TN0A 1I85A 2HTLC 1U3HA 2BSTB 4OD1L 3U0PB 1KJ2H 2EH7H 4R96B 4HKBB 2RR3A 5ISZB 4F3FB 3J8F7 1FVEB 5ILTH 3BP6A 4F33B 3WS6A 1NBYA 1N4XH 4Q0XH 2KQNA 2R29H 2A0LC 1QPPA 2BHZA 4QHKI 4HWEH 1AE6L 1YNTA 3GSNL 2HTLD 3EDJA 4ZD3H 4AIOA 2CDFB 3ARVA 5C0EA 3GUTA 2CMRH 1MHCB 5FKAA 43CAA 3AVEA 5LGHL 1L0YA 4PJIF 5JLZA 5MEPA 1DEEB 4Y16B 3UTPD 2QLVB 3GM0A 4JO3H 4M48L 3PWJB 2DWDB 5F7LB 3MJ9L 2AJXL 3ES6B 3BWAA 3BFOA 5D7IB 1NSNH 1ZHBB 3V52H 4O00A 3CC5B 2F54D 3IKCB 3OKMA 4LU5L 2UY6A 3N1QC 1AGCB 2BFVL 3PGFL 1G1YA 4M5YL 2EDJA 3MLXL 4QXTB 4CW1B 4N0UE 1EX0A 1FSKC 5DRXA 3NIFF 5E2WH 3T0EC 4HUNB 1YY9D 1Z9SA 4U3CA 2D7QA 4OCYH 3ZL4L 3A6OA 3HI6L 5IMLB 3OKOB 5JHDD 4AQOA 3A6CL 3FO0H 3L6FB 4MXWH 3IFLL 3SDCD 2ATKB 3PP3H 4K3HA 3FZUD 4Y2DB 3VCLB 1JK8A 4PBWD 3QWRA 1ZVSB 2K9UA 5C0EB 3GSUB 5C09E 5DXWA 4R4NC 2M8XA 2NX5D 3VWJA 5HDQL 5ANME 2XICA 3W5NA 1BLNB 2F5AH 1F5WA 2HT2C 3AY4C 4QRQB 1IC1A 2DJSA 4HXAH 1X44A 4A2LA 3MV8B 5ACMA 4JRXD 1MFAH 5FXCH 3RWEB 3BH8A 4XVSH 1VFBA 3CFJB 2X1WL 4OV5A 1MCSA 1WGOA 1WZKA 4HDIB 4KU1A 5LKNA 5D93B 2DWEB 1WJ3A 3CSYA 3CX5J 1Q9OA 3GI9L 5E6ZA 4WFHD 4AZ8A 5I9QC 1QRKA 3SHSA 3V6OC 2DDQH 4YBLC 3EYQD 3RDTD 3QQ4A 3QUKA 4H8WL 2VL4A 5BVJA 3N50A 4FFVC 3WJJC 3SPVA 9CGTA 5HD8D 4GRWE 2X6MA 4FQXB 5DJAB 3CXHJ 1YN6B 3VI3E 4ODXB 1KPRB 1IT9H 2ZOKB 4YC2B 2FWOA 5KVEH 4KDVA 3NZ8B 3QCUL 1IGCL 4XVTH 2R4RL 4NJAH 5FM4A 2UWEF 4PJAE 4YHPA 1Q9LA 4NZTH 3BPOB 3UYRL 4XAWL 3VXNA 4OFVA 3LS4L 3WJJA 1F45A 1FFNB 5FUOH 1WBZB 3WV0A 4RBPK 1WCBB 1YNKH 2MQ3A 3TLRA 4HULB 4I8DA 1N0XH 4PJAF 3D2UD 3QUYC 3ARDB 4EXPX 4JM4H 5FGBC 1A3LH 3BRFA 3MLPA 3J7HA 3R1GL 2NY3D 3B2UD 3QO0B 4OFIA 3GKWL 3CVHL 5LAXB 4GMSL 3A0OA 4M93C 2HTKC 4AIZB 4PGZA 5E9DD 5CSZB 5GS2D 4U3HA 3DMMC 5D8JH 4PRDB 3OGOE 3WXWH 5FO8A 5LWYL 5GGRB 4BH7A 3WLWC 1IAKA 2YEZA 4PGBA 1QSFE 4BQ9A 4IM8A 1XCTB 2FYYA 5IGXL 3X14B 5GGVL 5FOBA 5A43C 1DQTA 1QBBA 1DP0A 5SWSB 1KULA 1PZ5B 1ZSDA 2WBJC 5DURB 4WW2A 4YDKH 1ZWIA 1ZTXH 1KB5L 1L4IA 5D7LD 1FFNA 1FYTB 1Q1JH 3C5SA 3MSPA 3VFUA 4RMVA 2YN5A 5AZEL 4WEMB 1R0AL 4NOFA 2NZ9C 1NGQH 1CICD 3OKYA 5EOQL 1YEJL 3TV3H 5HHMD 2RGSA 2KPNA 2Z93B 1AE6H 3CZFA 3SE3A 4UINL 1EMTH 4S1QL 3O45A 1AXSA 3TYGL 5CBEB 1U92B 1HHHB 3VRIB 3EKCA 1XF4B 2Z8WC 3CX5K 4XWOD 1ZGLA 2FGWL 2QSCL 3MJ6A 4L8CA 3QP3A 5E8DL 3VXMA 1MFCH 1DN0B 1BJ8A 2GW5A 5JORB 5C8JB 2Y4SA 5BS0D 2GKIA 5DI8B 5EBGA 1B3JA 3SCMD 4K8RD 3RAJL 2CLVB 1T20A 4H25A 2BSRB 3MUHL 3KPSD 2VC2L 3S5LA 2X09A 5EZJA 2VAAB 1U8KB 2BNRA 3HR5A 5CIPB 2HKHL 4LCWB 1NGPL 2E27H 1AQDB 4XC3H 3K1DA 3VGHA 2GHWB 3BD4A 4J4PA 4ZFGL 3U48A 3GSRB 3CSBA 1NGXB 5GS1C 2XKUA 3LY6A 1YEEH 4OZ4A 3QHFH 3WYRA 1OGAD 2D7NA 4ZPTA 1TPXC 1PD6A 5EUOF 1DN2A 4PJ8A 5HYJB 1A5FH 1R3KA 4J3UA 4XPBL 4F15B 2AEIT 2Z31D 2RBLA 4M7LT 3B9VA 4HMEA 2XRAH 4KHTH 4TRPL 1BD2B 3DHJA 1CK0H 5LQBH 1HQ4A 2GYSA 3QDGD 3LH2L 4KK5C 2X4RA 3MLVL 5DUMH 3NOIA 3BPOC 5I17B 5JQ6H 4NC2B 1JWSB 1IAOB 1ES0A 3OAYH 1FL6B 4JN2A 2OQJB 5JUEL 1M1SA 4FG6D 1ZT7A 2NW2A 4P2RB 4H88H 4M3KB 4FS0A 4LNRA 3F7VA 1YN7A 2A74B 4BJLA 1EZVY 5J89A 1UT9A 1FAIL 1FE8H 1NCDL 1YEKH 4FQ2L 1E4XH 1RIHH 1MJJB 1OLZA 2ATPA 2IANB 4OLVH 4PJDA 1T6VN 2VDLH 3FQRB 5EZJB 3G08A 5KSUA 3QFJE 2P8PB 4XPFH 4J6RL 3TFKC 4YH6A 4X7FC 5LXGL 2I5YH 2ARJQ 3I50H 2ZUQB 3L3DB 3GSRA 1BIIB 1F4WH 5IWLA 3FT4A 1AH1A 4UDTA 3S88L 2AVGA 3MA7A 2QQKH 4FN0A 3NCJL 4YBLB 4P0DA 2M1KA 4Z7UE 4OCLC 1G7HB 3BD3A 4DCQA 2VLKA 2HT4D 2A83B 3RU8L 2NY5H 1DBML 1OAXH 4R7NB 3OKDA 1FZJA 1WISA 5I1EH 4GRLD 2J8HA 3QULB 3VFOA 3IYLW 3L9RA 4TUJA 3VGEA 3IS1X 3GO1H 1RULH 4G43A 4PRHA 4PV9A 5B8CB 1GPOH 3FT3A 3G5YB 4ZFOB 3QHTC 3EFFA 4LPYA 4Z95L 5EBMA 3KG5A 3MC0A 4P4RB 5FYJE 1UFUA 3WFEH 2X4UB 3MJ8B 5KSAD 4OKDA 5ID0A 1LO2L 2AS5M 4YK4C 4YDKL 4F7CB 1G6VK 1ZKAA 3SDCA 2AEPL 1ZE3C 1Q1JL 1J1PL 3RTQC 4OBSA 1ITCA 4HGKC 4PRBB 5DK2A 4BKLB 4WTZG 5EORL 1CT8B 4NQCE 1AKJA 5J6HB 3QEQA 3FT2A 3GBNL 3FHQA 5FOBB 2XN9B 2H2PC 1XGYL 4UT9L 2BRRL 3OKNB 1R3IH 1UZ8A 5DR5H 2GTWB 3QUZC 4POZC 2WIMA 3FONB 4OLXL 1LEKA 4QXWA 5GGTL 3SGKC 1A7QL 4Y5VC 4K3GA 3QQ9C 3SKOA 5E8DH 4XVJL 4KK8D 3W9EB 3GBMH 3H9ZA 3IDIB 1AO7B 1RUKH 1NDMA 3O3AB 2R0KL 5J7CC 4PJDB 5DJ8A 1JYVA 2DQCL 5T1MB 2APWA 2XWJB 3SKNA 4LIQL 4AQ1B 3K46A 1CDJA 1W72H 5HHNA 4WHTA 3ZE1E 1RUPH 4Y2OA 5GZND 4KVCH 1TJIL 4NQEE 5IJVA 4ZUSB 5CBAB 1QO3A 4KWUA 1Q38A 3DO7B 1ES0B 3O2DH 1FZMA 5KSVB 1D9KB 2YXFA 4X6FB 1YJDL 3DETC 5L6YL 3QHFL 2YR3A 3EYFA 1NFIA 4OIIL 2O5YL 5FCUL 4A6YB 5I1JH 1PLGL 3HNSH 1MNUL 1MAJA 5J1AA 1K3IA 2ERJC 3IDNA 4XMLL 2C1PA 3MNVA 1WUNT 1GRWA 3C60A 2V17H 4FQXA 5DJAA 3MLYH 5TQ0L 1SJHA 5LGKA 3CFCL 1YNLL 3DROB 5CJ8A 1JPFA 3GSWA 2Y07L 4NPYA 1ZMYA 1BVLB 3IXTA 2EIEA 3FB8B 3GJFA 3MGTB 2B20A 4LHUG 1BECA 4OZIE 4BSVA 3B9KD 3IFOA 4JRXE 4H88L 1Q94A 2IGFH 2DQHH 3DVNB 4F8TA 2A9ML 1KPUA 2OP4L 2P5WA 4X5WA 4WWKB 1BBJB 5D7KE 1F4HA 4G80A 4OZIF 2XZCL 2XYCA 4KFZC 3OKKA 3GK8H 2DLHA 4XP5L 4MQ7B 1S9WB 5HTSA 4S1SL 1IFHH 5H35B 3N1PC 4BZ1H 4ENEC 4LKCB 5ICZA 1YEFH 3LD8C 1H3WM 2BNQB 2XTJE 1HDMB 4LCUB 4LMQE 5I1KL 5EBWA 2QQKL 2W65A 3HE7D 4HZAA 4P2OB 5KTEH 5CBEA 1IQDB 1CDGA 5E1AB 5IT2H 1CDHA 1G7LB 2NLJA 3U9UB 1F4YL 1YC7A 3C2AH 3DO7A 4GRMA 1T2JA 3QDJA 2I9TB 3HA0A 1RJZB 3RKDD 4PIRF 4E41D 4U6HB 3UPRA 2O5XL 1I9JL 2NY5L 1OSPL 4ETYA 5ERWA 5ESVA 1WWCA 5HHNB 2GTWA 5K9QI 4PJCE 1OF2A 5GSVA 2BSSB 2DTSA 1PZUB 2WK2A 3ZTNH 2QHLA 2QTEA 1BP3B 4M1DL 4QGYA 1LP9B 5DTFA 1S5IL 2ADFL 2VXUL 3VXRE 3F5WA 4K23L 5ANMA 4PJCF 3ILQD 5GGUA 3RI5F 3QDAA 3FOMA 1AY1H 2EYRA 5C71A 3QUZB 1NGWB 2YEZB 4ORGB 5EB9A 2QQNL 5MERB 2AXHA 2ZJSH 1NFDF 5DT1L 4HKBA 2UUDH 2NTFB 2B5IC 3B2VL 5FO8B 3UJJL 3RVWC 4GRWF 5B39B 3O0RH 4G6AC 2NNAA 1HQRB 4LVEA 1WZ1L 3O4LB 1IEHA 2ESVB 3SKOB 1U2HA 3RY5A 1NLBL 1KB5B 5HY9A 3WEXB 5JW4N 1AO7E 2XZAH 3X13A 3QXDB 4YNYB 3PHOB 3CFIC 4G9FE 4ZFZA 1T1WA 3MACH 4JZJA 4XZUB 3S4SG 2Q7YA 3BMWA 1YY9C 4HWNA 4PJXF 5FYLH 1QNZH 2D7OA 4LF3A 5C9KA 3V6ZB 3D6GA 3LKPB 4MD4B 4AEIH 4PJFA 5EZIL 1TIUA 2QEJA 1U8MB 5IHZB 2V6HA 1JZ2A 1X5JA 4PBVC 2IMNA 1JUFB 3RUGE 2VR9A 2OTWB 5TH2B 1JF1B 4Z78B 1J8HE 3EYUL 3FB5A 5HVGB 1KBGL 2A9NL 4XX1G 1P7QB 4G7VH 1JZ8A 3RUGF 5DWUL 3VD3A 4RISL 4Z7UB 1O7VA 1I1YB 5K9KA 4KZEH 3B5HA 1G7MA 3GZKA 4O9HL 4NQDD 3KJ6H 1AFVH 4BQBA 4PRPD 4PR5A 4JZNA 1P7KA 4DGYL 2RQ8A 3R8QA 3TBSB 5BS0E 4HFUH 3NCBB 2VIRB 3QUZA 5GHWL 4MA8L 5D71L 4QCIB 1ZLUK 3KPLB 2IPUK 1XAUA 1HIML 3LSOB 2HRLA 4LBEA 1RURL 2YUVA 4HMCA 1X9QA 4WFFE 1LE9B 4U1NA 2CRYA 1S78C 2IADB 2IPTL 1PLGH 3HNSL 1MNUH 1RMFL 4XMLH 4Y8AA 4LVHC 2R1WA 4OLWH 5TE7L 3DX7B 5T3XD 5F7YC 2GT9B 4QTHB 5FAAA 3FRUA 5HHVL 1AJ7H 4RRPG 4PJBB 1BGXH 5IFAH 4PJ5B 2NY2B 2OI9C 1AQKH 3H9SE 1INDH 3O2WH 4P23D 7CGTA 1AI1L 2AJZA 3RWJB 4JN2B 1QFWI 3MFFA 2XA3A 3CFBB 4JFXB 4JFFD 5I17A 3IDMA 3ISWA 1CFTB 2X4SB 1FNHA 3PQYD 4D3CL 1MCHA 2EEDA 3DLQR 4HS6B 4WHYG 3I85A 3TCXA 5HYQA 1IAIM 3SDAD 4GXVH 2DL9A 5HGBA 4NKOA 1EV2E 1JWSA 3MOAH 4HS3A 4PJGA 3T1FA 3N85L 2F5BH 2ZSWB 3S5LB 3QPQD 2VAJA 2HH0L 5HBBA 4Z5RB 3PGDA 2P7TA 5CP3A 4GAJH 4RX4D 2XZQH 1J9CT 3DYMA 3MV7E 5LVEA 1J0YA 1FG2A 4D9QD 1I3RB 5I1KH 5J0BA 3IDYC 3X11A 4L9LB 2IBGA 1KIPA 4TVPL 3GMOB 5ALCH 1EXUA 2BNRD 1YMHB 2YZ8A 3GSQB 5HYJA 3S98A 4RFNB 4ERSH 1ZGLB 3MFGB 3IT8D 4Z78A 3JV5A 1WEJH 1KCVH 4IIQB 5EIIA 1IGTA 5C0BE 2HFGH 2NXZB 3SBWA 4YDVA 5A16B 3EIFA 4NNXA 1TFHA 4F7TA 1Y18B 3KPPB 5JW5A 2J5LB 3TPKA 4XCYB 3BMVA 5EULV 4AM0A 1I7ZB 4Q9BA 4K71B 1OAKH 2Z4QB